F480903

General Info

Members Datasets Scaffolds Average Seq Length
789 271 789 217

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10141442|Ga0157378_101414423
Length 255
Sequence LICAEAQRRLFKSAIGKASLTALRSGKAASFLNLRMTKSEVIQRIRDVGVIPVVRASSADEAIQVVEAIKAGGVSILEITMTVPGAVQVIEQLVRRFGEETVVGAGTVLDPEVANACISVGAQFIVSPALNLETIKFCREQDIPIMPGALTPTEVVTAWNAGADFVKVFPCGAVGGAGYIKSLKAPLPQIELVPTGGVSLKTAASFIEAGAAAIGVGADLVDVKSMLAGQPEKITEAARAYVEAVRSARASAPSA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
128 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
209 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
234 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
240 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
246 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
247 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
266 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
267 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
268 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 1.9
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011403 3300003203 Bacteria 3901
2 rootH2_10325698 3300003320 Bacteria 1675
3 rootL2_10011367 3300003322 Bacteria 3480
4 Ga0065704_10078408 3300005289 Bacteria 4439
5 Ga0065704_10251220 3300005289 Unclassified 989
6 Ga0065712_10000114 3300005290 Bacteria 191810
7 Ga0065712_10240405 3300005290 Unclassified 986
8 Ga0065715_10001576 3300005293 Bacteria 8225
9 Ga0065707_10010407 3300005295 Bacteria 4534
10 Ga0065707_10045450 3300005295 Bacteria 1041
11 Ga0070658_10023453 3300005327 Bacteria 4952
12 Ga0070658_10149186 3300005327 Bacteria 1957
13 Ga0070676_10130464 3300005328 Bacteria 1589
14 Ga0070690_100038517 3300005330 Bacteria 3017
15 Ga0070690_100062165 3300005330 Bacteria 2407
16 Ga0070690_100089827 3300005330 Bacteria 2021
17 Ga0070690_100540588 3300005330 Unclassified 877
18 Ga0070670_100000264 3300005331 Bacteria 46598
19 Ga0070670_100053552 3300005331 Bacteria 3465
20 Ga0070670_100109825 3300005331 Bacteria 2376
21 Ga0070670_100113953 3300005331 Unclassified 2331
22 Ga0070670_100226543 3300005331 Bacteria 1627
23 Ga0070670_100270655 3300005331 Bacteria 1482
24 Ga0070670_100389227 3300005331 Bacteria 1229
25 Ga0070670_100423727 3300005331 Bacteria 1177
26 Ga0068869_100000001 3300005334 Bacteria 178472
27 Ga0068869_100154235 3300005334 Unclassified 1783
28 Ga0068869_100357734 3300005334 Unclassified 1191
29 Ga0068869_100508378 3300005334 Bacteria 1007
30 Ga0070666_10090831 3300005335 Bacteria 2098
31 Ga0070680_100005023 3300005336 Bacteria 9977
32 Ga0070680_100030467 3300005336 Unclassified 4333
33 Ga0070680_100079366 3300005336 Bacteria 2705
34 Ga0070680_100235360 3300005336 Unclassified 1547
35 Ga0070682_100000002 3300005337 Bacteria 506802
36 Ga0070682_100002835 3300005337 Bacteria 9603
37 Ga0070682_100612780 3300005337 Bacteria 861
38 Ga0068868_100013082 3300005338 Bacteria 6075
39 Ga0068868_100049444 3300005338 Bacteria 3300
40 Ga0070689_100003073 3300005340 Bacteria 10995
41 Ga0070689_100004541 3300005340 Bacteria 9399
42 Ga0070689_100252768 3300005340 Bacteria 1455
43 Ga0070687_100165675 3300005343 Bacteria 1311
44 Ga0070661_100004719 3300005344 Bacteria 9377
45 Ga0070661_100592253 3300005344 Unclassified 896
46 Ga0070692_10093070 3300005345 Bacteria 1641
47 Ga0070668_100040266 3300005347 Bacteria 3576
48 Ga0070668_100734450 3300005347 Bacteria 873
49 Ga0070669_100264799 3300005353 Bacteria 1373
50 Ga0070669_100426873 3300005353 Bacteria 1089
51 Ga0070675_100054352 3300005354 Unclassified 3294
52 Ga0070675_100068406 3300005354 Bacteria 2940
53 Ga0070675_100770912 3300005354 Unclassified 878
54 Ga0070671_100011164 3300005355 Bacteria 7213
55 Ga0070671_100033207 3300005355 Bacteria 4267
56 Ga0070674_100142594 3300005356 Bacteria 1800
57 Ga0070674_100196736 3300005356 Unclassified 1554
58 Ga0070673_100016561 3300005364 Bacteria 5217
59 Ga0070673_100034168 3300005364 Bacteria 3845
60 Ga0070673_100071013 3300005364 Bacteria 2796
61 Ga0070673_100119486 3300005364 Bacteria 2196
62 Ga0070688_100019989 3300005365 Bacteria 3887
63 Ga0070659_100003797 3300005366 Bacteria 10780
64 Ga0070667_100423240 3300005367 Unclassified 1214
65 Ga0070703_10000392 3300005406 Bacteria 18342
66 Ga0070714_100008416 3300005435 Bacteria 8054
67 Ga0070714_100052712 3300005435 Unclassified 3470
68 Ga0070714_100091808 3300005435 Bacteria 2661
69 Ga0070713_100008200 3300005436 Bacteria 7400
70 Ga0070713_100157072 3300005436 Unclassified 2028
71 Ga0070713_100191824 3300005436 Bacteria 1841
72 Ga0070713_100267065 3300005436 Bacteria 1566
73 Ga0070710_10234134 3300005437 Bacteria 1174
74 Ga0070710_10391465 3300005437 Bacteria 929
75 Ga0070701_10014508 3300005438 Bacteria 3615
76 Ga0070701_10076264 3300005438 Bacteria 1804
77 Ga0070701_10120410 3300005438 Bacteria 1478
78 Ga0070711_100004787 3300005439 Bacteria 8023
79 Ga0070705_100069280 3300005440 Bacteria 2126
80 Ga0070705_100236999 3300005440 Bacteria 1273
81 Ga0070705_100723294 3300005440 Bacteria 784
82 Ga0070700_100000027 3300005441 Bacteria 123461
83 Ga0070700_100015179 3300005441 Bacteria 4363
84 Ga0070700_100028724 3300005441 Bacteria 3311
85 Ga0070700_100059524 3300005441 Bacteria 2405
86 Ga0070700_100120641 3300005441 Bacteria 1756
87 Ga0070700_100127197 3300005441 Bacteria 1715
88 Ga0070694_100002750 3300005444 Bacteria 10431
89 Ga0070694_100003143 3300005444 Bacteria 9834
90 Ga0070694_100061641 3300005444 Bacteria 2560
91 Ga0070694_100101996 3300005444 Bacteria 2031
92 Ga0070708_100001978 3300005445 Bacteria 15790
93 Ga0070708_100004377 3300005445 Bacteria 11094
94 Ga0070708_100068799 3300005445 Bacteria 3183
95 Ga0070708_100188335 3300005445 Unclassified 1930
96 Ga0070678_100096376 3300005456 Unclassified 2282
97 Ga0070662_100175327 3300005457 Bacteria 1686
98 Ga0070662_100461672 3300005457 Bacteria 1055
99 Ga0070662_100737493 3300005457 Bacteria 835
100 Ga0070681_10000791 3300005458 Bacteria 26380
101 Ga0070681_10009950 3300005458 Bacteria 9373
102 Ga0070681_10018035 3300005458 Bacteria 7052
103 Ga0070681_10122078 3300005458 Bacteria 2539
104 Ga0070681_10361792 3300005458 Bacteria 1361
105 Ga0070681_10612898 3300005458 Bacteria 1003
106 Ga0068867_100008304 3300005459 Bacteria 7330
107 Ga0068867_100118650 3300005459 Bacteria 2041
108 Ga0068867_100122516 3300005459 Bacteria 2011
109 Ga0068867_100239130 3300005459 Unclassified 1472
110 Ga0068867_100465427 3300005459 Bacteria 1080
111 Ga0070685_10033721 3300005466 Bacteria 2879
112 Ga0070685_10063610 3300005466 Bacteria 2167
113 Ga0070706_100000129 3300005467 Bacteria 92941
114 Ga0070706_100008753 3300005467 Bacteria 9428
115 Ga0070706_100026984 3300005467 Bacteria 5284
116 Ga0070706_100028708 3300005467 Bacteria 5122
117 Ga0070706_100078235 3300005467 Bacteria 3062
118 Ga0070706_100110660 3300005467 Bacteria 2556
119 Ga0070706_100151310 3300005467 Unclassified 2166
120 Ga0070706_100490606 3300005467 Bacteria 1143
121 Ga0070707_100011309 3300005468 Bacteria 8320
122 Ga0070707_100096183 3300005468 Bacteria 2868
123 Ga0070707_100139001 3300005468 Bacteria 2363
124 Ga0070707_100157947 3300005468 Bacteria 2209
125 Ga0070707_100283310 3300005468 Bacteria 1610
126 Ga0070707_100419197 3300005468 Bacteria 1299
127 Ga0070707_100447618 3300005468 Bacteria 1252
128 Ga0070707_100752982 3300005468 Bacteria 937
129 Ga0070698_100006886 3300005471 Bacteria 12316
130 Ga0070698_100010012 3300005471 Bacteria 10130
131 Ga0070698_100107442 3300005471 Bacteria 2758
132 Ga0070698_100148389 3300005471 Bacteria 2294
133 Ga0070698_100184133 3300005471 Bacteria 2026
134 Ga0070698_100615783 3300005471 Bacteria 1026
135 Ga0070699_100000979 3300005518 Bacteria 26634
136 Ga0070699_100001846 3300005518 Bacteria 19241
137 Ga0070699_100022040 3300005518 Bacteria 5487
138 Ga0070699_100030454 3300005518 Bacteria 4658
139 Ga0070699_100053200 3300005518 Bacteria 3504
140 Ga0070699_100108776 3300005518 Bacteria 2433
141 Ga0070699_100168707 3300005518 Bacteria 1939
142 Ga0070699_100199303 3300005518 Unclassified 1780
143 Ga0070699_100379042 3300005518 Unclassified 1277
144 Ga0070699_100383571 3300005518 Bacteria 1269
145 Ga0070679_100000011 3300005530 Bacteria 162902
146 Ga0070679_100223606 3300005530 Bacteria 1843
147 Ga0070679_100577555 3300005530 Unclassified 1068
148 Ga0070697_100009407 3300005536 Bacteria 7641
149 Ga0070697_100039023 3300005536 Bacteria 3839
150 Ga0070697_100039489 3300005536 Bacteria 3816
151 Ga0070697_100057775 3300005536 Bacteria 3157
152 Ga0070697_100068955 3300005536 Bacteria 2896
153 Ga0070697_100196904 3300005536 Bacteria 1712
154 Ga0070697_100288672 3300005536 Bacteria 1409
155 Ga0070697_100470318 3300005536 Bacteria 1097
156 Ga0070697_100539968 3300005536 Unclassified 1022
157 Ga0068853_100017320 3300005539 Bacteria 5948
158 Ga0068853_100023643 3300005539 Bacteria 5148
159 Ga0068853_100055159 3300005539 Unclassified 3425
160 Ga0068853_100125452 3300005539 Bacteria 2293
161 Ga0068853_100132996 3300005539 Bacteria 2228
162 Ga0070672_100050161 3300005543 Bacteria 3250
163 Ga0070672_100081496 3300005543 Bacteria 2594
164 Ga0070672_100798876 3300005543 Bacteria 830
165 Ga0070686_100019640 3300005544 Bacteria 3985
166 Ga0070686_100279880 3300005544 Bacteria 1230
167 Ga0070686_100455250 3300005544 Bacteria 985
168 Ga0070686_100583739 3300005544 Bacteria 878
169 Ga0070695_100054996 3300005545 Bacteria 2564
170 Ga0070695_100072735 3300005545 Bacteria 2255
171 Ga0070695_100138335 3300005545 Bacteria 1685
172 Ga0070695_100281664 3300005545 Unclassified 1222
173 Ga0070695_100303974 3300005545 Bacteria 1180
174 Ga0070695_100649500 3300005545 Bacteria 833
175 Ga0070695_100653064 3300005545 Bacteria 831
176 Ga0070696_100013512 3300005546 Bacteria 5478
177 Ga0070696_100031906 3300005546 Bacteria 3612
178 Ga0070696_100036934 3300005546 Bacteria 3370
179 Ga0070696_100043490 3300005546 Bacteria 3107
180 Ga0070696_100184107 3300005546 Unclassified 1551
181 Ga0070693_100106888 3300005547 Bacteria 1714
182 Ga0070693_100620092 3300005547 Unclassified 783
183 Ga0070665_100154435 3300005548 Bacteria 2297
184 Ga0070704_100007658 3300005549 Bacteria 6439
185 Ga0070704_100134628 3300005549 Unclassified 1921
186 Ga0070704_100264128 3300005549 Bacteria 1419
187 Ga0068855_100127808 3300005563 Bacteria 2905
188 Ga0068855_100130143 3300005563 Bacteria 2875
189 Ga0068855_100221933 3300005563 Bacteria 2119
190 Ga0068855_100241278 3300005563 Bacteria 2019
191 Ga0068855_100281478 3300005563 Bacteria 1847
192 Ga0068855_100857139 3300005563 Bacteria 962
193 Ga0070664_100015833 3300005564 Bacteria 6172
194 Ga0070664_100085079 3300005564 Bacteria 2731
195 Ga0068857_100005264 3300005577 Bacteria 11015
196 Ga0068857_100093228 3300005577 Bacteria 2697
197 Ga0068857_100272038 3300005577 Bacteria 1557
198 Ga0068857_100727611 3300005577 Bacteria 944
199 Ga0068854_100435634 3300005578 Bacteria 1092
200 Ga0068854_100896705 3300005578 Bacteria 779
201 Ga0068856_100250256 3300005614 Unclassified 1787
202 Ga0068856_100361662 3300005614 Unclassified 1470
203 Ga0068856_100888739 3300005614 Bacteria 910
204 Ga0070702_100004548 3300005615 Bacteria 6346
205 Ga0070702_100080861 3300005615 Unclassified 1946
