F480807

General Info

Members Datasets Scaffolds Average Seq Length
786 303 1572 156

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0821417|Ga0501039_0821417_53_610
Length 185
Sequence VLSLELHQLVGGQPAEGSVRFEEEIVDVLLQGGCSCGAVRYRLASDPLFVHCCHCLNCQRQTGSAFVINVLIESDRVEAVAGELQPVEVPRDDGSVQRIFRCPTCQIAVYSEYGLPGVLFVRAGTLDEPARVAPDVHIYTGSMVPWLTLPDSVPAYEVYYDTKSLWPAASLERLRAVMATARSGR

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 13.99
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0821417 3300049575 Unclassified 725
2 JGI24744J21845_10016830 3300002077 Unclassified 1455
3 JGI25406J46586_10009089 3300003203 Bacteria 4463
4 Ga0070658_10037593 3300005327 Bacteria 3903
5 Ga0070658_11032594 3300005327 Bacteria 715
6 Ga0070683_100000743 3300005329 Bacteria 23855
7 Ga0070683_100104626 3300005329 Bacteria 2668
8 Ga0070683_100344139 3300005329 Unclassified 1420
9 Ga0070683_100696850 3300005329 Bacteria 973
10 Ga0068869_100902986 3300005334 Bacteria 765
11 Ga0070680_100003202 3300005336 Bacteria 12168
12 Ga0070680_100402244 3300005336 Bacteria 1167
13 Ga0070680_100806149 3300005336 Bacteria 809
14 Ga0070682_100005074 3300005337 Bacteria 7319
15 Ga0070682_100008066 3300005337 Bacteria 5932
16 Ga0070682_100148071 3300005337 Unclassified 1608
17 Ga0068868_100133753 3300005338 Bacteria 2031
18 Ga0068868_100559833 3300005338 Bacteria 1008
19 Ga0070660_100032096 3300005339 Bacteria 3950
20 Ga0070660_100585758 3300005339 Bacteria 932
21 Ga0070660_100649519 3300005339 Bacteria 883
22 Ga0070660_100917387 3300005339 Unclassified 739
23 Ga0070689_100019316 3300005340 Bacteria 5037
24 Ga0070661_100241156 3300005344 Bacteria 1392
25 Ga0070692_10492134 3300005345 Bacteria 793
26 Ga0070675_100278538 3300005354 Unclassified 1469
27 Ga0070671_100284379 3300005355 Unclassified 1407
28 Ga0070674_100310152 3300005356 Bacteria 1261
29 Ga0070674_100381849 3300005356 Unclassified 1146
30 Ga0070673_100184700 3300005364 Bacteria 1787
31 Ga0070688_100050310 3300005365 Bacteria 2595
32 Ga0070659_100472423 3300005366 Bacteria 1066
33 Ga0070659_100690613 3300005366 Bacteria 882
34 Ga0070659_100778483 3300005366 Bacteria 831
35 Ga0070709_10008638 3300005434 Bacteria 5603
36 Ga0070709_10414823 3300005434 Bacteria 1008
37 Ga0070714_100011748 3300005435 Bacteria 6957
38 Ga0070714_100050101 3300005435 Bacteria 3556
39 Ga0070714_100126023 3300005435 Bacteria 2283
40 Ga0070714_100234063 3300005435 Bacteria 1693
41 Ga0070713_100130025 3300005436 Bacteria 2219
42 Ga0070710_10001819 3300005437 Bacteria 10069
43 Ga0070701_10003555 3300005438 Bacteria 6185
44 Ga0070701_10607666 3300005438 Bacteria 725
45 Ga0070711_100192661 3300005439 Bacteria 1568
46 Ga0070711_100491155 3300005439 Bacteria 1011
47 Ga0070705_100149470 3300005440 Bacteria 1548
48 Ga0070700_100375491 3300005441 Bacteria 1062
49 Ga0070708_100098765 3300005445 Bacteria 2670
50 Ga0070708_101919043 3300005445 Bacteria 549
51 Ga0070663_100077726 3300005455 Bacteria 2431
52 Ga0070678_100003130 3300005456 Bacteria 9160
53 Ga0070662_100096082 3300005457 Bacteria 2235
54 Ga0070681_10006580 3300005458 Bacteria 11318
55 Ga0070706_100134014 3300005467 Unclassified 2312
56 Ga0070707_100001273 3300005468 Bacteria 24807
57 Ga0070707_100051171 3300005468 Bacteria 3960
58 Ga0070707_100282500 3300005468 Bacteria 1613
59 Ga0070707_100439647 3300005468 Bacteria 1265
60 Ga0070698_100112306 3300005471 Bacteria 2690
61 Ga0070698_100668524 3300005471 Bacteria 980
62 Ga0070698_101371957 3300005471 Bacteria 657
63 Ga0070699_100018500 3300005518 Bacteria 5983
64 Ga0070679_100003409 3300005530 Bacteria 14558
65 Ga0070679_100303580 3300005530 Bacteria 1547
66 Ga0070679_100340001 3300005530 Bacteria 1449
67 Ga0070679_101446435 3300005530 Bacteria 634
68 Ga0070684_100000331 3300005535 Bacteria 32759
69 Ga0070684_100136300 3300005535 Bacteria 2218
70 Ga0070684_100217182 3300005535 Bacteria 1744
71 Ga0070684_100492644 3300005535 Bacteria 1135
72 Ga0070684_100989435 3300005535 Bacteria 789
73 Ga0070697_100048581 3300005536 Bacteria 3441
74 Ga0070672_100621401 3300005543 Bacteria 942
75 Ga0070686_100100961 3300005544 Unclassified 1949
76 Ga0070695_100493270 3300005545 Bacteria 946
77 Ga0070696_101136258 3300005546 Bacteria 658
78 Ga0070693_100129490 3300005547 Bacteria 1576
79 Ga0070693_100832951 3300005547 Bacteria 686
80 Ga0068855_100597830 3300005563 Unclassified 1190
81 Ga0070664_100775018 3300005564 Bacteria 896
82 Ga0070664_101154181 3300005564 Bacteria 730
83 Ga0068854_100588910 3300005578 Bacteria 948
84 Ga0068856_100009273 3300005614 Bacteria 9562
85 Ga0068856_100075066 3300005614 Bacteria 3349
86 Ga0068856_100138643 3300005614 Bacteria 2439
87 Ga0068856_100355481 3300005614 Archaea 1484
88 Ga0068856_100634983 3300005614 Bacteria 1088
89 Ga0070702_100000772 3300005615 Bacteria 12143
90 Ga0070702_100546953 3300005615 Bacteria 859
91 Ga0068852_100444947 3300005616 Unclassified 1282
92 Ga0068852_102542419 3300005616 Unclassified 532
93 Ga0068863_100103576 3300005841 Archaea 2707
94 Ga0068863_101794565 3300005841 Unclassified 623
95 Ga0068858_100233286 3300005842 Bacteria 1745
96 Ga0081538_10000116 3300005981 Bacteria 80435
97 Ga0081538_10002632 3300005981 Bacteria 17353
98 Ga0081538_10004941 3300005981 Bacteria 12144
99 Ga0081540_1013281 3300005983 Bacteria 5362
100 Ga0081539_10000840 3300005985 Bacteria 58916
101 Ga0070717_10042011 3300006028 Bacteria 3729
102 Ga0070717_10058586 3300006028 Unclassified 3185
103 Ga0070717_10435713 3300006028 Unclassified 1180
104 Ga0075432_10035187 3300006058 Bacteria 1740
105 Ga0075432_10111598 3300006058 Bacteria 1019
106 Ga0070716_100350135 3300006173 Bacteria 1045
107 Ga0070716_100983824 3300006173 Bacteria 666
108 Ga0070712_100004060 3300006175 Bacteria 8986
109 Ga0070712_100020415 3300006175 Bacteria 4335
110 Ga0070712_100044173 3300006175 Bacteria 3071
111 Ga0070712_100046920 3300006175 Bacteria 2988
112 Ga0070712_100475783 3300006175 Bacteria 1044
113 Ga0097621_100014698 3300006237 Bacteria 5867
114 Ga0097621_100215326 3300006237 Bacteria 1672
115 Ga0097621_100339585 3300006237 Unclassified 1334
116 Ga0097621_100451110 3300006237 Bacteria 1159
117 Ga0068871_100853148 3300006358 Bacteria 842
118 Ga0075428_100005274 3300006844 Bacteria 14375
119 Ga0075428_100022979 3300006844 Bacteria 6901
120 Ga0075428_100080755 3300006844 Bacteria 3549
121 Ga0075431_100033032 3300006847 Bacteria 5333
122 Ga0075431_100039338 3300006847 Bacteria 4872
123 Ga0075431_100579724 3300006847 Bacteria 1107
124 Ga0075433_10039456 3300006852 Bacteria 4083
125 Ga0075433_10673257 3300006852 Bacteria 907
126 Ga0075434_100001941 3300006871 Bacteria 17939
127 Ga0075434_100008128 3300006871 Bacteria 9729
128 Ga0075434_100203481 3300006871 Bacteria 2000
129 Ga0068865_100250606 3300006881 Unclassified 1397
130 Ga0075436_100014538 3300006914 Bacteria 5394
131 Ga0075436_100101258 3300006914 Bacteria 2006
132 Ga0075436_100885922 3300006914 Unclassified 667
133 Ga0075435_100044418 3300007076 Bacteria 3559
134 Ga0075435_100059573 3300007076 Bacteria 3095
135 Ga0105240_10205289 3300009093 Bacteria 2307
136 Ga0111539_10036486 3300009094 Bacteria 5943
137 Ga0111539_10106419 3300009094 Bacteria 3290
138 Ga0111539_11599318 3300009094 Bacteria 756
139 Ga0105245_10000499 3300009098 Bacteria 35958
