F480903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 271 | 789 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10141442|Ga0157378_101414423 |
| Length | 255 |
| Sequence | LICAEAQRRLFKSAIGKASLTALRSGKAASFLNLRMTKSEVIQRIRDVGVIPVVRASSADEAIQVVEAIKAGGVSILEITMTVPGAVQVIEQLVRRFGEETVVGAGTVLDPEVANACISVGAQFIVSPALNLETIKFCREQDIPIMPGALTPTEVVTAWNAGADFVKVFPCGAVGGAGYIKSLKAPLPQIELVPTGGVSLKTAASFIEAGAAAIGVGADLVDVKSMLAGQPEKITEAARAYVEAVRSARASAPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 128 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 129 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 130 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 206 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 207 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 208 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 209 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 210 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 234 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 235 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 240 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 241 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 246 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 247 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 248 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 249 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 267 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 268 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 269 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 271 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.53 |
| Nodule | 0 |
| Rhizoplane | 1.9 |
| Rhizosphere | 95.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10011403 | 3300003203 | Bacteria | 3901 |
| 2 | rootH2_10325698 | 3300003320 | Bacteria | 1675 |
| 3 | rootL2_10011367 | 3300003322 | Bacteria | 3480 |
| 4 | Ga0065704_10078408 | 3300005289 | Bacteria | 4439 |
| 5 | Ga0065704_10251220 | 3300005289 | Unclassified | 989 |
| 6 | Ga0065712_10000114 | 3300005290 | Bacteria | 191810 |
| 7 | Ga0065712_10240405 | 3300005290 | Unclassified | 986 |
| 8 | Ga0065715_10001576 | 3300005293 | Bacteria | 8225 |
| 9 | Ga0065707_10010407 | 3300005295 | Bacteria | 4534 |
| 10 | Ga0065707_10045450 | 3300005295 | Bacteria | 1041 |
| 11 | Ga0070658_10023453 | 3300005327 | Bacteria | 4952 |
| 12 | Ga0070658_10149186 | 3300005327 | Bacteria | 1957 |
| 13 | Ga0070676_10130464 | 3300005328 | Bacteria | 1589 |
| 14 | Ga0070690_100038517 | 3300005330 | Bacteria | 3017 |
| 15 | Ga0070690_100062165 | 3300005330 | Bacteria | 2407 |
| 16 | Ga0070690_100089827 | 3300005330 | Bacteria | 2021 |
| 17 | Ga0070690_100540588 | 3300005330 | Unclassified | 877 |
| 18 | Ga0070670_100000264 | 3300005331 | Bacteria | 46598 |
| 19 | Ga0070670_100053552 | 3300005331 | Bacteria | 3465 |
| 20 | Ga0070670_100109825 | 3300005331 | Bacteria | 2376 |
| 21 | Ga0070670_100113953 | 3300005331 | Unclassified | 2331 |
| 22 | Ga0070670_100226543 | 3300005331 | Bacteria | 1627 |
| 23 | Ga0070670_100270655 | 3300005331 | Bacteria | 1482 |
| 24 | Ga0070670_100389227 | 3300005331 | Bacteria | 1229 |
| 25 | Ga0070670_100423727 | 3300005331 | Bacteria | 1177 |
| 26 | Ga0068869_100000001 | 3300005334 | Bacteria | 178472 |
| 27 | Ga0068869_100154235 | 3300005334 | Unclassified | 1783 |
| 28 | Ga0068869_100357734 | 3300005334 | Unclassified | 1191 |
| 29 | Ga0068869_100508378 | 3300005334 | Bacteria | 1007 |
| 30 | Ga0070666_10090831 | 3300005335 | Bacteria | 2098 |
| 31 | Ga0070680_100005023 | 3300005336 | Bacteria | 9977 |
| 32 | Ga0070680_100030467 | 3300005336 | Unclassified | 4333 |
| 33 | Ga0070680_100079366 | 3300005336 | Bacteria | 2705 |
| 34 | Ga0070680_100235360 | 3300005336 | Unclassified | 1547 |
| 35 | Ga0070682_100000002 | 3300005337 | Bacteria | 506802 |
| 36 | Ga0070682_100002835 | 3300005337 | Bacteria | 9603 |
| 37 | Ga0070682_100612780 | 3300005337 | Bacteria | 861 |
| 38 | Ga0068868_100013082 | 3300005338 | Bacteria | 6075 |
| 39 | Ga0068868_100049444 | 3300005338 | Bacteria | 3300 |
| 40 | Ga0070689_100003073 | 3300005340 | Bacteria | 10995 |
| 41 | Ga0070689_100004541 | 3300005340 | Bacteria | 9399 |
| 42 | Ga0070689_100252768 | 3300005340 | Bacteria | 1455 |
| 43 | Ga0070687_100165675 | 3300005343 | Bacteria | 1311 |
| 44 | Ga0070661_100004719 | 3300005344 | Bacteria | 9377 |
| 45 | Ga0070661_100592253 | 3300005344 | Unclassified | 896 |
| 46 | Ga0070692_10093070 | 3300005345 | Bacteria | 1641 |
| 47 | Ga0070668_100040266 | 3300005347 | Bacteria | 3576 |
| 48 | Ga0070668_100734450 | 3300005347 | Bacteria | 873 |
| 49 | Ga0070669_100264799 | 3300005353 | Bacteria | 1373 |
| 50 | Ga0070669_100426873 | 3300005353 | Bacteria | 1089 |
| 51 | Ga0070675_100054352 | 3300005354 | Unclassified | 3294 |
| 52 | Ga0070675_100068406 | 3300005354 | Bacteria | 2940 |
| 53 | Ga0070675_100770912 | 3300005354 | Unclassified | 878 |
| 54 | Ga0070671_100011164 | 3300005355 | Bacteria | 7213 |
| 55 | Ga0070671_100033207 | 3300005355 | Bacteria | 4267 |
| 56 | Ga0070674_100142594 | 3300005356 | Bacteria | 1800 |
| 57 | Ga0070674_100196736 | 3300005356 | Unclassified | 1554 |
| 58 | Ga0070673_100016561 | 3300005364 | Bacteria | 5217 |
| 59 | Ga0070673_100034168 | 3300005364 | Bacteria | 3845 |
| 60 | Ga0070673_100071013 | 3300005364 | Bacteria | 2796 |
| 61 | Ga0070673_100119486 | 3300005364 | Bacteria | 2196 |
| 62 | Ga0070688_100019989 | 3300005365 | Bacteria | 3887 |
| 63 | Ga0070659_100003797 | 3300005366 | Bacteria | 10780 |
| 64 | Ga0070667_100423240 | 3300005367 | Unclassified | 1214 |
| 65 | Ga0070703_10000392 | 3300005406 | Bacteria | 18342 |
| 66 | Ga0070714_100008416 | 3300005435 | Bacteria | 8054 |
| 67 | Ga0070714_100052712 | 3300005435 | Unclassified | 3470 |
| 68 | Ga0070714_100091808 | 3300005435 | Bacteria | 2661 |
| 69 | Ga0070713_100008200 | 3300005436 | Bacteria | 7400 |
| 70 | Ga0070713_100157072 | 3300005436 | Unclassified | 2028 |
| 71 | Ga0070713_100191824 | 3300005436 | Bacteria | 1841 |
| 72 | Ga0070713_100267065 | 3300005436 | Bacteria | 1566 |
| 73 | Ga0070710_10234134 | 3300005437 | Bacteria | 1174 |
| 74 | Ga0070710_10391465 | 3300005437 | Bacteria | 929 |
| 75 | Ga0070701_10014508 | 3300005438 | Bacteria | 3615 |
| 76 | Ga0070701_10076264 | 3300005438 | Bacteria | 1804 |
| 77 | Ga0070701_10120410 | 3300005438 | Bacteria | 1478 |
| 78 | Ga0070711_100004787 | 3300005439 | Bacteria | 8023 |
| 79 | Ga0070705_100069280 | 3300005440 | Bacteria | 2126 |
| 80 | Ga0070705_100236999 | 3300005440 | Bacteria | 1273 |
| 81 | Ga0070705_100723294 | 3300005440 | Bacteria | 784 |
| 82 | Ga0070700_100000027 | 3300005441 | Bacteria | 123461 |
| 83 | Ga0070700_100015179 | 3300005441 | Bacteria | 4363 |
| 84 | Ga0070700_100028724 | 3300005441 | Bacteria | 3311 |
| 85 | Ga0070700_100059524 | 3300005441 | Bacteria | 2405 |
| 86 | Ga0070700_100120641 | 3300005441 | Bacteria | 1756 |
| 87 | Ga0070700_100127197 | 3300005441 | Bacteria | 1715 |
| 88 | Ga0070694_100002750 | 3300005444 | Bacteria | 10431 |
| 89 | Ga0070694_100003143 | 3300005444 | Bacteria | 9834 |
| 90 | Ga0070694_100061641 | 3300005444 | Bacteria | 2560 |
| 91 | Ga0070694_100101996 | 3300005444 | Bacteria | 2031 |
| 92 | Ga0070708_100001978 | 3300005445 | Bacteria | 15790 |
| 93 | Ga0070708_100004377 | 3300005445 | Bacteria | 11094 |
| 94 | Ga0070708_100068799 | 3300005445 | Bacteria | 3183 |
| 95 | Ga0070708_100188335 | 3300005445 | Unclassified | 1930 |
| 96 | Ga0070678_100096376 | 3300005456 | Unclassified | 2282 |
| 97 | Ga0070662_100175327 | 3300005457 | Bacteria | 1686 |
| 98 | Ga0070662_100461672 | 3300005457 | Bacteria | 1055 |
| 99 | Ga0070662_100737493 | 3300005457 | Bacteria | 835 |
| 100 | Ga0070681_10000791 | 3300005458 | Bacteria | 26380 |
| 101 | Ga0070681_10009950 | 3300005458 | Bacteria | 9373 |
| 102 | Ga0070681_10018035 | 3300005458 | Bacteria | 7052 |
| 103 | Ga0070681_10122078 | 3300005458 | Bacteria | 2539 |
| 104 | Ga0070681_10361792 | 3300005458 | Bacteria | 1361 |
| 105 | Ga0070681_10612898 | 3300005458 | Bacteria | 1003 |
| 106 | Ga0068867_100008304 | 3300005459 | Bacteria | 7330 |
| 107 | Ga0068867_100118650 | 3300005459 | Bacteria | 2041 |
| 108 | Ga0068867_100122516 | 3300005459 | Bacteria | 2011 |
| 109 | Ga0068867_100239130 | 3300005459 | Unclassified | 1472 |
| 110 | Ga0068867_100465427 | 3300005459 | Bacteria | 1080 |
| 111 | Ga0070685_10033721 | 3300005466 | Bacteria | 2879 |
| 112 | Ga0070685_10063610 | 3300005466 | Bacteria | 2167 |
| 113 | Ga0070706_100000129 | 3300005467 | Bacteria | 92941 |
| 114 | Ga0070706_100008753 | 3300005467 | Bacteria | 9428 |
| 115 | Ga0070706_100026984 | 3300005467 | Bacteria | 5284 |
| 116 | Ga0070706_100028708 | 3300005467 | Bacteria | 5122 |
| 117 | Ga0070706_100078235 | 3300005467 | Bacteria | 3062 |
| 118 | Ga0070706_100110660 | 3300005467 | Bacteria | 2556 |
| 119 | Ga0070706_100151310 | 3300005467 | Unclassified | 2166 |
| 120 | Ga0070706_100490606 | 3300005467 | Bacteria | 1143 |
| 121 | Ga0070707_100011309 | 3300005468 | Bacteria | 8320 |
| 122 | Ga0070707_100096183 | 3300005468 | Bacteria | 2868 |
| 123 | Ga0070707_100139001 | 3300005468 | Bacteria | 2363 |
| 124 | Ga0070707_100157947 | 3300005468 | Bacteria | 2209 |
| 125 | Ga0070707_100283310 | 3300005468 | Bacteria | 1610 |
| 126 | Ga0070707_100419197 | 3300005468 | Bacteria | 1299 |
| 127 | Ga0070707_100447618 | 3300005468 | Bacteria | 1252 |
| 128 | Ga0070707_100752982 | 3300005468 | Bacteria | 937 |
| 129 | Ga0070698_100006886 | 3300005471 | Bacteria | 12316 |
| 130 | Ga0070698_100010012 | 3300005471 | Bacteria | 10130 |
| 131 | Ga0070698_100107442 | 3300005471 | Bacteria | 2758 |
| 132 | Ga0070698_100148389 | 3300005471 | Bacteria | 2294 |
| 133 | Ga0070698_100184133 | 3300005471 | Bacteria | 2026 |
| 134 | Ga0070698_100615783 | 3300005471 | Bacteria | 1026 |
| 135 | Ga0070699_100000979 | 3300005518 | Bacteria | 26634 |
| 136 | Ga0070699_100001846 | 3300005518 | Bacteria | 19241 |
| 137 | Ga0070699_100022040 | 3300005518 | Bacteria | 5487 |
| 138 | Ga0070699_100030454 | 3300005518 | Bacteria | 4658 |
| 139 | Ga0070699_100053200 | 3300005518 | Bacteria | 3504 |
| 140 | Ga0070699_100108776 | 3300005518 | Bacteria | 2433 |
| 141 | Ga0070699_100168707 | 3300005518 | Bacteria | 1939 |
| 142 | Ga0070699_100199303 | 3300005518 | Unclassified | 1780 |
| 143 | Ga0070699_100379042 | 3300005518 | Unclassified | 1277 |
| 144 | Ga0070699_100383571 | 3300005518 | Bacteria | 1269 |
| 145 | Ga0070679_100000011 | 3300005530 | Bacteria | 162902 |
| 146 | Ga0070679_100223606 | 3300005530 | Bacteria | 1843 |
| 147 | Ga0070679_100577555 | 3300005530 | Unclassified | 1068 |
| 148 | Ga0070697_100009407 | 3300005536 | Bacteria | 7641 |
| 149 | Ga0070697_100039023 | 3300005536 | Bacteria | 3839 |
| 150 | Ga0070697_100039489 | 3300005536 | Bacteria | 3816 |
| 151 | Ga0070697_100057775 | 3300005536 | Bacteria | 3157 |
| 152 | Ga0070697_100068955 | 3300005536 | Bacteria | 2896 |
| 153 | Ga0070697_100196904 | 3300005536 | Bacteria | 1712 |
| 154 | Ga0070697_100288672 | 3300005536 | Bacteria | 1409 |
| 155 | Ga0070697_100470318 | 3300005536 | Bacteria | 1097 |
| 156 | Ga0070697_100539968 | 3300005536 | Unclassified | 1022 |
| 157 | Ga0068853_100017320 | 3300005539 | Bacteria | 5948 |
| 158 | Ga0068853_100023643 | 3300005539 | Bacteria | 5148 |
| 159 | Ga0068853_100055159 | 3300005539 | Unclassified | 3425 |
| 160 | Ga0068853_100125452 | 3300005539 | Bacteria | 2293 |
| 161 | Ga0068853_100132996 | 3300005539 | Bacteria | 2228 |
| 162 | Ga0070672_100050161 | 3300005543 | Bacteria | 3250 |
| 163 | Ga0070672_100081496 | 3300005543 | Bacteria | 2594 |
| 164 | Ga0070672_100798876 | 3300005543 | Bacteria | 830 |
| 165 | Ga0070686_100019640 | 3300005544 | Bacteria | 3985 |
| 166 | Ga0070686_100279880 | 3300005544 | Bacteria | 1230 |
| 167 | Ga0070686_100455250 | 3300005544 | Bacteria | 985 |
| 168 | Ga0070686_100583739 | 3300005544 | Bacteria | 878 |
| 169 | Ga0070695_100054996 | 3300005545 | Bacteria | 2564 |
| 170 | Ga0070695_100072735 | 3300005545 | Bacteria | 2255 |
| 171 | Ga0070695_100138335 | 3300005545 | Bacteria | 1685 |
| 172 | Ga0070695_100281664 | 3300005545 | Unclassified | 1222 |
| 173 | Ga0070695_100303974 | 3300005545 | Bacteria | 1180 |
| 174 | Ga0070695_100649500 | 3300005545 | Bacteria | 833 |
| 175 | Ga0070695_100653064 | 3300005545 | Bacteria | 831 |
| 176 | Ga0070696_100013512 | 3300005546 | Bacteria | 5478 |
| 177 | Ga0070696_100031906 | 3300005546 | Bacteria | 3612 |
| 178 | Ga0070696_100036934 | 3300005546 | Bacteria | 3370 |
| 179 | Ga0070696_100043490 | 3300005546 | Bacteria | 3107 |
| 180 | Ga0070696_100184107 | 3300005546 | Unclassified | 1551 |
| 181 | Ga0070693_100106888 | 3300005547 | Bacteria | 1714 |
| 182 | Ga0070693_100620092 | 3300005547 | Unclassified | 783 |
| 183 | Ga0070665_100154435 | 3300005548 | Bacteria | 2297 |
| 184 | Ga0070704_100007658 | 3300005549 | Bacteria | 6439 |
| 185 | Ga0070704_100134628 | 3300005549 | Unclassified | 1921 |
| 186 | Ga0070704_100264128 | 3300005549 | Bacteria | 1419 |
| 187 | Ga0068855_100127808 | 3300005563 | Bacteria | 2905 |
| 188 | Ga0068855_100130143 | 3300005563 | Bacteria | 2875 |
| 189 | Ga0068855_100221933 | 3300005563 | Bacteria | 2119 |
| 190 | Ga0068855_100241278 | 3300005563 | Bacteria | 2019 |
| 191 | Ga0068855_100281478 | 3300005563 | Bacteria | 1847 |
| 192 | Ga0068855_100857139 | 3300005563 | Bacteria | 962 |
| 193 | Ga0070664_100015833 | 3300005564 | Bacteria | 6172 |
| 194 | Ga0070664_100085079 | 3300005564 | Bacteria | 2731 |