206 Ga0070702_100082728 3300005615 Bacteria 1927
207 Ga0070702_100115467 3300005615 Bacteria 1672
208 Ga0068852_100025194 3300005616 Bacteria 4816
209 Ga0068852_100026870 3300005616 Bacteria 4685
210 Ga0068852_100041713 3300005616 Bacteria 3880
211 Ga0068859_100020497 3300005617 Bacteria 6635
212 Ga0068859_100068685 3300005617 Bacteria 3578
213 Ga0068859_100132596 3300005617 Bacteria 2563
214 Ga0068859_100514661 3300005617 Bacteria 1292
215 Ga0068859_100577059 3300005617 Bacteria 1218
216 Ga0068859_100792666 3300005617 Bacteria 1035
217 Ga0068859_100906902 3300005617 Unclassified 966
218 Ga0068864_100020048 3300005618 Bacteria 5591
219 Ga0068864_100025552 3300005618 Bacteria 4976
220 Ga0068864_100074372 3300005618 Bacteria 2964
221 Ga0068864_100076583 3300005618 Unclassified 2923
222 Ga0068864_100099264 3300005618 Bacteria 2579
223 Ga0068864_100135307 3300005618 Bacteria 2218
224 Ga0068864_100169772 3300005618 Bacteria 1988
225 Ga0068864_100226904 3300005618 Unclassified 1726
226 Ga0068864_100328728 3300005618 Unclassified 1438
227 Ga0068864_101070097 3300005618 Unclassified 802
228 Ga0068866_10137849 3300005718 Bacteria 1397
229 Ga0068861_100065983 3300005719 Bacteria 2789
230 Ga0068863_100014611 3300005841 Bacteria 7559
231 Ga0068863_100020006 3300005841 Bacteria 6402
232 Ga0068863_100043030 3300005841 Bacteria 4288
233 Ga0068863_100440468 3300005841 Bacteria 1278
234 Ga0068858_100006110 3300005842 Bacteria 11748
235 Ga0068858_100025175 3300005842 Bacteria 5537
236 Ga0068858_100076009 3300005842 Bacteria 3120
237 Ga0068858_100136776 3300005842 Bacteria 2299
238 Ga0068858_100154347 3300005842 Bacteria 2160
239 Ga0068858_100189305 3300005842 Bacteria 1944
240 Ga0068858_100212979 3300005842 Bacteria 1828
241 Ga0068858_100229701 3300005842 Bacteria 1759
242 Ga0068860_100022140 3300005843 Bacteria 6152
243 Ga0068860_100052901 3300005843 Bacteria 3862
244 Ga0068860_100335028 3300005843 Bacteria 1487
245 Ga0068860_100606643 3300005843 Unclassified 1100
246 Ga0068860_100789113 3300005843 Unclassified 963
247 Ga0068862_100494957 3300005844 Unclassified 1159
248 Ga0068862_100509350 3300005844 Bacteria 1144
249 Ga0081539_10001896 3300005985 Bacteria 32432
250 Ga0081539_10001952 3300005985 Bacteria 31511
251 Ga0081539_10205372 3300005985 Unclassified 906
252 Ga0070717_10024632 3300006028 Bacteria 4781
253 Ga0070717_10309099 3300006028 Bacteria 1406
254 Ga0070717_10527975 3300006028 Bacteria 1068
255 Ga0075365_10002661 3300006038 Bacteria 8870
256 Ga0075368_10063046 3300006042 Bacteria 1486
257 Ga0075363_100023183 3300006048 Bacteria 3143
258 Ga0075364_10095337 3300006051 Unclassified 1978
259 Ga0070716_100000005 3300006173 Bacteria 273485
260 Ga0070712_100004891 3300006175 Bacteria 8286
261 Ga0075362_10004805 3300006177 Bacteria 4881
262 Ga0075366_10000427 3300006195 Bacteria 19720
263 Ga0097621_100007454 3300006237 Bacteria 7826
264 Ga0097621_100018877 3300006237 Bacteria 5280
265 Ga0097621_100048746 3300006237 Bacteria 3438
266 Ga0097621_100151866 3300006237 Bacteria 1986
267 Ga0068871_100025056 3300006358 Bacteria 4636
268 Ga0068871_100026431 3300006358 Bacteria 4529
269 Ga0068871_100067749 3300006358 Bacteria 2930
270 Ga0068871_100230618 3300006358 Bacteria 1607
271 Ga0068871_100362930 3300006358 Bacteria 1283
272 Ga0075428_100735482 3300006844 Bacteria 1050
273 Ga0075430_100022222 3300006846 Bacteria 5394
274 Ga0075430_100079771 3300006846 Bacteria 2742
275 Ga0075431_100005275 3300006847 Bacteria 12734
276 Ga0075431_100359854 3300006847 Bacteria 1462
277 Ga0075433_10035713 3300006852 Bacteria 4278
278 Ga0075433_10064292 3300006852 Bacteria 3216
279 Ga0075433_10076042 3300006852 Bacteria 2956
280 Ga0075433_10124362 3300006852 Bacteria 2291
281 Ga0075433_10173952 3300006852 Bacteria 1916
282 Ga0075433_10235496 3300006852 Bacteria 1625
283 Ga0075433_10275070 3300006852 Bacteria 1492
284 Ga0075433_10403792 3300006852 Bacteria 1205
285 Ga0075433_10456029 3300006852 Bacteria 1127
286 Ga0075433_11049434 3300006852 Unclassified 709
287 Ga0075434_100064208 3300006871 Bacteria 3655
288 Ga0075434_100131818 3300006871 Bacteria 2519
289 Ga0075434_100825707 3300006871 Bacteria 943
290 Ga0075429_100019625 3300006880 Bacteria 5860
291 Ga0068865_100009287 3300006881 Bacteria 6092
292 Ga0068865_100093824 3300006881 Bacteria 2183
293 Ga0068865_100300764 3300006881 Bacteria 1284
294 Ga0068865_100412894 3300006881 Unclassified 1108
295 Ga0075436_100000008 3300006914 Bacteria 279288
296 Ga0075436_100231479 3300006914 Archaea 1313
297 Ga0097620_100020497 3300006931 Bacteria 6635
298 Ga0097620_100068687 3300006931 Bacteria 3578
299 Ga0097620_100132591 3300006931 Bacteria 2563
300 Ga0097620_100514619 3300006931 Bacteria 1292
301 Ga0097620_100577043 3300006931 Bacteria 1218
302 Ga0097620_100632570 3300006931 Unclassified 1162
303 Ga0097620_100792629 3300006931 Bacteria 1035
304 Ga0097620_100906706 3300006931 Unclassified 966
305 Ga0075435_100003209 3300007076 Bacteria 11071
306 Ga0075435_100137228 3300007076 Bacteria 2050
307 Ga0075435_100185526 3300007076 Unclassified 1759
308 Ga0075435_100767333 3300007076 Bacteria 839
309 Ga0075435_100771597 3300007076 Unclassified 837
310 Ga0099794_10019109 3300007265 Bacteria 3082
311 Ga0105251_10240377 3300009011 Bacteria 816
312 Ga0105250_10094258 3300009092 Bacteria 1220
313 Ga0105240_10370051 3300009093 Bacteria 1621
314 Ga0111539_10005494 3300009094 Bacteria 16398
315 Ga0111539_10005643 3300009094 Bacteria 16183
316 Ga0111539_10056166 3300009094 Bacteria 4680
317 Ga0111539_10069661 3300009094 Bacteria 4153
318 Ga0111539_10278956 3300009094 Bacteria 1945
319 Ga0105245_10102794 3300009098 Bacteria 2646
320 Ga0105245_11316173 3300009098 Bacteria 772
321 Ga0105247_10256181 3300009101 Bacteria 1198
322 Ga0114129_10004820 3300009147 Bacteria 19070
323 Ga0114129_10005760 3300009147 Bacteria 17559
324 Ga0114129_10048089 3300009147 Bacteria 5993
325 Ga0114129_10062300 3300009147 Bacteria 5211
326 Ga0114129_10089354 3300009147 Unclassified 4270
327 Ga0114129_10164783 3300009147 Bacteria 3026
328 Ga0114129_10229681 3300009147 Bacteria 2500
329 Ga0114129_10240067 3300009147 Bacteria 2436
330 Ga0114129_10255568 3300009147 Unclassified 2350
331 Ga0114129_10529184 3300009147 Bacteria 1536
332 Ga0114129_10640987 3300009147 Bacteria 1372
333 Ga0114129_10979227 3300009147 Bacteria 1066
334 Ga0114129_11291785 3300009147 Unclassified 905
335 Ga0114129_11412619 3300009147 Bacteria 858
336 Ga0105243_10000715 3300009148 Bacteria 31978
337 Ga0105243_10004026 3300009148 Bacteria 11701
338 Ga0105243_10018027 3300009148 Bacteria 5342
339 Ga0105243_10047860 3300009148 Bacteria 3369
340 Ga0105243_10193402 3300009148 Bacteria 1778
341 Ga0105243_10319858 3300009148 Unclassified 1413
342 Ga0105243_10522653 3300009148 Bacteria 1129
343 Ga0105243_11104124 3300009148 Unclassified 802
344 Ga0105241_10167925 3300009174 Bacteria 1810
345 Ga0105241_10263602 3300009174 Bacteria 1465
346 Ga0105241_10319426 3300009174 Bacteria 1338
347 Ga0105241_10534624 3300009174 Bacteria 1050
348 Ga0105241_10567921 3300009174 Bacteria 1021
349 Ga0105241_10816810 3300009174 Unclassified 860
350 Ga0105242_10002445 3300009176 Bacteria 14580
351 Ga0105242_10005773 3300009176 Bacteria 9536
352 Ga0105242_10020767 3300009176 Bacteria 5151
353 Ga0105242_10033576 3300009176 Bacteria 4109
354 Ga0105242_10033815 3300009176 Bacteria 4096
355 Ga0105242_10131911 3300009176 Bacteria 2158
356 Ga0105242_10157765 3300009176 Bacteria 1983
357 Ga0105242_10930101 3300009176 Unclassified 872
358 Ga0105242_11140144 3300009176 Unclassified 796
359 Ga0105248_10112779 3300009177 Bacteria 3066
360 Ga0105248_10188270 3300009177 Bacteria 2325
361 Ga0105248_10395519 3300009177 Bacteria 1556
362 Ga0105248_10443527 3300009177 Bacteria 1462
363 Ga0105248_10478710 3300009177 Bacteria 1403
364 Ga0105248_10527639 3300009177 Bacteria 1331
365 Ga0105248_10837361 3300009177 Unclassified 1038
366 Ga0105248_10978693 3300009177 Unclassified 956
367 Ga0105237_10076977 3300009545 Bacteria 3326
368 Ga0105237_10206969 3300009545 Bacteria 1962
369 Ga0105238_10020332 3300009551 Bacteria 6758
370 Ga0105238_10021791 3300009551 Bacteria 6527
371 Ga0105238_10052242 3300009551 Bacteria 4108
372 Ga0105238_10270363 3300009551 Bacteria 1680
373 Ga0105238_10685670 3300009551 Bacteria 1036
374 Ga0105238_11050456 3300009551 Unclassified 836
375 Ga0105249_10011016 3300009553 Bacteria 7944
376 Ga0105249_10128143 3300009553 Bacteria 2419
377 Ga0105249_10379003 3300009553 Bacteria 1440
378 Ga0105249_11068907 3300009553 Bacteria 877
379 Ga0105239_10019333 3300010375 Bacteria 7522
380 Ga0105239_10302270 3300010375 Bacteria 1802
381 Ga0105239_10329618 3300010375 Bacteria 1722
382 Ga0105239_10443852 3300010375 Bacteria 1471
383 Ga0105239_10960897 3300010375 Unclassified 982
384 Ga0105239_11095560 3300010375 Bacteria 917
385 Ga0105246_10135165 3300011119 Bacteria 1847
386 Ga0105246_10144583 3300011119 Bacteria 1793
387 Ga0157373_10027626 3300013100 Unclassified 4094
388 Ga0157373_10210312 3300013100 Bacteria 1372
389 Ga0157373_10376757 3300013100 Bacteria 1015
390 Ga0157373_10640263 3300013100 Unclassified 776
391 Ga0157370_10004929 3300013104 Bacteria 15107
392 Ga0157370_10025513 3300013104 Bacteria 5851
393 Ga0157370_10034070 3300013104 Bacteria 4962
394 Ga0157370_10052651 3300013104 Bacteria 3886
395 Ga0157370_10397991 3300013104 Bacteria 1268
396 Ga0157369_10007108 3300013105 Bacteria 12909
397 Ga0157369_10026429 3300013105 Bacteria 6438
398 Ga0157369_10035880 3300013105 Bacteria 5435
399 Ga0157374_10032095 3300013296 Bacteria 4779
400 Ga0157374_10323474 3300013296 Bacteria 1529
401 Ga0157374_11036211 3300013296 Unclassified 840
402 Ga0157378_10000001 3300013297 Bacteria 352632
403 Ga0157378_10020401 3300013297 Bacteria 5829
404 Ga0157378_10141442 3300013297 Bacteria 2235
405 Ga0157378_10150159 3300013297 Bacteria 2170
406 Ga0157378_10185876 3300013297 Bacteria 1957
407 Ga0157378_10667034 3300013297 Bacteria 1057
408 Ga0163162_10003094 3300013306 Bacteria 15891
409 Ga0163162_10008614 3300013306 Bacteria 9941
410 Ga0163162_10178794 3300013306 Bacteria 2247
411 Ga0163162_10228647 3300013306 Bacteria 1990
412 Ga0163162_10284668 3300013306 Bacteria 1785
413 Ga0163162_10291746 3300013306 Bacteria 1763
414 Ga0163162_10366001 3300013306 Bacteria 1575
415 Ga0157372_10010368 3300013307 Bacteria 9907
416 Ga0157372_10031617 3300013307 Bacteria 5795
417 Ga0157372_10314764 3300013307 Bacteria 1822
418 Ga0157372_10620012 3300013307 Bacteria 1261
419 Ga0157372_10790836 3300013307 Unclassified 1102
420 Ga0157375_10038209 3300013308 Bacteria 4608
421 Ga0157375_10062805 3300013308 Bacteria 3692
422 Ga0157375_10071960 3300013308 Bacteria 3472
423 Ga0157375_10195369 3300013308 Bacteria 2178
424 Ga0157375_10961224 3300013308 Unclassified 995
425 Ga0157375_11476551 3300013308 Unclassified 802
426 Ga0163163_10000278 3300014325 Bacteria 51079
427 Ga0163163_10010076 3300014325 Bacteria 8478
428 Ga0163163_10033041 3300014325 Bacteria 5002
429 Ga0163163_10066634 3300014325 Bacteria 3577
430 Ga0163163_10142079 3300014325 Bacteria 2443
431 Ga0163163_10258765 3300014325 Bacteria 1791