140 Ga0105245_10009775 3300009098 Bacteria 8356
141 Ga0105245_10332886 3300009098 Bacteria 1499
142 Ga0105245_10440715 3300009098 Bacteria 1309
143 Ga0105245_10553517 3300009098 Archaea 1172
144 Ga0105245_10589262 3300009098 Bacteria 1137
145 Ga0105245_11140978 3300009098 Bacteria 826
146 Ga0105247_10194202 3300009101 Bacteria 1360
147 Ga0114129_10001814 3300009147 Bacteria 29120
148 Ga0114129_10006241 3300009147 Bacteria 16896
149 Ga0114129_10403917 3300009147 Unclassified 1800
150 Ga0114129_11918013 3300009147 Bacteria 718
151 Ga0105243_11361751 3300009148 Bacteria 729
152 Ga0105241_10006217 3300009174 Bacteria 8806
153 Ga0105242_10150093 3300009176 Bacteria 2031
154 Ga0105242_10167892 3300009176 Bacteria 1926
155 Ga0105242_12614268 3300009176 Bacteria 554
156 Ga0105248_10022192 3300009177 Bacteria 7037
157 Ga0105248_10740835 3300009177 Bacteria 1109
158 Ga0105248_10978727 3300009177 Bacteria 956
159 Ga0105237_10869823 3300009545 Bacteria 908
160 Ga0105237_10906461 3300009545 Bacteria 888
161 Ga0105238_10116442 3300009551 Bacteria 2652
162 Ga0105238_10528964 3300009551 Bacteria 1182
163 Ga0105238_11324630 3300009551 Bacteria 746
164 Ga0105239_10215354 3300010375 Bacteria 2153
165 Ga0105239_10328854 3300010375 Bacteria 1724
166 Ga0105239_10411395 3300010375 Bacteria 1531
167 Ga0105239_10615956 3300010375 Bacteria 1239
168 Ga0105246_10164952 3300011119 Unclassified 1691
169 Ga0105246_10323638 3300011119 Unclassified 1254
170 Ga0157317_1005368 3300012475 Bacteria 865
171 Ga0157373_10653792 3300013100 Bacteria 768
172 Ga0157369_11692307 3300013105 Bacteria 643
173 Ga0157374_10030954 3300013296 Bacteria 4860
174 Ga0157374_10120807 3300013296 Bacteria 2528
175 Ga0157378_10341163 3300013297 Bacteria 1461
176 Ga0163162_10095384 3300013306 Unclassified 3061
177 Ga0163162_10309929 3300013306 Bacteria 1711
178 Ga0163162_10800919 3300013306 Bacteria 1060
179 Ga0157372_10284565 3300013307 Unclassified 1923
180 Ga0157372_11626611 3300013307 Bacteria 743
181 Ga0157375_10927833 3300013308 Bacteria 1013
182 Ga0157375_11914948 3300013308 Bacteria 704
183 Ga0157375_11979085 3300013308 Bacteria 692
184 Ga0157375_12265243 3300013308 Unclassified 647
185 Ga0163163_10261044 3300014325 Bacteria 1783
186 Ga0163163_10563057 3300014325 Bacteria 1202
187 Ga0157380_10060122 3300014326 Bacteria 3035
188 Ga0157380_11343834 3300014326 Unclassified 763
189 Ga0182008_10004085 3300014497 Bacteria 8608
190 Ga0182008_10089668 3300014497 Bacteria 1516
191 Ga0157377_10014451 3300014745 Bacteria 4018
192 Ga0157377_10333574 3300014745 Bacteria 1012
193 Ga0157377_10427226 3300014745 Bacteria 909
194 Ga0157377_11081800 3300014745 Unclassified 613
195 Ga0157376_10285770 3300014969 Bacteria 1555
196 Ga0157376_10362980 3300014969 Bacteria 1389
197 Ga0157376_10630509 3300014969 Bacteria 1070
198 Ga0157376_11135344 3300014969 Bacteria 808
199 Ga0182006_1008244 3300015261 Bacteria 4727
200 Ga0182007_10007521 3300015262 Bacteria 4561
201 Ga0163161_10105890 3300017792 Bacteria 2098
202 Ga0206356_10024515 3300020070 Bacteria 2066
203 Ga0206353_10593270 3300020082 Bacteria 1019
204 Ga0206353_11070079 3300020082 Bacteria 1198
205 Ga0207692_10659397 3300025898 Unclassified 677
206 Ga0207710_10101060 3300025900 Bacteria 1360
207 Ga0207688_10065409 3300025901 Bacteria 2055
208 Ga0207647_10060678 3300025904 Bacteria 2311
209 Ga0207685_10107893 3300025905 Unclassified 1202
210 Ga0207699_10127929 3300025906 Bacteria 1652
211 Ga0207699_10879778 3300025906 Bacteria 660
212 Ga0207643_10454500 3300025908 Bacteria 815
213 Ga0207705_10048413 3300025909 Bacteria 3058
214 Ga0207684_10158783 3300025910 Bacteria 1946
215 Ga0207707_10011505 3300025912 Bacteria 7706
216 Ga0207707_10313100 3300025912 Bacteria 1356
217 Ga0207695_11086824 3300025913 Bacteria 680
218 Ga0207671_10905020 3300025914 Bacteria 697
219 Ga0207693_10007412 3300025915 Bacteria 9022
220 Ga0207693_10022305 3300025915 Bacteria 5031
221 Ga0207693_10031178 3300025915 Bacteria 4212
222 Ga0207693_10034202 3300025915 Bacteria 4009
223 Ga0207693_10066997 3300025915 Bacteria 2811
224 Ga0207693_10380077 3300025915 Unclassified 1104
225 Ga0207693_10421631 3300025915 Bacteria 1043
226 Ga0207693_10525710 3300025915 Unclassified 923
227 Ga0207663_10159215 3300025916 Bacteria 1592
228 Ga0207663_10178368 3300025916 Bacteria 1515
229 Ga0207663_10736920 3300025916 Bacteria 782
230 Ga0207660_10359418 3300025917 Bacteria 1168
231 Ga0207657_10044303 3300025919 Bacteria 3912
232 Ga0207657_10152325 3300025919 Bacteria 1882
233 Ga0207657_10337799 3300025919 Bacteria 1189
234 Ga0207657_10578469 3300025919 Unclassified 877
235 Ga0207649_10146643 3300025920 Bacteria 1621
236 Ga0207652_10001137 3300025921 Bacteria 23969
237 Ga0207652_10267587 3300025921 Bacteria 1542
238 Ga0207652_11287170 3300025921 Bacteria 634
239 Ga0207646_10002421 3300025922 Bacteria 22033
240 Ga0207646_10044713 3300025922 Bacteria 3975
241 Ga0207646_10208212 3300025922 Bacteria 1766
242 Ga0207646_10909775 3300025922 Bacteria 780
243 Ga0207681_10848849 3300025923 Bacteria 764
244 Ga0207694_11399382 3300025924 Bacteria 591
245 Ga0207659_10926317 3300025926 Bacteria 749
246 Ga0207687_10003291 3300025927 Bacteria 10931
247 Ga0207687_10049765 3300025927 Bacteria 2915
248 Ga0207687_10100789 3300025927 Bacteria 2125
249 Ga0207687_10682081 3300025927 Bacteria 871
250 Ga0207664_10005779 3300025929 Bacteria 8462
251 Ga0207664_10066156 3300025929 Bacteria 2896
252 Ga0207664_10081174 3300025929 Bacteria 2638
253 Ga0207664_10108400 3300025929 Bacteria 2306
254 Ga0207664_10197061 3300025929 Bacteria 1737
255 Ga0207690_10361540 3300025932 Bacteria 1150
256 Ga0207686_10102075 3300025934 Bacteria 1917
257 Ga0207686_10197420 3300025934 Bacteria 1439
258 Ga0207704_10398529 3300025938 Bacteria 1085
259 Ga0207704_10967567 3300025938 Unclassified 719
260 Ga0207665_10459007 3300025939 Bacteria 979
261 Ga0207691_10066192 3300025940 Bacteria 3270
262 Ga0207661_10019903 3300025944 Bacteria 5009
263 Ga0207661_10117192 3300025944 Bacteria 2262
264 Ga0207661_10156730 3300025944 Bacteria 1973
265 Ga0207661_11023679 3300025944 Bacteria 761
266 Ga0207679_10077802 3300025945 Bacteria 2525
267 Ga0207679_10748570 3300025945 Unclassified 889
268 Ga0207679_11782747 3300025945 Bacteria 563
269 Ga0207667_11405457 3300025949 Bacteria 671
270 Ga0207640_10310709 3300025981 Bacteria 1251
271 Ga0207658_10702721 3300025986 Bacteria 914
272 Ga0207677_10118854 3300026023 Bacteria 1984
273 Ga0207678_10083180 3300026067 Bacteria 2738
274 Ga0207678_10198421 3300026067 Bacteria 1715
275 Ga0207708_10002065 3300026075 Bacteria 14794
276 Ga0207708_10438306 3300026075 Bacteria 1086
277 Ga0207708_11711494 3300026075 Unclassified 552
278 Ga0207702_10007123 3300026078 Bacteria 9569
279 Ga0207702_10126471 3300026078 Bacteria 2295
280 Ga0207702_10607363 3300026078 Bacteria 1074
281 Ga0207702_10825268 3300026078 Bacteria 917
282 Ga0207641_10075389 3300026088 Archaea 2913
283 Ga0207674_10099425 3300026116 Bacteria 2892
284 Ga0207674_11569270 3300026116 Bacteria 627
285 Ga0207674_11979452 3300026116 Bacteria 548
286 Ga0207675_101382541 3300026118 Unclassified 725
287 Ga0207683_10002467 3300026121 Bacteria 16133
288 Ga0207683_10024660 3300026121 Bacteria 5181
289 Ga0207698_11294700 3300026142 Bacteria 743