| 195 | Ga0068857_100005264 | 3300005577 | Bacteria | 11015 |
| 196 | Ga0068857_100093228 | 3300005577 | Bacteria | 2697 |
| 197 | Ga0068857_100272038 | 3300005577 | Bacteria | 1557 |
| 198 | Ga0068857_100727611 | 3300005577 | Bacteria | 944 |
| 199 | Ga0068854_100435634 | 3300005578 | Bacteria | 1092 |
| 200 | Ga0068854_100896705 | 3300005578 | Bacteria | 779 |
| 201 | Ga0068856_100250256 | 3300005614 | Unclassified | 1787 |
| 202 | Ga0068856_100361662 | 3300005614 | Unclassified | 1470 |
| 203 | Ga0068856_100888739 | 3300005614 | Bacteria | 910 |
| 204 | Ga0070702_100004548 | 3300005615 | Bacteria | 6346 |
| 205 | Ga0070702_100080861 | 3300005615 | Unclassified | 1946 |
| 206 | Ga0070702_100082728 | 3300005615 | Bacteria | 1927 |
| 207 | Ga0070702_100115467 | 3300005615 | Bacteria | 1672 |
| 208 | Ga0068852_100025194 | 3300005616 | Bacteria | 4816 |
| 209 | Ga0068852_100026870 | 3300005616 | Bacteria | 4685 |
| 210 | Ga0068852_100041713 | 3300005616 | Bacteria | 3880 |
| 211 | Ga0068859_100020497 | 3300005617 | Bacteria | 6635 |
| 212 | Ga0068859_100068685 | 3300005617 | Bacteria | 3578 |
| 213 | Ga0068859_100132596 | 3300005617 | Bacteria | 2563 |
| 214 | Ga0068859_100514661 | 3300005617 | Bacteria | 1292 |
| 215 | Ga0068859_100577059 | 3300005617 | Bacteria | 1218 |
| 216 | Ga0068859_100792666 | 3300005617 | Bacteria | 1035 |
| 217 | Ga0068859_100906902 | 3300005617 | Unclassified | 966 |
| 218 | Ga0068864_100020048 | 3300005618 | Bacteria | 5591 |
| 219 | Ga0068864_100025552 | 3300005618 | Bacteria | 4976 |
| 220 | Ga0068864_100074372 | 3300005618 | Bacteria | 2964 |
| 221 | Ga0068864_100076583 | 3300005618 | Unclassified | 2923 |
| 222 | Ga0068864_100099264 | 3300005618 | Bacteria | 2579 |
| 223 | Ga0068864_100135307 | 3300005618 | Bacteria | 2218 |
| 224 | Ga0068864_100169772 | 3300005618 | Bacteria | 1988 |
| 225 | Ga0068864_100226904 | 3300005618 | Unclassified | 1726 |
| 226 | Ga0068864_100328728 | 3300005618 | Unclassified | 1438 |
| 227 | Ga0068864_101070097 | 3300005618 | Unclassified | 802 |
| 228 | Ga0068866_10137849 | 3300005718 | Bacteria | 1397 |
| 229 | Ga0068861_100065983 | 3300005719 | Bacteria | 2789 |
| 230 | Ga0068863_100014611 | 3300005841 | Bacteria | 7559 |
| 231 | Ga0068863_100020006 | 3300005841 | Bacteria | 6402 |
| 232 | Ga0068863_100043030 | 3300005841 | Bacteria | 4288 |
| 233 | Ga0068863_100440468 | 3300005841 | Bacteria | 1278 |
| 234 | Ga0068858_100006110 | 3300005842 | Bacteria | 11748 |
| 235 | Ga0068858_100025175 | 3300005842 | Bacteria | 5537 |
| 236 | Ga0068858_100076009 | 3300005842 | Bacteria | 3120 |
| 237 | Ga0068858_100136776 | 3300005842 | Bacteria | 2299 |
| 238 | Ga0068858_100154347 | 3300005842 | Bacteria | 2160 |
| 239 | Ga0068858_100189305 | 3300005842 | Bacteria | 1944 |
| 240 | Ga0068858_100212979 | 3300005842 | Bacteria | 1828 |
| 241 | Ga0068858_100229701 | 3300005842 | Bacteria | 1759 |
| 242 | Ga0068860_100022140 | 3300005843 | Bacteria | 6152 |
| 243 | Ga0068860_100052901 | 3300005843 | Bacteria | 3862 |
| 244 | Ga0068860_100335028 | 3300005843 | Bacteria | 1487 |
| 245 | Ga0068860_100606643 | 3300005843 | Unclassified | 1100 |
| 246 | Ga0068860_100789113 | 3300005843 | Unclassified | 963 |
| 247 | Ga0068862_100494957 | 3300005844 | Unclassified | 1159 |
| 248 | Ga0068862_100509350 | 3300005844 | Bacteria | 1144 |
| 249 | Ga0081539_10001896 | 3300005985 | Bacteria | 32432 |
| 250 | Ga0081539_10001952 | 3300005985 | Bacteria | 31511 |
| 251 | Ga0081539_10205372 | 3300005985 | Unclassified | 906 |
| 252 | Ga0070717_10024632 | 3300006028 | Bacteria | 4781 |
| 253 | Ga0070717_10309099 | 3300006028 | Bacteria | 1406 |
| 254 | Ga0070717_10527975 | 3300006028 | Bacteria | 1068 |
| 255 | Ga0075365_10002661 | 3300006038 | Bacteria | 8870 |
| 256 | Ga0075368_10063046 | 3300006042 | Bacteria | 1486 |
| 257 | Ga0075363_100023183 | 3300006048 | Bacteria | 3143 |
| 258 | Ga0075364_10095337 | 3300006051 | Unclassified | 1978 |
| 259 | Ga0070716_100000005 | 3300006173 | Bacteria | 273485 |
| 260 | Ga0070712_100004891 | 3300006175 | Bacteria | 8286 |
| 261 | Ga0075362_10004805 | 3300006177 | Bacteria | 4881 |
| 262 | Ga0075366_10000427 | 3300006195 | Bacteria | 19720 |
| 263 | Ga0097621_100007454 | 3300006237 | Bacteria | 7826 |
| 264 | Ga0097621_100018877 | 3300006237 | Bacteria | 5280 |
| 265 | Ga0097621_100048746 | 3300006237 | Bacteria | 3438 |
| 266 | Ga0097621_100151866 | 3300006237 | Bacteria | 1986 |
| 267 | Ga0068871_100025056 | 3300006358 | Bacteria | 4636 |
| 268 | Ga0068871_100026431 | 3300006358 | Bacteria | 4529 |
| 269 | Ga0068871_100067749 | 3300006358 | Bacteria | 2930 |
| 270 | Ga0068871_100230618 | 3300006358 | Bacteria | 1607 |
| 271 | Ga0068871_100362930 | 3300006358 | Bacteria | 1283 |
| 272 | Ga0075428_100735482 | 3300006844 | Bacteria | 1050 |
| 273 | Ga0075430_100022222 | 3300006846 | Bacteria | 5394 |
| 274 | Ga0075430_100079771 | 3300006846 | Bacteria | 2742 |
| 275 | Ga0075431_100005275 | 3300006847 | Bacteria | 12734 |
| 276 | Ga0075431_100359854 | 3300006847 | Bacteria | 1462 |
| 277 | Ga0075433_10035713 | 3300006852 | Bacteria | 4278 |
| 278 | Ga0075433_10064292 | 3300006852 | Bacteria | 3216 |
| 279 | Ga0075433_10076042 | 3300006852 | Bacteria | 2956 |
| 280 | Ga0075433_10124362 | 3300006852 | Bacteria | 2291 |
| 281 | Ga0075433_10173952 | 3300006852 | Bacteria | 1916 |
| 282 | Ga0075433_10235496 | 3300006852 | Bacteria | 1625 |
| 283 | Ga0075433_10275070 | 3300006852 | Bacteria | 1492 |
| 284 | Ga0075433_10403792 | 3300006852 | Bacteria | 1205 |
| 285 | Ga0075433_10456029 | 3300006852 | Bacteria | 1127 |
| 286 | Ga0075433_11049434 | 3300006852 | Unclassified | 709 |
| 287 | Ga0075434_100064208 | 3300006871 | Bacteria | 3655 |
| 288 | Ga0075434_100131818 | 3300006871 | Bacteria | 2519 |
| 289 | Ga0075434_100825707 | 3300006871 | Bacteria | 943 |
| 290 | Ga0075429_100019625 | 3300006880 | Bacteria | 5860 |
| 291 | Ga0068865_100009287 | 3300006881 | Bacteria | 6092 |
| 292 | Ga0068865_100093824 | 3300006881 | Bacteria | 2183 |
| 293 | Ga0068865_100300764 | 3300006881 | Bacteria | 1284 |
| 294 | Ga0068865_100412894 | 3300006881 | Unclassified | 1108 |
| 295 | Ga0075436_100000008 | 3300006914 | Bacteria | 279288 |
| 296 | Ga0075436_100231479 | 3300006914 | Archaea | 1313 |
| 297 | Ga0097620_100020497 | 3300006931 | Bacteria | 6635 |
| 298 | Ga0097620_100068687 | 3300006931 | Bacteria | 3578 |
| 299 | Ga0097620_100132591 | 3300006931 | Bacteria | 2563 |
| 300 | Ga0097620_100514619 | 3300006931 | Bacteria | 1292 |
| 301 | Ga0097620_100577043 | 3300006931 | Bacteria | 1218 |
| 302 | Ga0097620_100632570 | 3300006931 | Unclassified | 1162 |
| 303 | Ga0097620_100792629 | 3300006931 | Bacteria | 1035 |
| 304 | Ga0097620_100906706 | 3300006931 | Unclassified | 966 |
| 305 | Ga0075435_100003209 | 3300007076 | Bacteria | 11071 |
| 306 | Ga0075435_100137228 | 3300007076 | Bacteria | 2050 |
| 307 | Ga0075435_100185526 | 3300007076 | Unclassified | 1759 |
| 308 | Ga0075435_100767333 | 3300007076 | Bacteria | 839 |
| 309 | Ga0075435_100771597 | 3300007076 | Unclassified | 837 |
| 310 | Ga0099794_10019109 | 3300007265 | Bacteria | 3082 |
| 311 | Ga0105251_10240377 | 3300009011 | Bacteria | 816 |
| 312 | Ga0105250_10094258 | 3300009092 | Bacteria | 1220 |
| 313 | Ga0105240_10370051 | 3300009093 | Bacteria | 1621 |
| 314 | Ga0111539_10005494 | 3300009094 | Bacteria | 16398 |
| 315 | Ga0111539_10005643 | 3300009094 | Bacteria | 16183 |
| 316 | Ga0111539_10056166 | 3300009094 | Bacteria | 4680 |
| 317 | Ga0111539_10069661 | 3300009094 | Bacteria | 4153 |
| 318 | Ga0111539_10278956 | 3300009094 | Bacteria | 1945 |
| 319 | Ga0105245_10102794 | 3300009098 | Bacteria | 2646 |
| 320 | Ga0105245_11316173 | 3300009098 | Bacteria | 772 |
| 321 | Ga0105247_10256181 | 3300009101 | Bacteria | 1198 |
| 322 | Ga0114129_10004820 | 3300009147 | Bacteria | 19070 |
| 323 | Ga0114129_10005760 | 3300009147 | Bacteria | 17559 |
| 324 | Ga0114129_10048089 | 3300009147 | Bacteria | 5993 |
| 325 | Ga0114129_10062300 | 3300009147 | Bacteria | 5211 |
| 326 | Ga0114129_10089354 | 3300009147 | Unclassified | 4270 |
| 327 | Ga0114129_10164783 | 3300009147 | Bacteria | 3026 |
| 328 | Ga0114129_10229681 | 3300009147 | Bacteria | 2500 |
| 329 | Ga0114129_10240067 | 3300009147 | Bacteria | 2436 |
| 330 | Ga0114129_10255568 | 3300009147 | Unclassified | 2350 |
| 331 | Ga0114129_10529184 | 3300009147 | Bacteria | 1536 |
| 332 | Ga0114129_10640987 | 3300009147 | Bacteria | 1372 |
| 333 | Ga0114129_10979227 | 3300009147 | Bacteria | 1066 |
| 334 | Ga0114129_11291785 | 3300009147 | Unclassified | 905 |
| 335 | Ga0114129_11412619 | 3300009147 | Bacteria | 858 |
| 336 | Ga0105243_10000715 | 3300009148 | Bacteria | 31978 |
| 337 | Ga0105243_10004026 | 3300009148 | Bacteria | 11701 |
| 338 | Ga0105243_10018027 | 3300009148 | Bacteria | 5342 |
| 339 | Ga0105243_10047860 | 3300009148 | Bacteria | 3369 |
| 340 | Ga0105243_10193402 | 3300009148 | Bacteria | 1778 |
| 341 | Ga0105243_10319858 | 3300009148 | Unclassified | 1413 |
| 342 | Ga0105243_10522653 | 3300009148 | Bacteria | 1129 |
| 343 | Ga0105243_11104124 | 3300009148 | Unclassified | 802 |
| 344 | Ga0105241_10167925 | 3300009174 | Bacteria | 1810 |
| 345 | Ga0105241_10263602 | 3300009174 | Bacteria | 1465 |
| 346 | Ga0105241_10319426 | 3300009174 | Bacteria | 1338 |
| 347 | Ga0105241_10534624 | 3300009174 | Bacteria | 1050 |
| 348 | Ga0105241_10567921 | 3300009174 | Bacteria | 1021 |
| 349 | Ga0105241_10816810 | 3300009174 | Unclassified | 860 |
| 350 | Ga0105242_10002445 | 3300009176 | Bacteria | 14580 |
| 351 | Ga0105242_10005773 | 3300009176 | Bacteria | 9536 |
| 352 | Ga0105242_10020767 | 3300009176 | Bacteria | 5151 |
| 353 | Ga0105242_10033576 | 3300009176 | Bacteria | 4109 |
| 354 | Ga0105242_10033815 | 3300009176 | Bacteria | 4096 |
| 355 | Ga0105242_10131911 | 3300009176 | Bacteria | 2158 |
| 356 | Ga0105242_10157765 | 3300009176 | Bacteria | 1983 |
| 357 | Ga0105242_10930101 | 3300009176 | Unclassified | 872 |
| 358 | Ga0105242_11140144 | 3300009176 | Unclassified | 796 |
| 359 | Ga0105248_10112779 | 3300009177 | Bacteria | 3066 |
| 360 | Ga0105248_10188270 | 3300009177 | Bacteria | 2325 |
| 361 | Ga0105248_10395519 | 3300009177 | Bacteria | 1556 |
| 362 | Ga0105248_10443527 | 3300009177 | Bacteria | 1462 |
| 363 | Ga0105248_10478710 | 3300009177 | Bacteria | 1403 |
| 364 | Ga0105248_10527639 | 3300009177 | Bacteria | 1331 |
| 365 | Ga0105248_10837361 | 3300009177 | Unclassified | 1038 |
| 366 | Ga0105248_10978693 | 3300009177 | Unclassified | 956 |
| 367 | Ga0105237_10076977 | 3300009545 | Bacteria | 3326 |
| 368 | Ga0105237_10206969 | 3300009545 | Bacteria | 1962 |
| 369 | Ga0105238_10020332 | 3300009551 | Bacteria | 6758 |
| 370 | Ga0105238_10021791 | 3300009551 | Bacteria | 6527 |
| 371 | Ga0105238_10052242 | 3300009551 | Bacteria | 4108 |
| 372 | Ga0105238_10270363 | 3300009551 | Bacteria | 1680 |
| 373 | Ga0105238_10685670 | 3300009551 | Bacteria | 1036 |
| 374 | Ga0105238_11050456 | 3300009551 | Unclassified | 836 |
| 375 | Ga0105249_10011016 | 3300009553 | Bacteria | 7944 |
| 376 | Ga0105249_10128143 | 3300009553 | Bacteria | 2419 |
| 377 | Ga0105249_10379003 | 3300009553 | Bacteria | 1440 |
| 378 | Ga0105249_11068907 | 3300009553 | Bacteria | 877 |
| 379 | Ga0105239_10019333 | 3300010375 | Bacteria | 7522 |
| 380 | Ga0105239_10302270 | 3300010375 | Bacteria | 1802 |
| 381 | Ga0105239_10329618 | 3300010375 | Bacteria | 1722 |
| 382 | Ga0105239_10443852 | 3300010375 | Bacteria | 1471 |
| 383 | Ga0105239_10960897 | 3300010375 | Unclassified | 982 |
| 384 | Ga0105239_11095560 | 3300010375 | Bacteria | 917 |
| 385 | Ga0105246_10135165 | 3300011119 | Bacteria | 1847 |
| 386 | Ga0105246_10144583 | 3300011119 | Bacteria | 1793 |
| 387 | Ga0157373_10027626 | 3300013100 | Unclassified | 4094 |
| 388 | Ga0157373_10210312 | 3300013100 | Bacteria | 1372 |
| 389 | Ga0157373_10376757 | 3300013100 | Bacteria | 1015 |
| 390 | Ga0157373_10640263 | 3300013100 | Unclassified | 776 |
| 391 | Ga0157370_10004929 | 3300013104 | Bacteria | 15107 |
| 392 | Ga0157370_10025513 | 3300013104 | Bacteria | 5851 |
| 393 | Ga0157370_10034070 | 3300013104 | Bacteria | 4962 |
| 394 | Ga0157370_10052651 | 3300013104 | Bacteria | 3886 |
| 395 | Ga0157370_10397991 | 3300013104 | Bacteria | 1268 |
| 396 | Ga0157369_10007108 | 3300013105 | Bacteria | 12909 |
| 397 | Ga0157369_10026429 | 3300013105 | Bacteria | 6438 |
| 398 | Ga0157369_10035880 | 3300013105 | Bacteria | 5435 |
| 399 | Ga0157374_10032095 | 3300013296 | Bacteria | 4779 |
| 400 | Ga0157374_10323474 | 3300013296 | Bacteria | 1529 |
| 401 | Ga0157374_11036211 | 3300013296 | Unclassified | 840 |
| 402 | Ga0157378_10000001 | 3300013297 | Bacteria | 352632 |
| 403 | Ga0157378_10020401 | 3300013297 | Bacteria | 5829 |
| 404 | Ga0157378_10141442 | 3300013297 | Bacteria | 2235 |
| 405 | Ga0157378_10150159 | 3300013297 | Bacteria | 2170 |
| 406 | Ga0157378_10185876 | 3300013297 | Bacteria | 1957 |
| 407 | Ga0157378_10667034 | 3300013297 | Bacteria | 1057 |
| 408 | Ga0163162_10003094 | 3300013306 | Bacteria | 15891 |
| 409 | Ga0163162_10008614 | 3300013306 | Bacteria | 9941 |
| 410 | Ga0163162_10178794 | 3300013306 | Bacteria | 2247 |
| 411 | Ga0163162_10228647 | 3300013306 | Bacteria | 1990 |
| 412 | Ga0163162_10284668 | 3300013306 | Bacteria | 1785 |
| 413 | Ga0163162_10291746 | 3300013306 | Bacteria | 1763 |
| 414 | Ga0163162_10366001 | 3300013306 | Bacteria | 1575 |
| 415 | Ga0157372_10010368 | 3300013307 | Bacteria | 9907 |
| 416 | Ga0157372_10031617 | 3300013307 | Bacteria | 5795 |
| 417 | Ga0157372_10314764 | 3300013307 | Bacteria | 1822 |