432 Ga0163163_11113694 3300014325 Bacteria 852
433 Ga0157380_10002199 3300014326 Bacteria 13104
434 Ga0157380_10034264 3300014326 Bacteria 3915
435 Ga0157380_10552006 3300014326 Bacteria 1130
436 Ga0157380_10702341 3300014326 Unclassified 1016
437 Ga0157377_10038163 3300014745 Bacteria 2651
438 Ga0157377_10158351 3300014745 Bacteria 1406
439 Ga0157377_10283253 3300014745 Bacteria 1087
440 Ga0157379_10030757 3300014968 Bacteria 4781
441 Ga0157379_10038580 3300014968 Bacteria 4262
442 Ga0157379_10388917 3300014968 Bacteria 1281
443 Ga0157376_10014317 3300014969 Bacteria 5949
444 Ga0157376_10738313 3300014969 Unclassified 993
445 Ga0163161_10045692 3300017792 Bacteria 3159
446 Ga0163161_10130697 3300017792 Bacteria 1894
447 Ga0163161_10254305 3300017792 Bacteria 1370
448 Ga0163161_10304968 3300017792 Unclassified 1255
449 Ga0163161_10901074 3300017792 Unclassified 749
450 Ga0224569_100350 3300022732 Unclassified 3884
451 Ga0224571_101635 3300022734 Unclassified 1407
452 Ga0224572_1023860 3300024225 Unclassified 1175
453 Ga0228598_1003751 3300024227 Unclassified 3246
454 Ga0207426_1071081 3300025302 Bacteria 971
455 Ga0207653_10000197 3300025885 Bacteria 41065
456 Ga0207692_10341673 3300025898 Bacteria 921
457 Ga0207680_10082738 3300025903 Bacteria 2021
458 Ga0207647_10013201 3300025904 Bacteria 5736
459 Ga0207647_10087790 3300025904 Bacteria 1857
460 Ga0207645_10004256 3300025907 Bacteria 10628
461 Ga0207684_10000057 3300025910 Bacteria 211445
462 Ga0207684_10021136 3300025910 Bacteria 5556
463 Ga0207684_10043668 3300025910 Bacteria 3801
464 Ga0207684_10047943 3300025910 Bacteria 3623
465 Ga0207684_10051623 3300025910 Bacteria 3489
466 Ga0207654_10277041 3300025911 Unclassified 1133
467 Ga0207654_10511450 3300025911 Unclassified 849
468 Ga0207707_10000007 3300025912 Bacteria 368555
469 Ga0207707_10441319 3300025912 Bacteria 1114
470 Ga0207695_10019908 3300025913 Bacteria 7711
471 Ga0207663_10004236 3300025916 Bacteria 7115
472 Ga0207660_10021570 3300025917 Unclassified 4333
473 Ga0207660_10124396 3300025917 Bacteria 1957
474 Ga0207660_10292346 3300025917 Unclassified 1296
475 Ga0207662_10007642 3300025918 Bacteria 5892
476 Ga0207662_10184242 3300025918 Bacteria 1345
477 Ga0207662_10467561 3300025918 Unclassified 864
478 Ga0207657_10017784 3300025919 Bacteria 6806
479 Ga0207657_10126263 3300025919 Bacteria 2101
480 Ga0207652_10000102 3300025921 Bacteria 92144
481 Ga0207652_10189742 3300025921 Bacteria 1849
482 Ga0207652_10478297 3300025921 Bacteria 1122
483 Ga0207646_10021862 3300025922 Bacteria 5903
484 Ga0207646_10038024 3300025922 Bacteria 4337
485 Ga0207646_10042592 3300025922 Bacteria 4078
486 Ga0207646_10049630 3300025922 Bacteria 3758
487 Ga0207646_10155608 3300025922 Bacteria 2062
488 Ga0207646_10303916 3300025922 Bacteria 1441
489 Ga0207646_10332846 3300025922 Bacteria 1372
490 Ga0207646_10444555 3300025922 Bacteria 1170
491 Ga0207681_10043155 3300025923 Unclassified 3017
492 Ga0207694_10013013 3300025924 Bacteria 6264
493 Ga0207694_10073229 3300025924 Bacteria 2679
494 Ga0207694_10148836 3300025924 Bacteria 1885
495 Ga0207694_10232467 3300025924 Bacteria 1506
496 Ga0207650_10000001 3300025925 Bacteria 1545726
497 Ga0207650_10064202 3300025925 Bacteria 2748
498 Ga0207650_10320788 3300025925 Bacteria 1269
499 Ga0207650_10348687 3300025925 Unclassified 1217
500 Ga0207650_10369766 3300025925 Bacteria 1183
501 Ga0207659_10635053 3300025926 Unclassified 912
502 Ga0207687_10559486 3300025927 Bacteria 960
503 Ga0207700_10009013 3300025928 Bacteria 6211
504 Ga0207700_10115830 3300025928 Bacteria 2165
505 Ga0207700_10180148 3300025928 Unclassified 1769
506 Ga0207700_10197555 3300025928 Bacteria 1693
507 Ga0207664_10119045 3300025929 Bacteria 2207
508 Ga0207664_10350501 3300025929 Bacteria 1306
509 Ga0207664_10576559 3300025929 Bacteria 1010
510 Ga0207644_10017412 3300025931 Bacteria 4851
511 Ga0207644_10022327 3300025931 Bacteria 4323
512 Ga0207690_10017206 3300025932 Unclassified 4411
513 Ga0207706_10060347 3300025933 Bacteria 3340
514 Ga0207706_10576925 3300025933 Bacteria 967
515 Ga0207686_10001008 3300025934 Bacteria 16707
516 Ga0207686_10049596 3300025934 Bacteria 2606
517 Ga0207686_10088898 3300025934 Bacteria 2035
518 Ga0207686_10099865 3300025934 Bacteria 1935
519 Ga0207686_10895687 3300025934 Unclassified 716
520 Ga0207709_10000301 3300025935 Bacteria 54207
521 Ga0207709_10009418 3300025935 Bacteria 5373
522 Ga0207709_10075641 3300025935 Bacteria 2153
523 Ga0207709_10169307 3300025935 Bacteria 1531
524 Ga0207709_10346569 3300025935 Bacteria 1120
525 Ga0207709_10535775 3300025935 Unclassified 919
526 Ga0207670_10005234 3300025936 Bacteria 7101
527 Ga0207670_10052415 3300025936 Bacteria 2743
528 Ga0207670_10227624 3300025936 Unclassified 1430
529 Ga0207670_10362893 3300025936 Bacteria 1150
530 Ga0207670_10480162 3300025936 Unclassified 1006
531 Ga0207669_10102161 3300025937 Unclassified 1898
532 Ga0207704_10041771 3300025938 Bacteria 2693
533 Ga0207704_10046427 3300025938 Unclassified 2589
534 Ga0207665_10000012 3300025939 Bacteria 143062
535 Ga0207665_10154177 3300025939 Bacteria 1648
536 Ga0207691_10001307 3300025940 Bacteria 24842
537 Ga0207711_10088945 3300025941 Bacteria 2712
538 Ga0207711_10093478 3300025941 Bacteria 2649
539 Ga0207711_10151551 3300025941 Bacteria 2092
540 Ga0207711_10498484 3300025941 Bacteria 1135
541 Ga0207711_11027576 3300025941 Bacteria 764
542 Ga0207689_10005329 3300025942 Bacteria 11529
543 Ga0207689_10009754 3300025942 Bacteria 8272
544 Ga0207689_10012945 3300025942 Bacteria 7123
545 Ga0207689_10033121 3300025942 Bacteria 4294
546 Ga0207689_10157628 3300025942 Bacteria 1871
547 Ga0207689_10455021 3300025942 Unclassified 1070
548 Ga0207679_10051176 3300025945 Bacteria 3023
549 Ga0207679_10054067 3300025945 Bacteria 2954
550 Ga0207679_10619032 3300025945 Bacteria 977
551 Ga0207679_10787033 3300025945 Unclassified 867
552 Ga0207667_10162489 3300025949 Bacteria 2297
553 Ga0207667_10253992 3300025949 Bacteria 1798
554 Ga0207667_10321950 3300025949 Bacteria 1579
555 Ga0207667_10348020 3300025949 Unclassified 1512
556 Ga0207667_10359121 3300025949 Bacteria 1486
557 Ga0207651_10009988 3300025960 Bacteria 5232
558 Ga0207651_10158061 3300025960 Bacteria 1773
559 Ga0207651_10366833 3300025960 Bacteria 1217
560 Ga0207712_10029132 3300025961 Bacteria 3700
561 Ga0207712_10048561 3300025961 Bacteria 2953
562 Ga0207712_10171800 3300025961 Bacteria 1695
563 Ga0207712_10239228 3300025961 Bacteria 1461
564 Ga0207712_10260727 3300025961 Bacteria 1406
565 Ga0207640_10050703 3300025981 Bacteria 2695
566 Ga0207640_10069296 3300025981 Unclassified 2368
567 Ga0207640_10363142 3300025981 Bacteria 1167
568 Ga0207640_10411165 3300025981 Unclassified 1104
569 Ga0207640_10970279 3300025981 Bacteria 746
570 Ga0207658_10017502 3300025986 Bacteria 4940
571 Ga0207658_10098578 3300025986 Bacteria 2284
572 Ga0207677_10217214 3300026023 Bacteria 1531
573 Ga0207677_10319675 3300026023 Unclassified 1289
574 Ga0207677_11119713 3300026023 Bacteria 718
575 Ga0207703_10040759 3300026035 Bacteria 3718
576 Ga0207703_10051577 3300026035 Unclassified 3335
577 Ga0207703_10061571 3300026035 Bacteria 3072
578 Ga0207703_10092280 3300026035 Bacteria 2548
579 Ga0207703_10307158 3300026035 Bacteria 1448
580 Ga0207703_10703097 3300026035 Bacteria 961
581 Ga0207639_10004670 3300026041 Bacteria 9221
582 Ga0207639_10153233 3300026041 Unclassified 1933
583 Ga0207639_10162021 3300026041 Unclassified 1886
584 Ga0207639_10588551 3300026041 Bacteria 1025
585 Ga0207678_10010423 3300026067 Bacteria 8160
586 Ga0207708_10000055 3300026075 Bacteria 103534
587 Ga0207708_10004707 3300026075 Bacteria 10034
588 Ga0207708_10022757 3300026075 Bacteria 4733
589 Ga0207708_10023536 3300026075 Bacteria 4658
590 Ga0207708_10041173 3300026075 Bacteria 3522
591 Ga0207708_10076890 3300026075 Unclassified 2561
592 Ga0207708_10078922 3300026075 Bacteria 2528
593 Ga0207708_10774708 3300026075 Bacteria 824
594 Ga0207702_10091278 3300026078 Bacteria 2667
595 Ga0207702_10131012 3300026078 Bacteria 2257
596 Ga0207702_10141246 3300026078 Bacteria 2179
597 Ga0207702_10191288 3300026078 Bacteria 1891
598 Ga0207702_10472199 3300026078 Unclassified 1220
599 Ga0207702_10497916 3300026078 Bacteria 1188
600 Ga0207641_10020923 3300026088 Bacteria 5377
601 Ga0207641_10057312 3300026088 Bacteria 3313
602 Ga0207641_10160533 3300026088 Bacteria 2043
603 Ga0207641_10186090 3300026088 Bacteria 1905
604 Ga0207641_10532315 3300026088 Bacteria 1144
605 Ga0207648_10009024 3300026089 Bacteria 9590
606 Ga0207648_10046582 3300026089 Bacteria 3802
607 Ga0207648_10058627 3300026089 Bacteria 3357
608 Ga0207648_10140863 3300026089 Bacteria 2125
609 Ga0207676_10008357 3300026095 Bacteria 7359
610 Ga0207676_10029661 3300026095 Bacteria 4098
611 Ga0207676_10056046 3300026095 Bacteria 3097
612 Ga0207676_10091382 3300026095 Bacteria 2500
613 Ga0207676_10381798 3300026095 Unclassified 1312
614 Ga0207674_10001093 3300026116 Bacteria 35304
615 Ga0207674_10015666 3300026116 Bacteria 8323
616 Ga0207674_10022251 3300026116 Bacteria 6810
617 Ga0207674_10022789 3300026116 Bacteria 6720
618 Ga0207674_10283960 3300026116 Bacteria 1603
619 Ga0207674_10403466 3300026116 Bacteria 1321
620 Ga0207675_100005231 3300026118 Bacteria 12487
621 Ga0207675_100031702 3300026118 Bacteria 4925
622 Ga0207675_100071904 3300026118 Bacteria 3234
623 Ga0207683_10031582 3300026121 Bacteria 4596
624 Ga0207698_10017167 3300026142 Bacteria 4904
625 Ga0207698_10046034 3300026142 Bacteria 3291
626 Ga0207698_10100382 3300026142 Unclassified 2397
627 Ga0207698_10245230 3300026142 Bacteria 1635
628 Ga0209813_10030346 3300027866 Bacteria 1588
629 Ga0207428_10000741 3300027907 Bacteria 37332
630 Ga0207428_10033144 3300027907 Bacteria 4244
631 Ga0207428_10040803 3300027907 Bacteria 3760
632 Ga0268266_10529173 3300028379 Unclassified 1128
633 Ga0268264_10169320 3300028381 Bacteria 1974
634 Ga0268264_10199723 3300028381 Bacteria 1828
635 Ga0268264_10235974 3300028381 Unclassified 1691
636 Ga0268264_10950289 3300028381 Bacteria 865
637 Ga0268264_10963484 3300028381 Unclassified 859
638 Ga0265762_1037727 3300030760 Bacteria 936
639 Ga0265330_10000718 3300031235 Bacteria 20901
640 Ga0265330_10003616 3300031235 Bacteria 8048
641 Ga0265330_10005817 3300031235 Bacteria 6120
642 Ga0265329_10015935 3300031242 Unclassified 2615
643 Ga0265316_10000285 3300031344 Bacteria 56873
644 Ga0265316_10005360 3300031344 Bacteria 12489
645 Ga0265316_10063818 3300031344 Bacteria 2855
646 Ga0265316_10308383 3300031344 Unclassified 1152
647 Ga0307408_100001594 3300031548 Bacteria 16750
648 Ga0307408_100324520 3300031548 Unclassified 1298
649 Ga0265342_10002221 3300031712 Bacteria 17044
650 Ga0307413_10081583 3300031824 Bacteria 2074
651 Ga0307410_10094264 3300031852 Bacteria 2132
652 Ga0307406_10012049 3300031901 Bacteria 4919
653 Ga0307406_10117779 3300031901 Bacteria 1840
654 Ga0307406_10241208 3300031901 Unclassified 1356
655 Ga0307406_10264427 3300031901 Bacteria 1303
656 Ga0307407_10129723 3300031903 Unclassified 1611
657 Ga0307409_100316959 3300031995 Bacteria 1458
658 Ga0307409_101052797 3300031995 Unclassified 833