290 Ga0207428_10008352 3300027907 Bacteria 9355
291 Ga0207428_10056739 3300027907 Bacteria 3111
292 Ga0207428_10215323 3300027907 Unclassified 1442
293 Ga0268266_10496101 3300028379 Unclassified 1165
294 Ga0268265_11044306 3300028380 Bacteria 809
295 Ga0265319_1063777 3300028563 Bacteria 1191
296 Ga0265334_10144269 3300028573 Archaea 842
297 Ga0265318_10041796 3300028577 Unclassified 1741
298 Ga0265338_10049709 3300028800 Bacteria 3797
299 Ga0265338_10068117 3300028800 Bacteria 3069
300 Ga0265338_10122295 3300028800 Bacteria 2072
301 Ga0265338_10131954 3300028800 Bacteria 1971
302 Ga0265332_10144245 3300031238 Bacteria 997
303 Ga0265320_10044762 3300031240 Bacteria 2179
304 Ga0265339_10013897 3300031249 Bacteria 4871
305 Ga0265331_10002389 3300031250 Bacteria 12737
306 Ga0265331_10084398 3300031250 Unclassified 1472
307 Ga0265316_10104349 3300031344 Bacteria 2151
308 Ga0265313_10000079 3300031595 Bacteria 95515
309 Ga0265314_10014243 3300031711 Bacteria 6375
310 Ga0265314_10018093 3300031711 Bacteria 5508
311 Ga0265342_10030080 3300031712 Bacteria 3369
312 Ga0265342_10231408 3300031712 Unclassified 993
313 Ga0307406_11100966 3300031901 Unclassified 686
314 Ga0307416_100270025 3300032002 Bacteria 1669
315 Ga0373944_0005132 3300035089 Unclassified 3440
316 Ga0373939_0062398 3300035114 Bacteria 1191
317 Ga0373960_0028199 3300035121 Bacteria 1548
318 Ga0373946_0388415 3300035171 Bacteria 703
319 Ga0373955_0560039 3300035172 Bacteria 699
320 Ga0373942_0016327 3300035207 Bacteria 1820
321 Ga0373947_1179984 3300035725 Bacteria 521
322 Ga0373937_0309752 3300036401 Bacteria 1493
323 Ga0395899_0208807 3300037312 Unclassified 1358
324 Ga0395899_0347258 3300037312 Bacteria 993
325 Ga0395900_0036646 3300037418 Bacteria 5057
326 Ga0395900_0057702 3300037418 Bacteria 3997
327 Ga0395900_0102148 3300037418 Bacteria 2945
328 Ga0395900_0125708 3300037418 Bacteria 2630
329 Ga0395900_0141996 3300037418 Bacteria 2458
330 Ga0395900_0207769 3300037418 Bacteria 1978
331 Ga0395900_0311626 3300037418 Bacteria 1557
332 Ga0395900_0696999 3300037418 Bacteria 949
333 Ga0395900_0762359 3300037418 Unclassified 897
334 Ga0395900_0848088 3300037418 Bacteria 839
335 Ga0395898_0007289 3300037466 Bacteria 11739
336 Ga0395898_0032534 3300037466 Bacteria 5206
337 Ga0395898_0036354 3300037466 Bacteria 4890
338 Ga0395898_0046089 3300037466 Bacteria 4282
339 Ga0395898_0083255 3300037466 Bacteria 3084
340 Ga0395898_0213695 3300037466 Bacteria 1840
341 Ga0395898_0839084 3300037466 Bacteria 858
342 Ga0395898_1021261 3300037466 Bacteria 762
343 Ga0395905_0003639 3300037471 Bacteria 16380
344 Ga0395905_0057384 3300037471 Bacteria 3642
345 Ga0395905_0088822 3300037471 Bacteria 2896
346 Ga0395905_0252053 3300037471 Bacteria 1649
347 Ga0395905_0398625 3300037471 Bacteria 1271
348 Ga0395905_0922527 3300037471 Bacteria 776
349 Ga0395901_0023034 3300038443 Bacteria 6383
350 Ga0395901_0114916 3300038443 Bacteria 2827
351 Ga0395901_0138741 3300038443 Bacteria 2555
352 Ga0395901_0161710 3300038443 Bacteria 2351
353 Ga0395901_0170458 3300038443 Bacteria 2284
354 Ga0395901_0198365 3300038443 Bacteria 2104
355 Ga0395901_0201522 3300038443 Bacteria 2086
356 Ga0395901_0237349 3300038443 Bacteria 1902
357 Ga0395901_0684929 3300038443 Unclassified 1024
358 Ga0395901_0764020 3300038443 Bacteria 958
359 Ga0395901_0932015 3300038443 Bacteria 848
360 Ga0395901_1181906 3300038443 Bacteria 732
361 Ga0395901_1559005 3300038443 Unclassified 615
362 Ga0451853_0125869 3300041512 Bacteria 711
363 Ga0451853_1097714 3300041512 Unclassified 1953
364 Ga0466969_0003156 3300044656 Bacteria 8774
365 Ga0466969_0119486 3300044656 Bacteria 1228
366 Ga0466965_0028061 3300044683 Bacteria 2733
367 Ga0466965_0741387 3300044683 Bacteria 566
368 Ga0466966_0007964 3300044684 Bacteria 7022
369 Ga0466966_0159014 3300044684 Bacteria 1376
370 Ga0466961_0002499 3300044693 Bacteria 11403
371 Ga0466961_0039290 3300044693 Bacteria 3034
372 Ga0466961_0055770 3300044693 Bacteria 2518
373 Ga0466961_0067042 3300044693 Unclassified 2280
374 Ga0466961_0330236 3300044693 Bacteria 929
375 Ga0466963_0000708 3300044694 Bacteria 16285
376 Ga0466963_0002922 3300044694 Bacteria 9652
377 Ga0466963_0014391 3300044694 Bacteria 4876
378 Ga0466963_0043355 3300044694 Bacteria 2957
379 Ga0466963_0168411 3300044694 Bacteria 1526
380 Ga0466963_0560343 3300044694 Bacteria 807
381 Ga0466964_0001239 3300044706 Bacteria 8665
382 Ga0466964_0003090 3300044706 Bacteria 6055
383 Ga0466964_0004061 3300044706 Bacteria 5384
384 Ga0466964_0018430 3300044706 Bacteria 2679
385 Ga0466964_0028944 3300044706 Bacteria 2185
386 Ga0466964_0603765 3300044706 Bacteria 602
387 Ga0466971_0001732 3300044719 Bacteria 9241
388 Ga0466968_0000973 3300044735 Bacteria 10068
389 Ga0466968_0017577 3300044735 Bacteria 2860
390 Ga0466968_0179692 3300044735 Unclassified 984
391 Ga0466968_0194945 3300044735 Bacteria 947
392 Ga0466970_0006853 3300044765 Bacteria 5704
393 Ga0466957_0005364 3300044842 Bacteria 7196
394 Ga0466957_0008149 3300044842 Bacteria 5949
395 Ga0466957_0010927 3300044842 Bacteria 5221
396 Ga0466957_0138166 3300044842 Unclassified 1568
397 Ga0466957_0399120 3300044842 Bacteria 940
398 Ga0466957_0445467 3300044842 Unclassified 892
399 Ga0466960_0013583 3300044901 Bacteria 3464
400 Ga0466960_0014013 3300044901 Bacteria 3419
401 Ga0466960_0130515 3300044901 Bacteria 1325
402 Ga0466960_0383945 3300044901 Bacteria 806
403 Ga0466959_0004476 3300045049 Bacteria 9361
404 Ga0466959_0004730 3300045049 Bacteria 9168
405 Ga0466959_0030254 3300045049 Bacteria 4010
406 Ga0466959_0046432 3300045049 Bacteria 3196
407 Ga0466959_0118172 3300045049 Bacteria 1887
408 Ga0466959_0130906 3300045049 Unclassified 1778
409 Ga0466959_0477692 3300045049 Bacteria 844
410 Ga0451576_0153814 3300045051 Bacteria 2399
411 Ga0451576_1822756 3300045051 Bacteria 629
412 Ga0466958_0003062 3300045836 Bacteria 8573
413 Ga0466958_0006780 3300045836 Bacteria 6257
414 Ga0466958_0007980 3300045836 Bacteria 5852
415 Ga0466958_0016026 3300045836 Bacteria 4309
416 Ga0466958_0023004 3300045836 Bacteria 3654
417 Ga0466958_0023888 3300045836 Bacteria 3594
418 Ga0466958_0033920 3300045836 Bacteria 3043
419 Ga0466958_0089962 3300045836 Bacteria 1899
420 Ga0466958_0100516 3300045836 Unclassified 1798
421 Ga0466967_0000724 3300045976 Bacteria 16867
422 Ga0466967_0001136 3300045976 Bacteria 14841
423 Ga0466967_0002143 3300045976 Bacteria 12109
424 Ga0466967_0008248 3300045976 Bacteria 7608
425 Ga0466967_0047040 3300045976 Bacteria 3759
426 Ga0466967_0072144 3300045976 Bacteria 3094
427 Ga0466967_0105771 3300045976 Bacteria 2578
428 Ga0466967_0121606 3300045976 Bacteria 2413
429 Ga0466967_0249020 3300045976 Bacteria 1697
430 Ga0466967_0303291 3300045976 Bacteria 1537
431 Ga0466967_0541609 3300045976 Bacteria 1145
432 Ga0466967_0682941 3300045976 Bacteria 1016
433 Ga0466967_0775299 3300045976 Bacteria 951
434 Ga0466967_0915972 3300045976 Bacteria 872
435 Ga0466967_1854741 3300045976 Unclassified 600
436 Ga0466967_1931024 3300045976 Bacteria 587
437 Ga0466967_2246894 3300045976 Bacteria 541
438 Ga0495592_0019587 3300046454 Bacteria 5147
439 Ga0495603_0007573 3300046455 Bacteria 6533
440 Ga0495603_0222706 3300046455 Bacteria 1088
441 Ga0495603_0555752 3300046455 Unclassified 657