| 418 | Ga0157372_10620012 | 3300013307 | Bacteria | 1261 |
| 419 | Ga0157372_10790836 | 3300013307 | Unclassified | 1102 |
| 420 | Ga0157375_10038209 | 3300013308 | Bacteria | 4608 |
| 421 | Ga0157375_10062805 | 3300013308 | Bacteria | 3692 |
| 422 | Ga0157375_10071960 | 3300013308 | Bacteria | 3472 |
| 423 | Ga0157375_10195369 | 3300013308 | Bacteria | 2178 |
| 424 | Ga0157375_10961224 | 3300013308 | Unclassified | 995 |
| 425 | Ga0157375_11476551 | 3300013308 | Unclassified | 802 |
| 426 | Ga0163163_10000278 | 3300014325 | Bacteria | 51079 |
| 427 | Ga0163163_10010076 | 3300014325 | Bacteria | 8478 |
| 428 | Ga0163163_10033041 | 3300014325 | Bacteria | 5002 |
| 429 | Ga0163163_10066634 | 3300014325 | Bacteria | 3577 |
| 430 | Ga0163163_10142079 | 3300014325 | Bacteria | 2443 |
| 431 | Ga0163163_10258765 | 3300014325 | Bacteria | 1791 |
| 432 | Ga0163163_11113694 | 3300014325 | Bacteria | 852 |
| 433 | Ga0157380_10002199 | 3300014326 | Bacteria | 13104 |
| 434 | Ga0157380_10034264 | 3300014326 | Bacteria | 3915 |
| 435 | Ga0157380_10552006 | 3300014326 | Bacteria | 1130 |
| 436 | Ga0157380_10702341 | 3300014326 | Unclassified | 1016 |
| 437 | Ga0157377_10038163 | 3300014745 | Bacteria | 2651 |
| 438 | Ga0157377_10158351 | 3300014745 | Bacteria | 1406 |
| 439 | Ga0157377_10283253 | 3300014745 | Bacteria | 1087 |
| 440 | Ga0157379_10030757 | 3300014968 | Bacteria | 4781 |
| 441 | Ga0157379_10038580 | 3300014968 | Bacteria | 4262 |
| 442 | Ga0157379_10388917 | 3300014968 | Bacteria | 1281 |
| 443 | Ga0157376_10014317 | 3300014969 | Bacteria | 5949 |
| 444 | Ga0157376_10738313 | 3300014969 | Unclassified | 993 |
| 445 | Ga0163161_10045692 | 3300017792 | Bacteria | 3159 |
| 446 | Ga0163161_10130697 | 3300017792 | Bacteria | 1894 |
| 447 | Ga0163161_10254305 | 3300017792 | Bacteria | 1370 |
| 448 | Ga0163161_10304968 | 3300017792 | Unclassified | 1255 |
| 449 | Ga0163161_10901074 | 3300017792 | Unclassified | 749 |
| 450 | Ga0224569_100350 | 3300022732 | Unclassified | 3884 |
| 451 | Ga0224571_101635 | 3300022734 | Unclassified | 1407 |
| 452 | Ga0224572_1023860 | 3300024225 | Unclassified | 1175 |
| 453 | Ga0228598_1003751 | 3300024227 | Unclassified | 3246 |
| 454 | Ga0207426_1071081 | 3300025302 | Bacteria | 971 |
| 455 | Ga0207653_10000197 | 3300025885 | Bacteria | 41065 |
| 456 | Ga0207692_10341673 | 3300025898 | Bacteria | 921 |
| 457 | Ga0207680_10082738 | 3300025903 | Bacteria | 2021 |
| 458 | Ga0207647_10013201 | 3300025904 | Bacteria | 5736 |
| 459 | Ga0207647_10087790 | 3300025904 | Bacteria | 1857 |
| 460 | Ga0207645_10004256 | 3300025907 | Bacteria | 10628 |
| 461 | Ga0207684_10000057 | 3300025910 | Bacteria | 211445 |
| 462 | Ga0207684_10021136 | 3300025910 | Bacteria | 5556 |
| 463 | Ga0207684_10043668 | 3300025910 | Bacteria | 3801 |
| 464 | Ga0207684_10047943 | 3300025910 | Bacteria | 3623 |
| 465 | Ga0207684_10051623 | 3300025910 | Bacteria | 3489 |
| 466 | Ga0207654_10277041 | 3300025911 | Unclassified | 1133 |
| 467 | Ga0207654_10511450 | 3300025911 | Unclassified | 849 |
| 468 | Ga0207707_10000007 | 3300025912 | Bacteria | 368555 |
| 469 | Ga0207707_10441319 | 3300025912 | Bacteria | 1114 |
| 470 | Ga0207695_10019908 | 3300025913 | Bacteria | 7711 |
| 471 | Ga0207663_10004236 | 3300025916 | Bacteria | 7115 |
| 472 | Ga0207660_10021570 | 3300025917 | Unclassified | 4333 |
| 473 | Ga0207660_10124396 | 3300025917 | Bacteria | 1957 |
| 474 | Ga0207660_10292346 | 3300025917 | Unclassified | 1296 |
| 475 | Ga0207662_10007642 | 3300025918 | Bacteria | 5892 |
| 476 | Ga0207662_10184242 | 3300025918 | Bacteria | 1345 |
| 477 | Ga0207662_10467561 | 3300025918 | Unclassified | 864 |
| 478 | Ga0207657_10017784 | 3300025919 | Bacteria | 6806 |
| 479 | Ga0207657_10126263 | 3300025919 | Bacteria | 2101 |
| 480 | Ga0207652_10000102 | 3300025921 | Bacteria | 92144 |
| 481 | Ga0207652_10189742 | 3300025921 | Bacteria | 1849 |
| 482 | Ga0207652_10478297 | 3300025921 | Bacteria | 1122 |
| 483 | Ga0207646_10021862 | 3300025922 | Bacteria | 5903 |
| 484 | Ga0207646_10038024 | 3300025922 | Bacteria | 4337 |
| 485 | Ga0207646_10042592 | 3300025922 | Bacteria | 4078 |
| 486 | Ga0207646_10049630 | 3300025922 | Bacteria | 3758 |
| 487 | Ga0207646_10155608 | 3300025922 | Bacteria | 2062 |
| 488 | Ga0207646_10303916 | 3300025922 | Bacteria | 1441 |
| 489 | Ga0207646_10332846 | 3300025922 | Bacteria | 1372 |
| 490 | Ga0207646_10444555 | 3300025922 | Bacteria | 1170 |
| 491 | Ga0207681_10043155 | 3300025923 | Unclassified | 3017 |
| 492 | Ga0207694_10013013 | 3300025924 | Bacteria | 6264 |
| 493 | Ga0207694_10073229 | 3300025924 | Bacteria | 2679 |
| 494 | Ga0207694_10148836 | 3300025924 | Bacteria | 1885 |
| 495 | Ga0207694_10232467 | 3300025924 | Bacteria | 1506 |
| 496 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 497 | Ga0207650_10064202 | 3300025925 | Bacteria | 2748 |
| 498 | Ga0207650_10320788 | 3300025925 | Bacteria | 1269 |
| 499 | Ga0207650_10348687 | 3300025925 | Unclassified | 1217 |
| 500 | Ga0207650_10369766 | 3300025925 | Bacteria | 1183 |
| 501 | Ga0207659_10635053 | 3300025926 | Unclassified | 912 |
| 502 | Ga0207687_10559486 | 3300025927 | Bacteria | 960 |
| 503 | Ga0207700_10009013 | 3300025928 | Bacteria | 6211 |
| 504 | Ga0207700_10115830 | 3300025928 | Bacteria | 2165 |
| 505 | Ga0207700_10180148 | 3300025928 | Unclassified | 1769 |
| 506 | Ga0207700_10197555 | 3300025928 | Bacteria | 1693 |
| 507 | Ga0207664_10119045 | 3300025929 | Bacteria | 2207 |
| 508 | Ga0207664_10350501 | 3300025929 | Bacteria | 1306 |
| 509 | Ga0207664_10576559 | 3300025929 | Bacteria | 1010 |
| 510 | Ga0207644_10017412 | 3300025931 | Bacteria | 4851 |
| 511 | Ga0207644_10022327 | 3300025931 | Bacteria | 4323 |
| 512 | Ga0207690_10017206 | 3300025932 | Unclassified | 4411 |
| 513 | Ga0207706_10060347 | 3300025933 | Bacteria | 3340 |
| 514 | Ga0207706_10576925 | 3300025933 | Bacteria | 967 |
| 515 | Ga0207686_10001008 | 3300025934 | Bacteria | 16707 |
| 516 | Ga0207686_10049596 | 3300025934 | Bacteria | 2606 |
| 517 | Ga0207686_10088898 | 3300025934 | Bacteria | 2035 |
| 518 | Ga0207686_10099865 | 3300025934 | Bacteria | 1935 |
| 519 | Ga0207686_10895687 | 3300025934 | Unclassified | 716 |
| 520 | Ga0207709_10000301 | 3300025935 | Bacteria | 54207 |
| 521 | Ga0207709_10009418 | 3300025935 | Bacteria | 5373 |
| 522 | Ga0207709_10075641 | 3300025935 | Bacteria | 2153 |
| 523 | Ga0207709_10169307 | 3300025935 | Bacteria | 1531 |
| 524 | Ga0207709_10346569 | 3300025935 | Bacteria | 1120 |
| 525 | Ga0207709_10535775 | 3300025935 | Unclassified | 919 |
| 526 | Ga0207670_10005234 | 3300025936 | Bacteria | 7101 |
| 527 | Ga0207670_10052415 | 3300025936 | Bacteria | 2743 |
| 528 | Ga0207670_10227624 | 3300025936 | Unclassified | 1430 |
| 529 | Ga0207670_10362893 | 3300025936 | Bacteria | 1150 |
| 530 | Ga0207670_10480162 | 3300025936 | Unclassified | 1006 |
| 531 | Ga0207669_10102161 | 3300025937 | Unclassified | 1898 |
| 532 | Ga0207704_10041771 | 3300025938 | Bacteria | 2693 |
| 533 | Ga0207704_10046427 | 3300025938 | Unclassified | 2589 |
| 534 | Ga0207665_10000012 | 3300025939 | Bacteria | 143062 |
| 535 | Ga0207665_10154177 | 3300025939 | Bacteria | 1648 |
| 536 | Ga0207691_10001307 | 3300025940 | Bacteria | 24842 |
| 537 | Ga0207711_10088945 | 3300025941 | Bacteria | 2712 |
| 538 | Ga0207711_10093478 | 3300025941 | Bacteria | 2649 |
| 539 | Ga0207711_10151551 | 3300025941 | Bacteria | 2092 |
| 540 | Ga0207711_10498484 | 3300025941 | Bacteria | 1135 |
| 541 | Ga0207711_11027576 | 3300025941 | Bacteria | 764 |
| 542 | Ga0207689_10005329 | 3300025942 | Bacteria | 11529 |
| 543 | Ga0207689_10009754 | 3300025942 | Bacteria | 8272 |
| 544 | Ga0207689_10012945 | 3300025942 | Bacteria | 7123 |
| 545 | Ga0207689_10033121 | 3300025942 | Bacteria | 4294 |
| 546 | Ga0207689_10157628 | 3300025942 | Bacteria | 1871 |
| 547 | Ga0207689_10455021 | 3300025942 | Unclassified | 1070 |
| 548 | Ga0207679_10051176 | 3300025945 | Bacteria | 3023 |
| 549 | Ga0207679_10054067 | 3300025945 | Bacteria | 2954 |
| 550 | Ga0207679_10619032 | 3300025945 | Bacteria | 977 |
| 551 | Ga0207679_10787033 | 3300025945 | Unclassified | 867 |
| 552 | Ga0207667_10162489 | 3300025949 | Bacteria | 2297 |
| 553 | Ga0207667_10253992 | 3300025949 | Bacteria | 1798 |
| 554 | Ga0207667_10321950 | 3300025949 | Bacteria | 1579 |
| 555 | Ga0207667_10348020 | 3300025949 | Unclassified | 1512 |
| 556 | Ga0207667_10359121 | 3300025949 | Bacteria | 1486 |
| 557 | Ga0207651_10009988 | 3300025960 | Bacteria | 5232 |
| 558 | Ga0207651_10158061 | 3300025960 | Bacteria | 1773 |
| 559 | Ga0207651_10366833 | 3300025960 | Bacteria | 1217 |
| 560 | Ga0207712_10029132 | 3300025961 | Bacteria | 3700 |
| 561 | Ga0207712_10048561 | 3300025961 | Bacteria | 2953 |
| 562 | Ga0207712_10171800 | 3300025961 | Bacteria | 1695 |
| 563 | Ga0207712_10239228 | 3300025961 | Bacteria | 1461 |
| 564 | Ga0207712_10260727 | 3300025961 | Bacteria | 1406 |
| 565 | Ga0207640_10050703 | 3300025981 | Bacteria | 2695 |
| 566 | Ga0207640_10069296 | 3300025981 | Unclassified | 2368 |
| 567 | Ga0207640_10363142 | 3300025981 | Bacteria | 1167 |
| 568 | Ga0207640_10411165 | 3300025981 | Unclassified | 1104 |
| 569 | Ga0207640_10970279 | 3300025981 | Bacteria | 746 |
| 570 | Ga0207658_10017502 | 3300025986 | Bacteria | 4940 |
| 571 | Ga0207658_10098578 | 3300025986 | Bacteria | 2284 |
| 572 | Ga0207677_10217214 | 3300026023 | Bacteria | 1531 |
| 573 | Ga0207677_10319675 | 3300026023 | Unclassified | 1289 |
| 574 | Ga0207677_11119713 | 3300026023 | Bacteria | 718 |
| 575 | Ga0207703_10040759 | 3300026035 | Bacteria | 3718 |
| 576 | Ga0207703_10051577 | 3300026035 | Unclassified | 3335 |
| 577 | Ga0207703_10061571 | 3300026035 | Bacteria | 3072 |
| 578 | Ga0207703_10092280 | 3300026035 | Bacteria | 2548 |
| 579 | Ga0207703_10307158 | 3300026035 | Bacteria | 1448 |
| 580 | Ga0207703_10703097 | 3300026035 | Bacteria | 961 |
| 581 | Ga0207639_10004670 | 3300026041 | Bacteria | 9221 |
| 582 | Ga0207639_10153233 | 3300026041 | Unclassified | 1933 |
| 583 | Ga0207639_10162021 | 3300026041 | Unclassified | 1886 |
| 584 | Ga0207639_10588551 | 3300026041 | Bacteria | 1025 |
| 585 | Ga0207678_10010423 | 3300026067 | Bacteria | 8160 |
| 586 | Ga0207708_10000055 | 3300026075 | Bacteria | 103534 |
| 587 | Ga0207708_10004707 | 3300026075 | Bacteria | 10034 |
| 588 | Ga0207708_10022757 | 3300026075 | Bacteria | 4733 |
| 589 | Ga0207708_10023536 | 3300026075 | Bacteria | 4658 |
| 590 | Ga0207708_10041173 | 3300026075 | Bacteria | 3522 |
| 591 | Ga0207708_10076890 | 3300026075 | Unclassified | 2561 |
| 592 | Ga0207708_10078922 | 3300026075 | Bacteria | 2528 |
| 593 | Ga0207708_10774708 | 3300026075 | Bacteria | 824 |
| 594 | Ga0207702_10091278 | 3300026078 | Bacteria | 2667 |
| 595 | Ga0207702_10131012 | 3300026078 | Bacteria | 2257 |
| 596 | Ga0207702_10141246 | 3300026078 | Bacteria | 2179 |
| 597 | Ga0207702_10191288 | 3300026078 | Bacteria | 1891 |
| 598 | Ga0207702_10472199 | 3300026078 | Unclassified | 1220 |
| 599 | Ga0207702_10497916 | 3300026078 | Bacteria | 1188 |
| 600 | Ga0207641_10020923 | 3300026088 | Bacteria | 5377 |
| 601 | Ga0207641_10057312 | 3300026088 | Bacteria | 3313 |
| 602 | Ga0207641_10160533 | 3300026088 | Bacteria | 2043 |
| 603 | Ga0207641_10186090 | 3300026088 | Bacteria | 1905 |
| 604 | Ga0207641_10532315 | 3300026088 | Bacteria | 1144 |
| 605 | Ga0207648_10009024 | 3300026089 | Bacteria | 9590 |
| 606 | Ga0207648_10046582 | 3300026089 | Bacteria | 3802 |
| 607 | Ga0207648_10058627 | 3300026089 | Bacteria | 3357 |
| 608 | Ga0207648_10140863 | 3300026089 | Bacteria | 2125 |
| 609 | Ga0207676_10008357 | 3300026095 | Bacteria | 7359 |
| 610 | Ga0207676_10029661 | 3300026095 | Bacteria | 4098 |
| 611 | Ga0207676_10056046 | 3300026095 | Bacteria | 3097 |
| 612 | Ga0207676_10091382 | 3300026095 | Bacteria | 2500 |
| 613 | Ga0207676_10381798 | 3300026095 | Unclassified | 1312 |
| 614 | Ga0207674_10001093 | 3300026116 | Bacteria | 35304 |
| 615 | Ga0207674_10015666 | 3300026116 | Bacteria | 8323 |
| 616 | Ga0207674_10022251 | 3300026116 | Bacteria | 6810 |
| 617 | Ga0207674_10022789 | 3300026116 | Bacteria | 6720 |
| 618 | Ga0207674_10283960 | 3300026116 | Bacteria | 1603 |
| 619 | Ga0207674_10403466 | 3300026116 | Bacteria | 1321 |
| 620 | Ga0207675_100005231 | 3300026118 | Bacteria | 12487 |
| 621 | Ga0207675_100031702 | 3300026118 | Bacteria | 4925 |
| 622 | Ga0207675_100071904 | 3300026118 | Bacteria | 3234 |
| 623 | Ga0207683_10031582 | 3300026121 | Bacteria | 4596 |
| 624 | Ga0207698_10017167 | 3300026142 | Bacteria | 4904 |
| 625 | Ga0207698_10046034 | 3300026142 | Bacteria | 3291 |
| 626 | Ga0207698_10100382 | 3300026142 | Unclassified | 2397 |
| 627 | Ga0207698_10245230 | 3300026142 | Bacteria | 1635 |
| 628 | Ga0209813_10030346 | 3300027866 | Bacteria | 1588 |
| 629 | Ga0207428_10000741 | 3300027907 | Bacteria | 37332 |
| 630 | Ga0207428_10033144 | 3300027907 | Bacteria | 4244 |
| 631 | Ga0207428_10040803 | 3300027907 | Bacteria | 3760 |
| 632 | Ga0268266_10529173 | 3300028379 | Unclassified | 1128 |
| 633 | Ga0268264_10169320 | 3300028381 | Bacteria | 1974 |
| 634 | Ga0268264_10199723 | 3300028381 | Bacteria | 1828 |
| 635 | Ga0268264_10235974 | 3300028381 | Unclassified | 1691 |
| 636 | Ga0268264_10950289 | 3300028381 | Bacteria | 865 |
| 637 | Ga0268264_10963484 | 3300028381 | Unclassified | 859 |
| 638 | Ga0265762_1037727 | 3300030760 | Bacteria | 936 |
| 639 | Ga0265330_10000718 | 3300031235 | Bacteria | 20901 |
| 640 | Ga0265330_10003616 | 3300031235 | Bacteria | 8048 |