659 Ga0307416_100394227 3300032002 Bacteria 1419
660 Ga0307415_100098928 3300032126 Bacteria 2133
661 Ga0307415_100441615 3300032126 Unclassified 1122
662 Ga0307415_100482267 3300032126 Unclassified 1080
663 Ga0373951_0008266 3300035091 Unclassified 2356
664 Ga0373941_0009241 3300035115 Bacteria 2476
665 Ga0373942_0006561 3300035207 Bacteria 2689
666 Ga0242422_03152 3300038699 Bacteria 1087
667 Ga0242420_059082 3300038996 Unclassified 762
668 Ga0451843_0740440 3300041509 Bacteria 823
669 Ga0439443_003583 3300042003 Bacteria 1970
670 Ga0439458_0039836 3300042157 Bacteria 1137
671 Ga0439459_0024023 3300042438 Bacteria 1193
672 Ga0451577_0164946 3300042876 Unclassified 1996
673 Ga0451576_0029752 3300045051 Bacteria 5843
674 Ga0451576_0111661 3300045051 Unclassified 2845
675 Ga0451576_0223794 3300045051 Bacteria 1965
676 Ga0451576_0561451 3300045051 Bacteria 1199
677 Ga0451576_0652491 3300045051 Bacteria 1106
678 Ga0451576_0822727 3300045051 Unclassified 975
679 Ga0495638_0225660 3300046460 Bacteria 1045
680 Ga0495666_0119203 3300046526 Bacteria 1237
681 Ga0495645_0336344 3300046543 Bacteria 976
682 Ga0495659_0050184 3300046664 Unclassified 1517
683 Ga0495669_0188112 3300046684 Bacteria 985
684 Ga0495636_0023074 3300047318 Bacteria 2518
685 Ga0495680_0211301 3300047322 Unclassified 1389
686 Ga0495687_160652 3300047443 Bacteria 756
687 Ga0495686_0000006 3300047472 Bacteria 770778
688 Ga0495686_0001512 3300047472 Bacteria 25025
689 Ga0495686_0019096 3300047472 Bacteria 4584
690 Ga0495686_0099850 3300047472 Bacteria 1751
691 Ga0495686_0238021 3300047472 Unclassified 1028
692 Ga0495602_0361478 3300048088 Unclassified 1045
693 Ga0496101_0054326 3300048904 Bacteria 2892
694 Ga0496102_0405637 3300048905 Bacteria 1281
695 Ga0496103_0120661 3300048906 Unclassified 1670
696 Ga0496104_0000031 3300048907 Bacteria 194537
697 Ga0496104_0491804 3300048907 Bacteria 1138
698 Ga0496104_0928615 3300048907 Bacteria 775
699 Ga0496105_0054848 3300048908 Bacteria 3291
700 Ga0496106_0000698 3300048909 Bacteria 24110
701 Ga0496106_0091539 3300048909 Unclassified 2348
702 Ga0496108_0223025 3300048911 Unclassified 1638
703 Ga0496108_0795977 3300048911 Bacteria 816
704 Ga0496112_0149951 3300048915 Bacteria 2299
705 Ga0496112_0328598 3300048915 Bacteria 1473
706 Ga0496112_0412945 3300048915 Bacteria 1289
707 Ga0496112_0524760 3300048915 Unclassified 1119
708 Ga0501291_019562 3300049514 Unclassified 1064
709 Ga0501072_0085433 3300049588 Bacteria 2503
710 Ga0501207_000450 3300049654 Bacteria 4604
711 Ga0501208_048383 3300049655 Unclassified 805
712 Ga0501227_077226 3300049665 Unclassified 870
713 Ga0501235_064804 3300049669 Bacteria 859
714 Ga0501236_013781 3300049670 Unclassified 1111
715 Ga0501249_015171 3300049679 Bacteria 1647
716 Ga0501249_016164 3300049679 Bacteria 1601
717 Ga0501249_070951 3300049679 Bacteria 814
718 Ga0501253_068141 3300049683 Bacteria 781
719 Ga0501257_019624 3300049686 Bacteria 1582
720 Ga0501257_086406 3300049686 Bacteria 813
721 Ga0501225_0023218 3300049705 Bacteria 1710
722 Ga0501225_0089361 3300049705 Bacteria 891
723 Ga0501234_012647 3300049707 Bacteria 1322
724 Ga0501079_0249801 3300049741 Bacteria 1386
725 Ga0501079_0312889 3300049741 Bacteria 1229
726 Ga0501081_0440341 3300049743 Bacteria 967
727 Ga0501263_021501 3300049760 Unclassified 871
728 Ga0501273_035228 3300049770 Unclassified 725
729 Ga0501204_009465 3300049850 Bacteria 1127
730 Ga0501204_030730 3300049850 Unclassified 745
731 nmdc:mga03683_129280_c2 3300050489 Unclassified 842
732 nmdc:mga03n38_180244_c1 3300050490 Unclassified 1082
733 nmdc:mga00v17_26556_c1 3300050491 Unclassified 2337
734 nmdc:mga0yw44_33764_c1 3300050492 Bacteria 2992
735 nmdc:mga0k408_218_c1 3300050493 Bacteria 30681
736 nmdc:mga04h51_42863_c1 3300050495 Bacteria 1486
737 nmdc:mga05p37_1061_c1 3300050507 Bacteria 31431
738 nmdc:mga05p37_169878_c1 3300050507 Bacteria 2660
739 nmdc:mga05p37_214153_c1 3300050507 Bacteria 2327
740 nmdc:mga05p37_222507_c1 3300050507 Bacteria 2277
741 nmdc:mga05p37_243769_c1 3300050507 Unclassified 2159
742 nmdc:mga05p37_383515_c1 3300050507 Unclassified 1646
743 nmdc:mga05p37_66941_c1 3300050507 Unclassified 4418
744 nmdc:mga05p37_6857_c1 3300050507 Bacteria 13429
745 nmdc:mga05p37_701062_c1 3300050507 Bacteria 1124
746 nmdc:mga05p37_97081_c1 3300050507 Bacteria 3630
747 nmdc:mga09592_17060_c1 3300050508 Bacteria 5944
748 nmdc:mga0qj67_401647_c1 3300050509 Bacteria 1106
749 nmdc:mga06r32_188961_c1 3300050510 Bacteria 2047
750 nmdc:mga06r32_4917_c1 3300050510 Bacteria 12037
751 nmdc:mga06r32_685798_c1 3300050510 Bacteria 991
752 nmdc:mga06r32_981797_c1 3300050510 Unclassified 798
753 nmdc:mga08y16_20585_c1 3300050511 Bacteria 6963
754 nmdc:mga08y16_2339_c1 3300050511 Bacteria 19433
755 nmdc:mga08y16_50331_c1 3300050511 Bacteria 4361
756 nmdc:mga0n895_157091_c1 3300050512 Bacteria 2305
757 nmdc:mga0n895_161404_c1 3300050512 Bacteria 2273
758 nmdc:mga0n895_171469_c1 3300050512 Bacteria 2202
759 nmdc:mga0n895_258105_c1 3300050512 Bacteria 1769
760 nmdc:mga0n895_71041_c1 3300050512 Bacteria 3451
761 nmdc:mga0rr50_131573_c1 3300050513 Bacteria 2004
762 nmdc:mga0rr50_132909_c1 3300050513 Bacteria 1994
763 nmdc:mga0rr50_2108_c1 3300050513 Bacteria 11117
764 nmdc:mga0rr50_239444_c1 3300050513 Bacteria 1504
765 nmdc:mga0rr50_275096_c1 3300050513 Bacteria 1404
766 nmdc:mga0rr50_833040_c1 3300050513 Unclassified 787
767 nmdc:mga08x19_165167_c2 3300050514 Archaea 1175
768 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
769 nmdc:mga0a205_107910_c1 3300050515 Bacteria 2682
770 nmdc:mga0a205_141587_c1 3300050515 Bacteria 2305
771 nmdc:mga0a205_193470_c1 3300050515 Archaea 1925
772 nmdc:mga0a205_24054_c1 3300050515 Bacteria 5785
773 nmdc:mga0a205_277826_c1 3300050515 Bacteria 1551
774 nmdc:mga0a205_30275_c1 3300050515 Bacteria 5181
775 nmdc:mga0a205_329698_c1 3300050515 Bacteria 1396
776 nmdc:mga0a205_368505_c1 3300050515 Bacteria 1302
777 nmdc:mga0a205_546692_c1 3300050515 Unclassified 1013
778 nmdc:mga0a205_70399_c1 3300050515 Bacteria 3377
779 nmdc:mga0a205_84770_c1 3300050515 Bacteria 3061
780 nmdc:mga0sz30_76907_c1 3300050516 Unclassified 1441
781 Ga0495601_0007655 3300053077 Bacteria 6346
782 Ga0495601_0353718 3300053077 Bacteria 955
783 Ga0495655_0053341 3300053083 Unclassified 1078
784 Ga0500640_004532 3300053095 Bacteria 5059
785 Ga0500554_000274 3300053102 Bacteria 11148
786 Ga0500572_001651 3300053111 Bacteria 5843
787 Ga0500595_000803 3300053119 Bacteria 18206
788 Ga0500637_0313672 3300053178 Bacteria 850
789 Ga0590075_013829 3300059424 Unclassified 1970

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100028708 Ga0070706_1000287084 183
2 3300005471 Ga0070698_100184133 Ga0070698_1001841331 183
3 3300005518 Ga0070699_100030454 Ga0070699_1000304544 183
4 3300025910 Ga0207684_10043668 Ga0207684_100436684 183
5 3300025922 Ga0207646_10021862 Ga0207646_100218622 183
6 3300047443 Ga0495687_160652 Ga0495687_160652_191_742 183
7 3300031235 Ga0265330_10003616 Ga0265330_100036164 187
8 3300031344 Ga0265316_10000285 Ga0265316_1000028521 187
9 3300047472 Ga0495686_0238021 Ga0495686_0238021_350_916 188
10 3300005563 Ga0068855_100130143 Ga0068855_1001301433 189
11 3300009093 Ga0105240_10370051 Ga0105240_103700511 189
12 3300009177 Ga0105248_10527639 Ga0105248_105276392 189
13 3300009553 Ga0105249_11068907 Ga0105249_110689072 189
14 3300025949 Ga0207667_10321950 Ga0207667_103219503 189
15 3300005614 Ga0068856_100888739 Ga0068856_1008887392 195
16 3300025924 Ga0207694_10013013 Ga0207694_100130135 195
17 3300009551 Ga0105238_10021791 Ga0105238_100217915 196
18 3300005289 Ga0065704_10251220 Ga0065704_102512202 198
19 3300005545 Ga0070695_100649500 Ga0070695_1006495001 199
20 3300005406 Ga0070703_10000392 Ga0070703_1000039214 200
21 3300005441 Ga0070700_100120641 Ga0070700_1001206412 200
22 3300005445 Ga0070708_100068799 Ga0070708_1000687992 200
23 3300005468 Ga0070707_100419197 Ga0070707_1004191972 200
24 3300009545 Ga0105237_10076977 Ga0105237_100769773 200
25 3300025885 Ga0207653_10000197 Ga0207653_1000019713 200
26 3300025922 Ga0207646_10332846 Ga0207646_103328461 200
27 3300026075 Ga0207708_10078922 Ga0207708_100789222 200
28 3300013297 Ga0157378_10150159 Ga0157378_101501593 202
29 3300026035 Ga0207703_10703097 Ga0207703_107030972 202
30 3300005471 Ga0070698_100107442 Ga0070698_1001074423 204
31 3300005545 Ga0070695_100303974 Ga0070695_1003039742 204
32 3300025922 Ga0207646_10303916 Ga0207646_103039162 204
33 3300005440 Ga0070705_100723294 Ga0070705_1007232941 205
34 3300005444 Ga0070694_100003143 Ga0070694_1000031437 205
35 3300005445 Ga0070708_100004377 Ga0070708_1000043772 205
36 3300005549 Ga0070704_100007658 Ga0070704_1000076582 205
37 3300005577 Ga0068857_100727611 Ga0068857_1007276112 205
38 3300005843 Ga0068860_100789113 Ga0068860_1007891132 205
39 3300006028 Ga0070717_10309099 Ga0070717_103090992 205
40 3300009176 Ga0105242_10930101 Ga0105242_109301011 205
41 3300013297 Ga0157378_10667034 Ga0157378_106670341 205
42 3300028381 Ga0268264_10950289 Ga0268264_109502892 205
43 3300005467 Ga0070706_100151310 Ga0070706_1001513102 206
44 3300005577 Ga0068857_100093228 Ga0068857_1000932283 206
45 3300006871 Ga0075434_100131818 Ga0075434_1001318182 206
46 3300009147 Ga0114129_10089354 Ga0114129_100893543 206
47 3300026116 Ga0207674_10022251 Ga0207674_100222514 206
48 3300005327 Ga0070658_10149186 Ga0070658_101491862 207
49 3300013296 Ga0157374_11036211 Ga0157374_110362111 207
50 3300025945 Ga0207679_10619032 Ga0207679_106190322 207
51 3300025960 Ga0207651_10009988 Ga0207651_100099883 207
52 3300031344 Ga0265316_10063818 Ga0265316_100638182 207
53 3300050507 nmdc:mga05p37_66941_c1 nmdc:mga05p37_66941_c1_3224_3880 207
54 3300050513 nmdc:mga0rr50_131573_c1 nmdc:mga0rr50_131573_c1_143_778 207
55 3300003322 rootL2_10011367 rootL2_100113674 208
56 3300005331 Ga0070670_100113953 Ga0070670_1001139533 208
57 3300025936 Ga0207670_10480162 Ga0207670_104801622 208
58 3300046460 Ga0495638_0225660 Ga0495638_0225660_347_973 208
59 3300050512 nmdc:mga0n895_258105_c1 nmdc:mga0n895_258105_c1_929_1594 208
60 3300005441 Ga0070700_100000027 Ga0070700_10000002770 209
61 3300005471 Ga0070698_100148389 Ga0070698_1001483891 209
62 3300005618 Ga0068864_101070097 Ga0068864_1010700971 209
63 3300009148 Ga0105243_10319858 Ga0105243_103198582 209
64 3300009176 Ga0105242_10033576 Ga0105242_100335762 209
65 3300014745 Ga0157377_10158351 Ga0157377_101583512 209
66 3300025934 Ga0207686_10099865 Ga0207686_100998652 209
67 3300025935 Ga0207709_10169307 Ga0207709_101693072 209
68 3300026075 Ga0207708_10000055 Ga0207708_1000005537 209
69 3300045051 Ga0451576_0223794 Ga0451576_0223794_1279_1941 209
70 3300053083 Ga0495655_0053341 Ga0495655_0053341_298_978 209
71 3300005536 Ga0070697_100196904 Ga0070697_1001969042 210
72 3300005536 Ga0070697_100470318 Ga0070697_1004703182 210
73 3300006852 Ga0075433_10275070 Ga0075433_102750701 210
74 3300025910 Ga0207684_10047943 Ga0207684_100479434 210
75 3300031548 Ga0307408_100001594 Ga0307408_1000015942 210
76 3300031824 Ga0307413_10081583 Ga0307413_100815832 210
77 3300031852 Ga0307410_10094264 Ga0307410_100942642 210