442 Ga0495629_0126716 3300046459 Bacteria 1779
443 Ga0495641_0030633 3300046461 Unclassified 2577
444 Ga0495641_0031387 3300046461 Plasmid 2539
445 Ga0495641_0181036 3300046461 Bacteria 943
446 Ga0495651_0494842 3300046462 Unclassified 783
447 Ga0495653_0064460 3300046463 Bacteria 2761
448 Ga0495653_0199873 3300046463 Unclassified 1357
449 Ga0495580_0141919 3300046472 Bacteria 1665
450 Ga0495580_0533018 3300046472 Unclassified 781
451 Ga0495582_0075788 3300046473 Unclassified 1863
452 Ga0495582_0124808 3300046473 Bacteria 1452
453 Ga0495639_0033196 3300046475 Bacteria 2305
454 Ga0495662_0163084 3300046476 Bacteria 1098
455 Ga0495664_0176451 3300046477 Bacteria 1296
456 Ga0495585_0399780 3300046492 Bacteria 662
457 Ga0495594_0072563 3300046499 Bacteria 1915
458 Ga0495596_0099476 3300046500 Bacteria 1129
459 Ga0495608_0038050 3300046511 Plasmid 3234
460 Ga0495608_0291708 3300046511 Bacteria 1011
461 Ga0495618_0169533 3300046514 Bacteria 1390
462 Ga0495618_0177483 3300046514 Bacteria 1354
463 Ga0495618_0494868 3300046514 Bacteria 738
464 Ga0495628_0084449 3300046516 Bacteria 2464
465 Ga0495630_0030750 3300046517 Plasmid 3996
466 Ga0495630_0040249 3300046517 Bacteria 3493
467 Ga0495630_0087466 3300046517 Unclassified 2353
468 Ga0495630_0208811 3300046517 Bacteria 1490
469 Ga0495663_0143960 3300046525 Bacteria 810
470 Ga0495666_0051206 3300046526 Bacteria 1984
471 Ga0495666_0171358 3300046526 Unclassified 1004
472 Ga0495665_0280867 3300046531 Unclassified 854
473 Ga0495665_0373795 3300046531 Bacteria 725
474 Ga0495640_0042413 3300046533 Plasmid 3175
475 Ga0495640_0086303 3300046533 Unclassified 2078
476 Ga0495640_0395671 3300046533 Bacteria 849
477 Ga0495587_0077554 3300046536 Bacteria 1929
478 Ga0495645_0458750 3300046543 Unclassified 803
479 Ga0495667_0002340 3300046559 Bacteria 12674
480 Ga0495667_0224014 3300046559 Bacteria 1200
481 Ga0495656_0075014 3300046615 Bacteria 1512
482 Ga0495656_0104758 3300046615 Bacteria 1314
483 Ga0495656_0255290 3300046615 Bacteria 887
484 Ga0495668_0260805 3300046616 Bacteria 949
485 Ga0495634_0039726 3300046642 Unclassified 3203
486 Ga0495634_0049930 3300046642 Bacteria 2811
487 Ga0495634_0079591 3300046642 Unclassified 2146
488 Ga0495634_0113615 3300046642 Bacteria 1739
489 Ga0495634_0391091 3300046642 Bacteria 827
490 Ga0495635_0036782 3300046663 Bacteria 3391
491 Ga0495635_0089730 3300046663 Bacteria 2103
492 Ga0495635_0298632 3300046663 Bacteria 1080
493 Ga0495588_0048975 3300046674 Unclassified 2171
494 Ga0495588_0252807 3300046674 Bacteria 929
495 Ga0495657_0066832 3300046675 Unclassified 2361
496 Ga0495657_0664084 3300046675 Bacteria 600
497 Ga0495599_0395434 3300046678 Bacteria 824
498 Ga0495646_0073097 3300046680 Bacteria 2015
499 Ga0495646_0379069 3300046680 Unclassified 738
500 Ga0495647_0196017 3300046681 Unclassified 884
501 Ga0495658_0409041 3300046683 Unclassified 865
502 Ga0495669_0152036 3300046684 Bacteria 1096
503 Ga0495613_0109095 3300046689 Unclassified 1996
504 Ga0495624_0029778 3300046690 Bacteria 3560
505 Ga0495624_0540841 3300046690 Unclassified 696
506 Ga0495670_0525096 3300046691 Bacteria 643
507 Ga0495581_0046330 3300047315 Unclassified 2512
508 Ga0495581_0355458 3300047315 Bacteria 855
509 Ga0495604_0105620 3300047317 Unclassified 2061
510 Ga0495674_0020877 3300047319 Bacteria 6063
511 Ga0495674_0022708 3300047319 Bacteria 5783
512 Ga0495674_0060813 3300047319 Bacteria 3295
513 Ga0495674_0102632 3300047319 Bacteria 2432
514 Ga0495676_0018502 3300047321 Bacteria 6143
515 Ga0495676_0113508 3300047321 Unclassified 1983
516 Ga0495680_0001666 3300047322 Bacteria 23625
517 Ga0495680_0025593 3300047322 Bacteria 4881
518 Ga0495680_0763220 3300047322 Bacteria 634
519 Ga0495683_0259857 3300047323 Bacteria 759
520 Ga0495675_0093386 3300047444 Bacteria 1888
521 Ga0495677_0030079 3300047445 Bacteria 1976
522 Ga0495684_0005868 3300047471 Bacteria 9542
523 Ga0495684_0108745 3300047471 Bacteria 2094
524 Ga0495684_0367595 3300047471 Unclassified 1017
525 Ga0495593_0111518 3300047673 Bacteria 1396
526 Ga0495593_0309122 3300047673 Unclassified 790
527 Ga0495614_0454361 3300048089 Unclassified 606
528 Ga0496100_0005437 3300048903 Bacteria 6861
529 Ga0496100_0041717 3300048903 Archaea 2927
530 Ga0496100_0154774 3300048903 Bacteria 1638
531 Ga0496100_0352338 3300048903 Unclassified 1112
532 Ga0496100_0592481 3300048903 Bacteria 860
533 Ga0496100_0994064 3300048903 Bacteria 660
534 Ga0496101_0016236 3300048904 Bacteria 5025
535 Ga0496101_0074693 3300048904 Bacteria 2494
536 Ga0496101_0142218 3300048904 Bacteria 1829
537 Ga0496101_0143455 3300048904 Bacteria 1822
538 Ga0496101_0284245 3300048904 Bacteria 1293
539 Ga0496101_0314999 3300048904 Archaea 1227
540 Ga0496101_0411686 3300048904 Bacteria 1065
541 Ga0496101_0415876 3300048904 Bacteria 1060
542 Ga0496101_1242472 3300048904 Bacteria 583
543 Ga0496102_0007721 3300048905 Bacteria 9189
544 Ga0496102_0117880 3300048905 Bacteria 2478
545 Ga0496102_0175401 3300048905 Bacteria 2018
546 Ga0496102_0261344 3300048905 Bacteria 1632
547 Ga0496102_0324391 3300048905 Bacteria 1450
548 Ga0496103_0010969 3300048906 Bacteria 5363
549 Ga0496103_0096402 3300048906 Unclassified 1869
550 Ga0496103_0135952 3300048906 Bacteria 1571
551 Ga0496103_0972646 3300048906 Bacteria 529
552 Ga0496104_0026073 3300048907 Bacteria 5392
553 Ga0496104_0028441 3300048907 Bacteria 5182
554 Ga0496104_0068366 3300048907 Bacteria 3376
555 Ga0496104_0271195 3300048907 Unclassified 1609
556 Ga0496104_0314815 3300048907 Bacteria 1478
557 Ga0496104_0882625 3300048907 Bacteria 799
558 Ga0496105_0019277 3300048908 Bacteria 5502
559 Ga0496105_0028767 3300048908 Bacteria 4546
560 Ga0496105_0036529 3300048908 Bacteria 4048
561 Ga0496105_0037713 3300048908 Bacteria 3980
562 Ga0496105_0147147 3300048908 Unclassified 1937
563 Ga0496105_0155564 3300048908 Bacteria 1878
564 Ga0496105_0190285 3300048908 Bacteria 1678
565 Ga0496105_0267618 3300048908 Bacteria 1381
566 Ga0496105_0286138 3300048908 Bacteria 1328
567 Ga0496105_0298217 3300048908 Bacteria 1296
568 Ga0496106_0005815 3300048909 Bacteria 9116
569 Ga0496106_0170606 3300048909 Bacteria 1724
570 Ga0496106_0230054 3300048909 Archaea 1480
571 Ga0496106_0489666 3300048909 Bacteria 988
572 Ga0496106_0636857 3300048909 Bacteria 852
573 Ga0496106_1094023 3300048909 Bacteria 625
574 Ga0496107_0003984 3300048910 Bacteria 9945
575 Ga0496107_0041602 3300048910 Bacteria 3300
576 Ga0496107_0042495 3300048910 Bacteria 3264
577 Ga0496107_0053936 3300048910 Bacteria 2900
578 Ga0496107_0107065 3300048910 Bacteria 2054
579 Ga0496107_0179720 3300048910 Archaea 1571
580 Ga0496107_0265702 3300048910 Bacteria 1277
581 Ga0496107_0337644 3300048910 Bacteria 1121
582 Ga0496107_0596270 3300048910 Unclassified 817
583 Ga0496108_0014563 3300048911 Bacteria 6419
584 Ga0496108_0072847 3300048911 Bacteria 2900
585 Ga0496108_0141546 3300048911 Bacteria 2072
586 Ga0496108_0171325 3300048911 Bacteria 1878
587 Ga0496108_0183906 3300048911 Bacteria 1810
588 Ga0496109_0015200 3300048912 Bacteria 6701
589 Ga0496109_0057879 3300048912 Bacteria 3540
590 Ga0496109_0105965 3300048912 Bacteria 2611
591 Ga0496109_0143335 3300048912 Bacteria 2234
592 Ga0496109_0832679 3300048912 Bacteria 861
593 Ga0496109_0944263 3300048912 Bacteria 800
594 Ga0496110_0035464 3300048913 Bacteria 4327
595 Ga0496110_0039329 3300048913 Bacteria 4118
596 Ga0496110_0096751 3300048913 Bacteria 2645
597 Ga0496110_0159366 3300048913 Bacteria 2045
598 Ga0496110_0172801 3300048913 Bacteria 1961
599 Ga0496111_0010854 3300048914 Bacteria 6125
600 Ga0496111_0051111 3300048914 Bacteria 2984
601 Ga0496111_0184324 3300048914 Bacteria 1552
602 Ga0496111_0386636 3300048914 Bacteria 1034
603 Ga0496111_0415857 3300048914 Bacteria 993
604 Ga0496112_0068160 3300048915 Bacteria 3513
605 Ga0496112_0182900 3300048915 Bacteria 2060
606 Ga0496112_0183341 3300048915 Bacteria 2057
607 Ga0496112_0225303 3300048915 Bacteria 1830
608 Ga0496112_0234008 3300048915 Archaea 1791
609 Ga0496112_0336850 3300048915 Bacteria 1452
610 Ga0496112_0489198 3300048915 Bacteria 1166
611 Ga0496112_0671335 3300048915 Bacteria 965
612 Ga0496112_0962164 3300048915 Unclassified 774
613 Ga0496113_0153866 3300048916 Bacteria 1815
614 Ga0496113_0155626 3300048916 Unclassified 1805
615 Ga0496113_0364554 3300048916 Bacteria 1159
616 Ga0496113_0447155 3300048916 Bacteria 1038
617 Ga0496113_0532439 3300048916 Bacteria 943
618 Ga0496113_0793059 3300048916 Unclassified 753
619 Ga0496114_0000738 3300048917 Bacteria 24412
620 Ga0496114_0001824 3300048917 Bacteria 16152
621 Ga0496114_0007449 3300048917 Bacteria 8654
622 Ga0496114_0012587 3300048917 Bacteria 6776
623 Ga0496114_0111423 3300048917 Bacteria 2345
624 Ga0496114_0118060 3300048917 Unclassified 2279
625 Ga0496114_0132203 3300048917 Archaea 2155
626 Ga0496114_0179627 3300048917 Bacteria 1848
627 Ga0496114_0363380 3300048917 Bacteria 1280
628 Ga0496114_0369513 3300048917 Bacteria 1269
629 Ga0496114_1025633 3300048917 Unclassified 709
630 Ga0496115_0006958 3300048918 Bacteria 8308
631 Ga0496115_0033805 3300048918 Bacteria 4039
632 Ga0496115_0053391 3300048918 Bacteria 3243
633 Ga0496115_0065465 3300048918 Bacteria 2935
634 Ga0496115_0089006 3300048918 Bacteria 2521
635 Ga0496115_0094265 3300048918 Bacteria 2449
636 Ga0496115_0353627 3300048918 Bacteria 1198
637 Ga0496115_0356297 3300048918 Unclassified 1193
638 Ga0501031_0022549 3300049568 Bacteria 4102
639 Ga0501031_0120194 3300049568 Bacteria 1716
640 Ga0501032_0105246 3300049569 Bacteria 1869
641 Ga0501033_0079739 3300049570 Bacteria 2402
642 Ga0501036_0002956 3300049572 Bacteria 13506
643 Ga0501036_0024992 3300049572 Bacteria 5038
644 Ga0501036_0028630 3300049572 Bacteria 4708
645 Ga0501036_0098053 3300049572 Bacteria 2478
646 Ga0501037_0042490 3300049573 Bacteria 3340
647 Ga0501038_0009245 3300049574 Bacteria 9044
648 Ga0501038_0596238 3300049574 Bacteria 836
649 Ga0501039_0004859 3300049575 Bacteria 10173
650 Ga0501039_0417990 3300049575 Bacteria 1053
651 Ga0501039_1052758 3300049575 Unclassified 631
652 Ga0501040_0004267 3300049576 Bacteria 9303
653 Ga0501040_0064790 3300049576 Bacteria 2516
654 Ga0501040_0710737 3300049576 Unclassified 727
655 Ga0501041_0096302 3300049577 Bacteria 1829
656 Ga0501041_0217575 3300049577 Bacteria 1198
657 Ga0501042_0000705 3300049578 Bacteria 18109
658 Ga0501042_0002132 3300049578 Bacteria 12010
659 Ga0501042_0286847 3300049578 Bacteria 1189
660 Ga0501043_0176078 3300049579 Bacteria 1667
661 Ga0501043_0777290 3300049579 Unclassified 694
662 Ga0501043_0805651 3300049579 Bacteria 679
663 Ga0501046_0150605 3300049580 Bacteria 1755
664 Ga0501047_0151168 3300049581 Bacteria 2198
665 Ga0501047_0236102 3300049581 Bacteria 1680
666 Ga0501047_0439236 3300049581 Bacteria 1135
667 Ga0501048_0006802 3300049582 Bacteria 8686
668 Ga0501048_0021655 3300049582 Bacteria 4704
669 Ga0501048_0429647 3300049582 Bacteria 945
670 Ga0501067_0032930 3300049583 Bacteria 2876
671 Ga0501067_0034045 3300049583 Bacteria 2826
672 Ga0501067_0054767 3300049583 Bacteria 2210
673 Ga0501068_0002477 3300049584 Bacteria 9808
674 Ga0501068_0115584 3300049584 Bacteria 1671
675 Ga0501069_0001978 3300049585 Bacteria 10248
676 Ga0501069_0094125 3300049585 Bacteria 1695
677 Ga0501069_0176705 3300049585 Bacteria 1233
678 Ga0501070_0007718 3300049586 Bacteria 9123
679 Ga0501070_0021104 3300049586 Bacteria 5465
680 Ga0501070_0126755 3300049586 Bacteria 2109
681 Ga0501071_0016021 3300049587 Bacteria 5150
682 Ga0501071_0053561 3300049587 Bacteria 2910
683 Ga0501071_0067322 3300049587 Bacteria 2604
684 Ga0501071_0077372 3300049587 Bacteria 2430
685 Ga0501072_0009496 3300049588 Bacteria 7397
686 Ga0501072_0016046 3300049588 Bacteria 5744
687 Ga0501072_0020916 3300049588 Bacteria 5072
688 Ga0501072_0081216 3300049588 Bacteria 2569
689 Ga0501072_0518318 3300049588 Bacteria 942
690 Ga0501073_0053229 3300049589 Bacteria 2834
691 Ga0501074_0003699 3300049590 Bacteria 10843
692 Ga0501074_0060397 3300049590 Bacteria 2731
693 Ga0501074_0181025 3300049590 Bacteria 1504
694 Ga0501074_0268687 3300049590 Bacteria 1212
695 Ga0501075_0018650 3300049591 Bacteria 5024
696 Ga0501075_0077919 3300049591 Bacteria 2508
697 Ga0501075_0601482 3300049591 Bacteria 839
698 Ga0501076_0100415 3300049592 Bacteria 2331
699 Ga0501076_0164683 3300049592 Bacteria 1807
700 Ga0501076_0295922 3300049592 Bacteria 1326
701 Ga0501076_0628928 3300049592 Bacteria 886
702 Ga0501076_0685720 3300049592 Bacteria 846
703 Ga0501077_0001990 3300049593 Bacteria 12330
704 Ga0501077_0016106 3300049593 Bacteria 4711
705 Ga0501077_0059144 3300049593 Bacteria 2433
706 Ga0501077_0107966 3300049593 Bacteria 1763
707 Ga0501079_0002900 3300049741 Bacteria 12533
708 Ga0501079_0011433 3300049741 Bacteria 6775
709 Ga0501079_0095808 3300049741 Bacteria 2300
710 Ga0501079_0195407 3300049741 Bacteria 1579
711 Ga0501080_0001672 3300049742 Bacteria 18888
712 Ga0501080_0040889 3300049742 Bacteria 4323
713 Ga0501080_0305536 3300049742 Bacteria 1442
714 Ga0501080_0555757 3300049742 Bacteria 1022
715 Ga0501080_0577234 3300049742 Bacteria 1000
716 Ga0501080_0653036 3300049742 Bacteria 931
717 Ga0501080_1715952 3300049742 Unclassified 529
718 Ga0501081_0002697 3300049743 Bacteria 11224
719 Ga0501081_0061625 3300049743 Bacteria 2601
720 Ga0501081_0344888 3300049743 Bacteria 1097
721 Ga0501083_0011641 3300049744 Bacteria 6172
722 Ga0501083_0020149 3300049744 Bacteria 4641
723 Ga0501083_0099304 3300049744 Bacteria 1920
724 Ga0501035_0004148 3300049822 Bacteria 13773
725 Ga0501035_0103459 3300049822 Bacteria 2498
726 Ga0501044_0144461 3300049823 Bacteria 2366
727 Ga0501044_0659097 3300049823 Unclassified 935
728 Ga0501045_0027482 3300049824 Bacteria 4100
729 Ga0501045_0049597 3300049824 Bacteria 3061
730 Ga0501045_0241708 3300049824 Bacteria 1344
731 Ga0501045_0540226 3300049824 Bacteria 865
732 nmdc:mga07m45_446661_c1 3300050496 Bacteria 750
733 nmdc:mga05p37_18903_c1 3300050507 Bacteria 8331
734 nmdc:mga05p37_36234_c1 3300050507 Bacteria 6054
735 nmdc:mga05p37_5176_c1 3300050507 Bacteria 15296
736 nmdc:mga05p37_559034_c1 3300050507 Unclassified 1300
737 nmdc:mga05p37_73052_c1 3300050507 Bacteria 4221
738 nmdc:mga09592_1284842_c1 3300050508 Unclassified 602
739 nmdc:mga0qj67_5458_c1 3300050509 Bacteria 9285
740 nmdc:mga06r32_264645_c1 3300050510 Unclassified 1707
741 nmdc:mga06r32_39189_c1 3300050510 Bacteria 4495
742 nmdc:mga06r32_418015_c1 3300050510 Bacteria 1322
743 nmdc:mga08y16_211901_c1 3300050511 Bacteria 2007
744 nmdc:mga08y16_69846_c1 3300050511 Bacteria 3661
745 nmdc:mga08y16_92398_c1 3300050511 Bacteria 3153
746 nmdc:mga0n895_1102213_c1 3300050512 Bacteria 771
747 nmdc:mga0n895_141836_c1 3300050512 Bacteria 2431
748 nmdc:mga0n895_142054_c1 3300050512 Bacteria 2430
749 nmdc:mga0n895_4986_c1 3300050512 Bacteria 11015
750 nmdc:mga0n895_729809_c1 3300050512 Bacteria 985
751 nmdc:mga0n895_89090_c1 3300050512 Bacteria 3087
752 nmdc:mga0rr50_10747_c1 3300050513 Bacteria 5831
753 nmdc:mga0rr50_509466_c1 3300050513 Unclassified 1024
754 nmdc:mga0rr50_571133_c1 3300050513 Bacteria 963
755 nmdc:mga08x19_43308_c1 3300050514 Bacteria 2872
756 nmdc:mga08x19_608458_c1 3300050514 Bacteria 774
757 nmdc:mga0a205_83789_c1 3300050515 Bacteria 3080
758 nmdc:mga0a205_99090_c1 3300050515 Bacteria 2813
759 Ga0495601_0010855 3300053077 Bacteria 5435
760 Ga0495601_0018014 3300053077 Bacteria 4293
761 Ga0495601_0056380 3300053077 Bacteria 2488
762 Ga0495612_0007348 3300053078 Bacteria 4505
763 Ga0495612_0012807 3300053078 Bacteria 3381
764 Ga0495612_0078784 3300053078 Bacteria 1383
765 Ga0495595_0015659 3300053084 Bacteria 3236
766 Ga0495595_0023531 3300053084 Bacteria 2713
767 Ga0495595_0054429 3300053084 Unclassified 1861
768 Ga0495619_0039923 3300053085 Bacteria 3066
769 Ga0495619_0052920 3300053085 Bacteria 2684
770 Ga0495619_0062531 3300053085 Bacteria 2478
771 Ga0501084_0004887 3300054114 Bacteria 10949
772 Ga0501084_0030054 3300054114 Unclassified 4545
773 Ga0501084_0243478 3300054114 Bacteria 1518
774 Ga0501084_0291805 3300054114 Bacteria 1377
775 Ga0501084_0307685 3300054114 Bacteria 1338
776 Ga0501084_0409819 3300054114 Bacteria 1146
777 Ga0501082_0010686 3300060353 Bacteria 7901
778 Ga0501082_0189554 3300060353 Bacteria 1789
779 Ga0501082_0251727 3300060353 Bacteria 1537
780 Ga0501082_1161305 3300060353 Bacteria 675
781 Ga0466962_0003041 3300061719 Bacteria 7999
782 Ga0466962_0006424 3300061719 Bacteria 5643
783 Ga0530510_0001506 3300061734 Bacteria 15662
784 Ga0530510_0112292 3300061734 Bacteria 1997
785 Ga0530510_0216551 3300061734 Bacteria 1423
786 Ga0530510_1169756 3300061734 Bacteria 590
787 Ga0501039_0821417
788 JGI24744J21845_10016830
789 JGI25406J46586_10009089
790 Ga0070658_10037593
791 Ga0070658_11032594
792 Ga0070683_100000743
793 Ga0070683_100104626
794 Ga0070683_100344139
795 Ga0070683_100696850
796 Ga0068869_100902986
797 Ga0070680_100003202
798 Ga0070680_100402244
799 Ga0070680_100806149
800 Ga0070682_100005074
801 Ga0070682_100008066
802 Ga0070682_100148071
803 Ga0068868_100133753
804 Ga0068868_100559833
805 Ga0070660_100032096
806 Ga0070660_100585758
807 Ga0070660_100649519
808 Ga0070660_100917387
809 Ga0070689_100019316
810 Ga0070661_100241156
811 Ga0070692_10492134
812 Ga0070675_100278538
813 Ga0070671_100284379
814 Ga0070674_100310152
815 Ga0070674_100381849
816 Ga0070673_100184700
817 Ga0070688_100050310
818 Ga0070659_100472423
819 Ga0070659_100690613
820 Ga0070659_100778483
821 Ga0070709_10008638
822 Ga0070709_10414823
823 Ga0070714_100011748
824 Ga0070714_100050101
825 Ga0070714_100126023
826 Ga0070714_100234063
827 Ga0070713_100130025
828 Ga0070710_10001819
829 Ga0070701_10003555
830 Ga0070701_10607666
831 Ga0070711_100192661
832 Ga0070711_100491155
833 Ga0070705_100149470
834 Ga0070700_100375491
835 Ga0070708_100098765
836 Ga0070708_101919043
837 Ga0070663_100077726
838 Ga0070678_100003130
839 Ga0070662_100096082
840 Ga0070681_10006580
841 Ga0070706_100134014
842 Ga0070707_100001273
843 Ga0070707_100051171
844 Ga0070707_100282500
845 Ga0070707_100439647
846 Ga0070698_100112306
847 Ga0070698_100668524
848 Ga0070698_101371957
849 Ga0070699_100018500
850 Ga0070679_100003409
851 Ga0070679_100303580
852 Ga0070679_100340001
853 Ga0070679_101446435
854 Ga0070684_100000331
855 Ga0070684_100136300
856 Ga0070684_100217182
857 Ga0070684_100492644
858 Ga0070684_100989435
859 Ga0070697_100048581
860 Ga0070672_100621401
861 Ga0070686_100100961
862 Ga0070695_100493270
863 Ga0070696_101136258
864 Ga0070693_100129490
865 Ga0070693_100832951
866 Ga0068855_100597830
867 Ga0070664_100775018
868 Ga0070664_101154181
869 Ga0068854_100588910
870 Ga0068856_100009273
871 Ga0068856_100075066
872 Ga0068856_100138643
873 Ga0068856_100355481
874 Ga0068856_100634983
875 Ga0070702_100000772
876 Ga0070702_100546953
877 Ga0068852_100444947
878 Ga0068852_102542419
879 Ga0068863_100103576
880 Ga0068863_101794565
881 Ga0068858_100233286
882 Ga0081538_10000116
883 Ga0081538_10002632
884 Ga0081538_10004941
885 Ga0081540_1013281
886 Ga0081539_10000840
887 Ga0070717_10042011
888 Ga0070717_10058586
889 Ga0070717_10435713
890 Ga0075432_10035187
891 Ga0075432_10111598
892 Ga0070716_100350135
893 Ga0070716_100983824
894 Ga0070712_100004060
895 Ga0070712_100020415
896 Ga0070712_100044173
897 Ga0070712_100046920
898 Ga0070712_100475783
899 Ga0097621_100014698
900 Ga0097621_100215326
901 Ga0097621_100339585
902 Ga0097621_100451110
903 Ga0068871_100853148
904 Ga0075428_100005274
905 Ga0075428_100022979
906 Ga0075428_100080755
907 Ga0075431_100033032
908 Ga0075431_100039338
909 Ga0075431_100579724
910 Ga0075433_10039456
911 Ga0075433_10673257
912 Ga0075434_100001941
913 Ga0075434_100008128
914 Ga0075434_100203481
915 Ga0068865_100250606
916 Ga0075436_100014538
917 Ga0075436_100101258
918 Ga0075436_100885922
919 Ga0075435_100044418
920 Ga0075435_100059573
921 Ga0105240_10205289
922 Ga0111539_10036486
923 Ga0111539_10106419
924 Ga0111539_11599318
925 Ga0105245_10000499
926 Ga0105245_10009775
927 Ga0105245_10332886
928 Ga0105245_10440715
929 Ga0105245_10553517
930 Ga0105245_10589262
931 Ga0105245_11140978
932 Ga0105247_10194202
933 Ga0114129_10001814
934 Ga0114129_10006241
935 Ga0114129_10403917
936 Ga0114129_11918013
937 Ga0105243_11361751
938 Ga0105241_10006217
939 Ga0105242_10150093
940 Ga0105242_10167892
941 Ga0105242_12614268
942 Ga0105248_10022192
943 Ga0105248_10740835
944 Ga0105248_10978727
945 Ga0105237_10869823
946 Ga0105237_10906461
947 Ga0105238_10116442
948 Ga0105238_10528964
949 Ga0105238_11324630
950 Ga0105239_10215354
951 Ga0105239_10328854
952 Ga0105239_10411395
953 Ga0105239_10615956
954 Ga0105246_10164952
955 Ga0105246_10323638
956 Ga0157317_1005368
957 Ga0157373_10653792
958 Ga0157369_11692307
959 Ga0157374_10030954
960 Ga0157374_10120807
961 Ga0157378_10341163
962 Ga0163162_10095384
963 Ga0163162_10309929
964 Ga0163162_10800919
965 Ga0157372_10284565
966 Ga0157372_11626611
967 Ga0157375_10927833
968 Ga0157375_11914948
969 Ga0157375_11979085
970 Ga0157375_12265243
971 Ga0163163_10261044
972 Ga0163163_10563057
973 Ga0157380_10060122
974 Ga0157380_11343834
975 Ga0182008_10004085
976 Ga0182008_10089668
977 Ga0157377_10014451
978 Ga0157377_10333574
979 Ga0157377_10427226
980 Ga0157377_11081800
981 Ga0157376_10285770
982 Ga0157376_10362980
983 Ga0157376_10630509
984 Ga0157376_11135344
985 Ga0182006_1008244
986 Ga0182007_10007521
987 Ga0163161_10105890
988 Ga0206356_10024515
989 Ga0206353_10593270
990 Ga0206353_11070079
991 Ga0207692_10659397
992 Ga0207710_10101060
993 Ga0207688_10065409
994 Ga0207647_10060678
995 Ga0207685_10107893
996 Ga0207699_10127929
997 Ga0207699_10879778
998 Ga0207643_10454500
999 Ga0207705_10048413
1000 Ga0207684_10158783
1001 Ga0207707_10011505
1002 Ga0207707_10313100
1003 Ga0207695_11086824
1004 Ga0207671_10905020
1005 Ga0207693_10007412
1006 Ga0207693_10022305
1007 Ga0207693_10031178
1008 Ga0207693_10034202
1009 Ga0207693_10066997
1010 Ga0207693_10380077
1011 Ga0207693_10421631
1012 Ga0207693_10525710
1013 Ga0207663_10159215
1014 Ga0207663_10178368
1015 Ga0207663_10736920
1016 Ga0207660_10359418
1017 Ga0207657_10044303
1018 Ga0207657_10152325
1019 Ga0207657_10337799
1020 Ga0207657_10578469
1021 Ga0207649_10146643
1022 Ga0207652_10001137
1023 Ga0207652_10267587
1024 Ga0207652_11287170
1025 Ga0207646_10002421
1026 Ga0207646_10044713
1027 Ga0207646_10208212
1028 Ga0207646_10909775
1029 Ga0207681_10848849
1030 Ga0207694_11399382
1031 Ga0207659_10926317
1032 Ga0207687_10003291
1033 Ga0207687_10049765
1034 Ga0207687_10100789
1035 Ga0207687_10682081
1036 Ga0207664_10005779
1037 Ga0207664_10066156
1038 Ga0207664_10081174
1039 Ga0207664_10108400
1040 Ga0207664_10197061
1041 Ga0207690_10361540
1042 Ga0207686_10102075
1043 Ga0207686_10197420
1044 Ga0207704_10398529
1045 Ga0207704_10967567
1046 Ga0207665_10459007
1047 Ga0207691_10066192
1048 Ga0207661_10019903
1049 Ga0207661_10117192
1050 Ga0207661_10156730
1051 Ga0207661_11023679
1052 Ga0207679_10077802
1053 Ga0207679_10748570
1054 Ga0207679_11782747
1055 Ga0207667_11405457
1056 Ga0207640_10310709
1057 Ga0207658_10702721
1058 Ga0207677_10118854
1059 Ga0207678_10083180
1060 Ga0207678_10198421
1061 Ga0207708_10002065
1062 Ga0207708_10438306
1063 Ga0207708_11711494
1064 Ga0207702_10007123
1065 Ga0207702_10126471
1066 Ga0207702_10607363
1067 Ga0207702_10825268
1068 Ga0207641_10075389
1069 Ga0207674_10099425
1070 Ga0207674_11569270
1071 Ga0207674_11979452
1072 Ga0207675_101382541
1073 Ga0207683_10002467
1074 Ga0207683_10024660
1075 Ga0207698_11294700
1076 Ga0207428_10008352
1077 Ga0207428_10056739
1078 Ga0207428_10215323
1079 Ga0268266_10496101
1080 Ga0268265_11044306
1081 Ga0265319_1063777
1082 Ga0265334_10144269
1083 Ga0265318_10041796
1084 Ga0265338_10049709
1085 Ga0265338_10068117
1086 Ga0265338_10122295
1087 Ga0265338_10131954
1088 Ga0265332_10144245
1089 Ga0265320_10044762
1090 Ga0265339_10013897
1091 Ga0265331_10002389
1092 Ga0265331_10084398
1093 Ga0265316_10104349
1094 Ga0265313_10000079
1095 Ga0265314_10014243
1096 Ga0265314_10018093
1097 Ga0265342_10030080
1098 Ga0265342_10231408
1099 Ga0307406_11100966
1100 Ga0307416_100270025
1101 Ga0373944_0005132
1102 Ga0373939_0062398
1103 Ga0373960_0028199
1104 Ga0373946_0388415
1105 Ga0373955_0560039
1106 Ga0373942_0016327
1107 Ga0373947_1179984
1108 Ga0373937_0309752
1109 Ga0395899_0208807
1110 Ga0395899_0347258
1111 Ga0395900_0036646
1112 Ga0395900_0057702
1113 Ga0395900_0102148
1114 Ga0395900_0125708
1115 Ga0395900_0141996
1116 Ga0395900_0207769
1117 Ga0395900_0311626
1118 Ga0395900_0696999
1119 Ga0395900_0762359
1120 Ga0395900_0848088
1121 Ga0395898_0007289
1122 Ga0395898_0032534
1123 Ga0395898_0036354
1124 Ga0395898_0046089
1125 Ga0395898_0083255
1126 Ga0395898_0213695
1127 Ga0395898_0839084
1128 Ga0395898_1021261
1129 Ga0395905_0003639
1130 Ga0395905_0057384
1131 Ga0395905_0088822
1132 Ga0395905_0252053
1133 Ga0395905_0398625
1134 Ga0395905_0922527
1135 Ga0395901_0023034
1136 Ga0395901_0114916
1137 Ga0395901_0138741
1138 Ga0395901_0161710
1139 Ga0395901_0170458
1140 Ga0395901_0198365
1141 Ga0395901_0201522
1142 Ga0395901_0237349
1143 Ga0395901_0684929
1144 Ga0395901_0764020
1145 Ga0395901_0932015
1146 Ga0395901_1181906
1147 Ga0395901_1559005
1148 Ga0451853_0125869
1149 Ga0451853_1097714
1150 Ga0466969_0003156
1151 Ga0466969_0119486
1152 Ga0466965_0028061
1153 Ga0466965_0741387
1154 Ga0466966_0007964
1155 Ga0466966_0159014
1156 Ga0466961_0002499
1157 Ga0466961_0039290
1158 Ga0466961_0055770
1159 Ga0466961_0067042
1160 Ga0466961_0330236
1161 Ga0466963_0000708
1162 Ga0466963_0002922
1163 Ga0466963_0014391
1164 Ga0466963_0043355
1165 Ga0466963_0168411
1166 Ga0466963_0560343
1167 Ga0466964_0001239
1168 Ga0466964_0003090
1169 Ga0466964_0004061
1170 Ga0466964_0018430
1171 Ga0466964_0028944
1172 Ga0466964_0603765
1173 Ga0466971_0001732
1174 Ga0466968_0000973
1175 Ga0466968_0017577
1176 Ga0466968_0179692
1177 Ga0466968_0194945
1178 Ga0466970_0006853
1179 Ga0466957_0005364
1180 Ga0466957_0008149
1181 Ga0466957_0010927
1182 Ga0466957_0138166
1183 Ga0466957_0399120
1184 Ga0466957_0445467
1185 Ga0466960_0013583
1186 Ga0466960_0014013
1187 Ga0466960_0130515
1188 Ga0466960_0383945
1189 Ga0466959_0004476
1190 Ga0466959_0004730
1191 Ga0466959_0030254
1192 Ga0466959_0046432
1193 Ga0466959_0118172
1194 Ga0466959_0130906
1195 Ga0466959_0477692
1196 Ga0451576_0153814
1197 Ga0451576_1822756
1198 Ga0466958_0003062
1199 Ga0466958_0006780
1200 Ga0466958_0007980
1201 Ga0466958_0016026
1202 Ga0466958_0023004
1203 Ga0466958_0023888
1204 Ga0466958_0033920
1205 Ga0466958_0089962
1206 Ga0466958_0100516
1207 Ga0466967_0000724
1208 Ga0466967_0001136
1209 Ga0466967_0002143
1210 Ga0466967_0008248
1211 Ga0466967_0047040
1212 Ga0466967_0072144
1213 Ga0466967_0105771
1214 Ga0466967_0121606
1215 Ga0466967_0249020
1216 Ga0466967_0303291
1217 Ga0466967_0541609
1218 Ga0466967_0682941
1219 Ga0466967_0775299
1220 Ga0466967_0915972
1221 Ga0466967_1854741
1222 Ga0466967_1931024
1223 Ga0466967_2246894
1224 Ga0495592_0019587
1225 Ga0495603_0007573
1226 Ga0495603_0222706
1227 Ga0495603_0555752
1228 Ga0495629_0126716
1229 Ga0495641_0030633
1230 Ga0495641_0031387
1231 Ga0495641_0181036
1232 Ga0495651_0494842
1233 Ga0495653_0064460
1234 Ga0495653_0199873
1235 Ga0495580_0141919
1236 Ga0495580_0533018
1237 Ga0495582_0075788
1238 Ga0495582_0124808
1239 Ga0495639_0033196
1240 Ga0495662_0163084
1241 Ga0495664_0176451
1242 Ga0495585_0399780
1243 Ga0495594_0072563
1244 Ga0495596_0099476
1245 Ga0495608_0038050
1246 Ga0495608_0291708
1247 Ga0495618_0169533
1248 Ga0495618_0177483
1249 Ga0495618_0494868
1250 Ga0495628_0084449
1251 Ga0495630_0030750
1252 Ga0495630_0040249
1253 Ga0495630_0087466
1254 Ga0495630_0208811
1255 Ga0495663_0143960
1256 Ga0495666_0051206
1257 Ga0495666_0171358
1258 Ga0495665_0280867
1259 Ga0495665_0373795
1260 Ga0495640_0042413
1261 Ga0495640_0086303
1262 Ga0495640_0395671
1263 Ga0495587_0077554
1264 Ga0495645_0458750
1265 Ga0495667_0002340
1266 Ga0495667_0224014
1267 Ga0495656_0075014
1268 Ga0495656_0104758
1269 Ga0495656_0255290
1270 Ga0495668_0260805
1271 Ga0495634_0039726
1272 Ga0495634_0049930
1273 Ga0495634_0079591
1274 Ga0495634_0113615
1275 Ga0495634_0391091
1276 Ga0495635_0036782
1277 Ga0495635_0089730
1278 Ga0495635_0298632
1279 Ga0495588_0048975
1280 Ga0495588_0252807
1281 Ga0495657_0066832
1282 Ga0495657_0664084
1283 Ga0495599_0395434
1284 Ga0495646_0073097
1285 Ga0495646_0379069
1286 Ga0495647_0196017
1287 Ga0495658_0409041
1288 Ga0495669_0152036
1289 Ga0495613_0109095
1290 Ga0495624_0029778
1291 Ga0495624_0540841
1292 Ga0495670_0525096
1293 Ga0495581_0046330
1294 Ga0495581_0355458
1295 Ga0495604_0105620
1296 Ga0495674_0020877
1297 Ga0495674_0022708
1298 Ga0495674_0060813
1299 Ga0495674_0102632
1300 Ga0495676_0018502
1301 Ga0495676_0113508
1302 Ga0495680_0001666
1303 Ga0495680_0025593
1304 Ga0495680_0763220
1305 Ga0495683_0259857
1306 Ga0495675_0093386
1307 Ga0495677_0030079
1308 Ga0495684_0005868
1309 Ga0495684_0108745
1310 Ga0495684_0367595
1311 Ga0495593_0111518
1312 Ga0495593_0309122
1313 Ga0495614_0454361
1314 Ga0496100_0005437
1315 Ga0496100_0041717
1316 Ga0496100_0154774
1317 Ga0496100_0352338
1318 Ga0496100_0592481
1319 Ga0496100_0994064
1320 Ga0496101_0016236
1321 Ga0496101_0074693
1322 Ga0496101_0142218
1323 Ga0496101_0143455
1324 Ga0496101_0284245
1325 Ga0496101_0314999
1326 Ga0496101_0411686
1327 Ga0496101_0415876
1328 Ga0496101_1242472
1329 Ga0496102_0007721
1330 Ga0496102_0117880
1331 Ga0496102_0175401
1332 Ga0496102_0261344
1333 Ga0496102_0324391
1334 Ga0496103_0010969
1335 Ga0496103_0096402
1336 Ga0496103_0135952
1337 Ga0496103_0972646
1338 Ga0496104_0026073
1339 Ga0496104_0028441
1340 Ga0496104_0068366
1341 Ga0496104_0271195
1342 Ga0496104_0314815
1343 Ga0496104_0882625
1344 Ga0496105_0019277
1345 Ga0496105_0028767
1346 Ga0496105_0036529
1347 Ga0496105_0037713
1348 Ga0496105_0147147
1349 Ga0496105_0155564
1350 Ga0496105_0190285
1351 Ga0496105_0267618
1352 Ga0496105_0286138
1353 Ga0496105_0298217
1354 Ga0496106_0005815
1355 Ga0496106_0170606
1356 Ga0496106_0230054
1357 Ga0496106_0489666
1358 Ga0496106_0636857
1359 Ga0496106_1094023
1360 Ga0496107_0003984
1361 Ga0496107_0041602
1362 Ga0496107_0042495
1363 Ga0496107_0053936
1364 Ga0496107_0107065
1365 Ga0496107_0179720
1366 Ga0496107_0265702
1367 Ga0496107_0337644
1368 Ga0496107_0596270
1369 Ga0496108_0014563
1370 Ga0496108_0072847
1371 Ga0496108_0141546
1372 Ga0496108_0171325
1373 Ga0496108_0183906
1374 Ga0496109_0015200
1375 Ga0496109_0057879
1376 Ga0496109_0105965
1377 Ga0496109_0143335
1378 Ga0496109_0832679
1379 Ga0496109_0944263
1380 Ga0496110_0035464
1381 Ga0496110_0039329
1382 Ga0496110_0096751
1383 Ga0496110_0159366
1384 Ga0496110_0172801
1385 Ga0496111_0010854
1386 Ga0496111_0051111
1387 Ga0496111_0184324
1388 Ga0496111_0386636
1389 Ga0496111_0415857
1390 Ga0496112_0068160
1391 Ga0496112_0182900
1392 Ga0496112_0183341
1393 Ga0496112_0225303
1394 Ga0496112_0234008
1395 Ga0496112_0336850
1396 Ga0496112_0489198
1397 Ga0496112_0671335
1398 Ga0496112_0962164
1399 Ga0496113_0153866
1400 Ga0496113_0155626
1401 Ga0496113_0364554
1402 Ga0496113_0447155
1403 Ga0496113_0532439
1404 Ga0496113_0793059
1405 Ga0496114_0000738
1406 Ga0496114_0001824
1407 Ga0496114_0007449
1408 Ga0496114_0012587
1409 Ga0496114_0111423
1410 Ga0496114_0118060
1411 Ga0496114_0132203
1412 Ga0496114_0179627
1413 Ga0496114_0363380
1414 Ga0496114_0369513
1415 Ga0496114_1025633
1416 Ga0496115_0006958
1417 Ga0496115_0033805
1418 Ga0496115_0053391
1419 Ga0496115_0065465
1420 Ga0496115_0089006
1421 Ga0496115_0094265
1422 Ga0496115_0353627
1423 Ga0496115_0356297
1424 Ga0501031_0022549
1425 Ga0501031_0120194
1426 Ga0501032_0105246
1427 Ga0501033_0079739
1428 Ga0501036_0002956
1429 Ga0501036_0024992
1430 Ga0501036_0028630
1431 Ga0501036_0098053
1432 Ga0501037_0042490
1433 Ga0501038_0009245
1434 Ga0501038_0596238
1435 Ga0501039_0004859
1436 Ga0501039_0417990
1437 Ga0501039_1052758
1438 Ga0501040_0004267
1439 Ga0501040_0064790
1440 Ga0501040_0710737
1441 Ga0501041_0096302
1442 Ga0501041_0217575
1443 Ga0501042_0000705
1444 Ga0501042_0002132
1445 Ga0501042_0286847
1446 Ga0501043_0176078
1447 Ga0501043_0777290
1448 Ga0501043_0805651
1449 Ga0501046_0150605
1450 Ga0501047_0151168
1451 Ga0501047_0236102
1452 Ga0501047_0439236
1453 Ga0501048_0006802
1454 Ga0501048_0021655
1455 Ga0501048_0429647
1456 Ga0501067_0032930
1457 Ga0501067_0034045
1458 Ga0501067_0054767
1459 Ga0501068_0002477
1460 Ga0501068_0115584
1461 Ga0501069_0001978
1462 Ga0501069_0094125
1463 Ga0501069_0176705
1464 Ga0501070_0007718
1465 Ga0501070_0021104
1466 Ga0501070_0126755
1467 Ga0501071_0016021
1468 Ga0501071_0053561
1469 Ga0501071_0067322
1470 Ga0501071_0077372
1471 Ga0501072_0009496
1472 Ga0501072_0016046
1473 Ga0501072_0020916
1474 Ga0501072_0081216
1475 Ga0501072_0518318
1476 Ga0501073_0053229
1477 Ga0501074_0003699
1478 Ga0501074_0060397
1479 Ga0501074_0181025
1480 Ga0501074_0268687
1481 Ga0501075_0018650
1482 Ga0501075_0077919
1483 Ga0501075_0601482
1484 Ga0501076_0100415
1485 Ga0501076_0164683
1486 Ga0501076_0295922
1487 Ga0501076_0628928
1488 Ga0501076_0685720
1489 Ga0501077_0001990
1490 Ga0501077_0016106
1491 Ga0501077_0059144
1492 Ga0501077_0107966
1493 Ga0501079_0002900
1494 Ga0501079_0011433
1495 Ga0501079_0095808
1496 Ga0501079_0195407
1497 Ga0501080_0001672
1498 Ga0501080_0040889
1499 Ga0501080_0305536
1500 Ga0501080_0555757
1501 Ga0501080_0577234
1502 Ga0501080_0653036
1503 Ga0501080_1715952
1504 Ga0501081_0002697
1505 Ga0501081_0061625
1506 Ga0501081_0344888
1507 Ga0501083_0011641
1508 Ga0501083_0020149
1509 Ga0501083_0099304
1510 Ga0501035_0004148
1511 Ga0501035_0103459
1512 Ga0501044_0144461
1513 Ga0501044_0659097
1514 Ga0501045_0027482
1515 Ga0501045_0049597
1516 Ga0501045_0241708
1517 Ga0501045_0540226
1518 nmdc:mga07m45_446661_c1
1519 nmdc:mga05p37_18903_c1
1520 nmdc:mga05p37_36234_c1
1521 nmdc:mga05p37_5176_c1
1522 nmdc:mga05p37_559034_c1
1523 nmdc:mga05p37_73052_c1
1524 nmdc:mga09592_1284842_c1
1525 nmdc:mga0qj67_5458_c1
1526 nmdc:mga06r32_264645_c1
1527 nmdc:mga06r32_39189_c1
1528 nmdc:mga06r32_418015_c1
1529 nmdc:mga08y16_211901_c1
1530 nmdc:mga08y16_69846_c1
1531 nmdc:mga08y16_92398_c1
1532 nmdc:mga0n895_1102213_c1
1533 nmdc:mga0n895_141836_c1
1534 nmdc:mga0n895_142054_c1
1535 nmdc:mga0n895_4986_c1
1536 nmdc:mga0n895_729809_c1
1537 nmdc:mga0n895_89090_c1
1538 nmdc:mga0rr50_10747_c1
1539 nmdc:mga0rr50_509466_c1
1540 nmdc:mga0rr50_571133_c1
1541 nmdc:mga08x19_43308_c1
1542 nmdc:mga08x19_608458_c1
1543 nmdc:mga0a205_83789_c1
1544 nmdc:mga0a205_99090_c1
1545 Ga0495601_0010855
1546 Ga0495601_0018014
1547 Ga0495601_0056380
1548 Ga0495612_0007348
1549 Ga0495612_0012807
1550 Ga0495612_0078784
1551 Ga0495595_0015659
1552 Ga0495595_0023531
1553 Ga0495595_0054429
1554 Ga0495619_0039923
1555 Ga0495619_0052920
1556 Ga0495619_0062531
1557 Ga0501084_0004887
1558 Ga0501084_0030054
1559 Ga0501084_0243478
1560 Ga0501084_0291805
1561 Ga0501084_0307685
1562 Ga0501084_0409819
1563 Ga0501082_0010686
1564 Ga0501082_0189554
1565 Ga0501082_0251727
1566 Ga0501082_1161305
1567 Ga0466962_0003041
1568 Ga0466962_0006424
1569 Ga0530510_0001506
1570 Ga0530510_0112292
1571 Ga0530510_0216551
1572 Ga0530510_1169756

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

51

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8855 5 137
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8097 5 137
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7483 7 107
3ku0-assembly2.cif.gz_B structure of gap31 with adenine at its binding pocket 0.7065 58 90
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6999 7 107
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7733 5 134 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7651 7 104 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7375 5 134 3.90.1590.10
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7332 8 114 2.170.150.70
af_A0A0P0X332_29_163_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7281 60 88 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A5D0WGL9-F1-model_v4 deleted 0.9722 3 156
AF-A0A627Z5T9-F1-model_v4 Aldehyde-activating protein 0.9718 7 155 GO:0016846
GO:0046872
AF-A0A534BLW2-F1-model_v4 GFA family protein 0.9707 6 125 GO:0016846
GO:0046872
AF-A0A534CBF8-F1-model_v4 GFA family protein 0.9703 4 156 GO:0016846
GO:0046872
AF-A0A6P2FQ69-F1-model_v4 CENP-V/GFA domain-containing protein 0.9686 1 160 GO:0016846
GO:0046872

Map