| 641 | Ga0265330_10005817 | 3300031235 | Bacteria | 6120 |
| 642 | Ga0265329_10015935 | 3300031242 | Unclassified | 2615 |
| 643 | Ga0265316_10000285 | 3300031344 | Bacteria | 56873 |
| 644 | Ga0265316_10005360 | 3300031344 | Bacteria | 12489 |
| 645 | Ga0265316_10063818 | 3300031344 | Bacteria | 2855 |
| 646 | Ga0265316_10308383 | 3300031344 | Unclassified | 1152 |
| 647 | Ga0307408_100001594 | 3300031548 | Bacteria | 16750 |
| 648 | Ga0307408_100324520 | 3300031548 | Unclassified | 1298 |
| 649 | Ga0265342_10002221 | 3300031712 | Bacteria | 17044 |
| 650 | Ga0307413_10081583 | 3300031824 | Bacteria | 2074 |
| 651 | Ga0307410_10094264 | 3300031852 | Bacteria | 2132 |
| 652 | Ga0307406_10012049 | 3300031901 | Bacteria | 4919 |
| 653 | Ga0307406_10117779 | 3300031901 | Bacteria | 1840 |
| 654 | Ga0307406_10241208 | 3300031901 | Unclassified | 1356 |
| 655 | Ga0307406_10264427 | 3300031901 | Bacteria | 1303 |
| 656 | Ga0307407_10129723 | 3300031903 | Unclassified | 1611 |
| 657 | Ga0307409_100316959 | 3300031995 | Bacteria | 1458 |
| 658 | Ga0307409_101052797 | 3300031995 | Unclassified | 833 |
| 659 | Ga0307416_100394227 | 3300032002 | Bacteria | 1419 |
| 660 | Ga0307415_100098928 | 3300032126 | Bacteria | 2133 |
| 661 | Ga0307415_100441615 | 3300032126 | Unclassified | 1122 |
| 662 | Ga0307415_100482267 | 3300032126 | Unclassified | 1080 |
| 663 | Ga0373951_0008266 | 3300035091 | Unclassified | 2356 |
| 664 | Ga0373941_0009241 | 3300035115 | Bacteria | 2476 |
| 665 | Ga0373942_0006561 | 3300035207 | Bacteria | 2689 |
| 666 | Ga0242422_03152 | 3300038699 | Bacteria | 1087 |
| 667 | Ga0242420_059082 | 3300038996 | Unclassified | 762 |
| 668 | Ga0451843_0740440 | 3300041509 | Bacteria | 823 |
| 669 | Ga0439443_003583 | 3300042003 | Bacteria | 1970 |
| 670 | Ga0439458_0039836 | 3300042157 | Bacteria | 1137 |
| 671 | Ga0439459_0024023 | 3300042438 | Bacteria | 1193 |
| 672 | Ga0451577_0164946 | 3300042876 | Unclassified | 1996 |
| 673 | Ga0451576_0029752 | 3300045051 | Bacteria | 5843 |
| 674 | Ga0451576_0111661 | 3300045051 | Unclassified | 2845 |
| 675 | Ga0451576_0223794 | 3300045051 | Bacteria | 1965 |
| 676 | Ga0451576_0561451 | 3300045051 | Bacteria | 1199 |
| 677 | Ga0451576_0652491 | 3300045051 | Bacteria | 1106 |
| 678 | Ga0451576_0822727 | 3300045051 | Unclassified | 975 |
| 679 | Ga0495638_0225660 | 3300046460 | Bacteria | 1045 |
| 680 | Ga0495666_0119203 | 3300046526 | Bacteria | 1237 |
| 681 | Ga0495645_0336344 | 3300046543 | Bacteria | 976 |
| 682 | Ga0495659_0050184 | 3300046664 | Unclassified | 1517 |
| 683 | Ga0495669_0188112 | 3300046684 | Bacteria | 985 |
| 684 | Ga0495636_0023074 | 3300047318 | Bacteria | 2518 |
| 685 | Ga0495680_0211301 | 3300047322 | Unclassified | 1389 |
| 686 | Ga0495687_160652 | 3300047443 | Bacteria | 756 |
| 687 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 688 | Ga0495686_0001512 | 3300047472 | Bacteria | 25025 |
| 689 | Ga0495686_0019096 | 3300047472 | Bacteria | 4584 |
| 690 | Ga0495686_0099850 | 3300047472 | Bacteria | 1751 |
| 691 | Ga0495686_0238021 | 3300047472 | Unclassified | 1028 |
| 692 | Ga0495602_0361478 | 3300048088 | Unclassified | 1045 |
| 693 | Ga0496101_0054326 | 3300048904 | Bacteria | 2892 |
| 694 | Ga0496102_0405637 | 3300048905 | Bacteria | 1281 |
| 695 | Ga0496103_0120661 | 3300048906 | Unclassified | 1670 |
| 696 | Ga0496104_0000031 | 3300048907 | Bacteria | 194537 |
| 697 | Ga0496104_0491804 | 3300048907 | Bacteria | 1138 |
| 698 | Ga0496104_0928615 | 3300048907 | Bacteria | 775 |
| 699 | Ga0496105_0054848 | 3300048908 | Bacteria | 3291 |
| 700 | Ga0496106_0000698 | 3300048909 | Bacteria | 24110 |
| 701 | Ga0496106_0091539 | 3300048909 | Unclassified | 2348 |
| 702 | Ga0496108_0223025 | 3300048911 | Unclassified | 1638 |
| 703 | Ga0496108_0795977 | 3300048911 | Bacteria | 816 |
| 704 | Ga0496112_0149951 | 3300048915 | Bacteria | 2299 |
| 705 | Ga0496112_0328598 | 3300048915 | Bacteria | 1473 |
| 706 | Ga0496112_0412945 | 3300048915 | Bacteria | 1289 |
| 707 | Ga0496112_0524760 | 3300048915 | Unclassified | 1119 |
| 708 | Ga0501291_019562 | 3300049514 | Unclassified | 1064 |
| 709 | Ga0501072_0085433 | 3300049588 | Bacteria | 2503 |
| 710 | Ga0501207_000450 | 3300049654 | Bacteria | 4604 |
| 711 | Ga0501208_048383 | 3300049655 | Unclassified | 805 |
| 712 | Ga0501227_077226 | 3300049665 | Unclassified | 870 |
| 713 | Ga0501235_064804 | 3300049669 | Bacteria | 859 |
| 714 | Ga0501236_013781 | 3300049670 | Unclassified | 1111 |
| 715 | Ga0501249_015171 | 3300049679 | Bacteria | 1647 |
| 716 | Ga0501249_016164 | 3300049679 | Bacteria | 1601 |
| 717 | Ga0501249_070951 | 3300049679 | Bacteria | 814 |
| 718 | Ga0501253_068141 | 3300049683 | Bacteria | 781 |
| 719 | Ga0501257_019624 | 3300049686 | Bacteria | 1582 |
| 720 | Ga0501257_086406 | 3300049686 | Bacteria | 813 |
| 721 | Ga0501225_0023218 | 3300049705 | Bacteria | 1710 |
| 722 | Ga0501225_0089361 | 3300049705 | Bacteria | 891 |
| 723 | Ga0501234_012647 | 3300049707 | Bacteria | 1322 |
| 724 | Ga0501079_0249801 | 3300049741 | Bacteria | 1386 |
| 725 | Ga0501079_0312889 | 3300049741 | Bacteria | 1229 |
| 726 | Ga0501081_0440341 | 3300049743 | Bacteria | 967 |
| 727 | Ga0501263_021501 | 3300049760 | Unclassified | 871 |
| 728 | Ga0501273_035228 | 3300049770 | Unclassified | 725 |
| 729 | Ga0501204_009465 | 3300049850 | Bacteria | 1127 |
| 730 | Ga0501204_030730 | 3300049850 | Unclassified | 745 |
| 731 | nmdc:mga03683_129280_c2 | 3300050489 | Unclassified | 842 |
| 732 | nmdc:mga03n38_180244_c1 | 3300050490 | Unclassified | 1082 |
| 733 | nmdc:mga00v17_26556_c1 | 3300050491 | Unclassified | 2337 |
| 734 | nmdc:mga0yw44_33764_c1 | 3300050492 | Bacteria | 2992 |
| 735 | nmdc:mga0k408_218_c1 | 3300050493 | Bacteria | 30681 |
| 736 | nmdc:mga04h51_42863_c1 | 3300050495 | Bacteria | 1486 |
| 737 | nmdc:mga05p37_1061_c1 | 3300050507 | Bacteria | 31431 |
| 738 | nmdc:mga05p37_169878_c1 | 3300050507 | Bacteria | 2660 |
| 739 | nmdc:mga05p37_214153_c1 | 3300050507 | Bacteria | 2327 |
| 740 | nmdc:mga05p37_222507_c1 | 3300050507 | Bacteria | 2277 |
| 741 | nmdc:mga05p37_243769_c1 | 3300050507 | Unclassified | 2159 |
| 742 | nmdc:mga05p37_383515_c1 | 3300050507 | Unclassified | 1646 |
| 743 | nmdc:mga05p37_66941_c1 | 3300050507 | Unclassified | 4418 |
| 744 | nmdc:mga05p37_6857_c1 | 3300050507 | Bacteria | 13429 |
| 745 | nmdc:mga05p37_701062_c1 | 3300050507 | Bacteria | 1124 |
| 746 | nmdc:mga05p37_97081_c1 | 3300050507 | Bacteria | 3630 |
| 747 | nmdc:mga09592_17060_c1 | 3300050508 | Bacteria | 5944 |
| 748 | nmdc:mga0qj67_401647_c1 | 3300050509 | Bacteria | 1106 |
| 749 | nmdc:mga06r32_188961_c1 | 3300050510 | Bacteria | 2047 |
| 750 | nmdc:mga06r32_4917_c1 | 3300050510 | Bacteria | 12037 |
| 751 | nmdc:mga06r32_685798_c1 | 3300050510 | Bacteria | 991 |
| 752 | nmdc:mga06r32_981797_c1 | 3300050510 | Unclassified | 798 |
| 753 | nmdc:mga08y16_20585_c1 | 3300050511 | Bacteria | 6963 |
| 754 | nmdc:mga08y16_2339_c1 | 3300050511 | Bacteria | 19433 |
| 755 | nmdc:mga08y16_50331_c1 | 3300050511 | Bacteria | 4361 |
| 756 | nmdc:mga0n895_157091_c1 | 3300050512 | Bacteria | 2305 |
| 757 | nmdc:mga0n895_161404_c1 | 3300050512 | Bacteria | 2273 |
| 758 | nmdc:mga0n895_171469_c1 | 3300050512 | Bacteria | 2202 |
| 759 | nmdc:mga0n895_258105_c1 | 3300050512 | Bacteria | 1769 |
| 760 | nmdc:mga0n895_71041_c1 | 3300050512 | Bacteria | 3451 |
| 761 | nmdc:mga0rr50_131573_c1 | 3300050513 | Bacteria | 2004 |
| 762 | nmdc:mga0rr50_132909_c1 | 3300050513 | Bacteria | 1994 |
| 763 | nmdc:mga0rr50_2108_c1 | 3300050513 | Bacteria | 11117 |
| 764 | nmdc:mga0rr50_239444_c1 | 3300050513 | Bacteria | 1504 |
| 765 | nmdc:mga0rr50_275096_c1 | 3300050513 | Bacteria | 1404 |
| 766 | nmdc:mga0rr50_833040_c1 | 3300050513 | Unclassified | 787 |
| 767 | nmdc:mga08x19_165167_c2 | 3300050514 | Archaea | 1175 |
| 768 | nmdc:mga08x19_16_c1 | 3300050514 | Bacteria | 348119 |
| 769 | nmdc:mga0a205_107910_c1 | 3300050515 | Bacteria | 2682 |
| 770 | nmdc:mga0a205_141587_c1 | 3300050515 | Bacteria | 2305 |
| 771 | nmdc:mga0a205_193470_c1 | 3300050515 | Archaea | 1925 |
| 772 | nmdc:mga0a205_24054_c1 | 3300050515 | Bacteria | 5785 |
| 773 | nmdc:mga0a205_277826_c1 | 3300050515 | Bacteria | 1551 |
| 774 | nmdc:mga0a205_30275_c1 | 3300050515 | Bacteria | 5181 |
| 775 | nmdc:mga0a205_329698_c1 | 3300050515 | Bacteria | 1396 |
| 776 | nmdc:mga0a205_368505_c1 | 3300050515 | Bacteria | 1302 |
| 777 | nmdc:mga0a205_546692_c1 | 3300050515 | Unclassified | 1013 |
| 778 | nmdc:mga0a205_70399_c1 | 3300050515 | Bacteria | 3377 |
| 779 | nmdc:mga0a205_84770_c1 | 3300050515 | Bacteria | 3061 |
| 780 | nmdc:mga0sz30_76907_c1 | 3300050516 | Unclassified | 1441 |
| 781 | Ga0495601_0007655 | 3300053077 | Bacteria | 6346 |
| 782 | Ga0495601_0353718 | 3300053077 | Bacteria | 955 |
| 783 | Ga0495655_0053341 | 3300053083 | Unclassified | 1078 |
| 784 | Ga0500640_004532 | 3300053095 | Bacteria | 5059 |
| 785 | Ga0500554_000274 | 3300053102 | Bacteria | 11148 |
| 786 | Ga0500572_001651 | 3300053111 | Bacteria | 5843 |
| 787 | Ga0500595_000803 | 3300053119 | Bacteria | 18206 |
| 788 | Ga0500637_0313672 | 3300053178 | Bacteria | 850 |
| 789 | Ga0590075_013829 | 3300059424 | Unclassified | 1970 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100028708 | Ga0070706_1000287084 | 183 |
| 2 | 3300005471 | Ga0070698_100184133 | Ga0070698_1001841331 | 183 |
| 3 | 3300005518 | Ga0070699_100030454 | Ga0070699_1000304544 | 183 |
| 4 | 3300025910 | Ga0207684_10043668 | Ga0207684_100436684 | 183 |
| 5 | 3300025922 | Ga0207646_10021862 | Ga0207646_100218622 | 183 |
| 6 | 3300047443 | Ga0495687_160652 | Ga0495687_160652_191_742 | 183 |
| 7 | 3300031235 | Ga0265330_10003616 | Ga0265330_100036164 | 187 |
| 8 | 3300031344 | Ga0265316_10000285 | Ga0265316_1000028521 | 187 |
| 9 | 3300047472 | Ga0495686_0238021 | Ga0495686_0238021_350_916 | 188 |
| 10 | 3300005563 | Ga0068855_100130143 | Ga0068855_1001301433 | 189 |
| 11 | 3300009093 | Ga0105240_10370051 | Ga0105240_103700511 | 189 |
| 12 | 3300009177 | Ga0105248_10527639 | Ga0105248_105276392 | 189 |
| 13 | 3300009553 | Ga0105249_11068907 | Ga0105249_110689072 | 189 |
| 14 | 3300025949 | Ga0207667_10321950 | Ga0207667_103219503 | 189 |
| 15 | 3300005614 | Ga0068856_100888739 | Ga0068856_1008887392 | 195 |
| 16 | 3300025924 | Ga0207694_10013013 | Ga0207694_100130135 | 195 |
| 17 | 3300009551 | Ga0105238_10021791 | Ga0105238_100217915 | 196 |
| 18 | 3300005289 | Ga0065704_10251220 | Ga0065704_102512202 | 198 |
| 19 | 3300005545 | Ga0070695_100649500 | Ga0070695_1006495001 | 199 |
| 20 | 3300005406 | Ga0070703_10000392 | Ga0070703_1000039214 | 200 |
| 21 | 3300005441 | Ga0070700_100120641 | Ga0070700_1001206412 | 200 |
| 22 | 3300005445 | Ga0070708_100068799 | Ga0070708_1000687992 | 200 |
| 23 | 3300005468 | Ga0070707_100419197 | Ga0070707_1004191972 | 200 |
| 24 | 3300009545 | Ga0105237_10076977 | Ga0105237_100769773 | 200 |
| 25 | 3300025885 | Ga0207653_10000197 | Ga0207653_1000019713 | 200 |
| 26 | 3300025922 | Ga0207646_10332846 | Ga0207646_103328461 | 200 |
| 27 | 3300026075 | Ga0207708_10078922 | Ga0207708_100789222 | 200 |
| 28 | 3300013297 | Ga0157378_10150159 | Ga0157378_101501593 | 202 |
| 29 | 3300026035 | Ga0207703_10703097 | Ga0207703_107030972 | 202 |
| 30 | 3300005471 | Ga0070698_100107442 | Ga0070698_1001074423 | 204 |
| 31 | 3300005545 | Ga0070695_100303974 | Ga0070695_1003039742 | 204 |
| 32 | 3300025922 | Ga0207646_10303916 | Ga0207646_103039162 | 204 |
| 33 | 3300005440 | Ga0070705_100723294 | Ga0070705_1007232941 | 205 |
| 34 | 3300005444 | Ga0070694_100003143 | Ga0070694_1000031437 | 205 |
| 35 | 3300005445 | Ga0070708_100004377 | Ga0070708_1000043772 | 205 |
| 36 | 3300005549 | Ga0070704_100007658 | Ga0070704_1000076582 | 205 |
| 37 | 3300005577 | Ga0068857_100727611 | Ga0068857_1007276112 | 205 |
| 38 | 3300005843 | Ga0068860_100789113 | Ga0068860_1007891132 | 205 |
| 39 | 3300006028 | Ga0070717_10309099 | Ga0070717_103090992 | 205 |
| 40 | 3300009176 | Ga0105242_10930101 | Ga0105242_109301011 | 205 |
| 41 | 3300013297 | Ga0157378_10667034 | Ga0157378_106670341 | 205 |
| 42 | 3300028381 | Ga0268264_10950289 | Ga0268264_109502892 | 205 |
| 43 | 3300005467 | Ga0070706_100151310 | Ga0070706_1001513102 | 206 |
| 44 | 3300005577 | Ga0068857_100093228 | Ga0068857_1000932283 | 206 |
| 45 | 3300006871 | Ga0075434_100131818 | Ga0075434_1001318182 | 206 |
| 46 | 3300009147 | Ga0114129_10089354 | Ga0114129_100893543 | 206 |
| 47 | 3300026116 | Ga0207674_10022251 | Ga0207674_100222514 | 206 |
| 48 | 3300005327 | Ga0070658_10149186 | Ga0070658_101491862 | 207 |
| 49 | 3300013296 | Ga0157374_11036211 | Ga0157374_110362111 | 207 |
| 50 | 3300025945 | Ga0207679_10619032 | Ga0207679_106190322 | 207 |
| 51 | 3300025960 | Ga0207651_10009988 | Ga0207651_100099883 | 207 |
| 52 | 3300031344 | Ga0265316_10063818 | Ga0265316_100638182 | 207 |
| 53 | 3300050507 | nmdc:mga05p37_66941_c1 | nmdc:mga05p37_66941_c1_3224_3880 | 207 |
| 54 | 3300050513 | nmdc:mga0rr50_131573_c1 | nmdc:mga0rr50_131573_c1_143_778 | 207 |
| 55 | 3300003322 | rootL2_10011367 | rootL2_100113674 | 208 |
| 56 | 3300005331 | Ga0070670_100113953 | Ga0070670_1001139533 | 208 |
| 57 | 3300025936 | Ga0207670_10480162 | Ga0207670_104801622 | 208 |
| 58 | 3300046460 | Ga0495638_0225660 | Ga0495638_0225660_347_973 | 208 |
| 59 | 3300050512 | nmdc:mga0n895_258105_c1 | nmdc:mga0n895_258105_c1_929_1594 | 208 |
| 60 | 3300005441 | Ga0070700_100000027 | Ga0070700_10000002770 | 209 |
| 61 | 3300005471 | Ga0070698_100148389 | Ga0070698_1001483891 | 209 |
| 62 | 3300005618 | Ga0068864_101070097 | Ga0068864_1010700971 | 209 |