78 3300031901 Ga0307406_10117779 Ga0307406_101177792 210
79 3300031995 Ga0307409_100316959 Ga0307409_1003169592 210
80 3300035115 Ga0373941_0009241 Ga0373941_0009241_1388_2023 210
81 3300049654 Ga0501207_000450 Ga0501207_000450_3325_3957 210
82 3300049670 Ga0501236_013781 Ga0501236_013781_315_947 210
83 3300049679 Ga0501249_016164 Ga0501249_016164_592_1224 210
84 3300049686 Ga0501257_019624 Ga0501257_019624_839_1471 210
85 3300049707 Ga0501234_012647 Ga0501234_012647_340_972 210
86 3300049850 Ga0501204_009465 Ga0501204_009465_105_737 210
87 3300050512 nmdc:mga0n895_171469_c1 nmdc:mga0n895_171469_c1_913_1548 210
88 3300050515 nmdc:mga0a205_24054_c1 nmdc:mga0a205_24054_c1_4715_5350 210
89 3300006852 Ga0075433_10235496 Ga0075433_102354962 211
90 3300009094 Ga0111539_10278956 Ga0111539_102789563 211
91 3300009147 Ga0114129_11412619 Ga0114129_114126191 211
92 3300025942 Ga0207689_10157628 Ga0207689_101576283 211
93 3300026075 Ga0207708_10774708 Ga0207708_107747081 211
94 3300049679 Ga0501249_015171 Ga0501249_015171_459_1106 211
95 3300049686 Ga0501257_086406 Ga0501257_086406_94_741 211
96 3300049705 Ga0501225_0089361 Ga0501225_0089361_92_739 211
97 3300050507 nmdc:mga05p37_169878_c1 nmdc:mga05p37_169878_c1_1189_1836 211
98 3300050515 nmdc:mga0a205_277826_c1 nmdc:mga0a205_277826_c1_271_909 211
99 3300053095 Ga0500640_004532 Ga0500640_004532_3681_4331 211
100 3300053102 Ga0500554_000274 Ga0500554_000274_8458_9108 211
101 3300053111 Ga0500572_001651 Ga0500572_001651_2569_3219 211
102 3300053119 Ga0500595_000803 Ga0500595_000803_4190_4840 211
103 3300053178 Ga0500637_0313672 Ga0500637_0313672_177_827 211
104 3300005345 Ga0070692_10093070 Ga0070692_100930702 212
105 3300005458 Ga0070681_10122078 Ga0070681_101220783 212
106 3300005545 Ga0070695_100072735 Ga0070695_1000727352 212
107 3300005546 Ga0070696_100013512 Ga0070696_1000135124 212
108 3300005985 Ga0081539_10205372 Ga0081539_102053721 212
109 3300006852 Ga0075433_10064292 Ga0075433_100642923 212
110 3300009148 Ga0105243_10193402 Ga0105243_101934022 212
111 3300026116 Ga0207674_10403466 Ga0207674_104034661 212
112 3300042157 Ga0439458_0039836 Ga0439458_0039836_79_720 212
113 3300042438 Ga0439459_0024023 Ga0439459_0024023_283_924 212
114 3300003320 rootH2_10325698 rootH2_103256981 213
115 3300005337 Ga0070682_100000002 Ga0070682_100000002193 213
116 3300005347 Ga0070668_100734450 Ga0070668_1007344502 213
117 3300025302 Ga0207426_1071081 Ga0207426_10710812 213
118 3300025904 Ga0207647_10087790 Ga0207647_100877902 213
119 3300005334 Ga0068869_100000001 Ga0068869_100000001146 214
120 3300042003 Ga0439443_003583 Ga0439443_003583_972_1616 214
121 3300005327 Ga0070658_10023453 Ga0070658_100234532 215
122 3300005331 Ga0070670_100053552 Ga0070670_1000535523 215
123 3300005331 Ga0070670_100226543 Ga0070670_1002265432 215
124 3300005331 Ga0070670_100389227 Ga0070670_1003892271 215
125 3300005331 Ga0070670_100423727 Ga0070670_1004237272 215
126 3300005336 Ga0070680_100030467 Ga0070680_1000304674 215
127 3300005336 Ga0070680_100235360 Ga0070680_1002353603 215
128 3300005340 Ga0070689_100003073 Ga0070689_1000030739 215
129 3300005344 Ga0070661_100004719 Ga0070661_1000047198 215
130 3300005364 Ga0070673_100119486 Ga0070673_1001194862 215
131 3300005435 Ga0070714_100008416 Ga0070714_1000084164 215
132 3300005435 Ga0070714_100052712 Ga0070714_1000527124 215
133 3300005435 Ga0070714_100091808 Ga0070714_1000918082 215
134 3300005436 Ga0070713_100008200 Ga0070713_1000082006 215
135 3300005436 Ga0070713_100157072 Ga0070713_1001570721 215
136 3300005436 Ga0070713_100267065 Ga0070713_1002670651 215
137 3300005437 Ga0070710_10234134 Ga0070710_102341342 215
138 3300005437 Ga0070710_10391465 Ga0070710_103914652 215
139 3300005439 Ga0070711_100004787 Ga0070711_1000047872 215
140 3300005444 Ga0070694_100061641 Ga0070694_1000616413 215
141 3300005444 Ga0070694_100101996 Ga0070694_1001019962 215
142 3300005457 Ga0070662_100461672 Ga0070662_1004616722 215
143 3300005458 Ga0070681_10000791 Ga0070681_100007911 215
144 3300005458 Ga0070681_10009950 Ga0070681_100099503 215
145 3300005458 Ga0070681_10361792 Ga0070681_103617922 215
146 3300005458 Ga0070681_10612898 Ga0070681_106128982 215
147 3300005468 Ga0070707_100447618 Ga0070707_1004476181 215
148 3300005518 Ga0070699_100199303 Ga0070699_1001993032 215
149 3300005530 Ga0070679_100000011 Ga0070679_10000001121 215
150 3300005530 Ga0070679_100223606 Ga0070679_1002236062 215
151 3300005530 Ga0070679_100577555 Ga0070679_1005775552 215
152 3300005536 Ga0070697_100039489 Ga0070697_1000394892 215
153 3300005536 Ga0070697_100539968 Ga0070697_1005399681 215
154 3300005539 Ga0068853_100055159 Ga0068853_1000551592 215
155 3300005545 Ga0070695_100281664 Ga0070695_1002816642 215
156 3300005546 Ga0070696_100184107 Ga0070696_1001841072 215
157 3300005547 Ga0070693_100620092 Ga0070693_1006200921 215
158 3300005563 Ga0068855_100127808 Ga0068855_1001278082 215
159 3300005563 Ga0068855_100241278 Ga0068855_1002412782 215
160 3300005563 Ga0068855_100281478 Ga0068855_1002814781 215
161 3300005577 Ga0068857_100272038 Ga0068857_1002720382 215
162 3300005578 Ga0068854_100896705 Ga0068854_1008967051 215
163 3300005614 Ga0068856_100361662 Ga0068856_1003616622 215
164 3300005615 Ga0070702_100080861 Ga0070702_1000808612 215
165 3300005616 Ga0068852_100025194 Ga0068852_1000251947 215
166 3300005616 Ga0068852_100026870 Ga0068852_1000268706 215
167 3300005616 Ga0068852_100041713 Ga0068852_1000417134 215
168 3300005617 Ga0068859_100068685 Ga0068859_1000686853 215
169 3300005617 Ga0068859_100906902 Ga0068859_1009069021 215
170 3300005618 Ga0068864_100099264 Ga0068864_1000992642 215
171 3300005618 Ga0068864_100135307 Ga0068864_1001353072 215
172 3300005841 Ga0068863_100043030 Ga0068863_1000430302 215
173 3300005841 Ga0068863_100440468 Ga0068863_1004404682 215
174 3300005842 Ga0068858_100076009 Ga0068858_1000760093 215
175 3300005842 Ga0068858_100229701 Ga0068858_1002297012 215
176 3300006028 Ga0070717_10024632 Ga0070717_100246324 215
177 3300006028 Ga0070717_10527975 Ga0070717_105279751 215
178 3300006173 Ga0070716_100000005 Ga0070716_10000000520 215
179 3300006175 Ga0070712_100004891 Ga0070712_1000048916 215
180 3300006852 Ga0075433_10035713 Ga0075433_100357132 215
181 3300006852 Ga0075433_10173952 Ga0075433_101739522 215
182 3300006852 Ga0075433_11049434 Ga0075433_110494341 215
183 3300006881 Ga0068865_100412894 Ga0068865_1004128942 215
184 3300006931 Ga0097620_100068687 Ga0097620_1000686873 215
185 3300006931 Ga0097620_100906706 Ga0097620_1009067061 215
186 3300007076 Ga0075435_100137228 Ga0075435_1001372282 215
187 3300007076 Ga0075435_100185526 Ga0075435_1001855261 215
188 3300009092 Ga0105250_10094258 Ga0105250_100942582 215
189 3300009147 Ga0114129_10048089 Ga0114129_100480895 215
190 3300009147 Ga0114129_10255568 Ga0114129_102555682 215
191 3300009148 Ga0105243_10000715 Ga0105243_100007158 215
192 3300009148 Ga0105243_10522653 Ga0105243_105226531 215
193 3300009174 Ga0105241_10263602 Ga0105241_102636022 215
194 3300009174 Ga0105241_10567921 Ga0105241_105679211 215
195 3300009176 Ga0105242_10002445 Ga0105242_100024452 215
196 3300009176 Ga0105242_10005773 Ga0105242_100057737 215
197 3300009177 Ga0105248_10112779 Ga0105248_101127792 215
198 3300009177 Ga0105248_10443527 Ga0105248_104435272 215
199 3300009177 Ga0105248_10478710 Ga0105248_104787102 215
200 3300009177 Ga0105248_10978693 Ga0105248_109786932 215
201 3300009545 Ga0105237_10206969 Ga0105237_102069692 215
202 3300009551 Ga0105238_10020332 Ga0105238_100203325 215
203 3300009551 Ga0105238_10270363 Ga0105238_102703632 215
204 3300009551 Ga0105238_11050456 Ga0105238_110504561 215
205 3300010375 Ga0105239_10019333 Ga0105239_100193332 215
206 3300010375 Ga0105239_10443852 Ga0105239_104438522 215
207 3300013100 Ga0157373_10376757 Ga0157373_103767572 215
208 3300013100 Ga0157373_10640263 Ga0157373_106402631 215
209 3300013104 Ga0157370_10004929 Ga0157370_1000492911 215
210 3300013104 Ga0157370_10034070 Ga0157370_100340705 215
211 3300013104 Ga0157370_10052651 Ga0157370_100526514 215
212 3300013104 Ga0157370_10397991 Ga0157370_103979912 215
213 3300013105 Ga0157369_10007108 Ga0157369_100071087 215
214 3300013105 Ga0157369_10026429 Ga0157369_100264294 215
215 3300013297 Ga0157378_10000001 Ga0157378_1000000159 215
216 3300013297 Ga0157378_10185876 Ga0157378_101858762 215
217 3300013306 Ga0163162_10003094 Ga0163162_1000309410 215
218 3300013306 Ga0163162_10366001 Ga0163162_103660012 215
219 3300013307 Ga0157372_10031617 Ga0157372_100316175 215
220 3300013307 Ga0157372_10314764 Ga0157372_103147642 215
221 3300013307 Ga0157372_10620012 Ga0157372_106200122 215
222 3300013308 Ga0157375_10195369 Ga0157375_101953692 215
223 3300014325 Ga0163163_10033041 Ga0163163_100330413 215
224 3300014745 Ga0157377_10283253 Ga0157377_102832532 215
225 3300025898 Ga0207692_10341673 Ga0207692_103416731 215
226 3300025911 Ga0207654_10277041 Ga0207654_102770411 215
227 3300025912 Ga0207707_10000007 Ga0207707_10000007131 215
228 3300025912 Ga0207707_10441319 Ga0207707_104413192 215
229 3300025913 Ga0207695_10019908 Ga0207695_100199082 215
230 3300025916 Ga0207663_10004236 Ga0207663_100042369 215
231 3300025917 Ga0207660_10021570 Ga0207660_100215701 215
232 3300025917 Ga0207660_10292346 Ga0207660_102923461 215
233 3300025919 Ga0207657_10017784 Ga0207657_100177847 215
234 3300025919 Ga0207657_10126263 Ga0207657_101262632 215
235 3300025921 Ga0207652_10000102 Ga0207652_1000010267 215
236 3300025921 Ga0207652_10189742 Ga0207652_101897422 215
237 3300025921 Ga0207652_10478297 Ga0207652_104782972 215
238 3300025922 Ga0207646_10444555 Ga0207646_104445551 215
239 3300025924 Ga0207694_10073229 Ga0207694_100732292 215
240 3300025924 Ga0207694_10148836 Ga0207694_101488362 215
241 3300025924 Ga0207694_10232467 Ga0207694_102324672 215
242 3300025925 Ga0207650_10320788 Ga0207650_103207881 215
243 3300025928 Ga0207700_10009013 Ga0207700_100090133 215
244 3300025928 Ga0207700_10180148 Ga0207700_101801482 215
245 3300025928 Ga0207700_10197555 Ga0207700_101975552 215
246 3300025929 Ga0207664_10119045 Ga0207664_101190453 215
247 3300025929 Ga0207664_10350501 Ga0207664_103505011 215
248 3300025929 Ga0207664_10576559 Ga0207664_105765592 215
249 3300025934 Ga0207686_10001008 Ga0207686_1000100814 215
250 3300025935 Ga0207709_10000301 Ga0207709_1000030134 215
251 3300025935 Ga0207709_10346569 Ga0207709_103465692 215
252 3300025936 Ga0207670_10005234 Ga0207670_100052343 215
253 3300025939 Ga0207665_10000012 Ga0207665_1000001220 215
254 3300025941 Ga0207711_10093478 Ga0207711_100934783 215
255 3300025941 Ga0207711_10498484 Ga0207711_104984842 215
256 3300025942 Ga0207689_10012945 Ga0207689_100129454 215
257 3300025945 Ga0207679_10787033 Ga0207679_107870331 215
258 3300025949 Ga0207667_10162489 Ga0207667_101624892 215
259 3300025949 Ga0207667_10253992 Ga0207667_102539922 215
260 3300025949 Ga0207667_10348020 Ga0207667_103480202 215
261 3300025960 Ga0207651_10158061 Ga0207651_101580612 215
262 3300025961 Ga0207712_10048561 Ga0207712_100485613 215
263 3300025981 Ga0207640_10050703 Ga0207640_100507033 215
264 3300025981 Ga0207640_10970279 Ga0207640_109702791 215
