F480890

General Info

Members Datasets Scaffolds Average Seq Length
789 329 1578 112

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10155452|Ga0065715_101554522
Length 116
Sequence MAESAKPSDLLQGTLDMLILKTLTLEPLHGYAIGVRITQISKGAFAVNAGSLFPAFRRLERDGLIKGEWRLTENNRRAKRYVLTARGRARLKDDMRDWEAQVRAISHILKARLADL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
225 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
228 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
229 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 2.66
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 22.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10155452 3300005293 Unclassified 1682
2 JGI24751J29686_10000613 3300002459 Bacteria 9278
3 Ga0065712_10073569 3300005290 Bacteria 4345
4 Ga0065715_10035688 3300005293 Bacteria 1150
5 Ga0065715_10308548 3300005293 Bacteria 1025
6 Ga0065715_10370190 3300005293 Bacteria 922
7 Ga0065707_10190951 3300005295 Bacteria 1361
8 Ga0065707_10256386 3300005295 Unclassified 1110
9 Ga0070676_10400109 3300005328 Unclassified 955
10 Ga0070676_10649683 3300005328 Bacteria 765
11 Ga0070683_100000470 3300005329 Bacteria 28333
12 Ga0070683_100521236 3300005329 Bacteria 1136
13 Ga0070683_100667595 3300005329 Unclassified 995
14 Ga0070690_100077942 3300005330 Bacteria 2164
15 Ga0070690_100100163 3300005330 Bacteria 1920
16 Ga0070690_101510895 3300005330 Bacteria 543
17 Ga0070670_100002170 3300005331 Bacteria 16123
18 Ga0070670_100006376 3300005331 Bacteria 9986
19 Ga0070670_100208341 3300005331 Bacteria 1699
20 Ga0070670_100625306 3300005331 Unclassified 965
21 Ga0068869_100000886 3300005334 Bacteria 17252
22 Ga0068869_100483082 3300005334 Bacteria 1032
23 Ga0070666_10083937 3300005335 Bacteria 2179
24 Ga0070666_10325291 3300005335 Unclassified 1097
25 Ga0070680_100105010 3300005336 Unclassified 2348
26 Ga0070680_100737687 3300005336 Unclassified 848
27 Ga0070682_100822743 3300005337 Bacteria 756
28 Ga0068868_100591448 3300005338 Unclassified 982
29 Ga0070660_100149465 3300005339 Bacteria 1878
30 Ga0070689_100014089 3300005340 Bacteria 5799
31 Ga0070689_100970702 3300005340 Bacteria 755
32 Ga0070687_100008851 3300005343 Bacteria 4280
33 Ga0070687_100270062 3300005343 Bacteria 1065
34 Ga0070661_100225172 3300005344 Bacteria 1440
35 Ga0070661_100280580 3300005344 Unclassified 1292
36 Ga0070692_10084319 3300005345 Bacteria 1717
37 Ga0070669_100097756 3300005353 Bacteria 2210
38 Ga0070675_100038434 3300005354 Bacteria 3900
39 Ga0070675_100124163 3300005354 Bacteria 2195
40 Ga0070675_100590297 3300005354 Bacteria 1007
41 Ga0070671_100026824 3300005355 Bacteria 4738
42 Ga0070671_100088035 3300005355 Bacteria 2598
43 Ga0070671_101043911 3300005355 Unclassified 717
44 Ga0070674_100074368 3300005356 Bacteria 2411
45 Ga0070674_100163542 3300005356 Bacteria 1691
46 Ga0070674_100283082 3300005356 Bacteria 1315
47 Ga0070674_100410524 3300005356 Bacteria 1109
48 Ga0070674_101253935 3300005356 Bacteria 660
49 Ga0070673_100010320 3300005364 Bacteria 6318
50 Ga0070673_100105816 3300005364 Bacteria 2325
51 Ga0070673_100518618 3300005364 Bacteria 1080
52 Ga0070673_102284618 3300005364 Unclassified 514
53 Ga0070673_102297150 3300005364 Unclassified 513
54 Ga0070688_100030125 3300005365 Bacteria 3255
55 Ga0070659_100004103 3300005366 Bacteria 10380
56 Ga0070659_100052120 3300005366 Unclassified 3218
57 Ga0070659_100925622 3300005366 Bacteria 763
58 Ga0070667_100140443 3300005367 Unclassified 2115
59 Ga0070667_100583060 3300005367 Unclassified 1029
60 Ga0070667_100805715 3300005367 Bacteria 872
61 Ga0070709_10000958 3300005434 Bacteria 16037
62 Ga0070709_10002667 3300005434 Bacteria 9637
63 Ga0070709_10140314 3300005434 Bacteria 1660
64 Ga0070709_10635642 3300005434 Bacteria 825
65 Ga0070709_10790132 3300005434 Unclassified 744
66 Ga0070709_11103508 3300005434 Unclassified 635
67 Ga0070709_11211017 3300005434 Bacteria 607
68 Ga0070714_100074203 3300005435 Bacteria 2949
69 Ga0070714_100164240 3300005435 Bacteria 2011
70 Ga0070714_100500009 3300005435 Unclassified 1159
71 Ga0070714_100508327 3300005435 Bacteria 1150
72 Ga0070714_100781132 3300005435 Unclassified 924
73 Ga0070713_100002828 3300005436 Bacteria 11356
74 Ga0070713_100275108 3300005436 Unclassified 1543
75 Ga0070713_100545125 3300005436 Bacteria 1098
76 Ga0070710_10030061 3300005437 Bacteria 2920
77 Ga0070710_10056501 3300005437 Bacteria 2221
78 Ga0070710_11509803 3300005437 Unclassified 505
79 Ga0070701_10008424 3300005438 Bacteria 4460
80 Ga0070711_100028595 3300005439 Bacteria 3669
81 Ga0070711_100084262 3300005439 Bacteria 2274
82 Ga0070700_100473879 3300005441 Bacteria 958
83 Ga0070708_100989082 3300005445 Bacteria 789
84 Ga0070663_100895954 3300005455 Bacteria 766
85 Ga0070678_100050405 3300005456 Bacteria 3011
86 Ga0070678_100489340 3300005456 Bacteria 1084
87 Ga0070662_100012690 3300005457 Bacteria 5592
88 Ga0070662_100226559 3300005457 Bacteria 1494
89 Ga0070662_101143898 3300005457 Bacteria 668
90 Ga0070681_10000580 3300005458 Bacteria 30243
91 Ga0070681_10035184 3300005458 Bacteria 5030
92 Ga0070681_10119806 3300005458 Bacteria 2567
93 Ga0070681_10164933 3300005458 Unclassified 2138
94 Ga0070681_10414067 3300005458 Bacteria 1259
95 Ga0070681_10839614 3300005458 Bacteria 836
96 Ga0068867_100124235 3300005459 Unclassified 1998
97 Ga0068867_100595876 3300005459 Unclassified 963
98 Ga0070685_10150052 3300005466 Bacteria 1476
99 Ga0070706_100197396 3300005467 Bacteria 1880
100 Ga0070707_100560060 3300005468 Unclassified 1105
101 Ga0070707_102028192 3300005468 Bacteria 543
102 Ga0070698_100134652 3300005471 Bacteria 2425
103 Ga0070698_100358999 3300005471 Bacteria 1389
104 Ga0070698_101168370 3300005471 Unclassified 719
105 Ga0070698_101543449 3300005471 Unclassified 616
106 Ga0070699_100838039 3300005518 Unclassified 842
107 Ga0070679_100038518 3300005530 Unclassified 4753
108 Ga0070679_100093790 3300005530 Bacteria 2989
109 Ga0070679_100333843 3300005530 Bacteria 1464
110 Ga0070684_100001638 3300005535 Bacteria 16218
111 Ga0070684_100005806 3300005535 Bacteria 9492
112 Ga0070684_100107634 3300005535 Bacteria 2497
113 Ga0070684_100121381 3300005535 Bacteria 2351
114 Ga0070684_100268904 3300005535 Bacteria 1560
115 Ga0070684_100302793 3300005535 Bacteria 1467
116 Ga0068853_100547404 3300005539 Bacteria 1096
117 Ga0068853_101603070 3300005539 Unclassified 631
118 Ga0068853_101640113 3300005539 Unclassified 623
119 Ga0070672_100100694 3300005543 Bacteria 2343
120 Ga0070672_100104641 3300005543 Bacteria 2300
121 Ga0070672_100367112 3300005543 Bacteria 1229
122 Ga0070686_100633233 3300005544 Unclassified 846
123 Ga0070686_100669882 3300005544 Bacteria 824
124 Ga0070686_101350536 3300005544 Bacteria 597
125 Ga0070686_101878739 3300005544 Unclassified 511
126 Ga0070695_100028757 3300005545 Bacteria 3451
127 Ga0070693_100128035 3300005547 Bacteria 1583
128 Ga0070693_100253320 3300005547 Bacteria 1168
129 Ga0070693_100801005 3300005547 Bacteria 698
130 Ga0070665_100177276 3300005548 Unclassified 2132
131 Ga0070665_100371156 3300005548 Bacteria 1438
132 Ga0070704_100237625 3300005549 Bacteria 1490
133 Ga0068855_100524832 3300005563 Bacteria 1284
134 Ga0068855_101222664 3300005563 Unclassified 780
135 Ga0068855_102377477 3300005563 Unclassified 529
136 Ga0068855_102432701 3300005563 Bacteria 522
137 Ga0070664_100027531 3300005564 Bacteria 4724
138 Ga0070664_100426447 3300005564 Unclassified 1215
139 Ga0070664_100534765 3300005564 Bacteria 1083
140 Ga0070664_100671215 3300005564 Unclassified 964
141 Ga0068857_100051807 3300005577 Bacteria 3642
142 Ga0068857_101328690 3300005577 Unclassified 698
143 Ga0068854_100020804 3300005578 Bacteria 4445
144 Ga0068854_100054251 3300005578 Bacteria 2882
145 Ga0068856_100398962 3300005614 Bacteria 1395
146 Ga0068856_100847939 3300005614 Bacteria 933
147 Ga0068856_100871621 3300005614 Unclassified 919
148 Ga0070702_100032870 3300005615 Bacteria 2849
149 Ga0070702_101102207 3300005615 Unclassified 634
150 Ga0068852_100014219 3300005616 Bacteria 6115
151 Ga0068852_100018058 3300005616 Bacteria 5549
152 Ga0068859_100011907 3300005617 Bacteria 8741
153 Ga0068859_100094688 3300005617 Bacteria 3039
154 Ga0068859_100110502 3300005617 Bacteria 2810
155 Ga0068859_100220642 3300005617 Bacteria 1983
156 Ga0068859_100697678 3300005617 Bacteria 1106
157 Ga0068859_101823205 3300005617 Bacteria 672
158 Ga0068864_100049147 3300005618 Bacteria 3628
159 Ga0068864_100129432 3300005618 Bacteria 2266
160 Ga0068864_100323684 3300005618 Unclassified 1448
161 Ga0068864_102610633 3300005618 Bacteria 511
162 Ga0068861_100374121 3300005719 Bacteria 1257
163 Ga0068861_100928645 3300005719 Unclassified 826
164 Ga0068861_101251022 3300005719 Unclassified 720
165 Ga0068851_10157942 3300005834 Bacteria 1244
166 Ga0068870_10443771 3300005840 Bacteria 854
167 Ga0068870_10710831 3300005840 Bacteria 694
168 Ga0068863_101059008 3300005841 Bacteria 815
169 Ga0068858_100035562 3300005842 Bacteria 4620
170 Ga0068858_100074107 3300005842 Bacteria 3160
171 Ga0068858_100094316 3300005842 Bacteria 2788
172 Ga0068860_100115818 3300005843 Bacteria 2563
173 Ga0068860_100138263 3300005843 Bacteria 2340
174 Ga0068860_100850402 3300005843 Unclassified 927
175 Ga0068860_102803485 3300005843 Unclassified 505
176 Ga0068862_100102380 3300005844 Bacteria 2507
177 Ga0068862_100202514 3300005844 Unclassified 1790
178 Ga0081455_10005606 3300005937 Bacteria 13719
179 Ga0081455_10093161 3300005937 Bacteria 2436
180 Ga0081539_10110009 3300005985 Bacteria 1389
181 Ga0070717_10008222 3300006028 Bacteria 7791
182 Ga0070717_10017356 3300006028 Bacteria 5601
183 Ga0070717_10420797 3300006028 Bacteria 1202
184 Ga0070717_10818537 3300006028 Unclassified 847
185 Ga0070717_11539549 3300006028 Unclassified 603
186 Ga0070717_11820523 3300006028 Unclassified 550
187 Ga0075365_10801000 3300006038 Bacteria 665
188 Ga0075368_10011790 3300006042 Bacteria 3188
189 Ga0075363_100013794 3300006048 Bacteria 3932
190 Ga0075364_10165415 3300006051 Unclassified 1494
191 Ga0070715_10311872 3300006163 Bacteria 846
192 Ga0070716_100008659 3300006173 Bacteria 5054
193 Ga0070716_100058021 3300006173 Unclassified 2226
194 Ga0070716_100469818 3300006173 Unclassified 921
195 Ga0070712_100011882 3300006175 Bacteria 5532
196 Ga0070712_100015952 3300006175 Unclassified 4845
197 Ga0075367_10029293 3300006178 Bacteria 3148
198 Ga0075367_10048970 3300006178 Bacteria 2490
199 Ga0075367_10181702 3300006178 Bacteria 1311
200 Ga0075366_10005121 3300006195 Bacteria 7090
201 Ga0075366_10142883 3300006195 Bacteria 1447
202 Ga0097621_100000820 3300006237 Bacteria 21967
203 Ga0097621_101732026 3300006237 Bacteria 595
204 Ga0075370_10080837 3300006353 Bacteria 1868
205 Ga0075370_10110166 3300006353 Bacteria 1598
206 Ga0075370_10845602 3300006353 Bacteria 559
207 Ga0068871_100037095 3300006358 Unclassified 3885
208 Ga0068871_100925092 3300006358 Bacteria 809
209 Ga0068871_101223769 3300006358 Unclassified 705
210 Ga0075428_100006967 3300006844 Bacteria 12541
211 Ga0075428_100117001 3300006844 Bacteria 2903
212 Ga0075428_100127130 3300006844 Unclassified 2773
213 Ga0075428_100328125 3300006844 Bacteria 1644
214 Ga0075430_100363184 3300006846 Bacteria 1195
215 Ga0075430_101435681 3300006846 Bacteria 567
216 Ga0075431_100081416 3300006847 Bacteria 3343
217 Ga0075431_100093635 3300006847 Bacteria 3100
218 Ga0075431_100179097 3300006847 Bacteria 2176
219 Ga0075431_100544397 3300006847 Bacteria 1149
220 Ga0075431_101516632 3300006847 Bacteria 629
221 Ga0075433_10311664 3300006852 Bacteria 1393
222 Ga0075433_11516057 3300006852 Unclassified 579
223 Ga0075433_11767424 3300006852 Unclassified 532
224 Ga0075434_100152863 3300006871 Bacteria 2328
225 Ga0075434_100228189 3300006871 Bacteria 1881
226 Ga0075434_100416312 3300006871 Bacteria 1365
227 Ga0075434_100499948 3300006871 Bacteria 1237
228 Ga0075434_100526722 3300006871 Bacteria 1202
229 Ga0075434_100687522 3300006871 Unclassified 1041
230 Ga0068865_101649034 3300006881 Bacteria 577
231 Ga0075436_100010338 3300006914 Bacteria 6394
232 Ga0075436_100020292 3300006914 Unclassified 4561
233 Ga0075436_100242078 3300006914 Unclassified 1283
234 Ga0075436_100396763 3300006914 Bacteria 999
235 Ga0075436_100500361 3300006914 Bacteria 889
236 Ga0097620_100011907 3300006931 Bacteria 8741
237 Ga0097620_100094689 3300006931 Bacteria 3039
238 Ga0097620_100110503 3300006931 Bacteria 2810
239 Ga0097620_100220651 3300006931 Bacteria 1983
240 Ga0097620_100697629 3300006931 Bacteria 1106
241 Ga0097620_101822805 3300006931 Bacteria 672
242 Ga0075435_100011431 3300007076 Bacteria 6531
243 Ga0075435_100068822 3300007076 Unclassified 2885
244 Ga0075435_100364601 3300007076 Bacteria 1240
245 Ga0075435_100554565 3300007076 Bacteria 995
246 Ga0075435_101890385 3300007076 Unclassified 524
247 Ga0105250_10356686 3300009092 Unclassified 641
248 Ga0105240_10141974 3300009093 Bacteria 2870
249 Ga0105240_10341633 3300009093 Unclassified 1700
250 Ga0105240_10511738 3300009093 Unclassified 1333
251 Ga0111539_10048893 3300009094 Bacteria 5048
252 Ga0111539_10082429 3300009094 Bacteria 3783
253 Ga0111539_10552122 3300009094 Bacteria 1342
254 Ga0105245_10006199 3300009098 Bacteria 10521
255 Ga0105245_10085988 3300009098 Unclassified 2883
256 Ga0105245_10092964 3300009098 Bacteria 2779
257 Ga0105247_10018573 3300009101 Bacteria 4172
258 Ga0105247_10841216 3300009101 Unclassified 704
259 Ga0105247_10854435 3300009101 Unclassified 699
260 Ga0114129_10004132 3300009147 Bacteria 20512
261 Ga0114129_10005746 3300009147 Bacteria 17576
262 Ga0114129_10056877 3300009147 Bacteria 5476
263 Ga0114129_10103108 3300009147 Bacteria 3945
264 Ga0114129_10163827 3300009147 Bacteria 3036
265 Ga0114129_10289812 3300009147 Bacteria 2185
266 Ga0114129_10952036 3300009147 Bacteria 1084
267 Ga0114129_11125412 3300009147 Bacteria 982
268 Ga0114129_12622287 3300009147 Unclassified 601
269 Ga0105243_10035361 3300009148 Bacteria 3872
270 Ga0105243_10314610 3300009148 Bacteria 1424
271 Ga0105241_10025190 3300009174 Unclassified 4422
272 Ga0105241_10096884 3300009174 Bacteria 2338
273 Ga0105241_10213337 3300009174 Bacteria 1618
274 Ga0105241_10440946 3300009174 Unclassified 1150
275 Ga0105242_10013079 3300009176 Bacteria 6404
276 Ga0105242_10861897 3300009176 Bacteria 902
277 Ga0105248_10028400 3300009177 Bacteria 6232
278 Ga0105248_10074913 3300009177 Bacteria 3804
279 Ga0105248_10147956 3300009177 Bacteria 2650
280 Ga0105248_10172979 3300009177 Bacteria 2434
281 Ga0105248_10311307 3300009177 Bacteria 1773
282 Ga0105248_10314238 3300009177 Bacteria 1764
283 Ga0105248_11053326 3300009177 Bacteria 919
284 Ga0105248_11094484 3300009177 Bacteria 901
285 Ga0105248_13247310 3300009177 Unclassified 517
286 Ga0105248_13262127 3300009177 Unclassified 516
287 Ga0105237_10001120 3300009545 Bacteria 35914
288 Ga0105237_10063485 3300009545 Unclassified 3691
289 Ga0105237_10106534 3300009545 Bacteria 2795
290 Ga0105237_10639895 3300009545 Unclassified 1070
291 Ga0105237_10927263 3300009545 Bacteria 878
292 Ga0105237_10960608 3300009545 Bacteria 861
293 Ga0105238_10161300 3300009551 Bacteria 2218
294 Ga0105238_10636468 3300009551 Bacteria 1076
295 Ga0105238_10938851 3300009551 Bacteria 884
296 Ga0105238_11732989 3300009551 Unclassified 656
297 Ga0105249_10182680 3300009553 Bacteria 2042
298 Ga0105249_10208512 3300009553 Bacteria 1916
299 Ga0105249_10669344 3300009553 Unclassified 1096
300 Ga0105249_11610838 3300009553 Bacteria 722
301 Ga0105249_12023783 3300009553 Unclassified 649
302 Ga0105239_10007809 3300010375 Bacteria 12236
303 Ga0105239_10179416 3300010375 Bacteria 2369
304 Ga0105239_10737290 3300010375 Bacteria 1127
305 Ga0105239_12274811 3300010375 Bacteria 631
306 Ga0105246_10090789 3300011119 Bacteria 2200
307 Ga0105246_10260968 3300011119 Unclassified 1380
308 Ga0105246_11793716 3300011119 Bacteria 586
309 Ga0157371_10067226 3300013102 Bacteria 2537
310 Ga0157370_10380694 3300013104 Bacteria 1300
311 Ga0157369_10375511 3300013105 Bacteria 1476
312 Ga0157369_10743411 3300013105 Bacteria 1009
313 Ga0157369_10930742 3300013105 Bacteria 891
314 Ga0157374_10009184 3300013296 Bacteria 8476
315 Ga0157378_10073658 3300013297 Bacteria 3071
316 Ga0163162_10203511 3300013306 Unclassified 2109
317 Ga0163162_11618573 3300013306 Bacteria 739
318 Ga0163162_12280288 3300013306 Bacteria 622
319 Ga0157372_10013618 3300013307 Bacteria 8693
320 Ga0157372_10077122 3300013307 Unclassified 3763
321 Ga0157372_10297465 3300013307 Bacteria 1877
322 Ga0157372_10367151 3300013307 Bacteria 1677
323 Ga0157372_11635507 3300013307 Unclassified 741
324 Ga0157375_10020223 3300013308 Bacteria 6077
325 Ga0157375_12962017 3300013308 Unclassified 567
326 Ga0163163_10103144 3300014325 Bacteria 2876
327 Ga0163163_10166427 3300014325 Bacteria 2251
328 Ga0163163_10948898 3300014325 Bacteria 923
329 Ga0163163_11961529 3300014325 Bacteria 645
330 Ga0163163_12290587 3300014325 Bacteria 599
331 Ga0157380_11395297 3300014326 Bacteria 751
332 Ga0157377_10004647 3300014745 Bacteria 6351
333 Ga0157377_10175198 3300014745 Bacteria 1344
334 Ga0157379_10072213 3300014968 Bacteria 3087
335 Ga0157379_10384799 3300014968 Bacteria 1287
336 Ga0157379_10534932 3300014968 Bacteria 1089
337 Ga0157379_11536665 3300014968 Bacteria 648
338 Ga0157379_12033323 3300014968 Bacteria 568
339 Ga0157376_10050713 3300014969 Bacteria 3444
340 Ga0157376_11580272 3300014969 Bacteria 690
341 Ga0157376_12245705 3300014969 Bacteria 585
342 Ga0157376_12783131 3300014969 Bacteria 529
343 Ga0163161_10143788 3300017792 Bacteria 1808
344 Ga0213873_10185401 3300021358 Unclassified 640
345 Ga0207666_1025226 3300025271 Bacteria 891
346 Ga0207697_10006720 3300025315 Bacteria 5177
347 Ga0207697_10125231 3300025315 Bacteria 1108
348 Ga0207656_10105398 3300025321 Bacteria 1297
349 Ga0207682_10209275 3300025893 Bacteria 899
350 Ga0207692_10086554 3300025898 Bacteria 1689
351 Ga0207692_10102833 3300025898 Bacteria 1572
352 Ga0207710_10191565 3300025900 Bacteria 1007
353 Ga0207688_10014861 3300025901 Bacteria 4225
354 Ga0207688_10562770 3300025901 Unclassified 717
355 Ga0207680_10107710 3300025903 Bacteria 1802
356 Ga0207680_10206370 3300025903 Bacteria 1341
357 Ga0207680_10891682 3300025903 Unclassified 637
358 Ga0207647_10030685 3300025904 Bacteria 3465
359 Ga0207685_10188832 3300025905 Bacteria 960
360 Ga0207685_10620860 3300025905 Bacteria 582
361 Ga0207699_10003581 3300025906 Bacteria 7425
362 Ga0207699_10084613 3300025906 Bacteria 1976
363 Ga0207699_10245051 3300025906 Bacteria 1233
364 Ga0207699_10297187 3300025906 Bacteria 1127
365 Ga0207699_10983588 3300025906 Unclassified 624
366 Ga0207645_10005586 3300025907 Bacteria 9093
367 Ga0207645_10044401 3300025907 Bacteria 2844
368 Ga0207643_10365690 3300025908 Bacteria 907
369 Ga0207643_10798617 3300025908 Bacteria 611
370 Ga0207705_10870512 3300025909 Bacteria 698
371 Ga0207684_10399420 3300025910 Unclassified 1182
372 Ga0207654_10173182 3300025911 Bacteria 1403
373 Ga0207654_10344253 3300025911 Bacteria 1025
374 Ga0207707_10009000 3300025912 Bacteria 8674
375 Ga0207707_10260955 3300025912 Bacteria 1503
376 Ga0207707_10340883 3300025912 Bacteria 1292
377 Ga0207707_10358152 3300025912 Unclassified 1256
378 Ga0207707_10617878 3300025912 Bacteria 916
379 Ga0207707_10774527 3300025912 Bacteria 801
380 Ga0207707_10989137 3300025912 Unclassified 691
381 Ga0207695_10306022 3300025913 Unclassified 1480
382 Ga0207671_10058916 3300025914 Bacteria 2847
383 Ga0207671_10172048 3300025914 Bacteria 1682
384 Ga0207671_10522277 3300025914 Unclassified 947
385 Ga0207693_10000272 3300025915 Bacteria 47757
386 Ga0207693_10049962 3300025915 Unclassified 3284
387 Ga0207663_10007011 3300025916 Bacteria 5814
388 Ga0207663_10011162 3300025916 Bacteria 4814
389 Ga0207663_10045740 3300025916 Bacteria 2694
390 Ga0207663_10234480 3300025916 Bacteria 1343
391 Ga0207660_10033952 3300025917 Bacteria 3532
392 Ga0207660_10036204 3300025917 Unclassified 3431
393 Ga0207662_10002924 3300025918 Bacteria 8666
394 Ga0207662_10755044 3300025918 Unclassified 684
395 Ga0207657_10050464 3300025919 Bacteria 3621
396 Ga0207649_10365713 3300025920 Bacteria 1071
397 Ga0207649_10416325 3300025920 Bacteria 1008
398 Ga0207649_10523640 3300025920 Bacteria 904
399 Ga0207652_10025346 3300025921 Unclassified 4929
400 Ga0207652_10525847 3300025921 Bacteria 1064
401 Ga0207652_10873869 3300025921 Bacteria 795
402 Ga0207646_10490130 3300025922 Unclassified 1108
403 Ga0207646_11081126 3300025922 Bacteria 706
404 Ga0207681_10008402 3300025923 Bacteria 6310
405 Ga0207681_11653094 3300025923 Unclassified 536
406 Ga0207694_10135821 3300025924 Bacteria 1975
407 Ga0207694_10208365 3300025924 Bacteria 1592
408 Ga0207694_10784877 3300025924 Bacteria 804
409 Ga0207694_11319794 3300025924 Unclassified 610
410 Ga0207650_10637054 3300025925 Unclassified 898
411 Ga0207659_10089130 3300025926 Bacteria 2300
412 Ga0207659_10121694 3300025926 Bacteria 2000
413 Ga0207659_10378003 3300025926 Bacteria 1181
414 Ga0207659_10869849 3300025926 Unclassified 775
415 Ga0207687_10028610 3300025927 Bacteria 3744
416 Ga0207700_10002215 3300025928 Bacteria 11155
417 Ga0207700_10021602 3300025928 Unclassified 4399
418 Ga0207700_10080070 3300025928 Bacteria 2546
419 Ga0207700_10213752 3300025928 Bacteria 1632
420 Ga0207700_10284718 3300025928 Unclassified 1423
421 Ga0207700_10786727 3300025928 Bacteria 851
422 Ga0207700_10978799 3300025928 Unclassified 757
423 Ga0207664_10451105 3300025929 Bacteria 1148
424 Ga0207644_10016164 3300025931 Bacteria 5020
425 Ga0207644_10100177 3300025931 Bacteria 2175
426 Ga0207644_10127817 3300025931 Bacteria 1942
427 Ga0207644_11195219 3300025931 Bacteria 639
428 Ga0207690_10109616 3300025932 Unclassified 1986
429 Ga0207690_10502219 3300025932 Bacteria 981
430 Ga0207690_10986484 3300025932 Bacteria 700
431 Ga0207706_10080023 3300025933 Bacteria 2873
432 Ga0207706_10382558 3300025933 Bacteria 1221
433 Ga0207706_11068790 3300025933 Bacteria 676
434 Ga0207686_10032282 3300025934 Bacteria 3116
435 Ga0207686_10048882 3300025934 Bacteria 2623
436 Ga0207686_10580243 3300025934 Bacteria 880
437 Ga0207686_10603060 3300025934 Bacteria 864
438 Ga0207709_10056139 3300025935 Unclassified 2436
439 Ga0207669_10008769 3300025937 Unclassified 4769
440 Ga0207669_10183369 3300025937 Unclassified 1503
441 Ga0207669_10324066 3300025937 Bacteria 1180
442 Ga0207669_10325489 3300025937 Bacteria 1178
443 Ga0207704_10639486 3300025938 Bacteria 875
444 Ga0207665_10011065 3300025939 Bacteria 5921
445 Ga0207665_10074505 3300025939 Unclassified 2323
446 Ga0207691_10005849 3300025940 Bacteria 11895
447 Ga0207691_10064527 3300025940 Bacteria 3317
448 Ga0207691_10098653 3300025940 Bacteria 2609
449 Ga0207711_10018033 3300025941 Bacteria 5867
450 Ga0207711_10042946 3300025941 Bacteria 3854
451 Ga0207711_10216118 3300025941 Bacteria 1752
452 Ga0207711_10707376 3300025941 Unclassified 940
453 Ga0207711_10773431 3300025941 Bacteria 895
454 Ga0207711_10999741 3300025941 Unclassified 776
455 Ga0207689_10080617 3300025942 Bacteria 2675
456 Ga0207689_10089098 3300025942 Bacteria 2534
457 Ga0207689_11272772 3300025942 Unclassified 618
458 Ga0207661_10017594 3300025944 Bacteria 5294
459 Ga0207661_10614502 3300025944 Bacteria 998
460 Ga0207661_11153074 3300025944 Unclassified 713
461 Ga0207679_10132316 3300025945 Bacteria 2003
462 Ga0207679_10632252 3300025945 Unclassified 967
463 Ga0207679_10819316 3300025945 Bacteria 849
464 Ga0207667_10195689 3300025949 Bacteria 2074
465 Ga0207667_11095300 3300025949 Unclassified 780
466 Ga0207667_12035813 3300025949 Unclassified 534
467 Ga0207651_10006196 3300025960 Bacteria 6229
468 Ga0207651_10009436 3300025960 Bacteria 5344
469 Ga0207651_10851981 3300025960 Bacteria 810
470 Ga0207712_10034790 3300025961 Bacteria 3417
471 Ga0207668_10080272 3300025972 Bacteria 2363
472 Ga0207668_10167599 3300025972 Bacteria 1719
473 Ga0207668_10883248 3300025972 Bacteria 795
474 Ga0207640_10077355 3300025981 Bacteria 2262
475 Ga0207640_10384472 3300025981 Bacteria 1138
476 Ga0207658_10043602 3300025986 Unclassified 3262
477 Ga0207658_10219438 3300025986 Bacteria 1599
478 Ga0207658_10640611 3300025986 Unclassified 957
479 Ga0207658_10858892 3300025986 Bacteria 825
480 Ga0207677_10161409 3300026023 Bacteria 1742
481 Ga0207703_10037404 3300026035 Bacteria 3866
482 Ga0207703_10408900 3300026035 Bacteria 1260
483 Ga0207703_11547482 3300026035 Bacteria 638
484 Ga0207639_10215618 3300026041 Bacteria 1655
485 Ga0207678_10056889 3300026067 Bacteria 3365
486 Ga0207678_10666119 3300026067 Unclassified 915
487 Ga0207708_10004195 3300026075 Bacteria 10598
488 Ga0207708_10596286 3300026075 Unclassified 935
489 Ga0207702_10028774 3300026078 Unclassified 4621
490 Ga0207702_10446623 3300026078 Bacteria 1254
491 Ga0207702_10718548 3300026078 Bacteria 985
492 Ga0207702_11211991 3300026078 Unclassified 749
493 Ga0207641_10626784 3300026088 Bacteria 1055
494 Ga0207641_11693298 3300026088 Bacteria 634
495 Ga0207648_10054378 3300026089 Bacteria 3497
496 Ga0207676_10504948 3300026095 Bacteria 1149
497 Ga0207676_10706398 3300026095 Unclassified 977
498 Ga0207674_10123548 3300026116 Bacteria 2554
499 Ga0207674_10274645 3300026116 Bacteria 1633
500 Ga0207675_100014149 3300026118 Bacteria 7440
501 Ga0207675_100205769 3300026118 Bacteria 1891
502 Ga0207675_100696945 3300026118 Unclassified 1024
503 Ga0207683_10064800 3300026121 Bacteria 3220
504 Ga0207683_10089193 3300026121 Bacteria 2744
505 Ga0207683_10239915 3300026121 Unclassified 1653
506 Ga0207683_10418860 3300026121 Bacteria 1233
507 Ga0207683_11598593 3300026121 Unclassified 601
508 Ga0207698_10004104 3300026142 Bacteria 8843
509 Ga0207698_10270875 3300026142 Bacteria 1565
510 Ga0209813_10009215 3300027866 Bacteria 2517
511 Ga0209813_10162543 3300027866 Bacteria 806
512 Ga0207428_10005646 3300027907 Bacteria 11630
513 Ga0207428_10090866 3300027907 Bacteria 2371
514 Ga0207428_10162393 3300027907 Bacteria 1696
515 Ga0207428_10418874 3300027907 Bacteria 979
516 Ga0265355_1015010 3300028036 Unclassified 653
517 Ga0268266_10583205 3300028379 Unclassified 1073
518 Ga0268265_10049238 3300028380 Bacteria 3168
519 Ga0268265_10236201 3300028380 Unclassified 1610
520 Ga0268264_10073297 3300028381 Bacteria 2905
521 Ga0268264_10134129 3300028381 Bacteria 2199
522 Ga0268264_10140717 3300028381 Bacteria 2151
523 Ga0268264_11493173 3300028381 Bacteria 686
524 Ga0265760_10032816 3300031090 Bacteria 1534
525 Ga0265330_10177325 3300031235 Bacteria 903
526 Ga0265331_10043753 3300031250 Bacteria 2167
527 Ga0265331_10117580 3300031250 Unclassified 1216
528 Ga0265316_10078636 3300031344 Bacteria 2532
529 Ga0265316_10274974 3300031344 Bacteria 1232
530 Ga0265316_10521029 3300031344 Unclassified 848
531 Ga0307408_100852190 3300031548 Bacteria 831
532 Ga0307408_102282789 3300031548 Bacteria 524
533 Ga0265313_10195516 3300031595 Unclassified 844
534 Ga0307407_11398931 3300031903 Bacteria 551
535 Ga0307409_100064006 3300031995 Bacteria 2887
536 Ga0307409_102344192 3300031995 Unclassified 563
537 Ga0307416_103200043 3300032002 Unclassified 548
538 Ga0373949_0176134 3300035090 Bacteria 631
539 Ga0373932_0156309 3300035112 Bacteria 786
540 Ga0373932_0237138 3300035112 Bacteria 661
541 Ga0373939_0017498 3300035114 Unclassified 1904
542 Ga0373954_0217087 3300035118 Bacteria 940
543 Ga0373960_0136951 3300035121 Bacteria 826
544 Ga0373955_0595803 3300035172 Bacteria 677
545 Ga0373955_1015206 3300035172 Unclassified 511
546 Ga0373961_0078760 3300035241 Unclassified 1033
547 Ga0373924_0337026 3300035410 Unclassified 672
548 Ga0373931_0007643 3300035691 Bacteria 5097
549 Ga0373931_0849832 3300035691 Bacteria 611
550 Ga0373933_0058668 3300035724 Unclassified 2316
551 Ga0373937_0156978 3300036401 Unclassified 2133
552 Ga0373937_0606686 3300036401 Bacteria 1039
553 Ga0373937_1150723 3300036401 Bacteria 724
554 Ga0373925_1364070 3300037068 Unclassified 581
555 Ga0395905_0099128 3300037471 Bacteria 2737
556 Ga0395905_0947831 3300037471 Bacteria 764
557 Ga0436364_0311194 3300037853 Bacteria 1162
558 Ga0395901_0572020 3300038443 Unclassified 1143
559 Ga0436365_1165855 3300039437 Unclassified 1615
560 Ga0436365_1175647 3300039437 Unclassified 980
561 Ga0436365_1466237 3300039437 Bacteria 900
562 Ga0436363_0980961 3300039450 Bacteria 1296
563 Ga0436363_1576799 3300039450 Unclassified 570
564 Ga0436362_1002387 3300039453 Bacteria 654
565 Ga0451802_0895257 3300041460 Bacteria 1200
566 Ga0439456_031268 3300042013 Bacteria 1140
567 Ga0450911_028202 3300042115 Bacteria 728
568 Ga0450923_036018 3300042125 Bacteria 1025
569 Ga0450888_027653 3300042126 Bacteria 748
570 Ga0450894_009962 3300042131 Bacteria 1231
571 Ga0450908_002407 3300042184 Bacteria 3662
572 Ga0451577_1094332 3300042876 Bacteria 713
573 Ga0451577_1151868 3300042876 Bacteria 693
574 Ga0466966_0261051 3300044684 Bacteria 1043
575 Ga0466961_0272533 3300044693 Bacteria 1037
576 Ga0466963_0006365 3300044694 Bacteria 6984
577 Ga0466957_0429061 3300044842 Bacteria 908
578 Ga0451576_0229450 3300045051 Bacteria 1939
579 Ga0451576_0434907 3300045051 Bacteria 1377
580 Ga0466967_0010744 3300045976 Bacteria 6884
581 Ga0466967_0573885 3300045976 Unclassified 1111
582 Ga0466967_0694422 3300045976 Bacteria 1008
583 Ga0466967_0764951 3300045976 Bacteria 958
584 Ga0495629_0006814 3300046459 Bacteria 8446
585 Ga0495651_0053597 3300046462 Unclassified 3104
586 Ga0495653_0139179 3300046463 Bacteria 1709
587 Ga0495580_0019162 3300046472 Bacteria 5086
588 Ga0495580_0892944 3300046472 Unclassified 572
589 Ga0495582_0009464 3300046473 Bacteria 5367
590 Ga0495582_0884228 3300046473 Unclassified 516
591 Ga0495639_0399991 3300046475 Bacteria 694
592 Ga0495664_0142385 3300046477 Unclassified 1454
593 Ga0495594_0019566 3300046499 Bacteria 3599
594 Ga0495628_0625143 3300046516 Unclassified 767
595 Ga0495652_0046099 3300046529 Unclassified 3744
596 Ga0495665_0102543 3300046531 Bacteria 1501
597 Ga0495587_0038068 3300046536 Unclassified 2885
598 Ga0495587_0053929 3300046536 Bacteria 2370
599 Ga0495587_0548584 3300046536 Unclassified 638
600 Ga0495645_0037171 3300046543 Bacteria 3548
601 Ga0495667_0000978 3300046559 Bacteria 18474
602 Ga0495635_0295683 3300046663 Unclassified 1086
603 Ga0495635_0816105 3300046663 Unclassified 600
604 Ga0495599_0015058 3300046678 Bacteria 4794
605 Ga0495623_0006625 3300046679 Bacteria 7540
606 Ga0495646_0114600 3300046680 Unclassified 1532
607 Ga0495658_0028103 3300046683 Bacteria 3033
608 Ga0495613_0457416 3300046689 Bacteria 864
609 Ga0495600_0013274 3300046809 Bacteria 5172
610 Ga0495581_0006434 3300047315 Bacteria 6817
611 Ga0495604_0106836 3300047317 Bacteria 2047
612 Ga0495674_0166780 3300047319 Unclassified 1840
613 Ga0495675_0004753 3300047444 Bacteria 8247
614 Ga0495684_0000960 3300047471 Bacteria 23493
615 Ga0495602_0063997 3300048088 Unclassified 3183
616 Ga0496102_0303506 3300048905 Bacteria 1505
617 Ga0496102_1254862 3300048905 Unclassified 660
618 Ga0496103_0341766 3300048906 Bacteria 963
619 Ga0496104_0070589 3300048907 Bacteria 3321
620 Ga0496104_0773136 3300048907 Bacteria 867
621 Ga0496104_1364779 3300048907 Unclassified 612
622 Ga0496105_0782091 3300048908 Bacteria 727
623 Ga0496106_0499414 3300048909 Unclassified 977
624 Ga0496107_0086223 3300048910 Bacteria 2292
625 Ga0496108_0379090 3300048911 Bacteria 1235
626 Ga0496108_0855502 3300048911 Bacteria 782
627 Ga0496109_0933491 3300048912 Bacteria 806
628 Ga0496110_0199392 3300048913 Bacteria 1818
629 Ga0496110_0570547 3300048913 Bacteria 1028
630 Ga0496112_0002037 3300048915 Bacteria 16019
631 Ga0496112_0233758 3300048915 Bacteria 1792
632 Ga0496112_0893424 3300048915 Bacteria 811
633 Ga0496113_0057646 3300048916 Bacteria 2920
634 Ga0496113_0132627 3300048916 Bacteria 1956
635 Ga0496114_0732062 3300048917 Bacteria 866
636 Ga0501031_0007336 3300049568 Bacteria 7191
637 Ga0501032_0005253 3300049569 Bacteria 9634
638 Ga0501032_0007209 3300049569 Bacteria 8133
639 Ga0501032_0366242 3300049569 Bacteria 927
640 Ga0501033_0009445 3300049570 Bacteria 7509
641 Ga0501033_0017279 3300049570 Bacteria 5451
642 Ga0501033_0061580 3300049570 Bacteria 2765
643 Ga0501034_0012912 3300049571 Bacteria 8613
644 Ga0501034_0041079 3300049571 Bacteria 4680
645 Ga0501034_0049367 3300049571 Bacteria 4245
646 Ga0501034_0064287 3300049571 Bacteria 3683
647 Ga0501034_0282049 3300049571 Bacteria 1600
648 Ga0501036_0019691 3300049572 Bacteria 5665
649 Ga0501036_0037637 3300049572 Bacteria 4092
650 Ga0501036_0263535 3300049572 Bacteria 1443
651 Ga0501037_0005503 3300049573 Bacteria 9235
652 Ga0501037_0045486 3300049573 Bacteria 3222
653 Ga0501038_0006794 3300049574 Bacteria 10566
654 Ga0501038_0049104 3300049574 Bacteria 3649
655 Ga0501038_0633171 3300049574 Bacteria 806
656 Ga0501039_0006593 3300049575 Bacteria 8818
657 Ga0501039_0020533 3300049575 Bacteria 5062
658 Ga0501039_0669844 3300049575 Bacteria 812
659 Ga0501040_0212833 3300049576 Bacteria 1374
660 Ga0501040_1315101 3300049576 Bacteria 524
661 Ga0501041_0678165 3300049577 Unclassified 659
662 Ga0501042_0009071 3300049578 Bacteria 6613
663 Ga0501042_0281366 3300049578 Bacteria 1201
664 Ga0501043_0027004 3300049579 Bacteria 4505
665 Ga0501043_0039125 3300049579 Bacteria 3727
666 Ga0501043_0168154 3300049579 Bacteria 1711
667 Ga0501046_0008623 3300049580 Bacteria 8866
668 Ga0501046_0169626 3300049580 Bacteria 1638
669 Ga0501047_0074600 3300049581 Bacteria 3265
670 Ga0501047_0106568 3300049581 Bacteria 2683
671 Ga0501047_0452311 3300049581 Bacteria 1113
672 Ga0501048_0001012 3300049582 Bacteria 20980
673 Ga0501048_0003368 3300049582 Bacteria 12150
674 Ga0501048_0016776 3300049582 Bacteria 5398
675 Ga0501048_0206828 3300049582 Bacteria 1392
676 Ga0501067_0005254 3300049583 Bacteria 7196
677 Ga0501067_0036150 3300049583 Bacteria 2743
678 Ga0501068_0000933 3300049584 Bacteria 15313
679 Ga0501068_0038412 3300049584 Bacteria 2868
680 Ga0501068_1081868 3300049584 Bacteria 530
681 Ga0501069_0009593 3300049585 Bacteria 5110
682 Ga0501069_0016337 3300049585 Bacteria 3985
683 Ga0501069_0094451 3300049585 Bacteria 1692
684 Ga0501070_0006402 3300049586 Bacteria 10017
685 Ga0501070_0016682 3300049586 Bacteria 6167
686 Ga0501070_0125790 3300049586 Bacteria 2118
687 Ga0501071_0171797 3300049587 Bacteria 1622
688 Ga0501071_0322913 3300049587 Bacteria 1172
689 Ga0501072_0083875 3300049588 Bacteria 2526
690 Ga0501072_0095665 3300049588 Bacteria 2361
691 Ga0501072_0197489 3300049588 Bacteria 1604
692 Ga0501072_0844182 3300049588 Bacteria 716
693 Ga0501073_0000599 3300049589 Bacteria 25394
694 Ga0501073_0013545 3300049589 Bacteria 5930
695 Ga0501073_0067941 3300049589 Bacteria 2484
696 Ga0501074_0008977 3300049590 Bacteria 7252
697 Ga0501074_0029728 3300049590 Bacteria 3958
698 Ga0501074_0128373 3300049590 Bacteria 1814
699 Ga0501075_0034881 3300049591 Bacteria 3749
700 Ga0501075_0056767 3300049591 Bacteria 2948
701 Ga0501075_0510104 3300049591 Bacteria 918
702 Ga0501075_1404491 3300049591 Unclassified 529
703 Ga0501247_007140 3300049677 Bacteria 1280
704 Ga0501079_0012726 3300049741 Bacteria 6427
705 Ga0501079_0046205 3300049741 Bacteria 3359
706 Ga0501079_0146454 3300049741 Bacteria 1840
707 Ga0501080_0051888 3300049742 Bacteria 3817
708 Ga0501080_0068241 3300049742 Bacteria 3307
709 Ga0501080_0506976 3300049742 Bacteria 1078
710 Ga0501080_0953354 3300049742 Bacteria 746
711 Ga0501081_0291471 3300049743 Bacteria 1196
712 Ga0501081_0320477 3300049743 Bacteria 1139
713 Ga0501083_0010696 3300049744 Bacteria 6454
714 Ga0501083_0034947 3300049744 Bacteria 3435
715 Ga0501035_0004294 3300049822 Bacteria 13532
716 Ga0501035_0106398 3300049822 Bacteria 2459
717 Ga0501035_0108020 3300049822 Bacteria 2439
718 Ga0501035_0219969 3300049822 Bacteria 1622
719 Ga0501044_0036922 3300049823 Bacteria 5109
720 Ga0501044_0045573 3300049823 Bacteria 4542
721 Ga0501044_0075129 3300049823 Bacteria 3431
722 Ga0501045_0012932 3300049824 Bacteria 5883
723 Ga0501045_0024109 3300049824 Bacteria 4367
724 Ga0501045_0033203 3300049824 Bacteria 3742
725 nmdc:mga03n38_23686_c1 3300050490 Bacteria 2501
726 nmdc:mga03n38_248322_c1 3300050490 Unclassified 939
727 nmdc:mga03n38_930393_c1 3300050490 Unclassified 512
728 nmdc:mga00v17_324510_c1 3300050491 Bacteria 1000
729 nmdc:mga00v17_458378_c1 3300050491 Bacteria 827
730 nmdc:mga00v17_59829_c1 3300050491 Bacteria 2339
731 nmdc:mga0k408_2142_c1 3300050493 Bacteria 10586
732 nmdc:mga0k408_32333_c2 3300050493 Bacteria 1995
733 nmdc:mga0k408_46453_c1 3300050493 Bacteria 2507
734 nmdc:mga0k408_88855_c1 3300050493 Bacteria 1814
735 nmdc:mga06z11_128878_c1 3300050494 Bacteria 1419
736 nmdc:mga06z11_202412_c1 3300050494 Bacteria 1154
737 nmdc:mga06z11_77087_c1 3300050494 Bacteria 1779
738 nmdc:mga06z11_895946_c1 3300050494 Bacteria 541
739 nmdc:mga04h51_107891_c1 3300050495 Bacteria 1023
740 nmdc:mga04h51_234129_c1 3300050495 Bacteria 732
741 nmdc:mga04h51_72535_c1 3300050495 Bacteria 1205
742 nmdc:mga07m45_110067_c1 3300050496 Bacteria 685
743 nmdc:mga07m45_312086_c1 3300050496 Bacteria 914
744 nmdc:mga07m45_735467_c1 3300050496 Unclassified 567
745 nmdc:mga05p37_104762_c1 3300050507 Bacteria 3480
746 nmdc:mga05p37_130658_c1 3300050507 Bacteria 3081
747 nmdc:mga05p37_455571_c1 3300050507 Bacteria 1479
748 nmdc:mga05p37_4_c1 3300050507 Bacteria 162001
749 nmdc:mga05p37_75635_c1 3300050507 Bacteria 4145
750 nmdc:mga05p37_85664_c2 3300050507 Bacteria 2528
751 nmdc:mga09592_435644_c1 3300050508 Bacteria 1131
752 nmdc:mga0qj67_1247439_c1 3300050509 Bacteria 577
753 nmdc:mga0qj67_247516_c1 3300050509 Bacteria 1446
754 nmdc:mga06r32_166583_c1 3300050510 Bacteria 2187
755 nmdc:mga06r32_1830282_c1 3300050510 Unclassified 542
756 nmdc:mga06r32_42303_c1 3300050510 Bacteria 4331
757 nmdc:mga06r32_523098_c1 3300050510 Bacteria 1162
758 nmdc:mga08y16_23445_c1 3300050511 Bacteria 6520
759 nmdc:mga08y16_367933_c1 3300050511 Bacteria 1475
760 nmdc:mga08y16_8519_c1 3300050511 Bacteria 10742
761 nmdc:mga08y16_889616_c1 3300050511 Bacteria 877
762 nmdc:mga0n895_357983_c1 3300050512 Unclassified 1478
763 nmdc:mga0n895_428433_c1 3300050512 Bacteria 1337
764 nmdc:mga0n895_437377_c1 3300050512 Bacteria 1321
765 nmdc:mga0n895_629750_c1 3300050512 Unclassified 1073
766 nmdc:mga0n895_79917_c1 3300050512 Bacteria 3257
767 nmdc:mga0rr50_1609291_c1 3300050513 Bacteria 548
768 nmdc:mga0rr50_4936_c1 3300050513 Bacteria 7897
769 nmdc:mga0rr50_95014_c1 3300050513 Unclassified 2329
770 nmdc:mga08x19_140033_c1 3300050514 Bacteria 1633
771 nmdc:mga08x19_169470_c1 3300050514 Unclassified 1487
772 nmdc:mga08x19_20141_c1 3300050514 Bacteria 4106
773 nmdc:mga08x19_74453_c1 3300050514 Unclassified 2219
774 nmdc:mga08x19_847049_c1 3300050514 Bacteria 649
775 nmdc:mga0a205_188072_c1 3300050515 Bacteria 1957
776 Ga0495601_0129942 3300053077 Bacteria 1640
777 Ga0495619_0317566 3300053085 Unclassified 1078
778 Ga0500555_000547 3300053103 Bacteria 14981
779 Ga0500645_000092 3300053730 Bacteria 69820
780 Ga0501084_0007056 3300054114 Bacteria 9259
781 Ga0501084_0045414 3300054114 Bacteria 3678
782 Ga0501084_0083669 3300054114 Bacteria 2678
783 Ga0501084_0093974 3300054114 Bacteria 2518
784 Ga0501082_0007531 3300060353 Bacteria 9393
785 Ga0501082_0036919 3300060353 Bacteria 4209
786 Ga0501082_0073693 3300060353 Bacteria 2940
787 Ga0501082_0629416 3300060353 Unclassified 939
788 Ga0530510_0102272 3300061734 Unclassified 2095
789 Ga0530510_0363722 3300061734 Bacteria 1088
790 Ga0065715_10155452
791 JGI24751J29686_10000613
792 Ga0065712_10073569
793 Ga0065715_10035688
794 Ga0065715_10308548
795 Ga0065715_10370190
796 Ga0065707_10190951
797 Ga0065707_10256386
798 Ga0070676_10400109
799 Ga0070676_10649683
800 Ga0070683_100000470
801 Ga0070683_100521236
802 Ga0070683_100667595
803 Ga0070690_100077942
804 Ga0070690_100100163
805 Ga0070690_101510895
806 Ga0070670_100002170
807 Ga0070670_100006376
808 Ga0070670_100208341
809 Ga0070670_100625306
810 Ga0068869_100000886
811 Ga0068869_100483082
812 Ga0070666_10083937
813 Ga0070666_10325291
814 Ga0070680_100105010
815 Ga0070680_100737687
816 Ga0070682_100822743
817 Ga0068868_100591448
818 Ga0070660_100149465
819 Ga0070689_100014089
820 Ga0070689_100970702
821 Ga0070687_100008851
822 Ga0070687_100270062
823 Ga0070661_100225172
824 Ga0070661_100280580
825 Ga0070692_10084319
826 Ga0070669_100097756
827 Ga0070675_100038434
828 Ga0070675_100124163
829 Ga0070675_100590297
830 Ga0070671_100026824
831 Ga0070671_100088035
832 Ga0070671_101043911
833 Ga0070674_100074368
834 Ga0070674_100163542
835 Ga0070674_100283082
836 Ga0070674_100410524
837 Ga0070674_101253935
838 Ga0070673_100010320
839 Ga0070673_100105816
840 Ga0070673_100518618
841 Ga0070673_102284618
842 Ga0070673_102297150
843 Ga0070688_100030125
844 Ga0070659_100004103
845 Ga0070659_100052120
846 Ga0070659_100925622
847 Ga0070667_100140443
848 Ga0070667_100583060
849 Ga0070667_100805715
850 Ga0070709_10000958
851 Ga0070709_10002667
852 Ga0070709_10140314
853 Ga0070709_10635642
854 Ga0070709_10790132
855 Ga0070709_11103508
856 Ga0070709_11211017
857 Ga0070714_100074203
858 Ga0070714_100164240
859 Ga0070714_100500009
860 Ga0070714_100508327
861 Ga0070714_100781132
862 Ga0070713_100002828
863 Ga0070713_100275108
864 Ga0070713_100545125
865 Ga0070710_10030061
866 Ga0070710_10056501
867 Ga0070710_11509803
868 Ga0070701_10008424
869 Ga0070711_100028595
870 Ga0070711_100084262
871 Ga0070700_100473879
872 Ga0070708_100989082
873 Ga0070663_100895954
874 Ga0070678_100050405
875 Ga0070678_100489340
876 Ga0070662_100012690
877 Ga0070662_100226559
878 Ga0070662_101143898
879 Ga0070681_10000580
880 Ga0070681_10035184
881 Ga0070681_10119806
882 Ga0070681_10164933
883 Ga0070681_10414067
884 Ga0070681_10839614
885 Ga0068867_100124235
886 Ga0068867_100595876
887 Ga0070685_10150052
888 Ga0070706_100197396
889 Ga0070707_100560060
890 Ga0070707_102028192
891 Ga0070698_100134652
892 Ga0070698_100358999
893 Ga0070698_101168370
894 Ga0070698_101543449
895 Ga0070699_100838039
896 Ga0070679_100038518
897 Ga0070679_100093790
898 Ga0070679_100333843
899 Ga0070684_100001638
900 Ga0070684_100005806
901 Ga0070684_100107634
902 Ga0070684_100121381
903 Ga0070684_100268904
904 Ga0070684_100302793
905 Ga0068853_100547404
906 Ga0068853_101603070
907 Ga0068853_101640113
908 Ga0070672_100100694
909 Ga0070672_100104641
910 Ga0070672_100367112
911 Ga0070686_100633233
912 Ga0070686_100669882
913 Ga0070686_101350536
914 Ga0070686_101878739
915 Ga0070695_100028757
916 Ga0070693_100128035
917 Ga0070693_100253320
918 Ga0070693_100801005
919 Ga0070665_100177276
920 Ga0070665_100371156
921 Ga0070704_100237625
922 Ga0068855_100524832
923 Ga0068855_101222664
924 Ga0068855_102377477
925 Ga0068855_102432701
926 Ga0070664_100027531
927 Ga0070664_100426447
928 Ga0070664_100534765
929 Ga0070664_100671215
930 Ga0068857_100051807
931 Ga0068857_101328690
932 Ga0068854_100020804
933 Ga0068854_100054251
934 Ga0068856_100398962
935 Ga0068856_100847939
936 Ga0068856_100871621
937 Ga0070702_100032870
938 Ga0070702_101102207
939 Ga0068852_100014219
940 Ga0068852_100018058
941 Ga0068859_100011907
942 Ga0068859_100094688
943 Ga0068859_100110502
944 Ga0068859_100220642
945 Ga0068859_100697678
946 Ga0068859_101823205
947 Ga0068864_100049147
948 Ga0068864_100129432
949 Ga0068864_100323684
950 Ga0068864_102610633
951 Ga0068861_100374121
952 Ga0068861_100928645
953 Ga0068861_101251022
954 Ga0068851_10157942
955 Ga0068870_10443771
956 Ga0068870_10710831
957 Ga0068863_101059008
958 Ga0068858_100035562
959 Ga0068858_100074107
960 Ga0068858_100094316
961 Ga0068860_100115818
962 Ga0068860_100138263
963 Ga0068860_100850402
964 Ga0068860_102803485
965 Ga0068862_100102380
966 Ga0068862_100202514
967 Ga0081455_10005606
968 Ga0081455_10093161
969 Ga0081539_10110009
970 Ga0070717_10008222
971 Ga0070717_10017356
972 Ga0070717_10420797
973 Ga0070717_10818537
974 Ga0070717_11539549
975 Ga0070717_11820523
976 Ga0075365_10801000
977 Ga0075368_10011790
978 Ga0075363_100013794
979 Ga0075364_10165415
980 Ga0070715_10311872
981 Ga0070716_100008659
982 Ga0070716_100058021
983 Ga0070716_100469818
984 Ga0070712_100011882
985 Ga0070712_100015952
986 Ga0075367_10029293
987 Ga0075367_10048970
988 Ga0075367_10181702
989 Ga0075366_10005121
990 Ga0075366_10142883
991 Ga0097621_100000820
992 Ga0097621_101732026
993 Ga0075370_10080837
994 Ga0075370_10110166
995 Ga0075370_10845602
996 Ga0068871_100037095
997 Ga0068871_100925092
998 Ga0068871_101223769
999 Ga0075428_100006967
1000 Ga0075428_100117001
1001 Ga0075428_100127130
1002 Ga0075428_100328125
1003 Ga0075430_100363184
1004 Ga0075430_101435681
1005 Ga0075431_100081416
1006 Ga0075431_100093635
1007 Ga0075431_100179097
1008 Ga0075431_100544397
1009 Ga0075431_101516632
1010 Ga0075433_10311664
1011 Ga0075433_11516057
1012 Ga0075433_11767424
1013 Ga0075434_100152863
1014 Ga0075434_100228189
1015 Ga0075434_100416312
1016 Ga0075434_100499948
1017 Ga0075434_100526722
1018 Ga0075434_100687522
1019 Ga0068865_101649034
1020 Ga0075436_100010338
1021 Ga0075436_100020292
1022 Ga0075436_100242078
1023 Ga0075436_100396763
1024 Ga0075436_100500361
1025 Ga0097620_100011907
1026 Ga0097620_100094689
1027 Ga0097620_100110503
1028 Ga0097620_100220651
1029 Ga0097620_100697629
1030 Ga0097620_101822805
1031 Ga0075435_100011431
1032 Ga0075435_100068822
1033 Ga0075435_100364601
1034 Ga0075435_100554565
1035 Ga0075435_101890385
1036 Ga0105250_10356686
1037 Ga0105240_10141974
1038 Ga0105240_10341633
1039 Ga0105240_10511738
1040 Ga0111539_10048893
1041 Ga0111539_10082429
1042 Ga0111539_10552122
1043 Ga0105245_10006199
1044 Ga0105245_10085988
1045 Ga0105245_10092964
1046 Ga0105247_10018573
1047 Ga0105247_10841216
1048 Ga0105247_10854435
1049 Ga0114129_10004132
1050 Ga0114129_10005746
1051 Ga0114129_10056877
1052 Ga0114129_10103108
1053 Ga0114129_10163827
1054 Ga0114129_10289812
1055 Ga0114129_10952036
1056 Ga0114129_11125412
1057 Ga0114129_12622287
1058 Ga0105243_10035361
1059 Ga0105243_10314610
1060 Ga0105241_10025190
1061 Ga0105241_10096884
1062 Ga0105241_10213337
1063 Ga0105241_10440946
1064 Ga0105242_10013079
1065 Ga0105242_10861897
1066 Ga0105248_10028400
1067 Ga0105248_10074913
1068 Ga0105248_10147956
1069 Ga0105248_10172979
1070 Ga0105248_10311307
1071 Ga0105248_10314238
1072 Ga0105248_11053326
1073 Ga0105248_11094484
1074 Ga0105248_13247310
1075 Ga0105248_13262127
1076 Ga0105237_10001120
1077 Ga0105237_10063485
1078 Ga0105237_10106534
1079 Ga0105237_10639895
1080 Ga0105237_10927263
1081 Ga0105237_10960608
1082 Ga0105238_10161300
1083 Ga0105238_10636468
1084 Ga0105238_10938851
1085 Ga0105238_11732989
1086 Ga0105249_10182680
1087 Ga0105249_10208512
1088 Ga0105249_10669344
1089 Ga0105249_11610838
1090 Ga0105249_12023783
1091 Ga0105239_10007809
1092 Ga0105239_10179416
1093 Ga0105239_10737290
1094 Ga0105239_12274811
1095 Ga0105246_10090789
1096 Ga0105246_10260968
1097 Ga0105246_11793716
1098 Ga0157371_10067226
1099 Ga0157370_10380694
1100 Ga0157369_10375511
1101 Ga0157369_10743411
1102 Ga0157369_10930742
1103 Ga0157374_10009184
1104 Ga0157378_10073658
1105 Ga0163162_10203511
1106 Ga0163162_11618573
1107 Ga0163162_12280288
1108 Ga0157372_10013618
1109 Ga0157372_10077122
1110 Ga0157372_10297465
1111 Ga0157372_10367151
1112 Ga0157372_11635507
1113 Ga0157375_10020223
1114 Ga0157375_12962017
1115 Ga0163163_10103144
1116 Ga0163163_10166427
1117 Ga0163163_10948898
1118 Ga0163163_11961529
1119 Ga0163163_12290587
1120 Ga0157380_11395297
1121 Ga0157377_10004647
1122 Ga0157377_10175198
1123 Ga0157379_10072213
1124 Ga0157379_10384799
1125 Ga0157379_10534932
1126 Ga0157379_11536665
1127 Ga0157379_12033323
1128 Ga0157376_10050713
1129 Ga0157376_11580272
1130 Ga0157376_12245705
1131 Ga0157376_12783131
1132 Ga0163161_10143788
1133 Ga0213873_10185401
1134 Ga0207666_1025226
1135 Ga0207697_10006720
1136 Ga0207697_10125231
1137 Ga0207656_10105398
1138 Ga0207682_10209275
1139 Ga0207692_10086554
1140 Ga0207692_10102833
1141 Ga0207710_10191565
1142 Ga0207688_10014861
1143 Ga0207688_10562770
1144 Ga0207680_10107710
1145 Ga0207680_10206370
1146 Ga0207680_10891682
1147 Ga0207647_10030685
1148 Ga0207685_10188832
1149 Ga0207685_10620860
1150 Ga0207699_10003581
1151 Ga0207699_10084613
1152 Ga0207699_10245051
1153 Ga0207699_10297187
1154 Ga0207699_10983588
1155 Ga0207645_10005586
1156 Ga0207645_10044401
1157 Ga0207643_10365690
1158 Ga0207643_10798617
1159 Ga0207705_10870512
1160 Ga0207684_10399420
1161 Ga0207654_10173182
1162 Ga0207654_10344253
1163 Ga0207707_10009000
1164 Ga0207707_10260955
1165 Ga0207707_10340883
1166 Ga0207707_10358152
1167 Ga0207707_10617878
1168 Ga0207707_10774527
1169 Ga0207707_10989137
1170 Ga0207695_10306022
1171 Ga0207671_10058916
1172 Ga0207671_10172048
1173 Ga0207671_10522277
1174 Ga0207693_10000272
1175 Ga0207693_10049962
1176 Ga0207663_10007011
1177 Ga0207663_10011162
1178 Ga0207663_10045740
1179 Ga0207663_10234480
1180 Ga0207660_10033952
1181 Ga0207660_10036204
1182 Ga0207662_10002924
1183 Ga0207662_10755044
1184 Ga0207657_10050464
1185 Ga0207649_10365713
1186 Ga0207649_10416325
1187 Ga0207649_10523640
1188 Ga0207652_10025346
1189 Ga0207652_10525847
1190 Ga0207652_10873869
1191 Ga0207646_10490130
1192 Ga0207646_11081126
1193 Ga0207681_10008402
1194 Ga0207681_11653094
1195 Ga0207694_10135821
1196 Ga0207694_10208365
1197 Ga0207694_10784877
1198 Ga0207694_11319794
1199 Ga0207650_10637054
1200 Ga0207659_10089130
1201 Ga0207659_10121694
1202 Ga0207659_10378003
1203 Ga0207659_10869849
1204 Ga0207687_10028610
1205 Ga0207700_10002215
1206 Ga0207700_10021602
1207 Ga0207700_10080070
1208 Ga0207700_10213752
1209 Ga0207700_10284718
1210 Ga0207700_10786727
1211 Ga0207700_10978799
1212 Ga0207664_10451105
1213 Ga0207644_10016164
1214 Ga0207644_10100177
1215 Ga0207644_10127817
1216 Ga0207644_11195219
1217 Ga0207690_10109616
1218 Ga0207690_10502219
1219 Ga0207690_10986484
1220 Ga0207706_10080023
1221 Ga0207706_10382558
1222 Ga0207706_11068790
1223 Ga0207686_10032282
1224 Ga0207686_10048882
1225 Ga0207686_10580243
1226 Ga0207686_10603060
1227 Ga0207709_10056139
1228 Ga0207669_10008769
1229 Ga0207669_10183369
1230 Ga0207669_10324066
1231 Ga0207669_10325489
1232 Ga0207704_10639486
1233 Ga0207665_10011065
1234 Ga0207665_10074505
1235 Ga0207691_10005849
1236 Ga0207691_10064527
1237 Ga0207691_10098653
1238 Ga0207711_10018033
1239 Ga0207711_10042946
1240 Ga0207711_10216118
1241 Ga0207711_10707376
1242 Ga0207711_10773431
1243 Ga0207711_10999741
1244 Ga0207689_10080617
1245 Ga0207689_10089098
1246 Ga0207689_11272772
1247 Ga0207661_10017594
1248 Ga0207661_10614502
1249 Ga0207661_11153074
1250 Ga0207679_10132316
1251 Ga0207679_10632252
1252 Ga0207679_10819316
1253 Ga0207667_10195689
1254 Ga0207667_11095300
1255 Ga0207667_12035813
1256 Ga0207651_10006196
1257 Ga0207651_10009436
1258 Ga0207651_10851981
1259 Ga0207712_10034790
1260 Ga0207668_10080272
1261 Ga0207668_10167599
1262 Ga0207668_10883248
1263 Ga0207640_10077355
1264 Ga0207640_10384472
1265 Ga0207658_10043602
1266 Ga0207658_10219438
1267 Ga0207658_10640611
1268 Ga0207658_10858892
1269 Ga0207677_10161409
1270 Ga0207703_10037404
1271 Ga0207703_10408900
1272 Ga0207703_11547482
1273 Ga0207639_10215618
1274 Ga0207678_10056889
1275 Ga0207678_10666119
1276 Ga0207708_10004195
1277 Ga0207708_10596286
1278 Ga0207702_10028774
1279 Ga0207702_10446623
1280 Ga0207702_10718548
1281 Ga0207702_11211991
1282 Ga0207641_10626784
1283 Ga0207641_11693298
1284 Ga0207648_10054378
1285 Ga0207676_10504948
1286 Ga0207676_10706398
1287 Ga0207674_10123548
1288 Ga0207674_10274645
1289 Ga0207675_100014149
1290 Ga0207675_100205769
1291 Ga0207675_100696945
1292 Ga0207683_10064800
1293 Ga0207683_10089193
1294 Ga0207683_10239915
1295 Ga0207683_10418860
1296 Ga0207683_11598593
1297 Ga0207698_10004104
1298 Ga0207698_10270875
1299 Ga0209813_10009215
1300 Ga0209813_10162543
1301 Ga0207428_10005646
1302 Ga0207428_10090866
1303 Ga0207428_10162393
1304 Ga0207428_10418874
1305 Ga0265355_1015010
1306 Ga0268266_10583205
1307 Ga0268265_10049238
1308 Ga0268265_10236201
1309 Ga0268264_10073297
1310 Ga0268264_10134129
1311 Ga0268264_10140717
1312 Ga0268264_11493173
1313 Ga0265760_10032816
1314 Ga0265330_10177325
1315 Ga0265331_10043753
1316 Ga0265331_10117580
1317 Ga0265316_10078636
1318 Ga0265316_10274974
1319 Ga0265316_10521029
1320 Ga0307408_100852190
1321 Ga0307408_102282789
1322 Ga0265313_10195516
1323 Ga0307407_11398931
1324 Ga0307409_100064006
1325 Ga0307409_102344192
1326 Ga0307416_103200043
1327 Ga0373949_0176134
1328 Ga0373932_0156309
1329 Ga0373932_0237138
1330 Ga0373939_0017498
1331 Ga0373954_0217087
1332 Ga0373960_0136951
1333 Ga0373955_0595803
1334 Ga0373955_1015206
1335 Ga0373961_0078760
1336 Ga0373924_0337026
1337 Ga0373931_0007643
1338 Ga0373931_0849832
1339 Ga0373933_0058668
1340 Ga0373937_0156978
1341 Ga0373937_0606686
1342 Ga0373937_1150723
1343 Ga0373925_1364070
1344 Ga0395905_0099128
1345 Ga0395905_0947831
1346 Ga0436364_0311194
1347 Ga0395901_0572020
1348 Ga0436365_1165855
1349 Ga0436365_1175647
1350 Ga0436365_1466237
1351 Ga0436363_0980961
1352 Ga0436363_1576799
1353 Ga0436362_1002387
1354 Ga0451802_0895257
1355 Ga0439456_031268
1356 Ga0450911_028202
1357 Ga0450923_036018
1358 Ga0450888_027653
1359 Ga0450894_009962
1360 Ga0450908_002407
1361 Ga0451577_1094332
1362 Ga0451577_1151868
1363 Ga0466966_0261051
1364 Ga0466961_0272533
1365 Ga0466963_0006365
1366 Ga0466957_0429061
1367 Ga0451576_0229450
1368 Ga0451576_0434907
1369 Ga0466967_0010744
1370 Ga0466967_0573885
1371 Ga0466967_0694422
1372 Ga0466967_0764951
1373 Ga0495629_0006814
1374 Ga0495651_0053597
1375 Ga0495653_0139179
1376 Ga0495580_0019162
1377 Ga0495580_0892944
1378 Ga0495582_0009464
1379 Ga0495582_0884228
1380 Ga0495639_0399991
1381 Ga0495664_0142385
1382 Ga0495594_0019566
1383 Ga0495628_0625143
1384 Ga0495652_0046099
1385 Ga0495665_0102543
1386 Ga0495587_0038068
1387 Ga0495587_0053929
1388 Ga0495587_0548584
1389 Ga0495645_0037171
1390 Ga0495667_0000978
1391 Ga0495635_0295683
1392 Ga0495635_0816105
1393 Ga0495599_0015058
1394 Ga0495623_0006625
1395 Ga0495646_0114600
1396 Ga0495658_0028103
1397 Ga0495613_0457416
1398 Ga0495600_0013274
1399 Ga0495581_0006434
1400 Ga0495604_0106836
1401 Ga0495674_0166780
1402 Ga0495675_0004753
1403 Ga0495684_0000960
1404 Ga0495602_0063997
1405 Ga0496102_0303506
1406 Ga0496102_1254862
1407 Ga0496103_0341766
1408 Ga0496104_0070589
1409 Ga0496104_0773136
1410 Ga0496104_1364779
1411 Ga0496105_0782091
1412 Ga0496106_0499414
1413 Ga0496107_0086223
1414 Ga0496108_0379090
1415 Ga0496108_0855502
1416 Ga0496109_0933491
1417 Ga0496110_0199392
1418 Ga0496110_0570547
1419 Ga0496112_0002037
1420 Ga0496112_0233758
1421 Ga0496112_0893424
1422 Ga0496113_0057646
1423 Ga0496113_0132627
1424 Ga0496114_0732062
1425 Ga0501031_0007336
1426 Ga0501032_0005253
1427 Ga0501032_0007209
1428 Ga0501032_0366242
1429 Ga0501033_0009445
1430 Ga0501033_0017279
1431 Ga0501033_0061580
1432 Ga0501034_0012912
1433 Ga0501034_0041079
1434 Ga0501034_0049367
1435 Ga0501034_0064287
1436 Ga0501034_0282049
1437 Ga0501036_0019691
1438 Ga0501036_0037637
1439 Ga0501036_0263535
1440 Ga0501037_0005503
1441 Ga0501037_0045486
1442 Ga0501038_0006794
1443 Ga0501038_0049104
1444 Ga0501038_0633171
1445 Ga0501039_0006593
1446 Ga0501039_0020533
1447 Ga0501039_0669844
1448 Ga0501040_0212833
1449 Ga0501040_1315101
1450 Ga0501041_0678165
1451 Ga0501042_0009071
1452 Ga0501042_0281366
1453 Ga0501043_0027004
1454 Ga0501043_0039125
1455 Ga0501043_0168154
1456 Ga0501046_0008623
1457 Ga0501046_0169626
1458 Ga0501047_0074600
1459 Ga0501047_0106568
1460 Ga0501047_0452311
1461 Ga0501048_0001012
1462 Ga0501048_0003368
1463 Ga0501048_0016776
1464 Ga0501048_0206828
1465 Ga0501067_0005254
1466 Ga0501067_0036150
1467 Ga0501068_0000933
1468 Ga0501068_0038412
1469 Ga0501068_1081868
1470 Ga0501069_0009593
1471 Ga0501069_0016337
1472 Ga0501069_0094451
1473 Ga0501070_0006402
1474 Ga0501070_0016682
1475 Ga0501070_0125790
1476 Ga0501071_0171797
1477 Ga0501071_0322913
1478 Ga0501072_0083875
1479 Ga0501072_0095665
1480 Ga0501072_0197489
1481 Ga0501072_0844182
1482 Ga0501073_0000599
1483 Ga0501073_0013545
1484 Ga0501073_0067941
1485 Ga0501074_0008977
1486 Ga0501074_0029728
1487 Ga0501074_0128373
1488 Ga0501075_0034881
1489 Ga0501075_0056767
1490 Ga0501075_0510104
1491 Ga0501075_1404491
1492 Ga0501247_007140
1493 Ga0501079_0012726
1494 Ga0501079_0046205
1495 Ga0501079_0146454
1496 Ga0501080_0051888
1497 Ga0501080_0068241
1498 Ga0501080_0506976
1499 Ga0501080_0953354
1500 Ga0501081_0291471
1501 Ga0501081_0320477
1502 Ga0501083_0010696
1503 Ga0501083_0034947
1504 Ga0501035_0004294
1505 Ga0501035_0106398
1506 Ga0501035_0108020
1507 Ga0501035_0219969
1508 Ga0501044_0036922
1509 Ga0501044_0045573
1510 Ga0501044_0075129
1511 Ga0501045_0012932
1512 Ga0501045_0024109
1513 Ga0501045_0033203
1514 nmdc:mga03n38_23686_c1
1515 nmdc:mga03n38_248322_c1
1516 nmdc:mga03n38_930393_c1
1517 nmdc:mga00v17_324510_c1
1518 nmdc:mga00v17_458378_c1
1519 nmdc:mga00v17_59829_c1
1520 nmdc:mga0k408_2142_c1
1521 nmdc:mga0k408_32333_c2
1522 nmdc:mga0k408_46453_c1
1523 nmdc:mga0k408_88855_c1
1524 nmdc:mga06z11_128878_c1
1525 nmdc:mga06z11_202412_c1
1526 nmdc:mga06z11_77087_c1
1527 nmdc:mga06z11_895946_c1
1528 nmdc:mga04h51_107891_c1
1529 nmdc:mga04h51_234129_c1
1530 nmdc:mga04h51_72535_c1
1531 nmdc:mga07m45_110067_c1
1532 nmdc:mga07m45_312086_c1
1533 nmdc:mga07m45_735467_c1
1534 nmdc:mga05p37_104762_c1
1535 nmdc:mga05p37_130658_c1
1536 nmdc:mga05p37_455571_c1
1537 nmdc:mga05p37_4_c1
1538 nmdc:mga05p37_75635_c1
1539 nmdc:mga05p37_85664_c2
1540 nmdc:mga09592_435644_c1
1541 nmdc:mga0qj67_1247439_c1
1542 nmdc:mga0qj67_247516_c1
1543 nmdc:mga06r32_166583_c1
1544 nmdc:mga06r32_1830282_c1
1545 nmdc:mga06r32_42303_c1
1546 nmdc:mga06r32_523098_c1
1547 nmdc:mga08y16_23445_c1
1548 nmdc:mga08y16_367933_c1
1549 nmdc:mga08y16_8519_c1
1550 nmdc:mga08y16_889616_c1
1551 nmdc:mga0n895_357983_c1
1552 nmdc:mga0n895_428433_c1
1553 nmdc:mga0n895_437377_c1
1554 nmdc:mga0n895_629750_c1
1555 nmdc:mga0n895_79917_c1
1556 nmdc:mga0rr50_1609291_c1
1557 nmdc:mga0rr50_4936_c1
1558 nmdc:mga0rr50_95014_c1
1559 nmdc:mga08x19_140033_c1
1560 nmdc:mga08x19_169470_c1
1561 nmdc:mga08x19_20141_c1
1562 nmdc:mga08x19_74453_c1
1563 nmdc:mga08x19_847049_c1
1564 nmdc:mga0a205_188072_c1
1565 Ga0495601_0129942
1566 Ga0495619_0317566
1567 Ga0500555_000547
1568 Ga0500645_000092
1569 Ga0501084_0007056
1570 Ga0501084_0045414
1571 Ga0501084_0083669
1572 Ga0501084_0093974
1573 Ga0501082_0007531
1574 Ga0501082_0036919
1575 Ga0501082_0073693
1576 Ga0501082_0629416
1577 Ga0530510_0102272
1578 Ga0530510_0363722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9393 5 107
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9328 5 105
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9134 6 109
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9132 5 107
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9049 4 109
ID Description Score Start End Superfamily
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9203 5 104 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9134 6 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9007 12 92 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8989 17 81 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8962 6 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A143PLJ9-F1-model_v4 Lineage-specific thermal regulator protein 0.9967 15 106
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.9955 12 111
AF-A0A3N5XMC9-F1-model_v4 PadR family transcriptional regulator 0.9927 15 109
AF-A0A6J4S1B4-F1-model_v4 Transcriptional regulator, PadR family 0.9918 15 110
AF-A0A2V8J116-F1-model_v4 PadR family transcriptional regulator 0.9916 15 107

Map