| 63 | 3300009148 | Ga0105243_10319858 | Ga0105243_103198582 | 209 |
| 64 | 3300009176 | Ga0105242_10033576 | Ga0105242_100335762 | 209 |
| 65 | 3300014745 | Ga0157377_10158351 | Ga0157377_101583512 | 209 |
| 66 | 3300025934 | Ga0207686_10099865 | Ga0207686_100998652 | 209 |
| 67 | 3300025935 | Ga0207709_10169307 | Ga0207709_101693072 | 209 |
| 68 | 3300026075 | Ga0207708_10000055 | Ga0207708_1000005537 | 209 |
| 69 | 3300045051 | Ga0451576_0223794 | Ga0451576_0223794_1279_1941 | 209 |
| 70 | 3300053083 | Ga0495655_0053341 | Ga0495655_0053341_298_978 | 209 |
| 71 | 3300005536 | Ga0070697_100196904 | Ga0070697_1001969042 | 210 |
| 72 | 3300005536 | Ga0070697_100470318 | Ga0070697_1004703182 | 210 |
| 73 | 3300006852 | Ga0075433_10275070 | Ga0075433_102750701 | 210 |
| 74 | 3300025910 | Ga0207684_10047943 | Ga0207684_100479434 | 210 |
| 75 | 3300031548 | Ga0307408_100001594 | Ga0307408_1000015942 | 210 |
| 76 | 3300031824 | Ga0307413_10081583 | Ga0307413_100815832 | 210 |
| 77 | 3300031852 | Ga0307410_10094264 | Ga0307410_100942642 | 210 |
| 78 | 3300031901 | Ga0307406_10117779 | Ga0307406_101177792 | 210 |
| 79 | 3300031995 | Ga0307409_100316959 | Ga0307409_1003169592 | 210 |
| 80 | 3300035115 | Ga0373941_0009241 | Ga0373941_0009241_1388_2023 | 210 |
| 81 | 3300049654 | Ga0501207_000450 | Ga0501207_000450_3325_3957 | 210 |
| 82 | 3300049670 | Ga0501236_013781 | Ga0501236_013781_315_947 | 210 |
| 83 | 3300049679 | Ga0501249_016164 | Ga0501249_016164_592_1224 | 210 |
| 84 | 3300049686 | Ga0501257_019624 | Ga0501257_019624_839_1471 | 210 |
| 85 | 3300049707 | Ga0501234_012647 | Ga0501234_012647_340_972 | 210 |
| 86 | 3300049850 | Ga0501204_009465 | Ga0501204_009465_105_737 | 210 |
| 87 | 3300050512 | nmdc:mga0n895_171469_c1 | nmdc:mga0n895_171469_c1_913_1548 | 210 |
| 88 | 3300050515 | nmdc:mga0a205_24054_c1 | nmdc:mga0a205_24054_c1_4715_5350 | 210 |
| 89 | 3300006852 | Ga0075433_10235496 | Ga0075433_102354962 | 211 |
| 90 | 3300009094 | Ga0111539_10278956 | Ga0111539_102789563 | 211 |
| 91 | 3300009147 | Ga0114129_11412619 | Ga0114129_114126191 | 211 |
| 92 | 3300025942 | Ga0207689_10157628 | Ga0207689_101576283 | 211 |
| 93 | 3300026075 | Ga0207708_10774708 | Ga0207708_107747081 | 211 |
| 94 | 3300049679 | Ga0501249_015171 | Ga0501249_015171_459_1106 | 211 |
| 95 | 3300049686 | Ga0501257_086406 | Ga0501257_086406_94_741 | 211 |
| 96 | 3300049705 | Ga0501225_0089361 | Ga0501225_0089361_92_739 | 211 |
| 97 | 3300050507 | nmdc:mga05p37_169878_c1 | nmdc:mga05p37_169878_c1_1189_1836 | 211 |
| 98 | 3300050515 | nmdc:mga0a205_277826_c1 | nmdc:mga0a205_277826_c1_271_909 | 211 |
| 99 | 3300053095 | Ga0500640_004532 | Ga0500640_004532_3681_4331 | 211 |
| 100 | 3300053102 | Ga0500554_000274 | Ga0500554_000274_8458_9108 | 211 |
| 101 | 3300053111 | Ga0500572_001651 | Ga0500572_001651_2569_3219 | 211 |
| 102 | 3300053119 | Ga0500595_000803 | Ga0500595_000803_4190_4840 | 211 |
| 103 | 3300053178 | Ga0500637_0313672 | Ga0500637_0313672_177_827 | 211 |
| 104 | 3300005345 | Ga0070692_10093070 | Ga0070692_100930702 | 212 |
| 105 | 3300005458 | Ga0070681_10122078 | Ga0070681_101220783 | 212 |
| 106 | 3300005545 | Ga0070695_100072735 | Ga0070695_1000727352 | 212 |
| 107 | 3300005546 | Ga0070696_100013512 | Ga0070696_1000135124 | 212 |
| 108 | 3300005985 | Ga0081539_10205372 | Ga0081539_102053721 | 212 |
| 109 | 3300006852 | Ga0075433_10064292 | Ga0075433_100642923 | 212 |
| 110 | 3300009148 | Ga0105243_10193402 | Ga0105243_101934022 | 212 |
| 111 | 3300026116 | Ga0207674_10403466 | Ga0207674_104034661 | 212 |
| 112 | 3300042157 | Ga0439458_0039836 | Ga0439458_0039836_79_720 | 212 |
| 113 | 3300042438 | Ga0439459_0024023 | Ga0439459_0024023_283_924 | 212 |
| 114 | 3300003320 | rootH2_10325698 | rootH2_103256981 | 213 |
| 115 | 3300005337 | Ga0070682_100000002 | Ga0070682_100000002193 | 213 |
| 116 | 3300005347 | Ga0070668_100734450 | Ga0070668_1007344502 | 213 |
| 117 | 3300025302 | Ga0207426_1071081 | Ga0207426_10710812 | 213 |
| 118 | 3300025904 | Ga0207647_10087790 | Ga0207647_100877902 | 213 |
| 119 | 3300005334 | Ga0068869_100000001 | Ga0068869_100000001146 | 214 |
| 120 | 3300042003 | Ga0439443_003583 | Ga0439443_003583_972_1616 | 214 |
| 121 | 3300005327 | Ga0070658_10023453 | Ga0070658_100234532 | 215 |
| 122 | 3300005331 | Ga0070670_100053552 | Ga0070670_1000535523 | 215 |
| 123 | 3300005331 | Ga0070670_100226543 | Ga0070670_1002265432 | 215 |
| 124 | 3300005331 | Ga0070670_100389227 | Ga0070670_1003892271 | 215 |
| 125 | 3300005331 | Ga0070670_100423727 | Ga0070670_1004237272 | 215 |
| 126 | 3300005336 | Ga0070680_100030467 | Ga0070680_1000304674 | 215 |
| 127 | 3300005336 | Ga0070680_100235360 | Ga0070680_1002353603 | 215 |
| 128 | 3300005340 | Ga0070689_100003073 | Ga0070689_1000030739 | 215 |
| 129 | 3300005344 | Ga0070661_100004719 | Ga0070661_1000047198 | 215 |
| 130 | 3300005364 | Ga0070673_100119486 | Ga0070673_1001194862 | 215 |
| 131 | 3300005435 | Ga0070714_100008416 | Ga0070714_1000084164 | 215 |
| 132 | 3300005435 | Ga0070714_100052712 | Ga0070714_1000527124 | 215 |
| 133 | 3300005435 | Ga0070714_100091808 | Ga0070714_1000918082 | 215 |
| 134 | 3300005436 | Ga0070713_100008200 | Ga0070713_1000082006 | 215 |
| 135 | 3300005436 | Ga0070713_100157072 | Ga0070713_1001570721 | 215 |
| 136 | 3300005436 | Ga0070713_100267065 | Ga0070713_1002670651 | 215 |
| 137 | 3300005437 | Ga0070710_10234134 | Ga0070710_102341342 | 215 |
| 138 | 3300005437 | Ga0070710_10391465 | Ga0070710_103914652 | 215 |
| 139 | 3300005439 | Ga0070711_100004787 | Ga0070711_1000047872 | 215 |
| 140 | 3300005444 | Ga0070694_100061641 | Ga0070694_1000616413 | 215 |
| 141 | 3300005444 | Ga0070694_100101996 | Ga0070694_1001019962 | 215 |
| 142 | 3300005457 | Ga0070662_100461672 | Ga0070662_1004616722 | 215 |
| 143 | 3300005458 | Ga0070681_10000791 | Ga0070681_100007911 | 215 |
| 144 | 3300005458 | Ga0070681_10009950 | Ga0070681_100099503 | 215 |
| 145 | 3300005458 | Ga0070681_10361792 | Ga0070681_103617922 | 215 |
| 146 | 3300005458 | Ga0070681_10612898 | Ga0070681_106128982 | 215 |
| 147 | 3300005468 | Ga0070707_100447618 | Ga0070707_1004476181 | 215 |
| 148 | 3300005518 | Ga0070699_100199303 | Ga0070699_1001993032 | 215 |
| 149 | 3300005530 | Ga0070679_100000011 | Ga0070679_10000001121 | 215 |
| 150 | 3300005530 | Ga0070679_100223606 | Ga0070679_1002236062 | 215 |
| 151 | 3300005530 | Ga0070679_100577555 | Ga0070679_1005775552 | 215 |
| 152 | 3300005536 | Ga0070697_100039489 | Ga0070697_1000394892 | 215 |
| 153 | 3300005536 | Ga0070697_100539968 | Ga0070697_1005399681 | 215 |
| 154 | 3300005539 | Ga0068853_100055159 | Ga0068853_1000551592 | 215 |
| 155 | 3300005545 | Ga0070695_100281664 | Ga0070695_1002816642 | 215 |
| 156 | 3300005546 | Ga0070696_100184107 | Ga0070696_1001841072 | 215 |
| 157 | 3300005547 | Ga0070693_100620092 | Ga0070693_1006200921 | 215 |
| 158 | 3300005563 | Ga0068855_100127808 | Ga0068855_1001278082 | 215 |
| 159 | 3300005563 | Ga0068855_100241278 | Ga0068855_1002412782 | 215 |
| 160 | 3300005563 | Ga0068855_100281478 | Ga0068855_1002814781 | 215 |
| 161 | 3300005577 | Ga0068857_100272038 | Ga0068857_1002720382 | 215 |
| 162 | 3300005578 | Ga0068854_100896705 | Ga0068854_1008967051 | 215 |
| 163 | 3300005614 | Ga0068856_100361662 | Ga0068856_1003616622 | 215 |
| 164 | 3300005615 | Ga0070702_100080861 | Ga0070702_1000808612 | 215 |
| 165 | 3300005616 | Ga0068852_100025194 | Ga0068852_1000251947 | 215 |
| 166 | 3300005616 | Ga0068852_100026870 | Ga0068852_1000268706 | 215 |
| 167 | 3300005616 | Ga0068852_100041713 | Ga0068852_1000417134 | 215 |
| 168 | 3300005617 | Ga0068859_100068685 | Ga0068859_1000686853 | 215 |
| 169 | 3300005617 | Ga0068859_100906902 | Ga0068859_1009069021 | 215 |
| 170 | 3300005618 | Ga0068864_100099264 | Ga0068864_1000992642 | 215 |
| 171 | 3300005618 | Ga0068864_100135307 | Ga0068864_1001353072 | 215 |
| 172 | 3300005841 | Ga0068863_100043030 | Ga0068863_1000430302 | 215 |
| 173 | 3300005841 | Ga0068863_100440468 | Ga0068863_1004404682 | 215 |
| 174 | 3300005842 | Ga0068858_100076009 | Ga0068858_1000760093 | 215 |
| 175 | 3300005842 | Ga0068858_100229701 | Ga0068858_1002297012 | 215 |
| 176 | 3300006028 | Ga0070717_10024632 | Ga0070717_100246324 | 215 |
| 177 | 3300006028 | Ga0070717_10527975 | Ga0070717_105279751 | 215 |
| 178 | 3300006173 | Ga0070716_100000005 | Ga0070716_10000000520 | 215 |
| 179 | 3300006175 | Ga0070712_100004891 | Ga0070712_1000048916 | 215 |
| 180 | 3300006852 | Ga0075433_10035713 | Ga0075433_100357132 | 215 |
| 181 | 3300006852 | Ga0075433_10173952 | Ga0075433_101739522 | 215 |
| 182 | 3300006852 | Ga0075433_11049434 | Ga0075433_110494341 | 215 |
| 183 | 3300006881 | Ga0068865_100412894 | Ga0068865_1004128942 | 215 |
| 184 | 3300006931 | Ga0097620_100068687 | Ga0097620_1000686873 | 215 |
| 185 | 3300006931 | Ga0097620_100906706 | Ga0097620_1009067061 | 215 |
| 186 | 3300007076 | Ga0075435_100137228 | Ga0075435_1001372282 | 215 |
| 187 | 3300007076 | Ga0075435_100185526 | Ga0075435_1001855261 | 215 |
| 188 | 3300009092 | Ga0105250_10094258 | Ga0105250_100942582 | 215 |
| 189 | 3300009147 | Ga0114129_10048089 | Ga0114129_100480895 | 215 |
| 190 | 3300009147 | Ga0114129_10255568 | Ga0114129_102555682 | 215 |
| 191 | 3300009148 | Ga0105243_10000715 | Ga0105243_100007158 | 215 |
| 192 | 3300009148 | Ga0105243_10522653 | Ga0105243_105226531 | 215 |
| 193 | 3300009174 | Ga0105241_10263602 | Ga0105241_102636022 | 215 |
| 194 | 3300009174 | Ga0105241_10567921 | Ga0105241_105679211 | 215 |
| 195 | 3300009176 | Ga0105242_10002445 | Ga0105242_100024452 | 215 |
| 196 | 3300009176 | Ga0105242_10005773 | Ga0105242_100057737 | 215 |
| 197 | 3300009177 | Ga0105248_10112779 | Ga0105248_101127792 | 215 |
| 198 | 3300009177 | Ga0105248_10443527 | Ga0105248_104435272 | 215 |
| 199 | 3300009177 | Ga0105248_10478710 | Ga0105248_104787102 | 215 |
| 200 | 3300009177 | Ga0105248_10978693 | Ga0105248_109786932 | 215 |
| 201 | 3300009545 | Ga0105237_10206969 | Ga0105237_102069692 | 215 |
| 202 | 3300009551 | Ga0105238_10020332 | Ga0105238_100203325 | 215 |
| 203 | 3300009551 | Ga0105238_10270363 | Ga0105238_102703632 | 215 |
| 204 | 3300009551 | Ga0105238_11050456 | Ga0105238_110504561 | 215 |
| 205 | 3300010375 | Ga0105239_10019333 | Ga0105239_100193332 | 215 |
| 206 | 3300010375 | Ga0105239_10443852 | Ga0105239_104438522 | 215 |
| 207 | 3300013100 | Ga0157373_10376757 | Ga0157373_103767572 | 215 |
| 208 | 3300013100 | Ga0157373_10640263 | Ga0157373_106402631 | 215 |
| 209 | 3300013104 | Ga0157370_10004929 | Ga0157370_1000492911 | 215 |
| 210 | 3300013104 | Ga0157370_10034070 | Ga0157370_100340705 | 215 |
| 211 | 3300013104 | Ga0157370_10052651 | Ga0157370_100526514 | 215 |
| 212 | 3300013104 | Ga0157370_10397991 | Ga0157370_103979912 | 215 |
| 213 | 3300013105 | Ga0157369_10007108 | Ga0157369_100071087 | 215 |
| 214 | 3300013105 | Ga0157369_10026429 | Ga0157369_100264294 | 215 |
| 215 | 3300013297 | Ga0157378_10000001 | Ga0157378_1000000159 | 215 |
| 216 | 3300013297 | Ga0157378_10185876 | Ga0157378_101858762 | 215 |
| 217 | 3300013306 | Ga0163162_10003094 | Ga0163162_1000309410 | 215 |
| 218 | 3300013306 | Ga0163162_10366001 | Ga0163162_103660012 | 215 |
| 219 | 3300013307 | Ga0157372_10031617 | Ga0157372_100316175 | 215 |
| 220 | 3300013307 | Ga0157372_10314764 | Ga0157372_103147642 | 215 |
| 221 | 3300013307 | Ga0157372_10620012 | Ga0157372_106200122 | 215 |
| 222 | 3300013308 | Ga0157375_10195369 | Ga0157375_101953692 | 215 |
| 223 | 3300014325 | Ga0163163_10033041 | Ga0163163_100330413 | 215 |
| 224 | 3300014745 | Ga0157377_10283253 | Ga0157377_102832532 | 215 |
| 225 | 3300025898 | Ga0207692_10341673 | Ga0207692_103416731 | 215 |
| 226 | 3300025911 | Ga0207654_10277041 | Ga0207654_102770411 | 215 |
| 227 | 3300025912 | Ga0207707_10000007 | Ga0207707_10000007131 | 215 |
| 228 | 3300025912 | Ga0207707_10441319 | Ga0207707_104413192 | 215 |
| 229 | 3300025913 | Ga0207695_10019908 | Ga0207695_100199082 | 215 |
| 230 | 3300025916 | Ga0207663_10004236 | Ga0207663_100042369 | 215 |
| 231 | 3300025917 | Ga0207660_10021570 | Ga0207660_100215701 | 215 |
| 232 | 3300025917 | Ga0207660_10292346 | Ga0207660_102923461 | 215 |
| 233 | 3300025919 | Ga0207657_10017784 | Ga0207657_100177847 | 215 |
| 234 | 3300025919 | Ga0207657_10126263 | Ga0207657_101262632 | 215 |
| 235 | 3300025921 | Ga0207652_10000102 | Ga0207652_1000010267 | 215 |
| 236 | 3300025921 | Ga0207652_10189742 | Ga0207652_101897422 | 215 |
| 237 | 3300025921 | Ga0207652_10478297 | Ga0207652_104782972 | 215 |
| 238 | 3300025922 | Ga0207646_10444555 | Ga0207646_104445551 | 215 |
| 239 | 3300025924 | Ga0207694_10073229 | Ga0207694_100732292 | 215 |
| 240 | 3300025924 | Ga0207694_10148836 | Ga0207694_101488362 | 215 |
| 241 | 3300025924 | Ga0207694_10232467 | Ga0207694_102324672 | 215 |
| 242 | 3300025925 | Ga0207650_10320788 | Ga0207650_103207881 | 215 |
| 243 | 3300025928 | Ga0207700_10009013 | Ga0207700_100090133 | 215 |
| 244 | 3300025928 | Ga0207700_10180148 | Ga0207700_101801482 | 215 |
| 245 | 3300025928 | Ga0207700_10197555 | Ga0207700_101975552 | 215 |
| 246 | 3300025929 | Ga0207664_10119045 | Ga0207664_101190453 | 215 |
| 247 | 3300025929 | Ga0207664_10350501 | Ga0207664_103505011 | 215 |
| 248 | 3300025929 | Ga0207664_10576559 | Ga0207664_105765592 | 215 |
| 249 | 3300025934 | Ga0207686_10001008 | Ga0207686_1000100814 | 215 |
| 250 | 3300025935 | Ga0207709_10000301 | Ga0207709_1000030134 | 215 |
| 251 | 3300025935 | Ga0207709_10346569 | Ga0207709_103465692 | 215 |
| 252 | 3300025936 | Ga0207670_10005234 | Ga0207670_100052343 | 215 |