265 3300026041 Ga0207639_10153233 Ga0207639_101532332 215
266 3300026041 Ga0207639_10162021 Ga0207639_101620212 215
267 3300026078 Ga0207702_10091278 Ga0207702_100912782 215
268 3300026078 Ga0207702_10131012 Ga0207702_101310122 215
269 3300026078 Ga0207702_10141246 Ga0207702_101412462 215
270 3300026078 Ga0207702_10472199 Ga0207702_104721991 215
271 3300026078 Ga0207702_10497916 Ga0207702_104979162 215
272 3300026088 Ga0207641_10160533 Ga0207641_101605333 215
273 3300026095 Ga0207676_10008357 Ga0207676_100083572 215
274 3300026095 Ga0207676_10091382 Ga0207676_100913822 215
275 3300026116 Ga0207674_10283960 Ga0207674_102839602 215
276 3300026118 Ga0207675_100005231 Ga0207675_1000052316 215
277 3300026142 Ga0207698_10017167 Ga0207698_100171675 215
278 3300026142 Ga0207698_10245230 Ga0207698_102452302 215
279 3300030760 Ga0265762_1037727 Ga0265762_10377271 215
280 3300031344 Ga0265316_10308383 Ga0265316_103083832 215
281 3300031548 Ga0307408_100324520 Ga0307408_1003245202 215
282 3300031901 Ga0307406_10241208 Ga0307406_102412081 215
283 3300031903 Ga0307407_10129723 Ga0307407_101297232 215
284 3300031995 Ga0307409_101052797 Ga0307409_1010527971 215
285 3300032002 Ga0307416_100394227 Ga0307416_1003942271 215
286 3300032126 Ga0307415_100098928 Ga0307415_1000989282 215
287 3300032126 Ga0307415_100441615 Ga0307415_1004416152 215
288 3300038699 Ga0242422_03152 Ga0242422_03152_115_765 215
289 3300038996 Ga0242420_059082 Ga0242420_059082_39_686 215
290 3300042876 Ga0451577_0164946 Ga0451577_0164946_759_1421 215
291 3300045051 Ga0451576_0029752 Ga0451576_0029752_4006_4668 215
292 3300045051 Ga0451576_0822727 Ga0451576_0822727_109_756 215
293 3300046526 Ga0495666_0119203 Ga0495666_0119203_31_678 215
294 3300047318 Ga0495636_0023074 Ga0495636_0023074_110_772 215
295 3300047472 Ga0495686_0000006 Ga0495686_0000006_587451_588101 215
296 3300047472 Ga0495686_0001512 Ga0495686_0001512_16746_17396 215
297 3300047472 Ga0495686_0019096 Ga0495686_0019096_3794_4456 215
298 3300047472 Ga0495686_0099850 Ga0495686_0099850_824_1474 215
299 3300048088 Ga0495602_0361478 Ga0495602_0361478_302_973 215
300 3300048906 Ga0496103_0120661 Ga0496103_0120661_848_1498 215
301 3300048907 Ga0496104_0000031 Ga0496104_0000031_142866_143516 215
302 3300048907 Ga0496104_0928615 Ga0496104_0928615_80_727 215
303 3300048909 Ga0496106_0000698 Ga0496106_0000698_8563_9225 215
304 3300048909 Ga0496106_0091539 Ga0496106_0091539_1574_2224 215
305 3300048911 Ga0496108_0223025 Ga0496108_0223025_761_1411 215
306 3300048911 Ga0496108_0795977 Ga0496108_0795977_16_663 215
307 3300048915 Ga0496112_0149951 Ga0496112_0149951_1246_1905 215
308 3300048915 Ga0496112_0524760 Ga0496112_0524760_342_992 215
309 3300049514 Ga0501291_019562 Ga0501291_019562_320_967 215
310 3300049705 Ga0501225_0023218 Ga0501225_0023218_51_698 215
311 3300049760 Ga0501263_021501 Ga0501263_021501_186_833 215
312 3300050507 nmdc:mga05p37_222507_c1 nmdc:mga05p37_222507_c1_1393_2055 215
313 3300050507 nmdc:mga05p37_243769_c1 nmdc:mga05p37_243769_c1_516_1163 215
314 3300050512 nmdc:mga0n895_161404_c1 nmdc:mga0n895_161404_c1_914_1561 215
315 3300050513 nmdc:mga0rr50_132909_c1 nmdc:mga0rr50_132909_c1_85_732 215
316 3300050513 nmdc:mga0rr50_239444_c1 nmdc:mga0rr50_239444_c1_634_1281 215
317 3300050513 nmdc:mga0rr50_833040_c1 nmdc:mga0rr50_833040_c1_87_749 215
318 3300050515 nmdc:mga0a205_30275_c1 nmdc:mga0a205_30275_c1_1736_2383 215
319 3300050515 nmdc:mga0a205_329698_c1 nmdc:mga0a205_329698_c1_468_1130 215
320 3300050515 nmdc:mga0a205_546692_c1 nmdc:mga0a205_546692_c1_116_763 215
321 3300050515 nmdc:mga0a205_70399_c1 nmdc:mga0a205_70399_c1_2711_3358 215
322 3300053077 Ga0495601_0353718 Ga0495601_0353718_218_889 215
323 3300005290 Ga0065712_10000114 Ga0065712_1000011448 216
324 3300005290 Ga0065712_10240405 Ga0065712_102404051 216
325 3300005293 Ga0065715_10001576 Ga0065715_100015763 216
326 3300005295 Ga0065707_10045450 Ga0065707_100454502 216
327 3300005328 Ga0070676_10130464 Ga0070676_101304641 216
328 3300005330 Ga0070690_100038517 Ga0070690_1000385173 216
329 3300005330 Ga0070690_100062165 Ga0070690_1000621652 216
330 3300005330 Ga0070690_100089827 Ga0070690_1000898271 216
331 3300005330 Ga0070690_100540588 Ga0070690_1005405881 216
332 3300005331 Ga0070670_100109825 Ga0070670_1001098251 216
333 3300005334 Ga0068869_100154235 Ga0068869_1001542351 216
334 3300005334 Ga0068869_100357734 Ga0068869_1003577342 216
335 3300005334 Ga0068869_100508378 Ga0068869_1005083781 216
336 3300005335 Ga0070666_10090831 Ga0070666_100908312 216
337 3300005336 Ga0070680_100005023 Ga0070680_1000050238 216
338 3300005336 Ga0070680_100079366 Ga0070680_1000793663 216
339 3300005337 Ga0070682_100002835 Ga0070682_1000028356 216
340 3300005337 Ga0070682_100612780 Ga0070682_1006127801 216
341 3300005338 Ga0068868_100013082 Ga0068868_1000130825 216
342 3300005338 Ga0068868_100049444 Ga0068868_1000494442 216
343 3300005340 Ga0070689_100004541 Ga0070689_1000045414 216
344 3300005340 Ga0070689_100252768 Ga0070689_1002527682 216
345 3300005343 Ga0070687_100165675 Ga0070687_1001656751 216
346 3300005344 Ga0070661_100592253 Ga0070661_1005922531 216
347 3300005347 Ga0070668_100040266 Ga0070668_1000402663 216
348 3300005353 Ga0070669_100264799 Ga0070669_1002647991 216
349 3300005354 Ga0070675_100054352 Ga0070675_1000543522 216
350 3300005354 Ga0070675_100068406 Ga0070675_1000684063 216
351 3300005354 Ga0070675_100770912 Ga0070675_1007709122 216
352 3300005355 Ga0070671_100011164 Ga0070671_1000111644 216
353 3300005355 Ga0070671_100033207 Ga0070671_1000332074 216
354 3300005356 Ga0070674_100142594 Ga0070674_1001425942 216
355 3300005356 Ga0070674_100196736 Ga0070674_1001967361 216
356 3300005364 Ga0070673_100034168 Ga0070673_1000341683 216
357 3300005364 Ga0070673_100071013 Ga0070673_1000710133 216
358 3300005365 Ga0070688_100019989 Ga0070688_1000199894 216
359 3300005366 Ga0070659_100003797 Ga0070659_1000037975 216
360 3300005367 Ga0070667_100423240 Ga0070667_1004232401 216
361 3300005436 Ga0070713_100191824 Ga0070713_1001918242 216
362 3300005438 Ga0070701_10014508 Ga0070701_100145083 216
363 3300005438 Ga0070701_10076264 Ga0070701_100762642 216
364 3300005438 Ga0070701_10120410 Ga0070701_101204101 216
365 3300005440 Ga0070705_100069280 Ga0070705_1000692802 216
366 3300005440 Ga0070705_100236999 Ga0070705_1002369992 216
367 3300005441 Ga0070700_100015179 Ga0070700_1000151794 216
368 3300005441 Ga0070700_100028724 Ga0070700_1000287242 216
369 3300005441 Ga0070700_100059524 Ga0070700_1000595242 216
370 3300005441 Ga0070700_100127197 Ga0070700_1001271972 216
371 3300005444 Ga0070694_100002750 Ga0070694_1000027501 216
372 3300005445 Ga0070708_100001978 Ga0070708_10000197812 216
373 3300005445 Ga0070708_100188335 Ga0070708_1001883352 216
374 3300005456 Ga0070678_100096376 Ga0070678_1000963762 216
375 3300005457 Ga0070662_100175327 Ga0070662_1001753271 216
376 3300005457 Ga0070662_100737493 Ga0070662_1007374931 216
377 3300005458 Ga0070681_10018035 Ga0070681_100180352 216
378 3300005459 Ga0068867_100008304 Ga0068867_1000083044 216
379 3300005459 Ga0068867_100118650 Ga0068867_1001186502 216
380 3300005459 Ga0068867_100465427 Ga0068867_1004654271 216
381 3300005466 Ga0070685_10033721 Ga0070685_100337213 216
382 3300005466 Ga0070685_10063610 Ga0070685_100636102 216
383 3300005467 Ga0070706_100000129 Ga0070706_10000012955 216
384 3300005467 Ga0070706_100008753 Ga0070706_1000087534 216
385 3300005467 Ga0070706_100026984 Ga0070706_1000269841 216
386 3300005467 Ga0070706_100078235 Ga0070706_1000782353 216
387 3300005467 Ga0070706_100490606 Ga0070706_1004906061 216
388 3300005468 Ga0070707_100011309 Ga0070707_1000113092 216
389 3300005468 Ga0070707_100096183 Ga0070707_1000961832 216
390 3300005468 Ga0070707_100139001 Ga0070707_1001390012 216
391 3300005468 Ga0070707_100157947 Ga0070707_1001579473 216
392 3300005468 Ga0070707_100283310 Ga0070707_1002833102 216
393 3300005471 Ga0070698_100006886 Ga0070698_1000068867 216
394 3300005471 Ga0070698_100010012 Ga0070698_1000100127 216
395 3300005471 Ga0070698_100615783 Ga0070698_1006157832 216
396 3300005518 Ga0070699_100000979 Ga0070699_10000097912 216
397 3300005518 Ga0070699_100001846 Ga0070699_1000018468 216
398 3300005518 Ga0070699_100022040 Ga0070699_1000220403 216
399 3300005518 Ga0070699_100053200 Ga0070699_1000532003 216
400 3300005518 Ga0070699_100108776 Ga0070699_1001087762 216
401 3300005518 Ga0070699_100168707 Ga0070699_1001687073 216
402 3300005518 Ga0070699_100379042 Ga0070699_1003790422 216
403 3300005518 Ga0070699_100383571 Ga0070699_1003835711 216
404 3300005536 Ga0070697_100009407 Ga0070697_1000094075 216
405 3300005536 Ga0070697_100039023 Ga0070697_1000390233 216
406 3300005536 Ga0070697_100057775 Ga0070697_1000577753 216
407 3300005536 Ga0070697_100068955 Ga0070697_1000689552 216
408 3300005536 Ga0070697_100288672 Ga0070697_1002886722 216
409 3300005539 Ga0068853_100017320 Ga0068853_1000173202 216
410 3300005539 Ga0068853_100023643 Ga0068853_1000236433 216
411 3300005539 Ga0068853_100125452 Ga0068853_1001254521 216
412 3300005539 Ga0068853_100132996 Ga0068853_1001329963 216
413 3300005543 Ga0070672_100050161 Ga0070672_1000501611 216
414 3300005543 Ga0070672_100081496 Ga0070672_1000814962 216
415 3300005543 Ga0070672_100798876 Ga0070672_1007988762 216
416 3300005544 Ga0070686_100019640 Ga0070686_1000196403 216
417 3300005544 Ga0070686_100279880 Ga0070686_1002798801 216
418 3300005544 Ga0070686_100455250 Ga0070686_1004552501 216
419 3300005544 Ga0070686_100583739 Ga0070686_1005837391 216
420 3300005545 Ga0070695_100054996 Ga0070695_1000549962 216
421 3300005545 Ga0070695_100138335 Ga0070695_1001383351 216
422 3300005545 Ga0070695_100653064 Ga0070695_1006530641 216
423 3300005546 Ga0070696_100031906 Ga0070696_1000319062 216
424 3300005546 Ga0070696_100036934 Ga0070696_1000369342 216
425 3300005546 Ga0070696_100043490 Ga0070696_1000434901 216
426 3300005547 Ga0070693_100106888 Ga0070693_1001068882 216
427 3300005548 Ga0070665_100154435 Ga0070665_1001544353 216
428 3300005549 Ga0070704_100134628 Ga0070704_1001346282 216
429 3300005549 Ga0070704_100264128 Ga0070704_1002641282 216
430 3300005563 Ga0068855_100221933 Ga0068855_1002219332 216
431 3300005563 Ga0068855_100857139 Ga0068855_1008571392 216
432 3300005564 Ga0070664_100015833 Ga0070664_1000158332 216
433 3300005564 Ga0070664_100085079 Ga0070664_1000850793 216
434 3300005577 Ga0068857_100005264 Ga0068857_1000052644 216
435 3300005578 Ga0068854_100435634 Ga0068854_1004356341 216
436 3300005614 Ga0068856_100250256 Ga0068856_1002502561 216
437 3300005615 Ga0070702_100004548 Ga0070702_1000045482 216
438 3300005615 Ga0070702_100082728 Ga0070702_1000827282 216
439 3300005615 Ga0070702_100115467 Ga0070702_1001154673 216
440 3300005617 Ga0068859_100020497 Ga0068859_1000204972 216
441 3300005617 Ga0068859_100132596 Ga0068859_1001325962 216
442 3300005617 Ga0068859_100577059 Ga0068859_1005770592 216
443 3300005617 Ga0068859_100792666 Ga0068859_1007926661 216
444 3300005618 Ga0068864_100020048 Ga0068864_1000200485 216
445 3300005618 Ga0068864_100025552 Ga0068864_1000255523 216
446 3300005618 Ga0068864_100074372 Ga0068864_1000743723 216
447 3300005618 Ga0068864_100076583 Ga0068864_1000765831 216
448 3300005618 Ga0068864_100169772 Ga0068864_1001697722 216
449 3300005618 Ga0068864_100328728 Ga0068864_1003287282 216
450 3300005718 Ga0068866_10137849 Ga0068866_101378492 216
451 3300005719 Ga0068861_100065983 Ga0068861_1000659833 216
452 3300005841 Ga0068863_100014611 Ga0068863_1000146115 216
453 3300005841 Ga0068863_100020006 Ga0068863_1000200061 216
454 3300005842 Ga0068858_100006110 Ga0068858_10000611010 216
455 3300005842 Ga0068858_100025175 Ga0068858_1000251752 216
456 3300005842 Ga0068858_100136776 Ga0068858_1001367762 216
457 3300005842 Ga0068858_100154347 Ga0068858_1001543472 216
458 3300005842 Ga0068858_100189305 Ga0068858_1001893053 216
459 3300005842 Ga0068858_100212979 Ga0068858_1002129791 216
460 3300005843 Ga0068860_100022140 Ga0068860_1000221402 216
461 3300005843 Ga0068860_100052901 Ga0068860_1000529015 216
462 3300005843 Ga0068860_100335028 Ga0068860_1003350281 216
463 3300005843 Ga0068860_100606643 Ga0068860_1006066431 216
464 3300005844 Ga0068862_100494957 Ga0068862_1004949572 216
465 3300005844 Ga0068862_100509350 Ga0068862_1005093502 216
466 3300005985 Ga0081539_10001952 Ga0081539_1000195213 216
467 3300006038 Ga0075365_10002661 Ga0075365_100026613 216
468 3300006042 Ga0075368_10063046 Ga0075368_100630461 216
469 3300006048 Ga0075363_100023183 Ga0075363_1000231833 216
470 3300006051 Ga0075364_10095337 Ga0075364_100953372 216
471 3300006177 Ga0075362_10004805 Ga0075362_100048051 216
472 3300006195 Ga0075366_10000427 Ga0075366_1000042710 216
473 3300006237 Ga0097621_100007454 Ga0097621_1000074544 216
474 3300006237 Ga0097621_100018877 Ga0097621_1000188772 216
475 3300006237 Ga0097621_100048746 Ga0097621_1000487463 216
476 3300006237 Ga0097621_100151866 Ga0097621_1001518662 216
477 3300006358 Ga0068871_100025056 Ga0068871_1000250563 216
478 3300006358 Ga0068871_100026431 Ga0068871_1000264312 216
479 3300006358 Ga0068871_100067749 Ga0068871_1000677493 216
480 3300006358 Ga0068871_100230618 Ga0068871_1002306182 216
481 3300006358 Ga0068871_100362930 Ga0068871_1003629302 216
482 3300006844 Ga0075428_100735482 Ga0075428_1007354821 216
483 3300006846 Ga0075430_100022222 Ga0075430_1000222226 216
484 3300006846 Ga0075430_100079771 Ga0075430_1000797712 216
485 3300006847 Ga0075431_100005275 Ga0075431_1000052758 216
486 3300006847 Ga0075431_100359854 Ga0075431_1003598542 216
487 3300006852 Ga0075433_10076042 Ga0075433_100760423 216
488 3300006852 Ga0075433_10124362 Ga0075433_101243622 216
489 3300006852 Ga0075433_10403792 Ga0075433_104037922 216
490 3300006852 Ga0075433_10456029 Ga0075433_104560291 216
491 3300006871 Ga0075434_100064208 Ga0075434_1000642083 216
492 3300006871 Ga0075434_100825707 Ga0075434_1008257072 216
493 3300006880 Ga0075429_100019625 Ga0075429_1000196253 216
494 3300006881 Ga0068865_100009287 Ga0068865_1000092873 216
495 3300006881 Ga0068865_100093824 Ga0068865_1000938242 216
496 3300006914 Ga0075436_100000008 Ga0075436_100000008193 216
497 3300006914 Ga0075436_100231479 Ga0075436_1002314792 216
498 3300006931 Ga0097620_100020497 Ga0097620_1000204972 216
499 3300006931 Ga0097620_100132591 Ga0097620_1001325912 216
500 3300006931 Ga0097620_100577043 Ga0097620_1005770432 216
501 3300006931 Ga0097620_100792629 Ga0097620_1007926292 216
502 3300007076 Ga0075435_100003209 Ga0075435_1000032094 216
503 3300007076 Ga0075435_100767333 Ga0075435_1007673331 216
504 3300007076 Ga0075435_100771597 Ga0075435_1007715971 216
505 3300007265 Ga0099794_10019109 Ga0099794_100191093 216
506 3300009094 Ga0111539_10005494 Ga0111539_1000549410 216
507 3300009094 Ga0111539_10005643 Ga0111539_100056438 216
508 3300009094 Ga0111539_10069661 Ga0111539_100696612 216
509 3300009098 Ga0105245_10102794 Ga0105245_101027942 216
510 3300009101 Ga0105247_10256181 Ga0105247_102561812 216
511 3300009147 Ga0114129_10004820 Ga0114129_1000482014 216
512 3300009147 Ga0114129_10005760 Ga0114129_1000576014 216
513 3300009147 Ga0114129_10062300 Ga0114129_100623001 216
514 3300009147 Ga0114129_10164783 Ga0114129_101647831 216
515 3300009147 Ga0114129_10240067 Ga0114129_102400672 216
516 3300009147 Ga0114129_10529184 Ga0114129_105291842 216
517 3300009147 Ga0114129_10640987 Ga0114129_106409872 216
518 3300009147 Ga0114129_10979227 Ga0114129_109792272 216
519 3300009147 Ga0114129_11291785 Ga0114129_112917851 216
520 3300009148 Ga0105243_10004026 Ga0105243_100040265 216
521 3300009148 Ga0105243_10047860 Ga0105243_100478602 216
522 3300009148 Ga0105243_11104124 Ga0105243_111041242 216
523 3300009174 Ga0105241_10319426 Ga0105241_103194262 216
524 3300009174 Ga0105241_10816810 Ga0105241_108168102 216
525 3300009176 Ga0105242_10020767 Ga0105242_100207671 216
526 3300009176 Ga0105242_10131911 Ga0105242_101319112 216
527 3300009176 Ga0105242_10157765 Ga0105242_101577651 216
528 3300009177 Ga0105248_10188270 Ga0105248_101882703 216
529 3300009177 Ga0105248_10395519 Ga0105248_103955192 216
530 3300009177 Ga0105248_10837361 Ga0105248_108373611 216
531 3300009551 Ga0105238_10052242 Ga0105238_100522422 216
532 3300009551 Ga0105238_10685670 Ga0105238_106856702 216
533 3300009553 Ga0105249_10011016 Ga0105249_100110166 216
534 3300009553 Ga0105249_10128143 Ga0105249_101281433 216
535 3300010375 Ga0105239_10960897 Ga0105239_109608972 216
536 3300010375 Ga0105239_11095560 Ga0105239_110955601 216
537 3300011119 Ga0105246_10135165 Ga0105246_101351652 216
538 3300011119 Ga0105246_10144583 Ga0105246_101445832 216
539 3300013100 Ga0157373_10027626 Ga0157373_100276263 216
540 3300013100 Ga0157373_10210312 Ga0157373_102103121 216
541 3300013104 Ga0157370_10025513 Ga0157370_100255134 216
542 3300013296 Ga0157374_10032095 Ga0157374_100320955 216
543 3300013296 Ga0157374_10323474 Ga0157374_103234742 216
544 3300013297 Ga0157378_10020401 Ga0157378_100204016 216
545 3300013306 Ga0163162_10178794 Ga0163162_101787942 216
546 3300013306 Ga0163162_10228647 Ga0163162_102286472 216
547 3300013306 Ga0163162_10284668 Ga0163162_102846681 216
548 3300013306 Ga0163162_10291746 Ga0163162_102917462 216
549 3300013307 Ga0157372_10790836 Ga0157372_107908361 216
550 3300013308 Ga0157375_10038209 Ga0157375_100382096 216
551 3300013308 Ga0157375_10062805 Ga0157375_100628054 216
552 3300013308 Ga0157375_10071960 Ga0157375_100719601 216
553 3300013308 Ga0157375_10961224 Ga0157375_109612242 216
554 3300013308 Ga0157375_11476551 Ga0157375_114765511 216
555 3300014325 Ga0163163_10010076 Ga0163163_100100765 216
556 3300014325 Ga0163163_10066634 Ga0163163_100666342 216
557 3300014325 Ga0163163_10142079 Ga0163163_101420792 216
558 3300014325 Ga0163163_10258765 Ga0163163_102587652 216
559 3300014326 Ga0157380_10002199 Ga0157380_100021999 216
560 3300014326 Ga0157380_10034264 Ga0157380_100342644 216
561 3300014326 Ga0157380_10552006 Ga0157380_105520061 216
562 3300014326 Ga0157380_10702341 Ga0157380_107023411 216
563 3300014745 Ga0157377_10038163 Ga0157377_100381633 216
564 3300014968 Ga0157379_10030757 Ga0157379_100307573 216
565 3300014968 Ga0157379_10038580 Ga0157379_100385802 216
566 3300014968 Ga0157379_10388917 Ga0157379_103889172 216
567 3300014969 Ga0157376_10738313 Ga0157376_107383131 216
568 3300017792 Ga0163161_10045692 Ga0163161_100456923 216
569 3300017792 Ga0163161_10130697 Ga0163161_101306971 216
570 3300017792 Ga0163161_10304968 Ga0163161_103049682 216
571 3300017792 Ga0163161_10901074 Ga0163161_109010741 216
572 3300022732 Ga0224569_100350 Ga0224569_1003502 216
573 3300022734 Ga0224571_101635 Ga0224571_1016352 216
574 3300024225 Ga0224572_1023860 Ga0224572_10238602 216
575 3300024227 Ga0228598_1003751 Ga0228598_10037512 216
576 3300025903 Ga0207680_10082738 Ga0207680_100827382 216
577 3300025904 Ga0207647_10013201 Ga0207647_100132015 216
578 3300025907 Ga0207645_10004256 Ga0207645_1000425610 216
579 3300025910 Ga0207684_10000057 Ga0207684_1000005726 216
580 3300025910 Ga0207684_10021136 Ga0207684_100211365 216
581 3300025910 Ga0207684_10051623 Ga0207684_100516233 216
582 3300025911 Ga0207654_10511450 Ga0207654_105114502 216
583 3300025917 Ga0207660_10124396 Ga0207660_101243963 216
584 3300025918 Ga0207662_10007642 Ga0207662_100076426 216
585 3300025918 Ga0207662_10184242 Ga0207662_101842422 216
586 3300025918 Ga0207662_10467561 Ga0207662_104675611 216
587 3300025922 Ga0207646_10038024 Ga0207646_100380242 216
588 3300025922 Ga0207646_10042592 Ga0207646_100425922 216
589 3300025922 Ga0207646_10049630 Ga0207646_100496304 216
590 3300025922 Ga0207646_10155608 Ga0207646_101556082 216
591 3300025925 Ga0207650_10064202 Ga0207650_100642022 216
592 3300025926 Ga0207659_10635053 Ga0207659_106350532 216
593 3300025927 Ga0207687_10559486 Ga0207687_105594861 216
594 3300025928 Ga0207700_10115830 Ga0207700_101158302 216
595 3300025931 Ga0207644_10017412 Ga0207644_100174124 216
596 3300025931 Ga0207644_10022327 Ga0207644_100223272 216
597 3300025932 Ga0207690_10017206 Ga0207690_100172064 216
598 3300025933 Ga0207706_10060347 Ga0207706_100603472 216
599 3300025933 Ga0207706_10576925 Ga0207706_105769251 216
600 3300025934 Ga0207686_10049596 Ga0207686_100495963 216
601 3300025934 Ga0207686_10895687 Ga0207686_108956871 216
602 3300025935 Ga0207709_10075641 Ga0207709_100756412 216
603 3300025935 Ga0207709_10535775 Ga0207709_105357751 216
604 3300025936 Ga0207670_10052415 Ga0207670_100524153 216
605 3300025936 Ga0207670_10227624 Ga0207670_102276242 216
606 3300025936 Ga0207670_10362893 Ga0207670_103628932 216
607 3300025937 Ga0207669_10102161 Ga0207669_101021613 216
608 3300025938 Ga0207704_10041771 Ga0207704_100417713 216
609 3300025938 Ga0207704_10046427 Ga0207704_100464271 216
610 3300025939 Ga0207665_10154177 Ga0207665_101541772 216
611 3300025940 Ga0207691_10001307 Ga0207691_1000130721 216
612 3300025941 Ga0207711_10088945 Ga0207711_100889453 216
613 3300025941 Ga0207711_10151551 Ga0207711_101515513 216
614 3300025941 Ga0207711_11027576 Ga0207711_110275761 216
615 3300025942 Ga0207689_10005329 Ga0207689_100053298 216
616 3300025942 Ga0207689_10009754 Ga0207689_100097544 216
617 3300025942 Ga0207689_10033121 Ga0207689_100331213 216
618 3300025942 Ga0207689_10455021 Ga0207689_104550212 216
619 3300025945 Ga0207679_10051176 Ga0207679_100511763 216
620 3300025945 Ga0207679_10054067 Ga0207679_100540672 216
621 3300025949 Ga0207667_10359121 Ga0207667_103591211 216
622 3300025960 Ga0207651_10366833 Ga0207651_103668332 216
623 3300025961 Ga0207712_10029132 Ga0207712_100291322 216
624 3300025961 Ga0207712_10171800 Ga0207712_101718002 216
625 3300025961 Ga0207712_10239228 Ga0207712_102392282 216
626 3300025961 Ga0207712_10260727 Ga0207712_102607272 216
627 3300025981 Ga0207640_10069296 Ga0207640_100692963 216
628 3300025981 Ga0207640_10363142 Ga0207640_103631421 216
629 3300025981 Ga0207640_10411165 Ga0207640_104111651 216
630 3300025986 Ga0207658_10017502 Ga0207658_100175026 216
631 3300025986 Ga0207658_10098578 Ga0207658_100985782 216
632 3300026023 Ga0207677_10319675 Ga0207677_103196752 216
633 3300026023 Ga0207677_11119713 Ga0207677_111197131 216
634 3300026035 Ga0207703_10040759 Ga0207703_100407593 216
635 3300026035 Ga0207703_10061571 Ga0207703_100615714 216
636 3300026035 Ga0207703_10092280 Ga0207703_100922803 216
637 3300026035 Ga0207703_10307158 Ga0207703_103071581 216
638 3300026041 Ga0207639_10004670 Ga0207639_100046703 216
639 3300026041 Ga0207639_10588551 Ga0207639_105885511 216
640 3300026067 Ga0207678_10010423 Ga0207678_100104234 216
641 3300026075 Ga0207708_10004707 Ga0207708_100047079 216
642 3300026075 Ga0207708_10023536 Ga0207708_100235362 216
643 3300026075 Ga0207708_10041173 Ga0207708_100411732 216
644 3300026075 Ga0207708_10076890 Ga0207708_100768902 216
645 3300026078 Ga0207702_10191288 Ga0207702_101912882 216
646 3300026088 Ga0207641_10020923 Ga0207641_100209236 216
647 3300026088 Ga0207641_10057312 Ga0207641_100573122 216
648 3300026088 Ga0207641_10186090 Ga0207641_101860901 216
649 3300026088 Ga0207641_10532315 Ga0207641_105323152 216
650 3300026089 Ga0207648_10009024 Ga0207648_100090243 216
651 3300026089 Ga0207648_10046582 Ga0207648_100465822 216
652 3300026095 Ga0207676_10029661 Ga0207676_100296612 216
653 3300026095 Ga0207676_10056046 Ga0207676_100560462 216
654 3300026095 Ga0207676_10381798 Ga0207676_103817982 216
655 3300026116 Ga0207674_10001093 Ga0207674_1000109324 216
656 3300026116 Ga0207674_10015666 Ga0207674_100156663 216
657 3300026116 Ga0207674_10022789 Ga0207674_100227893 216
658 3300026118 Ga0207675_100031702 Ga0207675_1000317023 216
659 3300026118 Ga0207675_100071904 Ga0207675_1000719042 216
660 3300026121 Ga0207683_10031582 Ga0207683_100315823 216
661 3300026142 Ga0207698_10046034 Ga0207698_100460343 216
662 3300026142 Ga0207698_10100382 Ga0207698_101003823 216
663 3300027866 Ga0209813_10030346 Ga0209813_100303462 216
664 3300027907 Ga0207428_10000741 Ga0207428_1000074130 216
665 3300027907 Ga0207428_10033144 Ga0207428_100331442 216
666 3300027907 Ga0207428_10040803 Ga0207428_100408032 216
667 3300028379 Ga0268266_10529173 Ga0268266_105291731 216
668 3300028381 Ga0268264_10169320 Ga0268264_101693201 216
669 3300028381 Ga0268264_10199723 Ga0268264_101997232 216
670 3300028381 Ga0268264_10235974 Ga0268264_102359743 216
671 3300028381 Ga0268264_10963484 Ga0268264_109634841 216
672 3300031235 Ga0265330_10000718 Ga0265330_1000071811 216
673 3300031235 Ga0265330_10005817 Ga0265330_100058174 216
674 3300031242 Ga0265329_10015935 Ga0265329_100159352 216
675 3300031344 Ga0265316_10005360 Ga0265316_100053608 216
676 3300031712 Ga0265342_10002221 Ga0265342_100022214 216
677 3300031901 Ga0307406_10012049 Ga0307406_100120495 216
678 3300031901 Ga0307406_10264427 Ga0307406_102644271 216
679 3300032126 Ga0307415_100482267 Ga0307415_1004822671 216
680 3300035091 Ga0373951_0008266 Ga0373951_0008266_1261_1920 216
681 3300035207 Ga0373942_0006561 Ga0373942_0006561_1242_1892 216
682 3300041509 Ga0451843_0740440 Ga0451843_0740440_42_692 216
683 3300045051 Ga0451576_0111661 Ga0451576_0111661_996_1670 216
684 3300045051 Ga0451576_0561451 Ga0451576_0561451_500_1165 216
685 3300045051 Ga0451576_0652491 Ga0451576_0652491_204_857 216
686 3300046664 Ga0495659_0050184 Ga0495659_0050184_659_1309 216
687 3300046684 Ga0495669_0188112 Ga0495669_0188112_115_768 216
688 3300047322 Ga0495680_0211301 Ga0495680_0211301_382_1050 216
689 3300048904 Ga0496101_0054326 Ga0496101_0054326_1134_1787 216
690 3300048905 Ga0496102_0405637 Ga0496102_0405637_313_963 216
691 3300048907 Ga0496104_0491804 Ga0496104_0491804_295_960 216
692 3300048915 Ga0496112_0328598 Ga0496112_0328598_289_939 216
693 3300049588 Ga0501072_0085433 Ga0501072_0085433_1419_2081 216
694 3300049655 Ga0501208_048383 Ga0501208_048383_112_768 216
695 3300049665 Ga0501227_077226 Ga0501227_077226_52_714 216
696 3300049669 Ga0501235_064804 Ga0501235_064804_41_703 216
697 3300049679 Ga0501249_070951 Ga0501249_070951_82_744 216
698 3300049683 Ga0501253_068141 Ga0501253_068141_77_739 216
699 3300049741 Ga0501079_0249801 Ga0501079_0249801_226_879 216
700 3300049741 Ga0501079_0312889 Ga0501079_0312889_214_876 216
701 3300049743 Ga0501081_0440341 Ga0501081_0440341_123_776 216
702 3300049770 Ga0501273_035228 Ga0501273_035228_19_681 216
703 3300049850 Ga0501204_030730 Ga0501204_030730_30_692 216
704 3300050489 nmdc:mga03683_129280_c2 nmdc:mga03683_129280_c2_34_687 216
705 3300050490 nmdc:mga03n38_180244_c1 nmdc:mga03n38_180244_c1_21_674 216
706 3300050491 nmdc:mga00v17_26556_c1 nmdc:mga00v17_26556_c1_1116_1769 216
707 3300050492 nmdc:mga0yw44_33764_c1 nmdc:mga0yw44_33764_c1_1947_2600 216
708 3300050493 nmdc:mga0k408_218_c1 nmdc:mga0k408_218_c1_8015_8668 216
709 3300050495 nmdc:mga04h51_42863_c1 nmdc:mga04h51_42863_c1_85_738 216
710 3300050507 nmdc:mga05p37_1061_c1 nmdc:mga05p37_1061_c1_2972_3625 216
711 3300050507 nmdc:mga05p37_214153_c1 nmdc:mga05p37_214153_c1_1388_2041 216
712 3300050507 nmdc:mga05p37_6857_c1 nmdc:mga05p37_6857_c1_286_966 216
713 3300050507 nmdc:mga05p37_701062_c1 nmdc:mga05p37_701062_c1_152_814 216
714 3300050507 nmdc:mga05p37_97081_c1 nmdc:mga05p37_97081_c1_256_909 216
715 3300050508 nmdc:mga09592_17060_c1 nmdc:mga09592_17060_c1_1518_2171 216
716 3300050509 nmdc:mga0qj67_401647_c1 nmdc:mga0qj67_401647_c1_290_940 216
717 3300050510 nmdc:mga06r32_188961_c1 nmdc:mga06r32_188961_c1_567_1217 216
718 3300050510 nmdc:mga06r32_4917_c1 nmdc:mga06r32_4917_c1_5280_5933 216
719 3300050510 nmdc:mga06r32_685798_c1 nmdc:mga06r32_685798_c1_328_981 216
720 3300050510 nmdc:mga06r32_981797_c1 nmdc:mga06r32_981797_c1_69_722 216
721 3300050511 nmdc:mga08y16_20585_c1 nmdc:mga08y16_20585_c1_4110_4760 216
722 3300050511 nmdc:mga08y16_2339_c1 nmdc:mga08y16_2339_c1_12447_13100 216
723 3300050512 nmdc:mga0n895_157091_c1 nmdc:mga0n895_157091_c1_514_1176 216
724 3300050512 nmdc:mga0n895_71041_c1 nmdc:mga0n895_71041_c1_906_1559 216
725 3300050513 nmdc:mga0rr50_2108_c1 nmdc:mga0rr50_2108_c1_8895_9572 216
726 3300050513 nmdc:mga0rr50_275096_c1 nmdc:mga0rr50_275096_c1_646_1299 216
727 3300050514 nmdc:mga08x19_165167_c2 nmdc:mga08x19_165167_c2_355_1017 216
728 3300050514 nmdc:mga08x19_16_c1 nmdc:mga08x19_16_c1_194036_194713 216
729 3300050515 nmdc:mga0a205_107910_c1 nmdc:mga0a205_107910_c1_1109_1765 216
730 3300050515 nmdc:mga0a205_193470_c1 nmdc:mga0a205_193470_c1_1027_1689 216
731 3300050515 nmdc:mga0a205_368505_c1 nmdc:mga0a205_368505_c1_111_791 216
732 3300050515 nmdc:mga0a205_84770_c1 nmdc:mga0a205_84770_c1_1708_2361 216
733 3300050516 nmdc:mga0sz30_76907_c1 nmdc:mga0sz30_76907_c1_29_682 216
734 3300059424 Ga0590075_013829 Ga0590075_013829_129_800 216
735 3300005331 Ga0070670_100000264 Ga0070670_10000026441 217
736 3300005467 Ga0070706_100110660 Ga0070706_1001106603 217
737 3300005468 Ga0070707_100752982 Ga0070707_1007529821 217
738 3300006881 Ga0068865_100300764 Ga0068865_1003007642 217
739 3300009011 Ga0105251_10240377 Ga0105251_102403772 217
740 3300009098 Ga0105245_11316173 Ga0105245_113161731 217
741 3300009147 Ga0114129_10229681 Ga0114129_102296813 217
742 3300009148 Ga0105243_10018027 Ga0105243_100180274 217
743 3300009174 Ga0105241_10167925 Ga0105241_101679252 217
744 3300009174 Ga0105241_10534624 Ga0105241_105346242 217
745 3300009176 Ga0105242_10033815 Ga0105242_100338154 217
746 3300010375 Ga0105239_10329618 Ga0105239_103296182 217
747 3300013105 Ga0157369_10035880 Ga0157369_100358804 217
748 3300013297 Ga0157378_10141442 Ga0157378_101414423 217
749 3300013306 Ga0163162_10008614 Ga0163162_100086142 217
750 3300013307 Ga0157372_10010368 Ga0157372_100103687 217
751 3300014969 Ga0157376_10014317 Ga0157376_100143174 217
752 3300017792 Ga0163161_10254305 Ga0163161_102543051 217
753 3300025923 Ga0207681_10043155 Ga0207681_100431553 217
754 3300025934 Ga0207686_10088898 Ga0207686_100888983 217
755 3300025935 Ga0207709_10009418 Ga0207709_100094184 217
756 3300026035 Ga0207703_10051577 Ga0207703_100515772 217
757 3300026075 Ga0207708_10022757 Ga0207708_100227572 217
758 3300026089 Ga0207648_10058627 Ga0207648_100586273 217
759 3300046543 Ga0495645_0336344 Ga0495645_0336344_107_787 217
760 3300048908 Ga0496105_0054848 Ga0496105_0054848_1189_1860 217
761 3300048915 Ga0496112_0412945 Ga0496112_0412945_570_1223 217
762 3300050507 nmdc:mga05p37_383515_c1 nmdc:mga05p37_383515_c1_141_797 217
763 3300053077 Ga0495601_0007655 Ga0495601_0007655_3010_3681 217
764 3300003203 JGI25406J46586_10011403 JGI25406J46586_100114035 218
765 3300005289 Ga0065704_10078408 Ga0065704_100784082 218
766 3300005295 Ga0065707_10010407 Ga0065707_100104073 218
767 3300005331 Ga0070670_100270655 Ga0070670_1002706552 218
768 3300005353 Ga0070669_100426873 Ga0070669_1004268732 218
769 3300005364 Ga0070673_100016561 Ga0070673_1000165613 218
770 3300005459 Ga0068867_100122516 Ga0068867_1001225162 218
771 3300005459 Ga0068867_100239130 Ga0068867_1002391302 218
772 3300005617 Ga0068859_100514661 Ga0068859_1005146612 218
773 3300005618 Ga0068864_100226904 Ga0068864_1002269042 218
774 3300005985 Ga0081539_10001896 Ga0081539_1000189613 218
775 3300006931 Ga0097620_100514619 Ga0097620_1005146192 218
776 3300006931 Ga0097620_100632570 Ga0097620_1006325702 218
777 3300009094 Ga0111539_10056166 Ga0111539_100561663 218
778 3300009176 Ga0105242_11140144 Ga0105242_111401441 218
779 3300009553 Ga0105249_10379003 Ga0105249_103790032 218
780 3300010375 Ga0105239_10302270 Ga0105239_103022702 218
781 3300014325 Ga0163163_10000278 Ga0163163_1000027824 218
782 3300014325 Ga0163163_11113694 Ga0163163_111136941 218
783 3300025925 Ga0207650_10000001 Ga0207650_10000001772 218
784 3300025925 Ga0207650_10348687 Ga0207650_103486871 218
785 3300025925 Ga0207650_10369766 Ga0207650_103697661 218
786 3300026023 Ga0207677_10217214 Ga0207677_102172141 218
787 3300026089 Ga0207648_10140863 Ga0207648_101408631 218
788 3300050511 nmdc:mga08y16_50331_c1 nmdc:mga08y16_50331_c1_2240_2896 218
789 3300050515 nmdc:mga0a205_141587_c1 nmdc:mga0a205_141587_c1_782_1438 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

41

237

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.9481 9 214
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.9472 9 214
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9448 6 214
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.944 9 213
6xh5-assembly1.cif.gz_A hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks 0.9426 5 213
ID Description Score Start End Superfamily
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9534 41 211 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9511 5 215 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9474 9 218 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9333 5 215 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9251 17 218 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V8S183-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9995 3 218 GO:0016829
AF-A0A2V8GAB8-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9963 3 217 GO:0016829
AF-A0A2N9L453-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (EC 4.1.2.14, EC 4.1.3.16) 0.995 9 218 GO:0000160
GO:0008675
GO:0008700
AF-A0A2V8S183-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9949 3 218 GO:0016829
AF-A0A3L6JGD4-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9931 4 216 GO:0016829

Feature Viewer

pLDDT pTM Quality
97.41 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map