| 253 | 3300025939 | Ga0207665_10000012 | Ga0207665_1000001220 | 215 |
| 254 | 3300025941 | Ga0207711_10093478 | Ga0207711_100934783 | 215 |
| 255 | 3300025941 | Ga0207711_10498484 | Ga0207711_104984842 | 215 |
| 256 | 3300025942 | Ga0207689_10012945 | Ga0207689_100129454 | 215 |
| 257 | 3300025945 | Ga0207679_10787033 | Ga0207679_107870331 | 215 |
| 258 | 3300025949 | Ga0207667_10162489 | Ga0207667_101624892 | 215 |
| 259 | 3300025949 | Ga0207667_10253992 | Ga0207667_102539922 | 215 |
| 260 | 3300025949 | Ga0207667_10348020 | Ga0207667_103480202 | 215 |
| 261 | 3300025960 | Ga0207651_10158061 | Ga0207651_101580612 | 215 |
| 262 | 3300025961 | Ga0207712_10048561 | Ga0207712_100485613 | 215 |
| 263 | 3300025981 | Ga0207640_10050703 | Ga0207640_100507033 | 215 |
| 264 | 3300025981 | Ga0207640_10970279 | Ga0207640_109702791 | 215 |
| 265 | 3300026041 | Ga0207639_10153233 | Ga0207639_101532332 | 215 |
| 266 | 3300026041 | Ga0207639_10162021 | Ga0207639_101620212 | 215 |
| 267 | 3300026078 | Ga0207702_10091278 | Ga0207702_100912782 | 215 |
| 268 | 3300026078 | Ga0207702_10131012 | Ga0207702_101310122 | 215 |
| 269 | 3300026078 | Ga0207702_10141246 | Ga0207702_101412462 | 215 |
| 270 | 3300026078 | Ga0207702_10472199 | Ga0207702_104721991 | 215 |
| 271 | 3300026078 | Ga0207702_10497916 | Ga0207702_104979162 | 215 |
| 272 | 3300026088 | Ga0207641_10160533 | Ga0207641_101605333 | 215 |
| 273 | 3300026095 | Ga0207676_10008357 | Ga0207676_100083572 | 215 |
| 274 | 3300026095 | Ga0207676_10091382 | Ga0207676_100913822 | 215 |
| 275 | 3300026116 | Ga0207674_10283960 | Ga0207674_102839602 | 215 |
| 276 | 3300026118 | Ga0207675_100005231 | Ga0207675_1000052316 | 215 |
| 277 | 3300026142 | Ga0207698_10017167 | Ga0207698_100171675 | 215 |
| 278 | 3300026142 | Ga0207698_10245230 | Ga0207698_102452302 | 215 |
| 279 | 3300030760 | Ga0265762_1037727 | Ga0265762_10377271 | 215 |
| 280 | 3300031344 | Ga0265316_10308383 | Ga0265316_103083832 | 215 |
| 281 | 3300031548 | Ga0307408_100324520 | Ga0307408_1003245202 | 215 |
| 282 | 3300031901 | Ga0307406_10241208 | Ga0307406_102412081 | 215 |
| 283 | 3300031903 | Ga0307407_10129723 | Ga0307407_101297232 | 215 |
| 284 | 3300031995 | Ga0307409_101052797 | Ga0307409_1010527971 | 215 |
| 285 | 3300032002 | Ga0307416_100394227 | Ga0307416_1003942271 | 215 |
| 286 | 3300032126 | Ga0307415_100098928 | Ga0307415_1000989282 | 215 |
| 287 | 3300032126 | Ga0307415_100441615 | Ga0307415_1004416152 | 215 |
| 288 | 3300038699 | Ga0242422_03152 | Ga0242422_03152_115_765 | 215 |
| 289 | 3300038996 | Ga0242420_059082 | Ga0242420_059082_39_686 | 215 |
| 290 | 3300042876 | Ga0451577_0164946 | Ga0451577_0164946_759_1421 | 215 |
| 291 | 3300045051 | Ga0451576_0029752 | Ga0451576_0029752_4006_4668 | 215 |
| 292 | 3300045051 | Ga0451576_0822727 | Ga0451576_0822727_109_756 | 215 |
| 293 | 3300046526 | Ga0495666_0119203 | Ga0495666_0119203_31_678 | 215 |
| 294 | 3300047318 | Ga0495636_0023074 | Ga0495636_0023074_110_772 | 215 |
| 295 | 3300047472 | Ga0495686_0000006 | Ga0495686_0000006_587451_588101 | 215 |
| 296 | 3300047472 | Ga0495686_0001512 | Ga0495686_0001512_16746_17396 | 215 |
| 297 | 3300047472 | Ga0495686_0019096 | Ga0495686_0019096_3794_4456 | 215 |
| 298 | 3300047472 | Ga0495686_0099850 | Ga0495686_0099850_824_1474 | 215 |
| 299 | 3300048088 | Ga0495602_0361478 | Ga0495602_0361478_302_973 | 215 |
| 300 | 3300048906 | Ga0496103_0120661 | Ga0496103_0120661_848_1498 | 215 |
| 301 | 3300048907 | Ga0496104_0000031 | Ga0496104_0000031_142866_143516 | 215 |
| 302 | 3300048907 | Ga0496104_0928615 | Ga0496104_0928615_80_727 | 215 |
| 303 | 3300048909 | Ga0496106_0000698 | Ga0496106_0000698_8563_9225 | 215 |
| 304 | 3300048909 | Ga0496106_0091539 | Ga0496106_0091539_1574_2224 | 215 |
| 305 | 3300048911 | Ga0496108_0223025 | Ga0496108_0223025_761_1411 | 215 |
| 306 | 3300048911 | Ga0496108_0795977 | Ga0496108_0795977_16_663 | 215 |
| 307 | 3300048915 | Ga0496112_0149951 | Ga0496112_0149951_1246_1905 | 215 |
| 308 | 3300048915 | Ga0496112_0524760 | Ga0496112_0524760_342_992 | 215 |
| 309 | 3300049514 | Ga0501291_019562 | Ga0501291_019562_320_967 | 215 |
| 310 | 3300049705 | Ga0501225_0023218 | Ga0501225_0023218_51_698 | 215 |
| 311 | 3300049760 | Ga0501263_021501 | Ga0501263_021501_186_833 | 215 |
| 312 | 3300050507 | nmdc:mga05p37_222507_c1 | nmdc:mga05p37_222507_c1_1393_2055 | 215 |
| 313 | 3300050507 | nmdc:mga05p37_243769_c1 | nmdc:mga05p37_243769_c1_516_1163 | 215 |
| 314 | 3300050512 | nmdc:mga0n895_161404_c1 | nmdc:mga0n895_161404_c1_914_1561 | 215 |
| 315 | 3300050513 | nmdc:mga0rr50_132909_c1 | nmdc:mga0rr50_132909_c1_85_732 | 215 |
| 316 | 3300050513 | nmdc:mga0rr50_239444_c1 | nmdc:mga0rr50_239444_c1_634_1281 | 215 |
| 317 | 3300050513 | nmdc:mga0rr50_833040_c1 | nmdc:mga0rr50_833040_c1_87_749 | 215 |
| 318 | 3300050515 | nmdc:mga0a205_30275_c1 | nmdc:mga0a205_30275_c1_1736_2383 | 215 |
| 319 | 3300050515 | nmdc:mga0a205_329698_c1 | nmdc:mga0a205_329698_c1_468_1130 | 215 |
| 320 | 3300050515 | nmdc:mga0a205_546692_c1 | nmdc:mga0a205_546692_c1_116_763 | 215 |
| 321 | 3300050515 | nmdc:mga0a205_70399_c1 | nmdc:mga0a205_70399_c1_2711_3358 | 215 |
| 322 | 3300053077 | Ga0495601_0353718 | Ga0495601_0353718_218_889 | 215 |
| 323 | 3300005290 | Ga0065712_10000114 | Ga0065712_1000011448 | 216 |
| 324 | 3300005290 | Ga0065712_10240405 | Ga0065712_102404051 | 216 |
| 325 | 3300005293 | Ga0065715_10001576 | Ga0065715_100015763 | 216 |
| 326 | 3300005295 | Ga0065707_10045450 | Ga0065707_100454502 | 216 |
| 327 | 3300005328 | Ga0070676_10130464 | Ga0070676_101304641 | 216 |
| 328 | 3300005330 | Ga0070690_100038517 | Ga0070690_1000385173 | 216 |
| 329 | 3300005330 | Ga0070690_100062165 | Ga0070690_1000621652 | 216 |
| 330 | 3300005330 | Ga0070690_100089827 | Ga0070690_1000898271 | 216 |
| 331 | 3300005330 | Ga0070690_100540588 | Ga0070690_1005405881 | 216 |
| 332 | 3300005331 | Ga0070670_100109825 | Ga0070670_1001098251 | 216 |
| 333 | 3300005334 | Ga0068869_100154235 | Ga0068869_1001542351 | 216 |
| 334 | 3300005334 | Ga0068869_100357734 | Ga0068869_1003577342 | 216 |
| 335 | 3300005334 | Ga0068869_100508378 | Ga0068869_1005083781 | 216 |
| 336 | 3300005335 | Ga0070666_10090831 | Ga0070666_100908312 | 216 |
| 337 | 3300005336 | Ga0070680_100005023 | Ga0070680_1000050238 | 216 |
| 338 | 3300005336 | Ga0070680_100079366 | Ga0070680_1000793663 | 216 |
| 339 | 3300005337 | Ga0070682_100002835 | Ga0070682_1000028356 | 216 |
| 340 | 3300005337 | Ga0070682_100612780 | Ga0070682_1006127801 | 216 |
| 341 | 3300005338 | Ga0068868_100013082 | Ga0068868_1000130825 | 216 |
| 342 | 3300005338 | Ga0068868_100049444 | Ga0068868_1000494442 | 216 |
| 343 | 3300005340 | Ga0070689_100004541 | Ga0070689_1000045414 | 216 |
| 344 | 3300005340 | Ga0070689_100252768 | Ga0070689_1002527682 | 216 |
| 345 | 3300005343 | Ga0070687_100165675 | Ga0070687_1001656751 | 216 |
| 346 | 3300005344 | Ga0070661_100592253 | Ga0070661_1005922531 | 216 |
| 347 | 3300005347 | Ga0070668_100040266 | Ga0070668_1000402663 | 216 |
| 348 | 3300005353 | Ga0070669_100264799 | Ga0070669_1002647991 | 216 |
| 349 | 3300005354 | Ga0070675_100054352 | Ga0070675_1000543522 | 216 |
| 350 | 3300005354 | Ga0070675_100068406 | Ga0070675_1000684063 | 216 |
| 351 | 3300005354 | Ga0070675_100770912 | Ga0070675_1007709122 | 216 |
| 352 | 3300005355 | Ga0070671_100011164 | Ga0070671_1000111644 | 216 |
| 353 | 3300005355 | Ga0070671_100033207 | Ga0070671_1000332074 | 216 |
| 354 | 3300005356 | Ga0070674_100142594 | Ga0070674_1001425942 | 216 |
| 355 | 3300005356 | Ga0070674_100196736 | Ga0070674_1001967361 | 216 |
| 356 | 3300005364 | Ga0070673_100034168 | Ga0070673_1000341683 | 216 |
| 357 | 3300005364 | Ga0070673_100071013 | Ga0070673_1000710133 | 216 |
| 358 | 3300005365 | Ga0070688_100019989 | Ga0070688_1000199894 | 216 |
| 359 | 3300005366 | Ga0070659_100003797 | Ga0070659_1000037975 | 216 |
| 360 | 3300005367 | Ga0070667_100423240 | Ga0070667_1004232401 | 216 |
| 361 | 3300005436 | Ga0070713_100191824 | Ga0070713_1001918242 | 216 |
| 362 | 3300005438 | Ga0070701_10014508 | Ga0070701_100145083 | 216 |
| 363 | 3300005438 | Ga0070701_10076264 | Ga0070701_100762642 | 216 |
| 364 | 3300005438 | Ga0070701_10120410 | Ga0070701_101204101 | 216 |
| 365 | 3300005440 | Ga0070705_100069280 | Ga0070705_1000692802 | 216 |
| 366 | 3300005440 | Ga0070705_100236999 | Ga0070705_1002369992 | 216 |
| 367 | 3300005441 | Ga0070700_100015179 | Ga0070700_1000151794 | 216 |
| 368 | 3300005441 | Ga0070700_100028724 | Ga0070700_1000287242 | 216 |
| 369 | 3300005441 | Ga0070700_100059524 | Ga0070700_1000595242 | 216 |
| 370 | 3300005441 | Ga0070700_100127197 | Ga0070700_1001271972 | 216 |
| 371 | 3300005444 | Ga0070694_100002750 | Ga0070694_1000027501 | 216 |
| 372 | 3300005445 | Ga0070708_100001978 | Ga0070708_10000197812 | 216 |
| 373 | 3300005445 | Ga0070708_100188335 | Ga0070708_1001883352 | 216 |
| 374 | 3300005456 | Ga0070678_100096376 | Ga0070678_1000963762 | 216 |
| 375 | 3300005457 | Ga0070662_100175327 | Ga0070662_1001753271 | 216 |
| 376 | 3300005457 | Ga0070662_100737493 | Ga0070662_1007374931 | 216 |
| 377 | 3300005458 | Ga0070681_10018035 | Ga0070681_100180352 | 216 |
| 378 | 3300005459 | Ga0068867_100008304 | Ga0068867_1000083044 | 216 |
| 379 | 3300005459 | Ga0068867_100118650 | Ga0068867_1001186502 | 216 |
| 380 | 3300005459 | Ga0068867_100465427 | Ga0068867_1004654271 | 216 |
| 381 | 3300005466 | Ga0070685_10033721 | Ga0070685_100337213 | 216 |
| 382 | 3300005466 | Ga0070685_10063610 | Ga0070685_100636102 | 216 |
| 383 | 3300005467 | Ga0070706_100000129 | Ga0070706_10000012955 | 216 |
| 384 | 3300005467 | Ga0070706_100008753 | Ga0070706_1000087534 | 216 |
| 385 | 3300005467 | Ga0070706_100026984 | Ga0070706_1000269841 | 216 |
| 386 | 3300005467 | Ga0070706_100078235 | Ga0070706_1000782353 | 216 |
| 387 | 3300005467 | Ga0070706_100490606 | Ga0070706_1004906061 | 216 |
| 388 | 3300005468 | Ga0070707_100011309 | Ga0070707_1000113092 | 216 |
| 389 | 3300005468 | Ga0070707_100096183 | Ga0070707_1000961832 | 216 |
| 390 | 3300005468 | Ga0070707_100139001 | Ga0070707_1001390012 | 216 |
| 391 | 3300005468 | Ga0070707_100157947 | Ga0070707_1001579473 | 216 |
| 392 | 3300005468 | Ga0070707_100283310 | Ga0070707_1002833102 | 216 |
| 393 | 3300005471 | Ga0070698_100006886 | Ga0070698_1000068867 | 216 |
| 394 | 3300005471 | Ga0070698_100010012 | Ga0070698_1000100127 | 216 |
| 395 | 3300005471 | Ga0070698_100615783 | Ga0070698_1006157832 | 216 |
| 396 | 3300005518 | Ga0070699_100000979 | Ga0070699_10000097912 | 216 |
| 397 | 3300005518 | Ga0070699_100001846 | Ga0070699_1000018468 | 216 |
| 398 | 3300005518 | Ga0070699_100022040 | Ga0070699_1000220403 | 216 |
| 399 | 3300005518 | Ga0070699_100053200 | Ga0070699_1000532003 | 216 |
| 400 | 3300005518 | Ga0070699_100108776 | Ga0070699_1001087762 | 216 |
| 401 | 3300005518 | Ga0070699_100168707 | Ga0070699_1001687073 | 216 |
| 402 | 3300005518 | Ga0070699_100379042 | Ga0070699_1003790422 | 216 |
| 403 | 3300005518 | Ga0070699_100383571 | Ga0070699_1003835711 | 216 |
| 404 | 3300005536 | Ga0070697_100009407 | Ga0070697_1000094075 | 216 |
| 405 | 3300005536 | Ga0070697_100039023 | Ga0070697_1000390233 | 216 |
| 406 | 3300005536 | Ga0070697_100057775 | Ga0070697_1000577753 | 216 |
| 407 | 3300005536 | Ga0070697_100068955 | Ga0070697_1000689552 | 216 |
| 408 | 3300005536 | Ga0070697_100288672 | Ga0070697_1002886722 | 216 |
| 409 | 3300005539 | Ga0068853_100017320 | Ga0068853_1000173202 | 216 |
| 410 | 3300005539 | Ga0068853_100023643 | Ga0068853_1000236433 | 216 |
| 411 | 3300005539 | Ga0068853_100125452 | Ga0068853_1001254521 | 216 |
| 412 | 3300005539 | Ga0068853_100132996 | Ga0068853_1001329963 | 216 |
| 413 | 3300005543 | Ga0070672_100050161 | Ga0070672_1000501611 | 216 |
| 414 | 3300005543 | Ga0070672_100081496 | Ga0070672_1000814962 | 216 |
| 415 | 3300005543 | Ga0070672_100798876 | Ga0070672_1007988762 | 216 |
| 416 | 3300005544 | Ga0070686_100019640 | Ga0070686_1000196403 | 216 |
| 417 | 3300005544 | Ga0070686_100279880 | Ga0070686_1002798801 | 216 |
| 418 | 3300005544 | Ga0070686_100455250 | Ga0070686_1004552501 | 216 |
| 419 | 3300005544 | Ga0070686_100583739 | Ga0070686_1005837391 | 216 |
| 420 | 3300005545 | Ga0070695_100054996 | Ga0070695_1000549962 | 216 |
| 421 | 3300005545 | Ga0070695_100138335 | Ga0070695_1001383351 | 216 |
| 422 | 3300005545 | Ga0070695_100653064 | Ga0070695_1006530641 | 216 |
| 423 | 3300005546 | Ga0070696_100031906 | Ga0070696_1000319062 | 216 |
| 424 | 3300005546 | Ga0070696_100036934 | Ga0070696_1000369342 | 216 |
| 425 | 3300005546 | Ga0070696_100043490 | Ga0070696_1000434901 | 216 |
| 426 | 3300005547 | Ga0070693_100106888 | Ga0070693_1001068882 | 216 |
| 427 | 3300005548 | Ga0070665_100154435 | Ga0070665_1001544353 | 216 |
| 428 | 3300005549 | Ga0070704_100134628 | Ga0070704_1001346282 | 216 |
| 429 | 3300005549 | Ga0070704_100264128 | Ga0070704_1002641282 | 216 |
| 430 | 3300005563 | Ga0068855_100221933 | Ga0068855_1002219332 | 216 |
| 431 | 3300005563 | Ga0068855_100857139 | Ga0068855_1008571392 | 216 |
| 432 | 3300005564 | Ga0070664_100015833 | Ga0070664_1000158332 | 216 |
| 433 | 3300005564 | Ga0070664_100085079 | Ga0070664_1000850793 | 216 |
| 434 | 3300005577 | Ga0068857_100005264 | Ga0068857_1000052644 | 216 |
| 435 | 3300005578 | Ga0068854_100435634 | Ga0068854_1004356341 | 216 |
| 436 | 3300005614 | Ga0068856_100250256 | Ga0068856_1002502561 | 216 |
| 437 | 3300005615 | Ga0070702_100004548 | Ga0070702_1000045482 | 216 |
| 438 | 3300005615 | Ga0070702_100082728 | Ga0070702_1000827282 | 216 |
| 439 | 3300005615 | Ga0070702_100115467 | Ga0070702_1001154673 | 216 |
| 440 | 3300005617 | Ga0068859_100020497 | Ga0068859_1000204972 | 216 |
| 441 | 3300005617 | Ga0068859_100132596 | Ga0068859_1001325962 | 216 |
| 442 | 3300005617 | Ga0068859_100577059 | Ga0068859_1005770592 | 216 |
| 443 | 3300005617 | Ga0068859_100792666 | Ga0068859_1007926661 | 216 |
| 444 | 3300005618 | Ga0068864_100020048 | Ga0068864_1000200485 | 216 |
| 445 | 3300005618 | Ga0068864_100025552 | Ga0068864_1000255523 | 216 |
| 446 | 3300005618 | Ga0068864_100074372 | Ga0068864_1000743723 | 216 |
| 447 | 3300005618 | Ga0068864_100076583 | Ga0068864_1000765831 | 216 |
| 448 | 3300005618 | Ga0068864_100169772 | Ga0068864_1001697722 | 216 |
| 449 | 3300005618 | Ga0068864_100328728 | Ga0068864_1003287282 | 216 |
| 450 | 3300005718 | Ga0068866_10137849 | Ga0068866_101378492 | 216 |
| 451 | 3300005719 | Ga0068861_100065983 | Ga0068861_1000659833 | 216 |
| 452 | 3300005841 | Ga0068863_100014611 | Ga0068863_1000146115 | 216 |
| 453 | 3300005841 | Ga0068863_100020006 | Ga0068863_1000200061 | 216 |
| 454 | 3300005842 | Ga0068858_100006110 | Ga0068858_10000611010 | 216 |
| 455 | 3300005842 | Ga0068858_100025175 | Ga0068858_1000251752 | 216 |
| 456 | 3300005842 | Ga0068858_100136776 | Ga0068858_1001367762 | 216 |
| 457 | 3300005842 | Ga0068858_100154347 | Ga0068858_1001543472 | 216 |
| 458 | 3300005842 | Ga0068858_100189305 | Ga0068858_1001893053 | 216 |
| 459 | 3300005842 | Ga0068858_100212979 | Ga0068858_1002129791 | 216 |
| 460 | 3300005843 | Ga0068860_100022140 | Ga0068860_1000221402 | 216 |
| 461 | 3300005843 | Ga0068860_100052901 | Ga0068860_1000529015 | 216 |
| 462 | 3300005843 | Ga0068860_100335028 | Ga0068860_1003350281 | 216 |
| 463 | 3300005843 | Ga0068860_100606643 | Ga0068860_1006066431 | 216 |
| 464 | 3300005844 | Ga0068862_100494957 | Ga0068862_1004949572 | 216 |
| 465 | 3300005844 | Ga0068862_100509350 | Ga0068862_1005093502 | 216 |
| 466 | 3300005985 | Ga0081539_10001952 | Ga0081539_1000195213 | 216 |
| 467 | 3300006038 | Ga0075365_10002661 | Ga0075365_100026613 | 216 |
| 468 | 3300006042 | Ga0075368_10063046 | Ga0075368_100630461 | 216 |
| 469 | 3300006048 | Ga0075363_100023183 | Ga0075363_1000231833 | 216 |
| 470 | 3300006051 | Ga0075364_10095337 | Ga0075364_100953372 | 216 |
| 471 | 3300006177 | Ga0075362_10004805 | Ga0075362_100048051 | 216 |
| 472 | 3300006195 | Ga0075366_10000427 | Ga0075366_1000042710 | 216 |
| 473 | 3300006237 | Ga0097621_100007454 | Ga0097621_1000074544 | 216 |
| 474 | 3300006237 | Ga0097621_100018877 | Ga0097621_1000188772 | 216 |
| 475 | 3300006237 | Ga0097621_100048746 | Ga0097621_1000487463 | 216 |
| 476 | 3300006237 | Ga0097621_100151866 | Ga0097621_1001518662 | 216 |
| 477 | 3300006358 | Ga0068871_100025056 | Ga0068871_1000250563 | 216 |
| 478 | 3300006358 | Ga0068871_100026431 | Ga0068871_1000264312 | 216 |
| 479 | 3300006358 | Ga0068871_100067749 | Ga0068871_1000677493 | 216 |
| 480 | 3300006358 | Ga0068871_100230618 | Ga0068871_1002306182 | 216 |
| 481 | 3300006358 | Ga0068871_100362930 | Ga0068871_1003629302 | 216 |
| 482 | 3300006844 | Ga0075428_100735482 | Ga0075428_1007354821 | 216 |
| 483 | 3300006846 | Ga0075430_100022222 | Ga0075430_1000222226 | 216 |
| 484 | 3300006846 | Ga0075430_100079771 | Ga0075430_1000797712 | 216 |
| 485 | 3300006847 | Ga0075431_100005275 | Ga0075431_1000052758 | 216 |
| 486 | 3300006847 | Ga0075431_100359854 | Ga0075431_1003598542 | 216 |
| 487 | 3300006852 | Ga0075433_10076042 | Ga0075433_100760423 | 216 |
| 488 | 3300006852 | Ga0075433_10124362 | Ga0075433_101243622 | 216 |
| 489 | 3300006852 | Ga0075433_10403792 | Ga0075433_104037922 | 216 |
| 490 | 3300006852 | Ga0075433_10456029 | Ga0075433_104560291 | 216 |
| 491 | 3300006871 | Ga0075434_100064208 | Ga0075434_1000642083 | 216 |
| 492 | 3300006871 | Ga0075434_100825707 | Ga0075434_1008257072 | 216 |
| 493 | 3300006880 | Ga0075429_100019625 | Ga0075429_1000196253 | 216 |
| 494 | 3300006881 | Ga0068865_100009287 | Ga0068865_1000092873 | 216 |
| 495 | 3300006881 | Ga0068865_100093824 | Ga0068865_1000938242 | 216 |
| 496 | 3300006914 | Ga0075436_100000008 | Ga0075436_100000008193 | 216 |
| 497 | 3300006914 | Ga0075436_100231479 | Ga0075436_1002314792 | 216 |
| 498 | 3300006931 | Ga0097620_100020497 | Ga0097620_1000204972 | 216 |
| 499 | 3300006931 | Ga0097620_100132591 | Ga0097620_1001325912 | 216 |
| 500 | 3300006931 | Ga0097620_100577043 | Ga0097620_1005770432 | 216 |
| 501 | 3300006931 | Ga0097620_100792629 | Ga0097620_1007926292 | 216 |
| 502 | 3300007076 | Ga0075435_100003209 | Ga0075435_1000032094 | 216 |
| 503 | 3300007076 | Ga0075435_100767333 | Ga0075435_1007673331 | 216 |
| 504 | 3300007076 | Ga0075435_100771597 | Ga0075435_1007715971 | 216 |
| 505 | 3300007265 | Ga0099794_10019109 | Ga0099794_100191093 | 216 |
| 506 | 3300009094 | Ga0111539_10005494 | Ga0111539_1000549410 | 216 |
| 507 | 3300009094 | Ga0111539_10005643 | Ga0111539_100056438 | 216 |
| 508 | 3300009094 | Ga0111539_10069661 | Ga0111539_100696612 | 216 |
| 509 | 3300009098 | Ga0105245_10102794 | Ga0105245_101027942 | 216 |
| 510 | 3300009101 | Ga0105247_10256181 | Ga0105247_102561812 | 216 |
| 511 | 3300009147 | Ga0114129_10004820 | Ga0114129_1000482014 | 216 |
| 512 | 3300009147 | Ga0114129_10005760 | Ga0114129_1000576014 | 216 |
| 513 | 3300009147 | Ga0114129_10062300 | Ga0114129_100623001 | 216 |
| 514 | 3300009147 | Ga0114129_10164783 | Ga0114129_101647831 | 216 |
| 515 | 3300009147 | Ga0114129_10240067 | Ga0114129_102400672 | 216 |
| 516 | 3300009147 | Ga0114129_10529184 | Ga0114129_105291842 | 216 |
| 517 | 3300009147 | Ga0114129_10640987 | Ga0114129_106409872 | 216 |
| 518 | 3300009147 | Ga0114129_10979227 | Ga0114129_109792272 | 216 |
| 519 | 3300009147 | Ga0114129_11291785 | Ga0114129_112917851 | 216 |
| 520 | 3300009148 | Ga0105243_10004026 | Ga0105243_100040265 | 216 |
| 521 | 3300009148 | Ga0105243_10047860 | Ga0105243_100478602 | 216 |
| 522 | 3300009148 | Ga0105243_11104124 | Ga0105243_111041242 | 216 |
| 523 | 3300009174 | Ga0105241_10319426 | Ga0105241_103194262 | 216 |
| 524 | 3300009174 | Ga0105241_10816810 | Ga0105241_108168102 | 216 |
| 525 | 3300009176 | Ga0105242_10020767 | Ga0105242_100207671 | 216 |
| 526 | 3300009176 | Ga0105242_10131911 | Ga0105242_101319112 | 216 |
| 527 | 3300009176 | Ga0105242_10157765 | Ga0105242_101577651 | 216 |
| 528 | 3300009177 | Ga0105248_10188270 | Ga0105248_101882703 | 216 |
| 529 | 3300009177 | Ga0105248_10395519 | Ga0105248_103955192 | 216 |
| 530 | 3300009177 | Ga0105248_10837361 | Ga0105248_108373611 | 216 |
| 531 | 3300009551 | Ga0105238_10052242 | Ga0105238_100522422 | 216 |
| 532 | 3300009551 | Ga0105238_10685670 | Ga0105238_106856702 | 216 |
| 533 | 3300009553 | Ga0105249_10011016 | Ga0105249_100110166 | 216 |
| 534 | 3300009553 | Ga0105249_10128143 | Ga0105249_101281433 | 216 |
| 535 | 3300010375 | Ga0105239_10960897 | Ga0105239_109608972 | 216 |
| 536 | 3300010375 | Ga0105239_11095560 | Ga0105239_110955601 | 216 |
| 537 | 3300011119 | Ga0105246_10135165 | Ga0105246_101351652 | 216 |
| 538 | 3300011119 | Ga0105246_10144583 | Ga0105246_101445832 | 216 |
| 539 | 3300013100 | Ga0157373_10027626 | Ga0157373_100276263 | 216 |
| 540 | 3300013100 | Ga0157373_10210312 | Ga0157373_102103121 | 216 |
| 541 | 3300013104 | Ga0157370_10025513 | Ga0157370_100255134 | 216 |
| 542 | 3300013296 | Ga0157374_10032095 | Ga0157374_100320955 | 216 |
| 543 | 3300013296 | Ga0157374_10323474 | Ga0157374_103234742 | 216 |
| 544 | 3300013297 | Ga0157378_10020401 | Ga0157378_100204016 | 216 |
| 545 | 3300013306 | Ga0163162_10178794 | Ga0163162_101787942 | 216 |
| 546 | 3300013306 | Ga0163162_10228647 | Ga0163162_102286472 | 216 |
| 547 | 3300013306 | Ga0163162_10284668 | Ga0163162_102846681 | 216 |
| 548 | 3300013306 | Ga0163162_10291746 | Ga0163162_102917462 | 216 |
| 549 | 3300013307 | Ga0157372_10790836 | Ga0157372_107908361 | 216 |
| 550 | 3300013308 | Ga0157375_10038209 | Ga0157375_100382096 | 216 |
| 551 | 3300013308 | Ga0157375_10062805 | Ga0157375_100628054 | 216 |
| 552 | 3300013308 | Ga0157375_10071960 | Ga0157375_100719601 | 216 |
| 553 | 3300013308 | Ga0157375_10961224 | Ga0157375_109612242 | 216 |
| 554 | 3300013308 | Ga0157375_11476551 | Ga0157375_114765511 | 216 |
| 555 | 3300014325 | Ga0163163_10010076 | Ga0163163_100100765 | 216 |
| 556 | 3300014325 | Ga0163163_10066634 | Ga0163163_100666342 | 216 |
| 557 | 3300014325 | Ga0163163_10142079 | Ga0163163_101420792 | 216 |
| 558 | 3300014325 | Ga0163163_10258765 | Ga0163163_102587652 | 216 |
| 559 | 3300014326 | Ga0157380_10002199 | Ga0157380_100021999 | 216 |
| 560 | 3300014326 | Ga0157380_10034264 | Ga0157380_100342644 | 216 |
| 561 | 3300014326 | Ga0157380_10552006 | Ga0157380_105520061 | 216 |
| 562 | 3300014326 | Ga0157380_10702341 | Ga0157380_107023411 | 216 |
| 563 | 3300014745 | Ga0157377_10038163 | Ga0157377_100381633 | 216 |
| 564 | 3300014968 | Ga0157379_10030757 | Ga0157379_100307573 | 216 |
| 565 | 3300014968 | Ga0157379_10038580 | Ga0157379_100385802 | 216 |
| 566 | 3300014968 | Ga0157379_10388917 | Ga0157379_103889172 | 216 |
| 567 | 3300014969 | Ga0157376_10738313 | Ga0157376_107383131 | 216 |
| 568 | 3300017792 | Ga0163161_10045692 | Ga0163161_100456923 | 216 |
| 569 | 3300017792 | Ga0163161_10130697 | Ga0163161_101306971 | 216 |
| 570 | 3300017792 | Ga0163161_10304968 | Ga0163161_103049682 | 216 |
| 571 | 3300017792 | Ga0163161_10901074 | Ga0163161_109010741 | 216 |
| 572 | 3300022732 | Ga0224569_100350 | Ga0224569_1003502 | 216 |
| 573 | 3300022734 | Ga0224571_101635 | Ga0224571_1016352 | 216 |
| 574 | 3300024225 | Ga0224572_1023860 | Ga0224572_10238602 | 216 |
| 575 | 3300024227 | Ga0228598_1003751 | Ga0228598_10037512 | 216 |
| 576 | 3300025903 | Ga0207680_10082738 | Ga0207680_100827382 | 216 |
| 577 | 3300025904 | Ga0207647_10013201 | Ga0207647_100132015 | 216 |
| 578 | 3300025907 | Ga0207645_10004256 | Ga0207645_1000425610 | 216 |
| 579 | 3300025910 | Ga0207684_10000057 | Ga0207684_1000005726 | 216 |
| 580 | 3300025910 | Ga0207684_10021136 | Ga0207684_100211365 | 216 |
| 581 | 3300025910 | Ga0207684_10051623 | Ga0207684_100516233 | 216 |
| 582 | 3300025911 | Ga0207654_10511450 | Ga0207654_105114502 | 216 |
| 583 | 3300025917 | Ga0207660_10124396 | Ga0207660_101243963 | 216 |
| 584 | 3300025918 | Ga0207662_10007642 | Ga0207662_100076426 | 216 |
| 585 | 3300025918 | Ga0207662_10184242 | Ga0207662_101842422 | 216 |
| 586 | 3300025918 | Ga0207662_10467561 | Ga0207662_104675611 | 216 |
| 587 | 3300025922 | Ga0207646_10038024 | Ga0207646_100380242 | 216 |
| 588 | 3300025922 | Ga0207646_10042592 | Ga0207646_100425922 | 216 |
| 589 | 3300025922 | Ga0207646_10049630 | Ga0207646_100496304 | 216 |
| 590 | 3300025922 | Ga0207646_10155608 | Ga0207646_101556082 | 216 |
| 591 | 3300025925 | Ga0207650_10064202 | Ga0207650_100642022 | 216 |
| 592 | 3300025926 | Ga0207659_10635053 | Ga0207659_106350532 | 216 |
| 593 | 3300025927 | Ga0207687_10559486 | Ga0207687_105594861 | 216 |
| 594 | 3300025928 | Ga0207700_10115830 | Ga0207700_101158302 | 216 |
| 595 | 3300025931 | Ga0207644_10017412 | Ga0207644_100174124 | 216 |
| 596 | 3300025931 | Ga0207644_10022327 | Ga0207644_100223272 | 216 |
| 597 | 3300025932 | Ga0207690_10017206 | Ga0207690_100172064 | 216 |
| 598 | 3300025933 | Ga0207706_10060347 | Ga0207706_100603472 | 216 |
| 599 | 3300025933 | Ga0207706_10576925 | Ga0207706_105769251 | 216 |
| 600 | 3300025934 | Ga0207686_10049596 | Ga0207686_100495963 | 216 |
| 601 | 3300025934 | Ga0207686_10895687 | Ga0207686_108956871 | 216 |
| 602 | 3300025935 | Ga0207709_10075641 | Ga0207709_100756412 | 216 |
| 603 | 3300025935 | Ga0207709_10535775 | Ga0207709_105357751 | 216 |
| 604 | 3300025936 | Ga0207670_10052415 | Ga0207670_100524153 | 216 |
| 605 | 3300025936 | Ga0207670_10227624 | Ga0207670_102276242 | 216 |
| 606 | 3300025936 | Ga0207670_10362893 | Ga0207670_103628932 | 216 |
| 607 | 3300025937 | Ga0207669_10102161 | Ga0207669_101021613 | 216 |
| 608 | 3300025938 | Ga0207704_10041771 | Ga0207704_100417713 | 216 |
| 609 | 3300025938 | Ga0207704_10046427 | Ga0207704_100464271 | 216 |
| 610 | 3300025939 | Ga0207665_10154177 | Ga0207665_101541772 | 216 |
| 611 | 3300025940 | Ga0207691_10001307 | Ga0207691_1000130721 | 216 |
| 612 | 3300025941 | Ga0207711_10088945 | Ga0207711_100889453 | 216 |
| 613 | 3300025941 | Ga0207711_10151551 | Ga0207711_101515513 | 216 |
| 614 | 3300025941 | Ga0207711_11027576 | Ga0207711_110275761 | 216 |
| 615 | 3300025942 | Ga0207689_10005329 | Ga0207689_100053298 | 216 |
| 616 | 3300025942 | Ga0207689_10009754 | Ga0207689_100097544 | 216 |
| 617 | 3300025942 | Ga0207689_10033121 | Ga0207689_100331213 | 216 |
| 618 | 3300025942 | Ga0207689_10455021 | Ga0207689_104550212 | 216 |
| 619 | 3300025945 | Ga0207679_10051176 | Ga0207679_100511763 | 216 |
| 620 | 3300025945 | Ga0207679_10054067 | Ga0207679_100540672 | 216 |
| 621 | 3300025949 | Ga0207667_10359121 | Ga0207667_103591211 | 216 |
| 622 | 3300025960 | Ga0207651_10366833 | Ga0207651_103668332 | 216 |
| 623 | 3300025961 | Ga0207712_10029132 | Ga0207712_100291322 | 216 |
| 624 | 3300025961 | Ga0207712_10171800 | Ga0207712_101718002 | 216 |
| 625 | 3300025961 | Ga0207712_10239228 | Ga0207712_102392282 | 216 |
| 626 | 3300025961 | Ga0207712_10260727 | Ga0207712_102607272 | 216 |
| 627 | 3300025981 | Ga0207640_10069296 | Ga0207640_100692963 | 216 |
| 628 | 3300025981 | Ga0207640_10363142 | Ga0207640_103631421 | 216 |
| 629 | 3300025981 | Ga0207640_10411165 | Ga0207640_104111651 | 216 |
| 630 | 3300025986 | Ga0207658_10017502 | Ga0207658_100175026 | 216 |
| 631 | 3300025986 | Ga0207658_10098578 | Ga0207658_100985782 | 216 |
| 632 | 3300026023 | Ga0207677_10319675 | Ga0207677_103196752 | 216 |
| 633 | 3300026023 | Ga0207677_11119713 | Ga0207677_111197131 | 216 |
| 634 | 3300026035 | Ga0207703_10040759 | Ga0207703_100407593 | 216 |
| 635 | 3300026035 | Ga0207703_10061571 | Ga0207703_100615714 | 216 |
| 636 | 3300026035 | Ga0207703_10092280 | Ga0207703_100922803 | 216 |
| 637 | 3300026035 | Ga0207703_10307158 | Ga0207703_103071581 | 216 |
| 638 | 3300026041 | Ga0207639_10004670 | Ga0207639_100046703 | 216 |
| 639 | 3300026041 | Ga0207639_10588551 | Ga0207639_105885511 | 216 |
| 640 | 3300026067 | Ga0207678_10010423 | Ga0207678_100104234 | 216 |
| 641 | 3300026075 | Ga0207708_10004707 | Ga0207708_100047079 | 216 |
| 642 | 3300026075 | Ga0207708_10023536 | Ga0207708_100235362 | 216 |
| 643 | 3300026075 | Ga0207708_10041173 | Ga0207708_100411732 | 216 |
| 644 | 3300026075 | Ga0207708_10076890 | Ga0207708_100768902 | 216 |
| 645 | 3300026078 | Ga0207702_10191288 | Ga0207702_101912882 | 216 |
| 646 | 3300026088 | Ga0207641_10020923 | Ga0207641_100209236 | 216 |
| 647 | 3300026088 | Ga0207641_10057312 | Ga0207641_100573122 | 216 |
| 648 | 3300026088 | Ga0207641_10186090 | Ga0207641_101860901 | 216 |
| 649 | 3300026088 | Ga0207641_10532315 | Ga0207641_105323152 | 216 |
| 650 | 3300026089 | Ga0207648_10009024 | Ga0207648_100090243 | 216 |
| 651 | 3300026089 | Ga0207648_10046582 | Ga0207648_100465822 | 216 |
| 652 | 3300026095 | Ga0207676_10029661 | Ga0207676_100296612 | 216 |
| 653 | 3300026095 | Ga0207676_10056046 | Ga0207676_100560462 | 216 |
| 654 | 3300026095 | Ga0207676_10381798 | Ga0207676_103817982 | 216 |
| 655 | 3300026116 | Ga0207674_10001093 | Ga0207674_1000109324 | 216 |
| 656 | 3300026116 | Ga0207674_10015666 | Ga0207674_100156663 | 216 |
| 657 | 3300026116 | Ga0207674_10022789 | Ga0207674_100227893 | 216 |
| 658 | 3300026118 | Ga0207675_100031702 | Ga0207675_1000317023 | 216 |
| 659 | 3300026118 | Ga0207675_100071904 | Ga0207675_1000719042 | 216 |
| 660 | 3300026121 | Ga0207683_10031582 | Ga0207683_100315823 | 216 |
| 661 | 3300026142 | Ga0207698_10046034 | Ga0207698_100460343 | 216 |
| 662 | 3300026142 | Ga0207698_10100382 | Ga0207698_101003823 | 216 |
| 663 | 3300027866 | Ga0209813_10030346 | Ga0209813_100303462 | 216 |
| 664 | 3300027907 | Ga0207428_10000741 | Ga0207428_1000074130 | 216 |
| 665 | 3300027907 | Ga0207428_10033144 | Ga0207428_100331442 | 216 |
| 666 | 3300027907 | Ga0207428_10040803 | Ga0207428_100408032 | 216 |
| 667 | 3300028379 | Ga0268266_10529173 | Ga0268266_105291731 | 216 |
| 668 | 3300028381 | Ga0268264_10169320 | Ga0268264_101693201 | 216 |
| 669 | 3300028381 | Ga0268264_10199723 | Ga0268264_101997232 | 216 |
| 670 | 3300028381 | Ga0268264_10235974 | Ga0268264_102359743 | 216 |
| 671 | 3300028381 | Ga0268264_10963484 | Ga0268264_109634841 | 216 |
| 672 | 3300031235 | Ga0265330_10000718 | Ga0265330_1000071811 | 216 |
| 673 | 3300031235 | Ga0265330_10005817 | Ga0265330_100058174 | 216 |
| 674 | 3300031242 | Ga0265329_10015935 | Ga0265329_100159352 | 216 |
| 675 | 3300031344 | Ga0265316_10005360 | Ga0265316_100053608 | 216 |
| 676 | 3300031712 | Ga0265342_10002221 | Ga0265342_100022214 | 216 |
| 677 | 3300031901 | Ga0307406_10012049 | Ga0307406_100120495 | 216 |
| 678 | 3300031901 | Ga0307406_10264427 | Ga0307406_102644271 | 216 |
| 679 | 3300032126 | Ga0307415_100482267 | Ga0307415_1004822671 | 216 |
| 680 | 3300035091 | Ga0373951_0008266 | Ga0373951_0008266_1261_1920 | 216 |
| 681 | 3300035207 | Ga0373942_0006561 | Ga0373942_0006561_1242_1892 | 216 |
| 682 | 3300041509 | Ga0451843_0740440 | Ga0451843_0740440_42_692 | 216 |
| 683 | 3300045051 | Ga0451576_0111661 | Ga0451576_0111661_996_1670 | 216 |
| 684 | 3300045051 | Ga0451576_0561451 | Ga0451576_0561451_500_1165 | 216 |
| 685 | 3300045051 | Ga0451576_0652491 | Ga0451576_0652491_204_857 | 216 |
| 686 | 3300046664 | Ga0495659_0050184 | Ga0495659_0050184_659_1309 | 216 |
| 687 | 3300046684 | Ga0495669_0188112 | Ga0495669_0188112_115_768 | 216 |
| 688 | 3300047322 | Ga0495680_0211301 | Ga0495680_0211301_382_1050 | 216 |
| 689 | 3300048904 | Ga0496101_0054326 | Ga0496101_0054326_1134_1787 | 216 |
| 690 | 3300048905 | Ga0496102_0405637 | Ga0496102_0405637_313_963 | 216 |
| 691 | 3300048907 | Ga0496104_0491804 | Ga0496104_0491804_295_960 | 216 |
| 692 | 3300048915 | Ga0496112_0328598 | Ga0496112_0328598_289_939 | 216 |
| 693 | 3300049588 | Ga0501072_0085433 | Ga0501072_0085433_1419_2081 | 216 |
| 694 | 3300049655 | Ga0501208_048383 | Ga0501208_048383_112_768 | 216 |
| 695 | 3300049665 | Ga0501227_077226 | Ga0501227_077226_52_714 | 216 |
| 696 | 3300049669 | Ga0501235_064804 | Ga0501235_064804_41_703 | 216 |
| 697 | 3300049679 | Ga0501249_070951 | Ga0501249_070951_82_744 | 216 |
| 698 | 3300049683 | Ga0501253_068141 | Ga0501253_068141_77_739 | 216 |
| 699 | 3300049741 | Ga0501079_0249801 | Ga0501079_0249801_226_879 | 216 |
| 700 | 3300049741 | Ga0501079_0312889 | Ga0501079_0312889_214_876 | 216 |
| 701 | 3300049743 | Ga0501081_0440341 | Ga0501081_0440341_123_776 | 216 |
| 702 | 3300049770 | Ga0501273_035228 | Ga0501273_035228_19_681 | 216 |
| 703 | 3300049850 | Ga0501204_030730 | Ga0501204_030730_30_692 | 216 |
| 704 | 3300050489 | nmdc:mga03683_129280_c2 | nmdc:mga03683_129280_c2_34_687 | 216 |
| 705 | 3300050490 | nmdc:mga03n38_180244_c1 | nmdc:mga03n38_180244_c1_21_674 | 216 |
| 706 | 3300050491 | nmdc:mga00v17_26556_c1 | nmdc:mga00v17_26556_c1_1116_1769 | 216 |
| 707 | 3300050492 | nmdc:mga0yw44_33764_c1 | nmdc:mga0yw44_33764_c1_1947_2600 | 216 |
| 708 | 3300050493 | nmdc:mga0k408_218_c1 | nmdc:mga0k408_218_c1_8015_8668 | 216 |
| 709 | 3300050495 | nmdc:mga04h51_42863_c1 | nmdc:mga04h51_42863_c1_85_738 | 216 |
| 710 | 3300050507 | nmdc:mga05p37_1061_c1 | nmdc:mga05p37_1061_c1_2972_3625 | 216 |
| 711 | 3300050507 | nmdc:mga05p37_214153_c1 | nmdc:mga05p37_214153_c1_1388_2041 | 216 |
| 712 | 3300050507 | nmdc:mga05p37_6857_c1 | nmdc:mga05p37_6857_c1_286_966 | 216 |
| 713 | 3300050507 | nmdc:mga05p37_701062_c1 | nmdc:mga05p37_701062_c1_152_814 | 216 |
| 714 | 3300050507 | nmdc:mga05p37_97081_c1 | nmdc:mga05p37_97081_c1_256_909 | 216 |
| 715 | 3300050508 | nmdc:mga09592_17060_c1 | nmdc:mga09592_17060_c1_1518_2171 | 216 |
| 716 | 3300050509 | nmdc:mga0qj67_401647_c1 | nmdc:mga0qj67_401647_c1_290_940 | 216 |
| 717 | 3300050510 | nmdc:mga06r32_188961_c1 | nmdc:mga06r32_188961_c1_567_1217 | 216 |
| 718 | 3300050510 | nmdc:mga06r32_4917_c1 | nmdc:mga06r32_4917_c1_5280_5933 | 216 |
| 719 | 3300050510 | nmdc:mga06r32_685798_c1 | nmdc:mga06r32_685798_c1_328_981 | 216 |
| 720 | 3300050510 | nmdc:mga06r32_981797_c1 | nmdc:mga06r32_981797_c1_69_722 | 216 |
| 721 | 3300050511 | nmdc:mga08y16_20585_c1 | nmdc:mga08y16_20585_c1_4110_4760 | 216 |
| 722 | 3300050511 | nmdc:mga08y16_2339_c1 | nmdc:mga08y16_2339_c1_12447_13100 | 216 |
| 723 | 3300050512 | nmdc:mga0n895_157091_c1 | nmdc:mga0n895_157091_c1_514_1176 | 216 |
| 724 | 3300050512 | nmdc:mga0n895_71041_c1 | nmdc:mga0n895_71041_c1_906_1559 | 216 |
| 725 | 3300050513 | nmdc:mga0rr50_2108_c1 | nmdc:mga0rr50_2108_c1_8895_9572 | 216 |
| 726 | 3300050513 | nmdc:mga0rr50_275096_c1 | nmdc:mga0rr50_275096_c1_646_1299 | 216 |
| 727 | 3300050514 | nmdc:mga08x19_165167_c2 | nmdc:mga08x19_165167_c2_355_1017 | 216 |
| 728 | 3300050514 | nmdc:mga08x19_16_c1 | nmdc:mga08x19_16_c1_194036_194713 | 216 |
| 729 | 3300050515 | nmdc:mga0a205_107910_c1 | nmdc:mga0a205_107910_c1_1109_1765 | 216 |
| 730 | 3300050515 | nmdc:mga0a205_193470_c1 | nmdc:mga0a205_193470_c1_1027_1689 | 216 |
| 731 | 3300050515 | nmdc:mga0a205_368505_c1 | nmdc:mga0a205_368505_c1_111_791 | 216 |
| 732 | 3300050515 | nmdc:mga0a205_84770_c1 | nmdc:mga0a205_84770_c1_1708_2361 | 216 |
| 733 | 3300050516 | nmdc:mga0sz30_76907_c1 | nmdc:mga0sz30_76907_c1_29_682 | 216 |
| 734 | 3300059424 | Ga0590075_013829 | Ga0590075_013829_129_800 | 216 |
| 735 | 3300005331 | Ga0070670_100000264 | Ga0070670_10000026441 | 217 |
| 736 | 3300005467 | Ga0070706_100110660 | Ga0070706_1001106603 | 217 |
| 737 | 3300005468 | Ga0070707_100752982 | Ga0070707_1007529821 | 217 |
| 738 | 3300006881 | Ga0068865_100300764 | Ga0068865_1003007642 | 217 |
| 739 | 3300009011 | Ga0105251_10240377 | Ga0105251_102403772 | 217 |
| 740 | 3300009098 | Ga0105245_11316173 | Ga0105245_113161731 | 217 |
| 741 | 3300009147 | Ga0114129_10229681 | Ga0114129_102296813 | 217 |
| 742 | 3300009148 | Ga0105243_10018027 | Ga0105243_100180274 | 217 |
| 743 | 3300009174 | Ga0105241_10167925 | Ga0105241_101679252 | 217 |
| 744 | 3300009174 | Ga0105241_10534624 | Ga0105241_105346242 | 217 |
| 745 | 3300009176 | Ga0105242_10033815 | Ga0105242_100338154 | 217 |
| 746 | 3300010375 | Ga0105239_10329618 | Ga0105239_103296182 | 217 |
| 747 | 3300013105 | Ga0157369_10035880 | Ga0157369_100358804 | 217 |
| 748 | 3300013297 | Ga0157378_10141442 | Ga0157378_101414423 | 217 |
| 749 | 3300013306 | Ga0163162_10008614 | Ga0163162_100086142 | 217 |
| 750 | 3300013307 | Ga0157372_10010368 | Ga0157372_100103687 | 217 |
| 751 | 3300014969 | Ga0157376_10014317 | Ga0157376_100143174 | 217 |
| 752 | 3300017792 | Ga0163161_10254305 | Ga0163161_102543051 | 217 |
| 753 | 3300025923 | Ga0207681_10043155 | Ga0207681_100431553 | 217 |
| 754 | 3300025934 | Ga0207686_10088898 | Ga0207686_100888983 | 217 |
| 755 | 3300025935 | Ga0207709_10009418 | Ga0207709_100094184 | 217 |
| 756 | 3300026035 | Ga0207703_10051577 | Ga0207703_100515772 | 217 |
| 757 | 3300026075 | Ga0207708_10022757 | Ga0207708_100227572 | 217 |
| 758 | 3300026089 | Ga0207648_10058627 | Ga0207648_100586273 | 217 |
| 759 | 3300046543 | Ga0495645_0336344 | Ga0495645_0336344_107_787 | 217 |
| 760 | 3300048908 | Ga0496105_0054848 | Ga0496105_0054848_1189_1860 | 217 |
| 761 | 3300048915 | Ga0496112_0412945 | Ga0496112_0412945_570_1223 | 217 |
| 762 | 3300050507 | nmdc:mga05p37_383515_c1 | nmdc:mga05p37_383515_c1_141_797 | 217 |
| 763 | 3300053077 | Ga0495601_0007655 | Ga0495601_0007655_3010_3681 | 217 |
| 764 | 3300003203 | JGI25406J46586_10011403 | JGI25406J46586_100114035 | 218 |
| 765 | 3300005289 | Ga0065704_10078408 | Ga0065704_100784082 | 218 |
| 766 | 3300005295 | Ga0065707_10010407 | Ga0065707_100104073 | 218 |
| 767 | 3300005331 | Ga0070670_100270655 | Ga0070670_1002706552 | 218 |
| 768 | 3300005353 | Ga0070669_100426873 | Ga0070669_1004268732 | 218 |
| 769 | 3300005364 | Ga0070673_100016561 | Ga0070673_1000165613 | 218 |
| 770 | 3300005459 | Ga0068867_100122516 | Ga0068867_1001225162 | 218 |
| 771 | 3300005459 | Ga0068867_100239130 | Ga0068867_1002391302 | 218 |
| 772 | 3300005617 | Ga0068859_100514661 | Ga0068859_1005146612 | 218 |
| 773 | 3300005618 | Ga0068864_100226904 | Ga0068864_1002269042 | 218 |
| 774 | 3300005985 | Ga0081539_10001896 | Ga0081539_1000189613 | 218 |
| 775 | 3300006931 | Ga0097620_100514619 | Ga0097620_1005146192 | 218 |
| 776 | 3300006931 | Ga0097620_100632570 | Ga0097620_1006325702 | 218 |
| 777 | 3300009094 | Ga0111539_10056166 | Ga0111539_100561663 | 218 |
| 778 | 3300009176 | Ga0105242_11140144 | Ga0105242_111401441 | 218 |
| 779 | 3300009553 | Ga0105249_10379003 | Ga0105249_103790032 | 218 |
| 780 | 3300010375 | Ga0105239_10302270 | Ga0105239_103022702 | 218 |
| 781 | 3300014325 | Ga0163163_10000278 | Ga0163163_1000027824 | 218 |
| 782 | 3300014325 | Ga0163163_11113694 | Ga0163163_111136941 | 218 |
| 783 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001772 | 218 |
| 784 | 3300025925 | Ga0207650_10348687 | Ga0207650_103486871 | 218 |
| 785 | 3300025925 | Ga0207650_10369766 | Ga0207650_103697661 | 218 |
| 786 | 3300026023 | Ga0207677_10217214 | Ga0207677_102172141 | 218 |
| 787 | 3300026089 | Ga0207648_10140863 | Ga0207648_101408631 | 218 |
| 788 | 3300050511 | nmdc:mga08y16_50331_c1 | nmdc:mga08y16_50331_c1_2240_2896 | 218 |
| 789 | 3300050515 | nmdc:mga0a205_141587_c1 | nmdc:mga0a205_141587_c1_782_1438 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8szz-assembly1.cif.gz_J | cryoem structure of computationally designed nanocage o32-zl4 | 0.9481 | 9 | 214 |
| 1wa3-assembly2.cif.gz_F | mechanism of the class i kdpg aldolase | 0.9472 | 9 | 214 |
| 8e01-assembly1.cif.gz_A | structure of engineered nano-cage fusion protein | 0.9448 | 6 | 214 |
| 8cus-assembly1.cif.gz_B | accurate computational design of genetically encoded 3d protein crystals | 0.944 | 9 | 213 |
| 6xh5-assembly1.cif.gz_A | hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks | 0.9426 | 5 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HW21_144_318_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9534 | 41 | 211 | 3.20.20.70 |
| 1vlwB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9511 | 5 | 215 | 3.20.20.70 |
| af_K7LFS0_36_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9474 | 9 | 218 | 3.20.20.70 |
| 1vlwB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9333 | 5 | 215 | 3.20.20.70 |
| 2v81A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9251 | 17 | 218 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8S183-F1-model_v4 | 2-dehydro-3-deoxyphosphogluconate aldolase | 0.9995 | 3 | 218 |
GO:0016829
|
| AF-A0A2V8GAB8-F1-model_v4 | 2-dehydro-3-deoxyphosphogluconate aldolase | 0.9963 | 3 | 217 |
GO:0016829
|
| AF-A0A2N9L453-F1-model_v4 | 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (EC 4.1.2.14, EC 4.1.3.16) | 0.995 | 9 | 218 |
GO:0000160
GO:0008675 GO:0008700 |
| AF-A0A2V8S183-F1-model_v4 | 2-dehydro-3-deoxyphosphogluconate aldolase | 0.9949 | 3 | 218 |
GO:0016829
|
| AF-A0A3L6JGD4-F1-model_v4 | 2-dehydro-3-deoxyphosphogluconate aldolase | 0.9931 | 4 | 216 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar