F480807
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 303 | 1572 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0821417|Ga0501039_0821417_53_610 |
| Length | 185 |
| Sequence | VLSLELHQLVGGQPAEGSVRFEEEIVDVLLQGGCSCGAVRYRLASDPLFVHCCHCLNCQRQTGSAFVINVLIESDRVEAVAGELQPVEVPRDDGSVQRIFRCPTCQIAVYSEYGLPGVLFVRAGTLDEPARVAPDVHIYTGSMVPWLTLPDSVPAYEVYYDTKSLWPAASLERLRAVMATARSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 181 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 13.99 |
| Rhizosphere | 85.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501039_0821417 | 3300049575 | Unclassified | 725 |
| 2 | JGI24744J21845_10016830 | 3300002077 | Unclassified | 1455 |
| 3 | JGI25406J46586_10009089 | 3300003203 | Bacteria | 4463 |
| 4 | Ga0070658_10037593 | 3300005327 | Bacteria | 3903 |
| 5 | Ga0070658_11032594 | 3300005327 | Bacteria | 715 |
| 6 | Ga0070683_100000743 | 3300005329 | Bacteria | 23855 |
| 7 | Ga0070683_100104626 | 3300005329 | Bacteria | 2668 |
| 8 | Ga0070683_100344139 | 3300005329 | Unclassified | 1420 |
| 9 | Ga0070683_100696850 | 3300005329 | Bacteria | 973 |
| 10 | Ga0068869_100902986 | 3300005334 | Bacteria | 765 |
| 11 | Ga0070680_100003202 | 3300005336 | Bacteria | 12168 |
| 12 | Ga0070680_100402244 | 3300005336 | Bacteria | 1167 |
| 13 | Ga0070680_100806149 | 3300005336 | Bacteria | 809 |
| 14 | Ga0070682_100005074 | 3300005337 | Bacteria | 7319 |
| 15 | Ga0070682_100008066 | 3300005337 | Bacteria | 5932 |
| 16 | Ga0070682_100148071 | 3300005337 | Unclassified | 1608 |
| 17 | Ga0068868_100133753 | 3300005338 | Bacteria | 2031 |
| 18 | Ga0068868_100559833 | 3300005338 | Bacteria | 1008 |
| 19 | Ga0070660_100032096 | 3300005339 | Bacteria | 3950 |
| 20 | Ga0070660_100585758 | 3300005339 | Bacteria | 932 |
| 21 | Ga0070660_100649519 | 3300005339 | Bacteria | 883 |
| 22 | Ga0070660_100917387 | 3300005339 | Unclassified | 739 |
| 23 | Ga0070689_100019316 | 3300005340 | Bacteria | 5037 |
| 24 | Ga0070661_100241156 | 3300005344 | Bacteria | 1392 |
| 25 | Ga0070692_10492134 | 3300005345 | Bacteria | 793 |
| 26 | Ga0070675_100278538 | 3300005354 | Unclassified | 1469 |
| 27 | Ga0070671_100284379 | 3300005355 | Unclassified | 1407 |
| 28 | Ga0070674_100310152 | 3300005356 | Bacteria | 1261 |
| 29 | Ga0070674_100381849 | 3300005356 | Unclassified | 1146 |
| 30 | Ga0070673_100184700 | 3300005364 | Bacteria | 1787 |
| 31 | Ga0070688_100050310 | 3300005365 | Bacteria | 2595 |
| 32 | Ga0070659_100472423 | 3300005366 | Bacteria | 1066 |
| 33 | Ga0070659_100690613 | 3300005366 | Bacteria | 882 |
| 34 | Ga0070659_100778483 | 3300005366 | Bacteria | 831 |
| 35 | Ga0070709_10008638 | 3300005434 | Bacteria | 5603 |
| 36 | Ga0070709_10414823 | 3300005434 | Bacteria | 1008 |
| 37 | Ga0070714_100011748 | 3300005435 | Bacteria | 6957 |
| 38 | Ga0070714_100050101 | 3300005435 | Bacteria | 3556 |
| 39 | Ga0070714_100126023 | 3300005435 | Bacteria | 2283 |
| 40 | Ga0070714_100234063 | 3300005435 | Bacteria | 1693 |
| 41 | Ga0070713_100130025 | 3300005436 | Bacteria | 2219 |
| 42 | Ga0070710_10001819 | 3300005437 | Bacteria | 10069 |
| 43 | Ga0070701_10003555 | 3300005438 | Bacteria | 6185 |
| 44 | Ga0070701_10607666 | 3300005438 | Bacteria | 725 |
| 45 | Ga0070711_100192661 | 3300005439 | Bacteria | 1568 |
| 46 | Ga0070711_100491155 | 3300005439 | Bacteria | 1011 |
| 47 | Ga0070705_100149470 | 3300005440 | Bacteria | 1548 |
| 48 | Ga0070700_100375491 | 3300005441 | Bacteria | 1062 |
| 49 | Ga0070708_100098765 | 3300005445 | Bacteria | 2670 |
| 50 | Ga0070708_101919043 | 3300005445 | Bacteria | 549 |
| 51 | Ga0070663_100077726 | 3300005455 | Bacteria | 2431 |
| 52 | Ga0070678_100003130 | 3300005456 | Bacteria | 9160 |
| 53 | Ga0070662_100096082 | 3300005457 | Bacteria | 2235 |
| 54 | Ga0070681_10006580 | 3300005458 | Bacteria | 11318 |
| 55 | Ga0070706_100134014 | 3300005467 | Unclassified | 2312 |
| 56 | Ga0070707_100001273 | 3300005468 | Bacteria | 24807 |
| 57 | Ga0070707_100051171 | 3300005468 | Bacteria | 3960 |
| 58 | Ga0070707_100282500 | 3300005468 | Bacteria | 1613 |
| 59 | Ga0070707_100439647 | 3300005468 | Bacteria | 1265 |
| 60 | Ga0070698_100112306 | 3300005471 | Bacteria | 2690 |
| 61 | Ga0070698_100668524 | 3300005471 | Bacteria | 980 |
| 62 | Ga0070698_101371957 | 3300005471 | Bacteria | 657 |
| 63 | Ga0070699_100018500 | 3300005518 | Bacteria | 5983 |
| 64 | Ga0070679_100003409 | 3300005530 | Bacteria | 14558 |
| 65 | Ga0070679_100303580 | 3300005530 | Bacteria | 1547 |
| 66 | Ga0070679_100340001 | 3300005530 | Bacteria | 1449 |
| 67 | Ga0070679_101446435 | 3300005530 | Bacteria | 634 |
| 68 | Ga0070684_100000331 | 3300005535 | Bacteria | 32759 |
| 69 | Ga0070684_100136300 | 3300005535 | Bacteria | 2218 |
| 70 | Ga0070684_100217182 | 3300005535 | Bacteria | 1744 |
| 71 | Ga0070684_100492644 | 3300005535 | Bacteria | 1135 |
| 72 | Ga0070684_100989435 | 3300005535 | Bacteria | 789 |
| 73 | Ga0070697_100048581 | 3300005536 | Bacteria | 3441 |
| 74 | Ga0070672_100621401 | 3300005543 | Bacteria | 942 |
| 75 | Ga0070686_100100961 | 3300005544 | Unclassified | 1949 |
| 76 | Ga0070695_100493270 | 3300005545 | Bacteria | 946 |
| 77 | Ga0070696_101136258 | 3300005546 | Bacteria | 658 |
| 78 | Ga0070693_100129490 | 3300005547 | Bacteria | 1576 |
| 79 | Ga0070693_100832951 | 3300005547 | Bacteria | 686 |
| 80 | Ga0068855_100597830 | 3300005563 | Unclassified | 1190 |
| 81 | Ga0070664_100775018 | 3300005564 | Bacteria | 896 |
| 82 | Ga0070664_101154181 | 3300005564 | Bacteria | 730 |
| 83 | Ga0068854_100588910 | 3300005578 | Bacteria | 948 |
| 84 | Ga0068856_100009273 | 3300005614 | Bacteria | 9562 |
| 85 | Ga0068856_100075066 | 3300005614 | Bacteria | 3349 |
| 86 | Ga0068856_100138643 | 3300005614 | Bacteria | 2439 |
| 87 | Ga0068856_100355481 | 3300005614 | Archaea | 1484 |
| 88 | Ga0068856_100634983 | 3300005614 | Bacteria | 1088 |
| 89 | Ga0070702_100000772 | 3300005615 | Bacteria | 12143 |
| 90 | Ga0070702_100546953 | 3300005615 | Bacteria | 859 |
| 91 | Ga0068852_100444947 | 3300005616 | Unclassified | 1282 |
| 92 | Ga0068852_102542419 | 3300005616 | Unclassified | 532 |
| 93 | Ga0068863_100103576 | 3300005841 | Archaea | 2707 |
| 94 | Ga0068863_101794565 | 3300005841 | Unclassified | 623 |
| 95 | Ga0068858_100233286 | 3300005842 | Bacteria | 1745 |
| 96 | Ga0081538_10000116 | 3300005981 | Bacteria | 80435 |
| 97 | Ga0081538_10002632 | 3300005981 | Bacteria | 17353 |
| 98 | Ga0081538_10004941 | 3300005981 | Bacteria | 12144 |
| 99 | Ga0081540_1013281 | 3300005983 | Bacteria | 5362 |
| 100 | Ga0081539_10000840 | 3300005985 | Bacteria | 58916 |
| 101 | Ga0070717_10042011 | 3300006028 | Bacteria | 3729 |
| 102 | Ga0070717_10058586 | 3300006028 | Unclassified | 3185 |
| 103 | Ga0070717_10435713 | 3300006028 | Unclassified | 1180 |
| 104 | Ga0075432_10035187 | 3300006058 | Bacteria | 1740 |
| 105 | Ga0075432_10111598 | 3300006058 | Bacteria | 1019 |
| 106 | Ga0070716_100350135 | 3300006173 | Bacteria | 1045 |
| 107 | Ga0070716_100983824 | 3300006173 | Bacteria | 666 |
| 108 | Ga0070712_100004060 | 3300006175 | Bacteria | 8986 |
| 109 | Ga0070712_100020415 | 3300006175 | Bacteria | 4335 |
| 110 | Ga0070712_100044173 | 3300006175 | Bacteria | 3071 |
| 111 | Ga0070712_100046920 | 3300006175 | Bacteria | 2988 |
| 112 | Ga0070712_100475783 | 3300006175 | Bacteria | 1044 |
| 113 | Ga0097621_100014698 | 3300006237 | Bacteria | 5867 |
| 114 | Ga0097621_100215326 | 3300006237 | Bacteria | 1672 |
| 115 | Ga0097621_100339585 | 3300006237 | Unclassified | 1334 |
| 116 | Ga0097621_100451110 | 3300006237 | Bacteria | 1159 |
| 117 | Ga0068871_100853148 | 3300006358 | Bacteria | 842 |
| 118 | Ga0075428_100005274 | 3300006844 | Bacteria | 14375 |
| 119 | Ga0075428_100022979 | 3300006844 | Bacteria | 6901 |
| 120 | Ga0075428_100080755 | 3300006844 | Bacteria | 3549 |
| 121 | Ga0075431_100033032 | 3300006847 | Bacteria | 5333 |
| 122 | Ga0075431_100039338 | 3300006847 | Bacteria | 4872 |
| 123 | Ga0075431_100579724 | 3300006847 | Bacteria | 1107 |
| 124 | Ga0075433_10039456 | 3300006852 | Bacteria | 4083 |
| 125 | Ga0075433_10673257 | 3300006852 | Bacteria | 907 |
| 126 | Ga0075434_100001941 | 3300006871 | Bacteria | 17939 |
| 127 | Ga0075434_100008128 | 3300006871 | Bacteria | 9729 |
| 128 | Ga0075434_100203481 | 3300006871 | Bacteria | 2000 |
| 129 | Ga0068865_100250606 | 3300006881 | Unclassified | 1397 |
| 130 | Ga0075436_100014538 | 3300006914 | Bacteria | 5394 |
| 131 | Ga0075436_100101258 | 3300006914 | Bacteria | 2006 |
| 132 | Ga0075436_100885922 | 3300006914 | Unclassified | 667 |
| 133 | Ga0075435_100044418 | 3300007076 | Bacteria | 3559 |
| 134 | Ga0075435_100059573 | 3300007076 | Bacteria | 3095 |
| 135 | Ga0105240_10205289 | 3300009093 | Bacteria | 2307 |
| 136 | Ga0111539_10036486 | 3300009094 | Bacteria | 5943 |
| 137 | Ga0111539_10106419 | 3300009094 | Bacteria | 3290 |
| 138 | Ga0111539_11599318 | 3300009094 | Bacteria | 756 |
| 139 | Ga0105245_10000499 | 3300009098 | Bacteria | 35958 |
| 140 | Ga0105245_10009775 | 3300009098 | Bacteria | 8356 |
| 141 | Ga0105245_10332886 | 3300009098 | Bacteria | 1499 |
| 142 | Ga0105245_10440715 | 3300009098 | Bacteria | 1309 |
| 143 | Ga0105245_10553517 | 3300009098 | Archaea | 1172 |
| 144 | Ga0105245_10589262 | 3300009098 | Bacteria | 1137 |
| 145 | Ga0105245_11140978 | 3300009098 | Bacteria | 826 |
| 146 | Ga0105247_10194202 | 3300009101 | Bacteria | 1360 |
| 147 | Ga0114129_10001814 | 3300009147 | Bacteria | 29120 |
| 148 | Ga0114129_10006241 | 3300009147 | Bacteria | 16896 |
| 149 | Ga0114129_10403917 | 3300009147 | Unclassified | 1800 |
| 150 | Ga0114129_11918013 | 3300009147 | Bacteria | 718 |
| 151 | Ga0105243_11361751 | 3300009148 | Bacteria | 729 |
| 152 | Ga0105241_10006217 | 3300009174 | Bacteria | 8806 |
| 153 | Ga0105242_10150093 | 3300009176 | Bacteria | 2031 |
| 154 | Ga0105242_10167892 | 3300009176 | Bacteria | 1926 |
| 155 | Ga0105242_12614268 | 3300009176 | Bacteria | 554 |
| 156 | Ga0105248_10022192 | 3300009177 | Bacteria | 7037 |
| 157 | Ga0105248_10740835 | 3300009177 | Bacteria | 1109 |
| 158 | Ga0105248_10978727 | 3300009177 | Bacteria | 956 |
| 159 | Ga0105237_10869823 | 3300009545 | Bacteria | 908 |
| 160 | Ga0105237_10906461 | 3300009545 | Bacteria | 888 |
| 161 | Ga0105238_10116442 | 3300009551 | Bacteria | 2652 |
| 162 | Ga0105238_10528964 | 3300009551 | Bacteria | 1182 |
| 163 | Ga0105238_11324630 | 3300009551 | Bacteria | 746 |
| 164 | Ga0105239_10215354 | 3300010375 | Bacteria | 2153 |
| 165 | Ga0105239_10328854 | 3300010375 | Bacteria | 1724 |
| 166 | Ga0105239_10411395 | 3300010375 | Bacteria | 1531 |
| 167 | Ga0105239_10615956 | 3300010375 | Bacteria | 1239 |
| 168 | Ga0105246_10164952 | 3300011119 | Unclassified | 1691 |
| 169 | Ga0105246_10323638 | 3300011119 | Unclassified | 1254 |
| 170 | Ga0157317_1005368 | 3300012475 | Bacteria | 865 |
| 171 | Ga0157373_10653792 | 3300013100 | Bacteria | 768 |
| 172 | Ga0157369_11692307 | 3300013105 | Bacteria | 643 |
| 173 | Ga0157374_10030954 | 3300013296 | Bacteria | 4860 |
| 174 | Ga0157374_10120807 | 3300013296 | Bacteria | 2528 |
| 175 | Ga0157378_10341163 | 3300013297 | Bacteria | 1461 |
| 176 | Ga0163162_10095384 | 3300013306 | Unclassified | 3061 |
| 177 | Ga0163162_10309929 | 3300013306 | Bacteria | 1711 |
| 178 | Ga0163162_10800919 | 3300013306 | Bacteria | 1060 |
| 179 | Ga0157372_10284565 | 3300013307 | Unclassified | 1923 |
| 180 | Ga0157372_11626611 | 3300013307 | Bacteria | 743 |
| 181 | Ga0157375_10927833 | 3300013308 | Bacteria | 1013 |
| 182 | Ga0157375_11914948 | 3300013308 | Bacteria | 704 |
| 183 | Ga0157375_11979085 | 3300013308 | Bacteria | 692 |
| 184 | Ga0157375_12265243 | 3300013308 | Unclassified | 647 |
| 185 | Ga0163163_10261044 | 3300014325 | Bacteria | 1783 |
| 186 | Ga0163163_10563057 | 3300014325 | Bacteria | 1202 |
| 187 | Ga0157380_10060122 | 3300014326 | Bacteria | 3035 |
| 188 | Ga0157380_11343834 | 3300014326 | Unclassified | 763 |
| 189 | Ga0182008_10004085 | 3300014497 | Bacteria | 8608 |
| 190 | Ga0182008_10089668 | 3300014497 | Bacteria | 1516 |
| 191 | Ga0157377_10014451 | 3300014745 | Bacteria | 4018 |
| 192 | Ga0157377_10333574 | 3300014745 | Bacteria | 1012 |
| 193 | Ga0157377_10427226 | 3300014745 | Bacteria | 909 |
| 194 | Ga0157377_11081800 | 3300014745 | Unclassified | 613 |
| 195 | Ga0157376_10285770 | 3300014969 | Bacteria | 1555 |
| 196 | Ga0157376_10362980 | 3300014969 | Bacteria | 1389 |
| 197 | Ga0157376_10630509 | 3300014969 | Bacteria | 1070 |
| 198 | Ga0157376_11135344 | 3300014969 | Bacteria | 808 |
| 199 | Ga0182006_1008244 | 3300015261 | Bacteria | 4727 |
| 200 | Ga0182007_10007521 | 3300015262 | Bacteria | 4561 |
| 201 | Ga0163161_10105890 | 3300017792 | Bacteria | 2098 |
| 202 | Ga0206356_10024515 | 3300020070 | Bacteria | 2066 |
| 203 | Ga0206353_10593270 | 3300020082 | Bacteria | 1019 |
| 204 | Ga0206353_11070079 | 3300020082 | Bacteria | 1198 |
| 205 | Ga0207692_10659397 | 3300025898 | Unclassified | 677 |
| 206 | Ga0207710_10101060 | 3300025900 | Bacteria | 1360 |
| 207 | Ga0207688_10065409 | 3300025901 | Bacteria | 2055 |
| 208 | Ga0207647_10060678 | 3300025904 | Bacteria | 2311 |
| 209 | Ga0207685_10107893 | 3300025905 | Unclassified | 1202 |
| 210 | Ga0207699_10127929 | 3300025906 | Bacteria | 1652 |
| 211 | Ga0207699_10879778 | 3300025906 | Bacteria | 660 |
| 212 | Ga0207643_10454500 | 3300025908 | Bacteria | 815 |
| 213 | Ga0207705_10048413 | 3300025909 | Bacteria | 3058 |
| 214 | Ga0207684_10158783 | 3300025910 | Bacteria | 1946 |
| 215 | Ga0207707_10011505 | 3300025912 | Bacteria | 7706 |
| 216 | Ga0207707_10313100 | 3300025912 | Bacteria | 1356 |
| 217 | Ga0207695_11086824 | 3300025913 | Bacteria | 680 |
| 218 | Ga0207671_10905020 | 3300025914 | Bacteria | 697 |
| 219 | Ga0207693_10007412 | 3300025915 | Bacteria | 9022 |
| 220 | Ga0207693_10022305 | 3300025915 | Bacteria | 5031 |
| 221 | Ga0207693_10031178 | 3300025915 | Bacteria | 4212 |
| 222 | Ga0207693_10034202 | 3300025915 | Bacteria | 4009 |
| 223 | Ga0207693_10066997 | 3300025915 | Bacteria | 2811 |
| 224 | Ga0207693_10380077 | 3300025915 | Unclassified | 1104 |
| 225 | Ga0207693_10421631 | 3300025915 | Bacteria | 1043 |
| 226 | Ga0207693_10525710 | 3300025915 | Unclassified | 923 |
| 227 | Ga0207663_10159215 | 3300025916 | Bacteria | 1592 |
| 228 | Ga0207663_10178368 | 3300025916 | Bacteria | 1515 |
| 229 | Ga0207663_10736920 | 3300025916 | Bacteria | 782 |
| 230 | Ga0207660_10359418 | 3300025917 | Bacteria | 1168 |
| 231 | Ga0207657_10044303 | 3300025919 | Bacteria | 3912 |
| 232 | Ga0207657_10152325 | 3300025919 | Bacteria | 1882 |
| 233 | Ga0207657_10337799 | 3300025919 | Bacteria | 1189 |
| 234 | Ga0207657_10578469 | 3300025919 | Unclassified | 877 |
| 235 | Ga0207649_10146643 | 3300025920 | Bacteria | 1621 |
| 236 | Ga0207652_10001137 | 3300025921 | Bacteria | 23969 |
| 237 | Ga0207652_10267587 | 3300025921 | Bacteria | 1542 |
| 238 | Ga0207652_11287170 | 3300025921 | Bacteria | 634 |
| 239 | Ga0207646_10002421 | 3300025922 | Bacteria | 22033 |
| 240 | Ga0207646_10044713 | 3300025922 | Bacteria | 3975 |
| 241 | Ga0207646_10208212 | 3300025922 | Bacteria | 1766 |
| 242 | Ga0207646_10909775 | 3300025922 | Bacteria | 780 |
| 243 | Ga0207681_10848849 | 3300025923 | Bacteria | 764 |
| 244 | Ga0207694_11399382 | 3300025924 | Bacteria | 591 |
| 245 | Ga0207659_10926317 | 3300025926 | Bacteria | 749 |
| 246 | Ga0207687_10003291 | 3300025927 | Bacteria | 10931 |
| 247 | Ga0207687_10049765 | 3300025927 | Bacteria | 2915 |
| 248 | Ga0207687_10100789 | 3300025927 | Bacteria | 2125 |
| 249 | Ga0207687_10682081 | 3300025927 | Bacteria | 871 |
| 250 | Ga0207664_10005779 | 3300025929 | Bacteria | 8462 |
| 251 | Ga0207664_10066156 | 3300025929 | Bacteria | 2896 |
| 252 | Ga0207664_10081174 | 3300025929 | Bacteria | 2638 |
| 253 | Ga0207664_10108400 | 3300025929 | Bacteria | 2306 |
| 254 | Ga0207664_10197061 | 3300025929 | Bacteria | 1737 |
| 255 | Ga0207690_10361540 | 3300025932 | Bacteria | 1150 |
| 256 | Ga0207686_10102075 | 3300025934 | Bacteria | 1917 |
| 257 | Ga0207686_10197420 | 3300025934 | Bacteria | 1439 |
| 258 | Ga0207704_10398529 | 3300025938 | Bacteria | 1085 |
| 259 | Ga0207704_10967567 | 3300025938 | Unclassified | 719 |
| 260 | Ga0207665_10459007 | 3300025939 | Bacteria | 979 |
| 261 | Ga0207691_10066192 | 3300025940 | Bacteria | 3270 |
| 262 | Ga0207661_10019903 | 3300025944 | Bacteria | 5009 |
| 263 | Ga0207661_10117192 | 3300025944 | Bacteria | 2262 |
| 264 | Ga0207661_10156730 | 3300025944 | Bacteria | 1973 |
| 265 | Ga0207661_11023679 | 3300025944 | Bacteria | 761 |
| 266 | Ga0207679_10077802 | 3300025945 | Bacteria | 2525 |
| 267 | Ga0207679_10748570 | 3300025945 | Unclassified | 889 |
| 268 | Ga0207679_11782747 | 3300025945 | Bacteria | 563 |
| 269 | Ga0207667_11405457 | 3300025949 | Bacteria | 671 |
| 270 | Ga0207640_10310709 | 3300025981 | Bacteria | 1251 |
| 271 | Ga0207658_10702721 | 3300025986 | Bacteria | 914 |
| 272 | Ga0207677_10118854 | 3300026023 | Bacteria | 1984 |
| 273 | Ga0207678_10083180 | 3300026067 | Bacteria | 2738 |
| 274 | Ga0207678_10198421 | 3300026067 | Bacteria | 1715 |
| 275 | Ga0207708_10002065 | 3300026075 | Bacteria | 14794 |
| 276 | Ga0207708_10438306 | 3300026075 | Bacteria | 1086 |
| 277 | Ga0207708_11711494 | 3300026075 | Unclassified | 552 |
| 278 | Ga0207702_10007123 | 3300026078 | Bacteria | 9569 |
| 279 | Ga0207702_10126471 | 3300026078 | Bacteria | 2295 |
| 280 | Ga0207702_10607363 | 3300026078 | Bacteria | 1074 |
| 281 | Ga0207702_10825268 | 3300026078 | Bacteria | 917 |
| 282 | Ga0207641_10075389 | 3300026088 | Archaea | 2913 |
| 283 | Ga0207674_10099425 | 3300026116 | Bacteria | 2892 |
| 284 | Ga0207674_11569270 | 3300026116 | Bacteria | 627 |
| 285 | Ga0207674_11979452 | 3300026116 | Bacteria | 548 |
| 286 | Ga0207675_101382541 | 3300026118 | Unclassified | 725 |
| 287 | Ga0207683_10002467 | 3300026121 | Bacteria | 16133 |
| 288 | Ga0207683_10024660 | 3300026121 | Bacteria | 5181 |
| 289 | Ga0207698_11294700 | 3300026142 | Bacteria | 743 |
| 290 | Ga0207428_10008352 | 3300027907 | Bacteria | 9355 |
| 291 | Ga0207428_10056739 | 3300027907 | Bacteria | 3111 |
| 292 | Ga0207428_10215323 | 3300027907 | Unclassified | 1442 |
| 293 | Ga0268266_10496101 | 3300028379 | Unclassified | 1165 |
| 294 | Ga0268265_11044306 | 3300028380 | Bacteria | 809 |
| 295 | Ga0265319_1063777 | 3300028563 | Bacteria | 1191 |
| 296 | Ga0265334_10144269 | 3300028573 | Archaea | 842 |
| 297 | Ga0265318_10041796 | 3300028577 | Unclassified | 1741 |
| 298 | Ga0265338_10049709 | 3300028800 | Bacteria | 3797 |
| 299 | Ga0265338_10068117 | 3300028800 | Bacteria | 3069 |
| 300 | Ga0265338_10122295 | 3300028800 | Bacteria | 2072 |
| 301 | Ga0265338_10131954 | 3300028800 | Bacteria | 1971 |
| 302 | Ga0265332_10144245 | 3300031238 | Bacteria | 997 |
| 303 | Ga0265320_10044762 | 3300031240 | Bacteria | 2179 |
| 304 | Ga0265339_10013897 | 3300031249 | Bacteria | 4871 |
| 305 | Ga0265331_10002389 | 3300031250 | Bacteria | 12737 |
| 306 | Ga0265331_10084398 | 3300031250 | Unclassified | 1472 |
| 307 | Ga0265316_10104349 | 3300031344 | Bacteria | 2151 |
| 308 | Ga0265313_10000079 | 3300031595 | Bacteria | 95515 |
| 309 | Ga0265314_10014243 | 3300031711 | Bacteria | 6375 |
| 310 | Ga0265314_10018093 | 3300031711 | Bacteria | 5508 |
| 311 | Ga0265342_10030080 | 3300031712 | Bacteria | 3369 |
| 312 | Ga0265342_10231408 | 3300031712 | Unclassified | 993 |
| 313 | Ga0307406_11100966 | 3300031901 | Unclassified | 686 |
| 314 | Ga0307416_100270025 | 3300032002 | Bacteria | 1669 |
| 315 | Ga0373944_0005132 | 3300035089 | Unclassified | 3440 |
| 316 | Ga0373939_0062398 | 3300035114 | Bacteria | 1191 |
| 317 | Ga0373960_0028199 | 3300035121 | Bacteria | 1548 |
| 318 | Ga0373946_0388415 | 3300035171 | Bacteria | 703 |
| 319 | Ga0373955_0560039 | 3300035172 | Bacteria | 699 |
| 320 | Ga0373942_0016327 | 3300035207 | Bacteria | 1820 |
| 321 | Ga0373947_1179984 | 3300035725 | Bacteria | 521 |
| 322 | Ga0373937_0309752 | 3300036401 | Bacteria | 1493 |
| 323 | Ga0395899_0208807 | 3300037312 | Unclassified | 1358 |
| 324 | Ga0395899_0347258 | 3300037312 | Bacteria | 993 |
| 325 | Ga0395900_0036646 | 3300037418 | Bacteria | 5057 |
| 326 | Ga0395900_0057702 | 3300037418 | Bacteria | 3997 |
| 327 | Ga0395900_0102148 | 3300037418 | Bacteria | 2945 |
| 328 | Ga0395900_0125708 | 3300037418 | Bacteria | 2630 |
| 329 | Ga0395900_0141996 | 3300037418 | Bacteria | 2458 |
| 330 | Ga0395900_0207769 | 3300037418 | Bacteria | 1978 |
| 331 | Ga0395900_0311626 | 3300037418 | Bacteria | 1557 |
| 332 | Ga0395900_0696999 | 3300037418 | Bacteria | 949 |
| 333 | Ga0395900_0762359 | 3300037418 | Unclassified | 897 |
| 334 | Ga0395900_0848088 | 3300037418 | Bacteria | 839 |
| 335 | Ga0395898_0007289 | 3300037466 | Bacteria | 11739 |
| 336 | Ga0395898_0032534 | 3300037466 | Bacteria | 5206 |
| 337 | Ga0395898_0036354 | 3300037466 | Bacteria | 4890 |
| 338 | Ga0395898_0046089 | 3300037466 | Bacteria | 4282 |
| 339 | Ga0395898_0083255 | 3300037466 | Bacteria | 3084 |
| 340 | Ga0395898_0213695 | 3300037466 | Bacteria | 1840 |
| 341 | Ga0395898_0839084 | 3300037466 | Bacteria | 858 |
| 342 | Ga0395898_1021261 | 3300037466 | Bacteria | 762 |
| 343 | Ga0395905_0003639 | 3300037471 | Bacteria | 16380 |
| 344 | Ga0395905_0057384 | 3300037471 | Bacteria | 3642 |
| 345 | Ga0395905_0088822 | 3300037471 | Bacteria | 2896 |
| 346 | Ga0395905_0252053 | 3300037471 | Bacteria | 1649 |
| 347 | Ga0395905_0398625 | 3300037471 | Bacteria | 1271 |
| 348 | Ga0395905_0922527 | 3300037471 | Bacteria | 776 |
| 349 | Ga0395901_0023034 | 3300038443 | Bacteria | 6383 |
| 350 | Ga0395901_0114916 | 3300038443 | Bacteria | 2827 |
| 351 | Ga0395901_0138741 | 3300038443 | Bacteria | 2555 |
| 352 | Ga0395901_0161710 | 3300038443 | Bacteria | 2351 |
| 353 | Ga0395901_0170458 | 3300038443 | Bacteria | 2284 |
| 354 | Ga0395901_0198365 | 3300038443 | Bacteria | 2104 |
| 355 | Ga0395901_0201522 | 3300038443 | Bacteria | 2086 |
| 356 | Ga0395901_0237349 | 3300038443 | Bacteria | 1902 |
| 357 | Ga0395901_0684929 | 3300038443 | Unclassified | 1024 |
| 358 | Ga0395901_0764020 | 3300038443 | Bacteria | 958 |
| 359 | Ga0395901_0932015 | 3300038443 | Bacteria | 848 |
| 360 | Ga0395901_1181906 | 3300038443 | Bacteria | 732 |
| 361 | Ga0395901_1559005 | 3300038443 | Unclassified | 615 |
| 362 | Ga0451853_0125869 | 3300041512 | Bacteria | 711 |
| 363 | Ga0451853_1097714 | 3300041512 | Unclassified | 1953 |
| 364 | Ga0466969_0003156 | 3300044656 | Bacteria | 8774 |
| 365 | Ga0466969_0119486 | 3300044656 | Bacteria | 1228 |
| 366 | Ga0466965_0028061 | 3300044683 | Bacteria | 2733 |
| 367 | Ga0466965_0741387 | 3300044683 | Bacteria | 566 |
| 368 | Ga0466966_0007964 | 3300044684 | Bacteria | 7022 |
| 369 | Ga0466966_0159014 | 3300044684 | Bacteria | 1376 |
| 370 | Ga0466961_0002499 | 3300044693 | Bacteria | 11403 |
| 371 | Ga0466961_0039290 | 3300044693 | Bacteria | 3034 |
| 372 | Ga0466961_0055770 | 3300044693 | Bacteria | 2518 |
| 373 | Ga0466961_0067042 | 3300044693 | Unclassified | 2280 |
| 374 | Ga0466961_0330236 | 3300044693 | Bacteria | 929 |
| 375 | Ga0466963_0000708 | 3300044694 | Bacteria | 16285 |
| 376 | Ga0466963_0002922 | 3300044694 | Bacteria | 9652 |
| 377 | Ga0466963_0014391 | 3300044694 | Bacteria | 4876 |
| 378 | Ga0466963_0043355 | 3300044694 | Bacteria | 2957 |
| 379 | Ga0466963_0168411 | 3300044694 | Bacteria | 1526 |
| 380 | Ga0466963_0560343 | 3300044694 | Bacteria | 807 |
| 381 | Ga0466964_0001239 | 3300044706 | Bacteria | 8665 |
| 382 | Ga0466964_0003090 | 3300044706 | Bacteria | 6055 |
| 383 | Ga0466964_0004061 | 3300044706 | Bacteria | 5384 |
| 384 | Ga0466964_0018430 | 3300044706 | Bacteria | 2679 |
| 385 | Ga0466964_0028944 | 3300044706 | Bacteria | 2185 |
| 386 | Ga0466964_0603765 | 3300044706 | Bacteria | 602 |
| 387 | Ga0466971_0001732 | 3300044719 | Bacteria | 9241 |
| 388 | Ga0466968_0000973 | 3300044735 | Bacteria | 10068 |
| 389 | Ga0466968_0017577 | 3300044735 | Bacteria | 2860 |
| 390 | Ga0466968_0179692 | 3300044735 | Unclassified | 984 |
| 391 | Ga0466968_0194945 | 3300044735 | Bacteria | 947 |
| 392 | Ga0466970_0006853 | 3300044765 | Bacteria | 5704 |
| 393 | Ga0466957_0005364 | 3300044842 | Bacteria | 7196 |
| 394 | Ga0466957_0008149 | 3300044842 | Bacteria | 5949 |
| 395 | Ga0466957_0010927 | 3300044842 | Bacteria | 5221 |
| 396 | Ga0466957_0138166 | 3300044842 | Unclassified | 1568 |
| 397 | Ga0466957_0399120 | 3300044842 | Bacteria | 940 |
| 398 | Ga0466957_0445467 | 3300044842 | Unclassified | 892 |
| 399 | Ga0466960_0013583 | 3300044901 | Bacteria | 3464 |
| 400 | Ga0466960_0014013 | 3300044901 | Bacteria | 3419 |
| 401 | Ga0466960_0130515 | 3300044901 | Bacteria | 1325 |
| 402 | Ga0466960_0383945 | 3300044901 | Bacteria | 806 |
| 403 | Ga0466959_0004476 | 3300045049 | Bacteria | 9361 |
| 404 | Ga0466959_0004730 | 3300045049 | Bacteria | 9168 |
| 405 | Ga0466959_0030254 | 3300045049 | Bacteria | 4010 |
| 406 | Ga0466959_0046432 | 3300045049 | Bacteria | 3196 |
| 407 | Ga0466959_0118172 | 3300045049 | Bacteria | 1887 |
| 408 | Ga0466959_0130906 | 3300045049 | Unclassified | 1778 |
| 409 | Ga0466959_0477692 | 3300045049 | Bacteria | 844 |
| 410 | Ga0451576_0153814 | 3300045051 | Bacteria | 2399 |
| 411 | Ga0451576_1822756 | 3300045051 | Bacteria | 629 |
| 412 | Ga0466958_0003062 | 3300045836 | Bacteria | 8573 |
| 413 | Ga0466958_0006780 | 3300045836 | Bacteria | 6257 |
| 414 | Ga0466958_0007980 | 3300045836 | Bacteria | 5852 |
| 415 | Ga0466958_0016026 | 3300045836 | Bacteria | 4309 |
| 416 | Ga0466958_0023004 | 3300045836 | Bacteria | 3654 |
| 417 | Ga0466958_0023888 | 3300045836 | Bacteria | 3594 |
| 418 | Ga0466958_0033920 | 3300045836 | Bacteria | 3043 |
| 419 | Ga0466958_0089962 | 3300045836 | Bacteria | 1899 |
| 420 | Ga0466958_0100516 | 3300045836 | Unclassified | 1798 |
| 421 | Ga0466967_0000724 | 3300045976 | Bacteria | 16867 |
| 422 | Ga0466967_0001136 | 3300045976 | Bacteria | 14841 |
| 423 | Ga0466967_0002143 | 3300045976 | Bacteria | 12109 |
| 424 | Ga0466967_0008248 | 3300045976 | Bacteria | 7608 |
| 425 | Ga0466967_0047040 | 3300045976 | Bacteria | 3759 |
| 426 | Ga0466967_0072144 | 3300045976 | Bacteria | 3094 |
| 427 | Ga0466967_0105771 | 3300045976 | Bacteria | 2578 |
| 428 | Ga0466967_0121606 | 3300045976 | Bacteria | 2413 |
| 429 | Ga0466967_0249020 | 3300045976 | Bacteria | 1697 |
| 430 | Ga0466967_0303291 | 3300045976 | Bacteria | 1537 |
| 431 | Ga0466967_0541609 | 3300045976 | Bacteria | 1145 |
| 432 | Ga0466967_0682941 | 3300045976 | Bacteria | 1016 |
| 433 | Ga0466967_0775299 | 3300045976 | Bacteria | 951 |
| 434 | Ga0466967_0915972 | 3300045976 | Bacteria | 872 |
| 435 | Ga0466967_1854741 | 3300045976 | Unclassified | 600 |
| 436 | Ga0466967_1931024 | 3300045976 | Bacteria | 587 |
| 437 | Ga0466967_2246894 | 3300045976 | Bacteria | 541 |
| 438 | Ga0495592_0019587 | 3300046454 | Bacteria | 5147 |
| 439 | Ga0495603_0007573 | 3300046455 | Bacteria | 6533 |
| 440 | Ga0495603_0222706 | 3300046455 | Bacteria | 1088 |
| 441 | Ga0495603_0555752 | 3300046455 | Unclassified | 657 |
| 442 | Ga0495629_0126716 | 3300046459 | Bacteria | 1779 |
| 443 | Ga0495641_0030633 | 3300046461 | Unclassified | 2577 |
| 444 | Ga0495641_0031387 | 3300046461 | Plasmid | 2539 |
| 445 | Ga0495641_0181036 | 3300046461 | Bacteria | 943 |
| 446 | Ga0495651_0494842 | 3300046462 | Unclassified | 783 |
| 447 | Ga0495653_0064460 | 3300046463 | Bacteria | 2761 |
| 448 | Ga0495653_0199873 | 3300046463 | Unclassified | 1357 |
| 449 | Ga0495580_0141919 | 3300046472 | Bacteria | 1665 |
| 450 | Ga0495580_0533018 | 3300046472 | Unclassified | 781 |
| 451 | Ga0495582_0075788 | 3300046473 | Unclassified | 1863 |
| 452 | Ga0495582_0124808 | 3300046473 | Bacteria | 1452 |
| 453 | Ga0495639_0033196 | 3300046475 | Bacteria | 2305 |
| 454 | Ga0495662_0163084 | 3300046476 | Bacteria | 1098 |
| 455 | Ga0495664_0176451 | 3300046477 | Bacteria | 1296 |
| 456 | Ga0495585_0399780 | 3300046492 | Bacteria | 662 |
| 457 | Ga0495594_0072563 | 3300046499 | Bacteria | 1915 |
| 458 | Ga0495596_0099476 | 3300046500 | Bacteria | 1129 |
| 459 | Ga0495608_0038050 | 3300046511 | Plasmid | 3234 |
| 460 | Ga0495608_0291708 | 3300046511 | Bacteria | 1011 |
| 461 | Ga0495618_0169533 | 3300046514 | Bacteria | 1390 |
| 462 | Ga0495618_0177483 | 3300046514 | Bacteria | 1354 |
| 463 | Ga0495618_0494868 | 3300046514 | Bacteria | 738 |
| 464 | Ga0495628_0084449 | 3300046516 | Bacteria | 2464 |
| 465 | Ga0495630_0030750 | 3300046517 | Plasmid | 3996 |
| 466 | Ga0495630_0040249 | 3300046517 | Bacteria | 3493 |
| 467 | Ga0495630_0087466 | 3300046517 | Unclassified | 2353 |
| 468 | Ga0495630_0208811 | 3300046517 | Bacteria | 1490 |
| 469 | Ga0495663_0143960 | 3300046525 | Bacteria | 810 |
| 470 | Ga0495666_0051206 | 3300046526 | Bacteria | 1984 |
| 471 | Ga0495666_0171358 | 3300046526 | Unclassified | 1004 |
| 472 | Ga0495665_0280867 | 3300046531 | Unclassified | 854 |
| 473 | Ga0495665_0373795 | 3300046531 | Bacteria | 725 |
| 474 | Ga0495640_0042413 | 3300046533 | Plasmid | 3175 |
| 475 | Ga0495640_0086303 | 3300046533 | Unclassified | 2078 |
| 476 | Ga0495640_0395671 | 3300046533 | Bacteria | 849 |
| 477 | Ga0495587_0077554 | 3300046536 | Bacteria | 1929 |
| 478 | Ga0495645_0458750 | 3300046543 | Unclassified | 803 |
| 479 | Ga0495667_0002340 | 3300046559 | Bacteria | 12674 |
| 480 | Ga0495667_0224014 | 3300046559 | Bacteria | 1200 |
| 481 | Ga0495656_0075014 | 3300046615 | Bacteria | 1512 |
| 482 | Ga0495656_0104758 | 3300046615 | Bacteria | 1314 |
| 483 | Ga0495656_0255290 | 3300046615 | Bacteria | 887 |
| 484 | Ga0495668_0260805 | 3300046616 | Bacteria | 949 |
| 485 | Ga0495634_0039726 | 3300046642 | Unclassified | 3203 |
| 486 | Ga0495634_0049930 | 3300046642 | Bacteria | 2811 |
| 487 | Ga0495634_0079591 | 3300046642 | Unclassified | 2146 |
| 488 | Ga0495634_0113615 | 3300046642 | Bacteria | 1739 |
| 489 | Ga0495634_0391091 | 3300046642 | Bacteria | 827 |
| 490 | Ga0495635_0036782 | 3300046663 | Bacteria | 3391 |
| 491 | Ga0495635_0089730 | 3300046663 | Bacteria | 2103 |
| 492 | Ga0495635_0298632 | 3300046663 | Bacteria | 1080 |
| 493 | Ga0495588_0048975 | 3300046674 | Unclassified | 2171 |
| 494 | Ga0495588_0252807 | 3300046674 | Bacteria | 929 |
| 495 | Ga0495657_0066832 | 3300046675 | Unclassified | 2361 |
| 496 | Ga0495657_0664084 | 3300046675 | Bacteria | 600 |
| 497 | Ga0495599_0395434 | 3300046678 | Bacteria | 824 |
| 498 | Ga0495646_0073097 | 3300046680 | Bacteria | 2015 |
| 499 | Ga0495646_0379069 | 3300046680 | Unclassified | 738 |
| 500 | Ga0495647_0196017 | 3300046681 | Unclassified | 884 |
| 501 | Ga0495658_0409041 | 3300046683 | Unclassified | 865 |
| 502 | Ga0495669_0152036 | 3300046684 | Bacteria | 1096 |
| 503 | Ga0495613_0109095 | 3300046689 | Unclassified | 1996 |
| 504 | Ga0495624_0029778 | 3300046690 | Bacteria | 3560 |
| 505 | Ga0495624_0540841 | 3300046690 | Unclassified | 696 |
| 506 | Ga0495670_0525096 | 3300046691 | Bacteria | 643 |
| 507 | Ga0495581_0046330 | 3300047315 | Unclassified | 2512 |
| 508 | Ga0495581_0355458 | 3300047315 | Bacteria | 855 |
| 509 | Ga0495604_0105620 | 3300047317 | Unclassified | 2061 |
| 510 | Ga0495674_0020877 | 3300047319 | Bacteria | 6063 |
| 511 | Ga0495674_0022708 | 3300047319 | Bacteria | 5783 |
| 512 | Ga0495674_0060813 | 3300047319 | Bacteria | 3295 |
| 513 | Ga0495674_0102632 | 3300047319 | Bacteria | 2432 |
| 514 | Ga0495676_0018502 | 3300047321 | Bacteria | 6143 |
| 515 | Ga0495676_0113508 | 3300047321 | Unclassified | 1983 |
| 516 | Ga0495680_0001666 | 3300047322 | Bacteria | 23625 |
| 517 | Ga0495680_0025593 | 3300047322 | Bacteria | 4881 |
| 518 | Ga0495680_0763220 | 3300047322 | Bacteria | 634 |
| 519 | Ga0495683_0259857 | 3300047323 | Bacteria | 759 |
| 520 | Ga0495675_0093386 | 3300047444 | Bacteria | 1888 |
| 521 | Ga0495677_0030079 | 3300047445 | Bacteria | 1976 |
| 522 | Ga0495684_0005868 | 3300047471 | Bacteria | 9542 |
| 523 | Ga0495684_0108745 | 3300047471 | Bacteria | 2094 |
| 524 | Ga0495684_0367595 | 3300047471 | Unclassified | 1017 |
| 525 | Ga0495593_0111518 | 3300047673 | Bacteria | 1396 |
| 526 | Ga0495593_0309122 | 3300047673 | Unclassified | 790 |
| 527 | Ga0495614_0454361 | 3300048089 | Unclassified | 606 |
| 528 | Ga0496100_0005437 | 3300048903 | Bacteria | 6861 |
| 529 | Ga0496100_0041717 | 3300048903 | Archaea | 2927 |
| 530 | Ga0496100_0154774 | 3300048903 | Bacteria | 1638 |
| 531 | Ga0496100_0352338 | 3300048903 | Unclassified | 1112 |
| 532 | Ga0496100_0592481 | 3300048903 | Bacteria | 860 |
| 533 | Ga0496100_0994064 | 3300048903 | Bacteria | 660 |
| 534 | Ga0496101_0016236 | 3300048904 | Bacteria | 5025 |
| 535 | Ga0496101_0074693 | 3300048904 | Bacteria | 2494 |
| 536 | Ga0496101_0142218 | 3300048904 | Bacteria | 1829 |
| 537 | Ga0496101_0143455 | 3300048904 | Bacteria | 1822 |
| 538 | Ga0496101_0284245 | 3300048904 | Bacteria | 1293 |
| 539 | Ga0496101_0314999 | 3300048904 | Archaea | 1227 |
| 540 | Ga0496101_0411686 | 3300048904 | Bacteria | 1065 |
| 541 | Ga0496101_0415876 | 3300048904 | Bacteria | 1060 |
| 542 | Ga0496101_1242472 | 3300048904 | Bacteria | 583 |
| 543 | Ga0496102_0007721 | 3300048905 | Bacteria | 9189 |
| 544 | Ga0496102_0117880 | 3300048905 | Bacteria | 2478 |
| 545 | Ga0496102_0175401 | 3300048905 | Bacteria | 2018 |
| 546 | Ga0496102_0261344 | 3300048905 | Bacteria | 1632 |
| 547 | Ga0496102_0324391 | 3300048905 | Bacteria | 1450 |
| 548 | Ga0496103_0010969 | 3300048906 | Bacteria | 5363 |
| 549 | Ga0496103_0096402 | 3300048906 | Unclassified | 1869 |
| 550 | Ga0496103_0135952 | 3300048906 | Bacteria | 1571 |
| 551 | Ga0496103_0972646 | 3300048906 | Bacteria | 529 |
| 552 | Ga0496104_0026073 | 3300048907 | Bacteria | 5392 |
| 553 | Ga0496104_0028441 | 3300048907 | Bacteria | 5182 |
| 554 | Ga0496104_0068366 | 3300048907 | Bacteria | 3376 |
| 555 | Ga0496104_0271195 | 3300048907 | Unclassified | 1609 |
| 556 | Ga0496104_0314815 | 3300048907 | Bacteria | 1478 |
| 557 | Ga0496104_0882625 | 3300048907 | Bacteria | 799 |
| 558 | Ga0496105_0019277 | 3300048908 | Bacteria | 5502 |
| 559 | Ga0496105_0028767 | 3300048908 | Bacteria | 4546 |
| 560 | Ga0496105_0036529 | 3300048908 | Bacteria | 4048 |
| 561 | Ga0496105_0037713 | 3300048908 | Bacteria | 3980 |
| 562 | Ga0496105_0147147 | 3300048908 | Unclassified | 1937 |
| 563 | Ga0496105_0155564 | 3300048908 | Bacteria | 1878 |
| 564 | Ga0496105_0190285 | 3300048908 | Bacteria | 1678 |
| 565 | Ga0496105_0267618 | 3300048908 | Bacteria | 1381 |
| 566 | Ga0496105_0286138 | 3300048908 | Bacteria | 1328 |
| 567 | Ga0496105_0298217 | 3300048908 | Bacteria | 1296 |
| 568 | Ga0496106_0005815 | 3300048909 | Bacteria | 9116 |
| 569 | Ga0496106_0170606 | 3300048909 | Bacteria | 1724 |
| 570 | Ga0496106_0230054 | 3300048909 | Archaea | 1480 |
| 571 | Ga0496106_0489666 | 3300048909 | Bacteria | 988 |
| 572 | Ga0496106_0636857 | 3300048909 | Bacteria | 852 |
| 573 | Ga0496106_1094023 | 3300048909 | Bacteria | 625 |
| 574 | Ga0496107_0003984 | 3300048910 | Bacteria | 9945 |
| 575 | Ga0496107_0041602 | 3300048910 | Bacteria | 3300 |
| 576 | Ga0496107_0042495 | 3300048910 | Bacteria | 3264 |
| 577 | Ga0496107_0053936 | 3300048910 | Bacteria | 2900 |
| 578 | Ga0496107_0107065 | 3300048910 | Bacteria | 2054 |
| 579 | Ga0496107_0179720 | 3300048910 | Archaea | 1571 |
| 580 | Ga0496107_0265702 | 3300048910 | Bacteria | 1277 |
| 581 | Ga0496107_0337644 | 3300048910 | Bacteria | 1121 |
| 582 | Ga0496107_0596270 | 3300048910 | Unclassified | 817 |
| 583 | Ga0496108_0014563 | 3300048911 | Bacteria | 6419 |
| 584 | Ga0496108_0072847 | 3300048911 | Bacteria | 2900 |
| 585 | Ga0496108_0141546 | 3300048911 | Bacteria | 2072 |
| 586 | Ga0496108_0171325 | 3300048911 | Bacteria | 1878 |
| 587 | Ga0496108_0183906 | 3300048911 | Bacteria | 1810 |
| 588 | Ga0496109_0015200 | 3300048912 | Bacteria | 6701 |
| 589 | Ga0496109_0057879 | 3300048912 | Bacteria | 3540 |
| 590 | Ga0496109_0105965 | 3300048912 | Bacteria | 2611 |
| 591 | Ga0496109_0143335 | 3300048912 | Bacteria | 2234 |
| 592 | Ga0496109_0832679 | 3300048912 | Bacteria | 861 |
| 593 | Ga0496109_0944263 | 3300048912 | Bacteria | 800 |
| 594 | Ga0496110_0035464 | 3300048913 | Bacteria | 4327 |
| 595 | Ga0496110_0039329 | 3300048913 | Bacteria | 4118 |
| 596 | Ga0496110_0096751 | 3300048913 | Bacteria | 2645 |
| 597 | Ga0496110_0159366 | 3300048913 | Bacteria | 2045 |
| 598 | Ga0496110_0172801 | 3300048913 | Bacteria | 1961 |
| 599 | Ga0496111_0010854 | 3300048914 | Bacteria | 6125 |
| 600 | Ga0496111_0051111 | 3300048914 | Bacteria | 2984 |
| 601 | Ga0496111_0184324 | 3300048914 | Bacteria | 1552 |
| 602 | Ga0496111_0386636 | 3300048914 | Bacteria | 1034 |
| 603 | Ga0496111_0415857 | 3300048914 | Bacteria | 993 |
| 604 | Ga0496112_0068160 | 3300048915 | Bacteria | 3513 |
| 605 | Ga0496112_0182900 | 3300048915 | Bacteria | 2060 |
| 606 | Ga0496112_0183341 | 3300048915 | Bacteria | 2057 |
| 607 | Ga0496112_0225303 | 3300048915 | Bacteria | 1830 |
| 608 | Ga0496112_0234008 | 3300048915 | Archaea | 1791 |
| 609 | Ga0496112_0336850 | 3300048915 | Bacteria | 1452 |
| 610 | Ga0496112_0489198 | 3300048915 | Bacteria | 1166 |
| 611 | Ga0496112_0671335 | 3300048915 | Bacteria | 965 |
| 612 | Ga0496112_0962164 | 3300048915 | Unclassified | 774 |
| 613 | Ga0496113_0153866 | 3300048916 | Bacteria | 1815 |
| 614 | Ga0496113_0155626 | 3300048916 | Unclassified | 1805 |
| 615 | Ga0496113_0364554 | 3300048916 | Bacteria | 1159 |
| 616 | Ga0496113_0447155 | 3300048916 | Bacteria | 1038 |
| 617 | Ga0496113_0532439 | 3300048916 | Bacteria | 943 |
| 618 | Ga0496113_0793059 | 3300048916 | Unclassified | 753 |
| 619 | Ga0496114_0000738 | 3300048917 | Bacteria | 24412 |
| 620 | Ga0496114_0001824 | 3300048917 | Bacteria | 16152 |
| 621 | Ga0496114_0007449 | 3300048917 | Bacteria | 8654 |
| 622 | Ga0496114_0012587 | 3300048917 | Bacteria | 6776 |
| 623 | Ga0496114_0111423 | 3300048917 | Bacteria | 2345 |
| 624 | Ga0496114_0118060 | 3300048917 | Unclassified | 2279 |
| 625 | Ga0496114_0132203 | 3300048917 | Archaea | 2155 |
| 626 | Ga0496114_0179627 | 3300048917 | Bacteria | 1848 |
| 627 | Ga0496114_0363380 | 3300048917 | Bacteria | 1280 |
| 628 | Ga0496114_0369513 | 3300048917 | Bacteria | 1269 |
| 629 | Ga0496114_1025633 | 3300048917 | Unclassified | 709 |
| 630 | Ga0496115_0006958 | 3300048918 | Bacteria | 8308 |
| 631 | Ga0496115_0033805 | 3300048918 | Bacteria | 4039 |
| 632 | Ga0496115_0053391 | 3300048918 | Bacteria | 3243 |
| 633 | Ga0496115_0065465 | 3300048918 | Bacteria | 2935 |
| 634 | Ga0496115_0089006 | 3300048918 | Bacteria | 2521 |
| 635 | Ga0496115_0094265 | 3300048918 | Bacteria | 2449 |
| 636 | Ga0496115_0353627 | 3300048918 | Bacteria | 1198 |
| 637 | Ga0496115_0356297 | 3300048918 | Unclassified | 1193 |
| 638 | Ga0501031_0022549 | 3300049568 | Bacteria | 4102 |
| 639 | Ga0501031_0120194 | 3300049568 | Bacteria | 1716 |
| 640 | Ga0501032_0105246 | 3300049569 | Bacteria | 1869 |
| 641 | Ga0501033_0079739 | 3300049570 | Bacteria | 2402 |
| 642 | Ga0501036_0002956 | 3300049572 | Bacteria | 13506 |
| 643 | Ga0501036_0024992 | 3300049572 | Bacteria | 5038 |
| 644 | Ga0501036_0028630 | 3300049572 | Bacteria | 4708 |
| 645 | Ga0501036_0098053 | 3300049572 | Bacteria | 2478 |
| 646 | Ga0501037_0042490 | 3300049573 | Bacteria | 3340 |
| 647 | Ga0501038_0009245 | 3300049574 | Bacteria | 9044 |
| 648 | Ga0501038_0596238 | 3300049574 | Bacteria | 836 |
| 649 | Ga0501039_0004859 | 3300049575 | Bacteria | 10173 |
| 650 | Ga0501039_0417990 | 3300049575 | Bacteria | 1053 |
| 651 | Ga0501039_1052758 | 3300049575 | Unclassified | 631 |
| 652 | Ga0501040_0004267 | 3300049576 | Bacteria | 9303 |
| 653 | Ga0501040_0064790 | 3300049576 | Bacteria | 2516 |
| 654 | Ga0501040_0710737 | 3300049576 | Unclassified | 727 |
| 655 | Ga0501041_0096302 | 3300049577 | Bacteria | 1829 |
| 656 | Ga0501041_0217575 | 3300049577 | Bacteria | 1198 |
| 657 | Ga0501042_0000705 | 3300049578 | Bacteria | 18109 |
| 658 | Ga0501042_0002132 | 3300049578 | Bacteria | 12010 |
| 659 | Ga0501042_0286847 | 3300049578 | Bacteria | 1189 |
| 660 | Ga0501043_0176078 | 3300049579 | Bacteria | 1667 |
| 661 | Ga0501043_0777290 | 3300049579 | Unclassified | 694 |
| 662 | Ga0501043_0805651 | 3300049579 | Bacteria | 679 |
| 663 | Ga0501046_0150605 | 3300049580 | Bacteria | 1755 |
| 664 | Ga0501047_0151168 | 3300049581 | Bacteria | 2198 |
| 665 | Ga0501047_0236102 | 3300049581 | Bacteria | 1680 |
| 666 | Ga0501047_0439236 | 3300049581 | Bacteria | 1135 |
| 667 | Ga0501048_0006802 | 3300049582 | Bacteria | 8686 |
| 668 | Ga0501048_0021655 | 3300049582 | Bacteria | 4704 |
| 669 | Ga0501048_0429647 | 3300049582 | Bacteria | 945 |
| 670 | Ga0501067_0032930 | 3300049583 | Bacteria | 2876 |
| 671 | Ga0501067_0034045 | 3300049583 | Bacteria | 2826 |
| 672 | Ga0501067_0054767 | 3300049583 | Bacteria | 2210 |
| 673 | Ga0501068_0002477 | 3300049584 | Bacteria | 9808 |
| 674 | Ga0501068_0115584 | 3300049584 | Bacteria | 1671 |
| 675 | Ga0501069_0001978 | 3300049585 | Bacteria | 10248 |
| 676 | Ga0501069_0094125 | 3300049585 | Bacteria | 1695 |
| 677 | Ga0501069_0176705 | 3300049585 | Bacteria | 1233 |
| 678 | Ga0501070_0007718 | 3300049586 | Bacteria | 9123 |
| 679 | Ga0501070_0021104 | 3300049586 | Bacteria | 5465 |
| 680 | Ga0501070_0126755 | 3300049586 | Bacteria | 2109 |
| 681 | Ga0501071_0016021 | 3300049587 | Bacteria | 5150 |
| 682 | Ga0501071_0053561 | 3300049587 | Bacteria | 2910 |
| 683 | Ga0501071_0067322 | 3300049587 | Bacteria | 2604 |
| 684 | Ga0501071_0077372 | 3300049587 | Bacteria | 2430 |
| 685 | Ga0501072_0009496 | 3300049588 | Bacteria | 7397 |
| 686 | Ga0501072_0016046 | 3300049588 | Bacteria | 5744 |
| 687 | Ga0501072_0020916 | 3300049588 | Bacteria | 5072 |
| 688 | Ga0501072_0081216 | 3300049588 | Bacteria | 2569 |
| 689 | Ga0501072_0518318 | 3300049588 | Bacteria | 942 |
| 690 | Ga0501073_0053229 | 3300049589 | Bacteria | 2834 |
| 691 | Ga0501074_0003699 | 3300049590 | Bacteria | 10843 |
| 692 | Ga0501074_0060397 | 3300049590 | Bacteria | 2731 |
| 693 | Ga0501074_0181025 | 3300049590 | Bacteria | 1504 |
| 694 | Ga0501074_0268687 | 3300049590 | Bacteria | 1212 |
| 695 | Ga0501075_0018650 | 3300049591 | Bacteria | 5024 |
| 696 | Ga0501075_0077919 | 3300049591 | Bacteria | 2508 |
| 697 | Ga0501075_0601482 | 3300049591 | Bacteria | 839 |
| 698 | Ga0501076_0100415 | 3300049592 | Bacteria | 2331 |
| 699 | Ga0501076_0164683 | 3300049592 | Bacteria | 1807 |
| 700 | Ga0501076_0295922 | 3300049592 | Bacteria | 1326 |
| 701 | Ga0501076_0628928 | 3300049592 | Bacteria | 886 |
| 702 | Ga0501076_0685720 | 3300049592 | Bacteria | 846 |
| 703 | Ga0501077_0001990 | 3300049593 | Bacteria | 12330 |
| 704 | Ga0501077_0016106 | 3300049593 | Bacteria | 4711 |
| 705 | Ga0501077_0059144 | 3300049593 | Bacteria | 2433 |
| 706 | Ga0501077_0107966 | 3300049593 | Bacteria | 1763 |
| 707 | Ga0501079_0002900 | 3300049741 | Bacteria | 12533 |
| 708 | Ga0501079_0011433 | 3300049741 | Bacteria | 6775 |
| 709 | Ga0501079_0095808 | 3300049741 | Bacteria | 2300 |
| 710 | Ga0501079_0195407 | 3300049741 | Bacteria | 1579 |
| 711 | Ga0501080_0001672 | 3300049742 | Bacteria | 18888 |
| 712 | Ga0501080_0040889 | 3300049742 | Bacteria | 4323 |
| 713 | Ga0501080_0305536 | 3300049742 | Bacteria | 1442 |
| 714 | Ga0501080_0555757 | 3300049742 | Bacteria | 1022 |
| 715 | Ga0501080_0577234 | 3300049742 | Bacteria | 1000 |
| 716 | Ga0501080_0653036 | 3300049742 | Bacteria | 931 |
| 717 | Ga0501080_1715952 | 3300049742 | Unclassified | 529 |
| 718 | Ga0501081_0002697 | 3300049743 | Bacteria | 11224 |
| 719 | Ga0501081_0061625 | 3300049743 | Bacteria | 2601 |
| 720 | Ga0501081_0344888 | 3300049743 | Bacteria | 1097 |
| 721 | Ga0501083_0011641 | 3300049744 | Bacteria | 6172 |
| 722 | Ga0501083_0020149 | 3300049744 | Bacteria | 4641 |
| 723 | Ga0501083_0099304 | 3300049744 | Bacteria | 1920 |
| 724 | Ga0501035_0004148 | 3300049822 | Bacteria | 13773 |
| 725 | Ga0501035_0103459 | 3300049822 | Bacteria | 2498 |
| 726 | Ga0501044_0144461 | 3300049823 | Bacteria | 2366 |
| 727 | Ga0501044_0659097 | 3300049823 | Unclassified | 935 |
| 728 | Ga0501045_0027482 | 3300049824 | Bacteria | 4100 |
| 729 | Ga0501045_0049597 | 3300049824 | Bacteria | 3061 |
| 730 | Ga0501045_0241708 | 3300049824 | Bacteria | 1344 |
| 731 | Ga0501045_0540226 | 3300049824 | Bacteria | 865 |
| 732 | nmdc:mga07m45_446661_c1 | 3300050496 | Bacteria | 750 |
| 733 | nmdc:mga05p37_18903_c1 | 3300050507 | Bacteria | 8331 |
| 734 | nmdc:mga05p37_36234_c1 | 3300050507 | Bacteria | 6054 |
| 735 | nmdc:mga05p37_5176_c1 | 3300050507 | Bacteria | 15296 |
| 736 | nmdc:mga05p37_559034_c1 | 3300050507 | Unclassified | 1300 |
| 737 | nmdc:mga05p37_73052_c1 | 3300050507 | Bacteria | 4221 |
| 738 | nmdc:mga09592_1284842_c1 | 3300050508 | Unclassified | 602 |
| 739 | nmdc:mga0qj67_5458_c1 | 3300050509 | Bacteria | 9285 |
| 740 | nmdc:mga06r32_264645_c1 | 3300050510 | Unclassified | 1707 |
| 741 | nmdc:mga06r32_39189_c1 | 3300050510 | Bacteria | 4495 |
| 742 | nmdc:mga06r32_418015_c1 | 3300050510 | Bacteria | 1322 |
| 743 | nmdc:mga08y16_211901_c1 | 3300050511 | Bacteria | 2007 |
| 744 | nmdc:mga08y16_69846_c1 | 3300050511 | Bacteria | 3661 |
| 745 | nmdc:mga08y16_92398_c1 | 3300050511 | Bacteria | 3153 |
| 746 | nmdc:mga0n895_1102213_c1 | 3300050512 | Bacteria | 771 |
| 747 | nmdc:mga0n895_141836_c1 | 3300050512 | Bacteria | 2431 |
| 748 | nmdc:mga0n895_142054_c1 | 3300050512 | Bacteria | 2430 |
| 749 | nmdc:mga0n895_4986_c1 | 3300050512 | Bacteria | 11015 |
| 750 | nmdc:mga0n895_729809_c1 | 3300050512 | Bacteria | 985 |
| 751 | nmdc:mga0n895_89090_c1 | 3300050512 | Bacteria | 3087 |
| 752 | nmdc:mga0rr50_10747_c1 | 3300050513 | Bacteria | 5831 |
| 753 | nmdc:mga0rr50_509466_c1 | 3300050513 | Unclassified | 1024 |
| 754 | nmdc:mga0rr50_571133_c1 | 3300050513 | Bacteria | 963 |
| 755 | nmdc:mga08x19_43308_c1 | 3300050514 | Bacteria | 2872 |
| 756 | nmdc:mga08x19_608458_c1 | 3300050514 | Bacteria | 774 |
| 757 | nmdc:mga0a205_83789_c1 | 3300050515 | Bacteria | 3080 |
| 758 | nmdc:mga0a205_99090_c1 | 3300050515 | Bacteria | 2813 |
| 759 | Ga0495601_0010855 | 3300053077 | Bacteria | 5435 |
| 760 | Ga0495601_0018014 | 3300053077 | Bacteria | 4293 |
| 761 | Ga0495601_0056380 | 3300053077 | Bacteria | 2488 |
| 762 | Ga0495612_0007348 | 3300053078 | Bacteria | 4505 |
| 763 | Ga0495612_0012807 | 3300053078 | Bacteria | 3381 |
| 764 | Ga0495612_0078784 | 3300053078 | Bacteria | 1383 |
| 765 | Ga0495595_0015659 | 3300053084 | Bacteria | 3236 |
| 766 | Ga0495595_0023531 | 3300053084 | Bacteria | 2713 |
| 767 | Ga0495595_0054429 | 3300053084 | Unclassified | 1861 |
| 768 | Ga0495619_0039923 | 3300053085 | Bacteria | 3066 |
| 769 | Ga0495619_0052920 | 3300053085 | Bacteria | 2684 |
| 770 | Ga0495619_0062531 | 3300053085 | Bacteria | 2478 |
| 771 | Ga0501084_0004887 | 3300054114 | Bacteria | 10949 |
| 772 | Ga0501084_0030054 | 3300054114 | Unclassified | 4545 |
| 773 | Ga0501084_0243478 | 3300054114 | Bacteria | 1518 |
| 774 | Ga0501084_0291805 | 3300054114 | Bacteria | 1377 |
| 775 | Ga0501084_0307685 | 3300054114 | Bacteria | 1338 |
| 776 | Ga0501084_0409819 | 3300054114 | Bacteria | 1146 |
| 777 | Ga0501082_0010686 | 3300060353 | Bacteria | 7901 |
| 778 | Ga0501082_0189554 | 3300060353 | Bacteria | 1789 |
| 779 | Ga0501082_0251727 | 3300060353 | Bacteria | 1537 |
| 780 | Ga0501082_1161305 | 3300060353 | Bacteria | 675 |
| 781 | Ga0466962_0003041 | 3300061719 | Bacteria | 7999 |
| 782 | Ga0466962_0006424 | 3300061719 | Bacteria | 5643 |
| 783 | Ga0530510_0001506 | 3300061734 | Bacteria | 15662 |
| 784 | Ga0530510_0112292 | 3300061734 | Bacteria | 1997 |
| 785 | Ga0530510_0216551 | 3300061734 | Bacteria | 1423 |
| 786 | Ga0530510_1169756 | 3300061734 | Bacteria | 590 |
| 787 | Ga0501039_0821417 | |||
| 788 | JGI24744J21845_10016830 | |||
| 789 | JGI25406J46586_10009089 | |||
| 790 | Ga0070658_10037593 | |||
| 791 | Ga0070658_11032594 | |||
| 792 | Ga0070683_100000743 | |||
| 793 | Ga0070683_100104626 | |||
| 794 | Ga0070683_100344139 | |||
| 795 | Ga0070683_100696850 | |||
| 796 | Ga0068869_100902986 | |||
| 797 | Ga0070680_100003202 | |||
| 798 | Ga0070680_100402244 | |||
| 799 | Ga0070680_100806149 | |||
| 800 | Ga0070682_100005074 | |||
| 801 | Ga0070682_100008066 | |||
| 802 | Ga0070682_100148071 | |||
| 803 | Ga0068868_100133753 | |||
| 804 | Ga0068868_100559833 | |||
| 805 | Ga0070660_100032096 | |||
| 806 | Ga0070660_100585758 | |||
| 807 | Ga0070660_100649519 | |||
| 808 | Ga0070660_100917387 | |||
| 809 | Ga0070689_100019316 | |||
| 810 | Ga0070661_100241156 | |||
| 811 | Ga0070692_10492134 | |||
| 812 | Ga0070675_100278538 | |||
| 813 | Ga0070671_100284379 | |||
| 814 | Ga0070674_100310152 | |||
| 815 | Ga0070674_100381849 | |||
| 816 | Ga0070673_100184700 | |||
| 817 | Ga0070688_100050310 | |||
| 818 | Ga0070659_100472423 | |||
| 819 | Ga0070659_100690613 | |||
| 820 | Ga0070659_100778483 | |||
| 821 | Ga0070709_10008638 | |||
| 822 | Ga0070709_10414823 | |||
| 823 | Ga0070714_100011748 | |||
| 824 | Ga0070714_100050101 | |||
| 825 | Ga0070714_100126023 | |||
| 826 | Ga0070714_100234063 | |||
| 827 | Ga0070713_100130025 | |||
| 828 | Ga0070710_10001819 | |||
| 829 | Ga0070701_10003555 | |||
| 830 | Ga0070701_10607666 | |||
| 831 | Ga0070711_100192661 | |||
| 832 | Ga0070711_100491155 | |||
| 833 | Ga0070705_100149470 | |||
| 834 | Ga0070700_100375491 | |||
| 835 | Ga0070708_100098765 | |||
| 836 | Ga0070708_101919043 | |||
| 837 | Ga0070663_100077726 | |||
| 838 | Ga0070678_100003130 | |||
| 839 | Ga0070662_100096082 | |||
| 840 | Ga0070681_10006580 | |||
| 841 | Ga0070706_100134014 | |||
| 842 | Ga0070707_100001273 | |||
| 843 | Ga0070707_100051171 | |||
| 844 | Ga0070707_100282500 | |||
| 845 | Ga0070707_100439647 | |||
| 846 | Ga0070698_100112306 | |||
| 847 | Ga0070698_100668524 | |||
| 848 | Ga0070698_101371957 | |||
| 849 | Ga0070699_100018500 | |||
| 850 | Ga0070679_100003409 | |||
| 851 | Ga0070679_100303580 | |||
| 852 | Ga0070679_100340001 | |||
| 853 | Ga0070679_101446435 | |||
| 854 | Ga0070684_100000331 | |||
| 855 | Ga0070684_100136300 | |||
| 856 | Ga0070684_100217182 | |||
| 857 | Ga0070684_100492644 | |||
| 858 | Ga0070684_100989435 | |||
| 859 | Ga0070697_100048581 | |||
| 860 | Ga0070672_100621401 | |||
| 861 | Ga0070686_100100961 | |||
| 862 | Ga0070695_100493270 | |||
| 863 | Ga0070696_101136258 | |||
| 864 | Ga0070693_100129490 | |||
| 865 | Ga0070693_100832951 | |||
| 866 | Ga0068855_100597830 | |||
| 867 | Ga0070664_100775018 | |||
| 868 | Ga0070664_101154181 | |||
| 869 | Ga0068854_100588910 | |||
| 870 | Ga0068856_100009273 | |||
| 871 | Ga0068856_100075066 | |||
| 872 | Ga0068856_100138643 | |||
| 873 | Ga0068856_100355481 | |||
| 874 | Ga0068856_100634983 | |||
| 875 | Ga0070702_100000772 | |||
| 876 | Ga0070702_100546953 | |||
| 877 | Ga0068852_100444947 | |||
| 878 | Ga0068852_102542419 | |||
| 879 | Ga0068863_100103576 | |||
| 880 | Ga0068863_101794565 | |||
| 881 | Ga0068858_100233286 | |||
| 882 | Ga0081538_10000116 | |||
| 883 | Ga0081538_10002632 | |||
| 884 | Ga0081538_10004941 | |||
| 885 | Ga0081540_1013281 | |||
| 886 | Ga0081539_10000840 | |||
| 887 | Ga0070717_10042011 | |||
| 888 | Ga0070717_10058586 | |||
| 889 | Ga0070717_10435713 | |||
| 890 | Ga0075432_10035187 | |||
| 891 | Ga0075432_10111598 | |||
| 892 | Ga0070716_100350135 | |||
| 893 | Ga0070716_100983824 | |||
| 894 | Ga0070712_100004060 | |||
| 895 | Ga0070712_100020415 | |||
| 896 | Ga0070712_100044173 | |||
| 897 | Ga0070712_100046920 | |||
| 898 | Ga0070712_100475783 | |||
| 899 | Ga0097621_100014698 | |||
| 900 | Ga0097621_100215326 | |||
| 901 | Ga0097621_100339585 | |||
| 902 | Ga0097621_100451110 | |||
| 903 | Ga0068871_100853148 | |||
| 904 | Ga0075428_100005274 | |||
| 905 | Ga0075428_100022979 | |||
| 906 | Ga0075428_100080755 | |||
| 907 | Ga0075431_100033032 | |||
| 908 | Ga0075431_100039338 | |||
| 909 | Ga0075431_100579724 | |||
| 910 | Ga0075433_10039456 | |||
| 911 | Ga0075433_10673257 | |||
| 912 | Ga0075434_100001941 | |||
| 913 | Ga0075434_100008128 | |||
| 914 | Ga0075434_100203481 | |||
| 915 | Ga0068865_100250606 | |||
| 916 | Ga0075436_100014538 | |||
| 917 | Ga0075436_100101258 | |||
| 918 | Ga0075436_100885922 | |||
| 919 | Ga0075435_100044418 | |||
| 920 | Ga0075435_100059573 | |||
| 921 | Ga0105240_10205289 | |||
| 922 | Ga0111539_10036486 | |||
| 923 | Ga0111539_10106419 | |||
| 924 | Ga0111539_11599318 | |||
| 925 | Ga0105245_10000499 | |||
| 926 | Ga0105245_10009775 | |||
| 927 | Ga0105245_10332886 | |||
| 928 | Ga0105245_10440715 | |||
| 929 | Ga0105245_10553517 | |||
| 930 | Ga0105245_10589262 | |||
| 931 | Ga0105245_11140978 | |||
| 932 | Ga0105247_10194202 | |||
| 933 | Ga0114129_10001814 | |||
| 934 | Ga0114129_10006241 | |||
| 935 | Ga0114129_10403917 | |||
| 936 | Ga0114129_11918013 | |||
| 937 | Ga0105243_11361751 | |||
| 938 | Ga0105241_10006217 | |||
| 939 | Ga0105242_10150093 | |||
| 940 | Ga0105242_10167892 | |||
| 941 | Ga0105242_12614268 | |||
| 942 | Ga0105248_10022192 | |||
| 943 | Ga0105248_10740835 | |||
| 944 | Ga0105248_10978727 | |||
| 945 | Ga0105237_10869823 | |||
| 946 | Ga0105237_10906461 | |||
| 947 | Ga0105238_10116442 | |||
| 948 | Ga0105238_10528964 | |||
| 949 | Ga0105238_11324630 | |||
| 950 | Ga0105239_10215354 | |||
| 951 | Ga0105239_10328854 | |||
| 952 | Ga0105239_10411395 | |||
| 953 | Ga0105239_10615956 | |||
| 954 | Ga0105246_10164952 | |||
| 955 | Ga0105246_10323638 | |||
| 956 | Ga0157317_1005368 | |||
| 957 | Ga0157373_10653792 | |||
| 958 | Ga0157369_11692307 | |||
| 959 | Ga0157374_10030954 | |||
| 960 | Ga0157374_10120807 | |||
| 961 | Ga0157378_10341163 | |||
| 962 | Ga0163162_10095384 | |||
| 963 | Ga0163162_10309929 | |||
| 964 | Ga0163162_10800919 | |||
| 965 | Ga0157372_10284565 | |||
| 966 | Ga0157372_11626611 | |||
| 967 | Ga0157375_10927833 | |||
| 968 | Ga0157375_11914948 | |||
| 969 | Ga0157375_11979085 | |||
| 970 | Ga0157375_12265243 | |||
| 971 | Ga0163163_10261044 | |||
| 972 | Ga0163163_10563057 | |||
| 973 | Ga0157380_10060122 | |||
| 974 | Ga0157380_11343834 | |||
| 975 | Ga0182008_10004085 | |||
| 976 | Ga0182008_10089668 | |||
| 977 | Ga0157377_10014451 | |||
| 978 | Ga0157377_10333574 | |||
| 979 | Ga0157377_10427226 | |||
| 980 | Ga0157377_11081800 | |||
| 981 | Ga0157376_10285770 | |||
| 982 | Ga0157376_10362980 | |||
| 983 | Ga0157376_10630509 | |||
| 984 | Ga0157376_11135344 | |||
| 985 | Ga0182006_1008244 | |||
| 986 | Ga0182007_10007521 | |||
| 987 | Ga0163161_10105890 | |||
| 988 | Ga0206356_10024515 | |||
| 989 | Ga0206353_10593270 | |||
| 990 | Ga0206353_11070079 | |||
| 991 | Ga0207692_10659397 | |||
| 992 | Ga0207710_10101060 | |||
| 993 | Ga0207688_10065409 | |||
| 994 | Ga0207647_10060678 | |||
| 995 | Ga0207685_10107893 | |||
| 996 | Ga0207699_10127929 | |||
| 997 | Ga0207699_10879778 | |||
| 998 | Ga0207643_10454500 | |||
| 999 | Ga0207705_10048413 | |||
| 1000 | Ga0207684_10158783 | |||
| 1001 | Ga0207707_10011505 | |||
| 1002 | Ga0207707_10313100 | |||
| 1003 | Ga0207695_11086824 | |||
| 1004 | Ga0207671_10905020 | |||
| 1005 | Ga0207693_10007412 | |||
| 1006 | Ga0207693_10022305 | |||
| 1007 | Ga0207693_10031178 | |||
| 1008 | Ga0207693_10034202 | |||
| 1009 | Ga0207693_10066997 | |||
| 1010 | Ga0207693_10380077 | |||
| 1011 | Ga0207693_10421631 | |||
| 1012 | Ga0207693_10525710 | |||
| 1013 | Ga0207663_10159215 | |||
| 1014 | Ga0207663_10178368 | |||
| 1015 | Ga0207663_10736920 | |||
| 1016 | Ga0207660_10359418 | |||
| 1017 | Ga0207657_10044303 | |||
| 1018 | Ga0207657_10152325 | |||
| 1019 | Ga0207657_10337799 | |||
| 1020 | Ga0207657_10578469 | |||
| 1021 | Ga0207649_10146643 | |||
| 1022 | Ga0207652_10001137 | |||
| 1023 | Ga0207652_10267587 | |||
| 1024 | Ga0207652_11287170 | |||
| 1025 | Ga0207646_10002421 | |||
| 1026 | Ga0207646_10044713 | |||
| 1027 | Ga0207646_10208212 | |||
| 1028 | Ga0207646_10909775 | |||
| 1029 | Ga0207681_10848849 | |||
| 1030 | Ga0207694_11399382 | |||
| 1031 | Ga0207659_10926317 | |||
| 1032 | Ga0207687_10003291 | |||
| 1033 | Ga0207687_10049765 | |||
| 1034 | Ga0207687_10100789 | |||
| 1035 | Ga0207687_10682081 | |||
| 1036 | Ga0207664_10005779 | |||
| 1037 | Ga0207664_10066156 | |||
| 1038 | Ga0207664_10081174 | |||
| 1039 | Ga0207664_10108400 | |||
| 1040 | Ga0207664_10197061 | |||
| 1041 | Ga0207690_10361540 | |||
| 1042 | Ga0207686_10102075 | |||
| 1043 | Ga0207686_10197420 | |||
| 1044 | Ga0207704_10398529 | |||
| 1045 | Ga0207704_10967567 | |||
| 1046 | Ga0207665_10459007 | |||
| 1047 | Ga0207691_10066192 | |||
| 1048 | Ga0207661_10019903 | |||
| 1049 | Ga0207661_10117192 | |||
| 1050 | Ga0207661_10156730 | |||
| 1051 | Ga0207661_11023679 | |||
| 1052 | Ga0207679_10077802 | |||
| 1053 | Ga0207679_10748570 | |||
| 1054 | Ga0207679_11782747 | |||
| 1055 | Ga0207667_11405457 | |||
| 1056 | Ga0207640_10310709 | |||
| 1057 | Ga0207658_10702721 | |||
| 1058 | Ga0207677_10118854 | |||
| 1059 | Ga0207678_10083180 | |||
| 1060 | Ga0207678_10198421 | |||
| 1061 | Ga0207708_10002065 | |||
| 1062 | Ga0207708_10438306 | |||
| 1063 | Ga0207708_11711494 | |||
| 1064 | Ga0207702_10007123 | |||
| 1065 | Ga0207702_10126471 | |||
| 1066 | Ga0207702_10607363 | |||
| 1067 | Ga0207702_10825268 | |||
| 1068 | Ga0207641_10075389 | |||
| 1069 | Ga0207674_10099425 | |||
| 1070 | Ga0207674_11569270 | |||
| 1071 | Ga0207674_11979452 | |||
| 1072 | Ga0207675_101382541 | |||
| 1073 | Ga0207683_10002467 | |||
| 1074 | Ga0207683_10024660 | |||
| 1075 | Ga0207698_11294700 | |||
| 1076 | Ga0207428_10008352 | |||
| 1077 | Ga0207428_10056739 | |||
| 1078 | Ga0207428_10215323 | |||
| 1079 | Ga0268266_10496101 | |||
| 1080 | Ga0268265_11044306 | |||
| 1081 | Ga0265319_1063777 | |||
| 1082 | Ga0265334_10144269 | |||
| 1083 | Ga0265318_10041796 | |||
| 1084 | Ga0265338_10049709 | |||
| 1085 | Ga0265338_10068117 | |||
| 1086 | Ga0265338_10122295 | |||
| 1087 | Ga0265338_10131954 | |||
| 1088 | Ga0265332_10144245 | |||
| 1089 | Ga0265320_10044762 | |||
| 1090 | Ga0265339_10013897 | |||
| 1091 | Ga0265331_10002389 | |||
| 1092 | Ga0265331_10084398 | |||
| 1093 | Ga0265316_10104349 | |||
| 1094 | Ga0265313_10000079 | |||
| 1095 | Ga0265314_10014243 | |||
| 1096 | Ga0265314_10018093 | |||
| 1097 | Ga0265342_10030080 | |||
| 1098 | Ga0265342_10231408 | |||
| 1099 | Ga0307406_11100966 | |||
| 1100 | Ga0307416_100270025 | |||
| 1101 | Ga0373944_0005132 | |||
| 1102 | Ga0373939_0062398 | |||
| 1103 | Ga0373960_0028199 | |||
| 1104 | Ga0373946_0388415 | |||
| 1105 | Ga0373955_0560039 | |||
| 1106 | Ga0373942_0016327 | |||
| 1107 | Ga0373947_1179984 | |||
| 1108 | Ga0373937_0309752 | |||
| 1109 | Ga0395899_0208807 | |||
| 1110 | Ga0395899_0347258 | |||
| 1111 | Ga0395900_0036646 | |||
| 1112 | Ga0395900_0057702 | |||
| 1113 | Ga0395900_0102148 | |||
| 1114 | Ga0395900_0125708 | |||
| 1115 | Ga0395900_0141996 | |||
| 1116 | Ga0395900_0207769 | |||
| 1117 | Ga0395900_0311626 | |||
| 1118 | Ga0395900_0696999 | |||
| 1119 | Ga0395900_0762359 | |||
| 1120 | Ga0395900_0848088 | |||
| 1121 | Ga0395898_0007289 | |||
| 1122 | Ga0395898_0032534 | |||
| 1123 | Ga0395898_0036354 | |||
| 1124 | Ga0395898_0046089 | |||
| 1125 | Ga0395898_0083255 | |||
| 1126 | Ga0395898_0213695 | |||
| 1127 | Ga0395898_0839084 | |||
| 1128 | Ga0395898_1021261 | |||
| 1129 | Ga0395905_0003639 | |||
| 1130 | Ga0395905_0057384 | |||
| 1131 | Ga0395905_0088822 | |||
| 1132 | Ga0395905_0252053 | |||
| 1133 | Ga0395905_0398625 | |||
| 1134 | Ga0395905_0922527 | |||
| 1135 | Ga0395901_0023034 | |||
| 1136 | Ga0395901_0114916 | |||
| 1137 | Ga0395901_0138741 | |||
| 1138 | Ga0395901_0161710 | |||
| 1139 | Ga0395901_0170458 | |||
| 1140 | Ga0395901_0198365 | |||
| 1141 | Ga0395901_0201522 | |||
| 1142 | Ga0395901_0237349 | |||
| 1143 | Ga0395901_0684929 | |||
| 1144 | Ga0395901_0764020 | |||
| 1145 | Ga0395901_0932015 | |||
| 1146 | Ga0395901_1181906 | |||
| 1147 | Ga0395901_1559005 | |||
| 1148 | Ga0451853_0125869 | |||
| 1149 | Ga0451853_1097714 | |||
| 1150 | Ga0466969_0003156 | |||
| 1151 | Ga0466969_0119486 | |||
| 1152 | Ga0466965_0028061 | |||
| 1153 | Ga0466965_0741387 | |||
| 1154 | Ga0466966_0007964 | |||
| 1155 | Ga0466966_0159014 | |||
| 1156 | Ga0466961_0002499 | |||
| 1157 | Ga0466961_0039290 | |||
| 1158 | Ga0466961_0055770 | |||
| 1159 | Ga0466961_0067042 | |||
| 1160 | Ga0466961_0330236 | |||
| 1161 | Ga0466963_0000708 | |||
| 1162 | Ga0466963_0002922 | |||
| 1163 | Ga0466963_0014391 | |||
| 1164 | Ga0466963_0043355 | |||
| 1165 | Ga0466963_0168411 | |||
| 1166 | Ga0466963_0560343 | |||
| 1167 | Ga0466964_0001239 | |||
| 1168 | Ga0466964_0003090 | |||
| 1169 | Ga0466964_0004061 | |||
| 1170 | Ga0466964_0018430 | |||
| 1171 | Ga0466964_0028944 | |||
| 1172 | Ga0466964_0603765 | |||
| 1173 | Ga0466971_0001732 | |||
| 1174 | Ga0466968_0000973 | |||
| 1175 | Ga0466968_0017577 | |||
| 1176 | Ga0466968_0179692 | |||
| 1177 | Ga0466968_0194945 | |||
| 1178 | Ga0466970_0006853 | |||
| 1179 | Ga0466957_0005364 | |||
| 1180 | Ga0466957_0008149 | |||
| 1181 | Ga0466957_0010927 | |||
| 1182 | Ga0466957_0138166 | |||
| 1183 | Ga0466957_0399120 | |||
| 1184 | Ga0466957_0445467 | |||
| 1185 | Ga0466960_0013583 | |||
| 1186 | Ga0466960_0014013 | |||
| 1187 | Ga0466960_0130515 | |||
| 1188 | Ga0466960_0383945 | |||
| 1189 | Ga0466959_0004476 | |||
| 1190 | Ga0466959_0004730 | |||
| 1191 | Ga0466959_0030254 | |||
| 1192 | Ga0466959_0046432 | |||
| 1193 | Ga0466959_0118172 | |||
| 1194 | Ga0466959_0130906 | |||
| 1195 | Ga0466959_0477692 | |||
| 1196 | Ga0451576_0153814 | |||
| 1197 | Ga0451576_1822756 | |||
| 1198 | Ga0466958_0003062 | |||
| 1199 | Ga0466958_0006780 | |||
| 1200 | Ga0466958_0007980 | |||
| 1201 | Ga0466958_0016026 | |||
| 1202 | Ga0466958_0023004 | |||
| 1203 | Ga0466958_0023888 | |||
| 1204 | Ga0466958_0033920 | |||
| 1205 | Ga0466958_0089962 | |||
| 1206 | Ga0466958_0100516 | |||
| 1207 | Ga0466967_0000724 | |||
| 1208 | Ga0466967_0001136 | |||
| 1209 | Ga0466967_0002143 | |||
| 1210 | Ga0466967_0008248 | |||
| 1211 | Ga0466967_0047040 | |||
| 1212 | Ga0466967_0072144 | |||
| 1213 | Ga0466967_0105771 | |||
| 1214 | Ga0466967_0121606 | |||
| 1215 | Ga0466967_0249020 | |||
| 1216 | Ga0466967_0303291 | |||
| 1217 | Ga0466967_0541609 | |||
| 1218 | Ga0466967_0682941 | |||
| 1219 | Ga0466967_0775299 | |||
| 1220 | Ga0466967_0915972 | |||
| 1221 | Ga0466967_1854741 | |||
| 1222 | Ga0466967_1931024 | |||
| 1223 | Ga0466967_2246894 | |||
| 1224 | Ga0495592_0019587 | |||
| 1225 | Ga0495603_0007573 | |||
| 1226 | Ga0495603_0222706 | |||
| 1227 | Ga0495603_0555752 | |||
| 1228 | Ga0495629_0126716 | |||
| 1229 | Ga0495641_0030633 | |||
| 1230 | Ga0495641_0031387 | |||
| 1231 | Ga0495641_0181036 | |||
| 1232 | Ga0495651_0494842 | |||
| 1233 | Ga0495653_0064460 | |||
| 1234 | Ga0495653_0199873 | |||
| 1235 | Ga0495580_0141919 | |||
| 1236 | Ga0495580_0533018 | |||
| 1237 | Ga0495582_0075788 | |||
| 1238 | Ga0495582_0124808 | |||
| 1239 | Ga0495639_0033196 | |||
| 1240 | Ga0495662_0163084 | |||
| 1241 | Ga0495664_0176451 | |||
| 1242 | Ga0495585_0399780 | |||
| 1243 | Ga0495594_0072563 | |||
| 1244 | Ga0495596_0099476 | |||
| 1245 | Ga0495608_0038050 | |||
| 1246 | Ga0495608_0291708 | |||
| 1247 | Ga0495618_0169533 | |||
| 1248 | Ga0495618_0177483 | |||
| 1249 | Ga0495618_0494868 | |||
| 1250 | Ga0495628_0084449 | |||
| 1251 | Ga0495630_0030750 | |||
| 1252 | Ga0495630_0040249 | |||
| 1253 | Ga0495630_0087466 | |||
| 1254 | Ga0495630_0208811 | |||
| 1255 | Ga0495663_0143960 | |||
| 1256 | Ga0495666_0051206 | |||
| 1257 | Ga0495666_0171358 | |||
| 1258 | Ga0495665_0280867 | |||
| 1259 | Ga0495665_0373795 | |||
| 1260 | Ga0495640_0042413 | |||
| 1261 | Ga0495640_0086303 | |||
| 1262 | Ga0495640_0395671 | |||
| 1263 | Ga0495587_0077554 | |||
| 1264 | Ga0495645_0458750 | |||
| 1265 | Ga0495667_0002340 | |||
| 1266 | Ga0495667_0224014 | |||
| 1267 | Ga0495656_0075014 | |||
| 1268 | Ga0495656_0104758 | |||
| 1269 | Ga0495656_0255290 | |||
| 1270 | Ga0495668_0260805 | |||
| 1271 | Ga0495634_0039726 | |||
| 1272 | Ga0495634_0049930 | |||
| 1273 | Ga0495634_0079591 | |||
| 1274 | Ga0495634_0113615 | |||
| 1275 | Ga0495634_0391091 | |||
| 1276 | Ga0495635_0036782 | |||
| 1277 | Ga0495635_0089730 | |||
| 1278 | Ga0495635_0298632 | |||
| 1279 | Ga0495588_0048975 | |||
| 1280 | Ga0495588_0252807 | |||
| 1281 | Ga0495657_0066832 | |||
| 1282 | Ga0495657_0664084 | |||
| 1283 | Ga0495599_0395434 | |||
| 1284 | Ga0495646_0073097 | |||
| 1285 | Ga0495646_0379069 | |||
| 1286 | Ga0495647_0196017 | |||
| 1287 | Ga0495658_0409041 | |||
| 1288 | Ga0495669_0152036 | |||
| 1289 | Ga0495613_0109095 | |||
| 1290 | Ga0495624_0029778 | |||
| 1291 | Ga0495624_0540841 | |||
| 1292 | Ga0495670_0525096 | |||
| 1293 | Ga0495581_0046330 | |||
| 1294 | Ga0495581_0355458 | |||
| 1295 | Ga0495604_0105620 | |||
| 1296 | Ga0495674_0020877 | |||
| 1297 | Ga0495674_0022708 | |||
| 1298 | Ga0495674_0060813 | |||
| 1299 | Ga0495674_0102632 | |||
| 1300 | Ga0495676_0018502 | |||
| 1301 | Ga0495676_0113508 | |||
| 1302 | Ga0495680_0001666 | |||
| 1303 | Ga0495680_0025593 | |||
| 1304 | Ga0495680_0763220 | |||
| 1305 | Ga0495683_0259857 | |||
| 1306 | Ga0495675_0093386 | |||
| 1307 | Ga0495677_0030079 | |||
| 1308 | Ga0495684_0005868 | |||
| 1309 | Ga0495684_0108745 | |||
| 1310 | Ga0495684_0367595 | |||
| 1311 | Ga0495593_0111518 | |||
| 1312 | Ga0495593_0309122 | |||
| 1313 | Ga0495614_0454361 | |||
| 1314 | Ga0496100_0005437 | |||
| 1315 | Ga0496100_0041717 | |||
| 1316 | Ga0496100_0154774 | |||
| 1317 | Ga0496100_0352338 | |||
| 1318 | Ga0496100_0592481 | |||
| 1319 | Ga0496100_0994064 | |||
| 1320 | Ga0496101_0016236 | |||
| 1321 | Ga0496101_0074693 | |||
| 1322 | Ga0496101_0142218 | |||
| 1323 | Ga0496101_0143455 | |||
| 1324 | Ga0496101_0284245 | |||
| 1325 | Ga0496101_0314999 | |||
| 1326 | Ga0496101_0411686 | |||
| 1327 | Ga0496101_0415876 | |||
| 1328 | Ga0496101_1242472 | |||
| 1329 | Ga0496102_0007721 | |||
| 1330 | Ga0496102_0117880 | |||
| 1331 | Ga0496102_0175401 | |||
| 1332 | Ga0496102_0261344 | |||
| 1333 | Ga0496102_0324391 | |||
| 1334 | Ga0496103_0010969 | |||
| 1335 | Ga0496103_0096402 | |||
| 1336 | Ga0496103_0135952 | |||
| 1337 | Ga0496103_0972646 | |||
| 1338 | Ga0496104_0026073 | |||
| 1339 | Ga0496104_0028441 | |||
| 1340 | Ga0496104_0068366 | |||
| 1341 | Ga0496104_0271195 | |||
| 1342 | Ga0496104_0314815 | |||
| 1343 | Ga0496104_0882625 | |||
| 1344 | Ga0496105_0019277 | |||
| 1345 | Ga0496105_0028767 | |||
| 1346 | Ga0496105_0036529 | |||
| 1347 | Ga0496105_0037713 | |||
| 1348 | Ga0496105_0147147 | |||
| 1349 | Ga0496105_0155564 | |||
| 1350 | Ga0496105_0190285 | |||
| 1351 | Ga0496105_0267618 | |||
| 1352 | Ga0496105_0286138 | |||
| 1353 | Ga0496105_0298217 | |||
| 1354 | Ga0496106_0005815 | |||
| 1355 | Ga0496106_0170606 | |||
| 1356 | Ga0496106_0230054 | |||
| 1357 | Ga0496106_0489666 | |||
| 1358 | Ga0496106_0636857 | |||
| 1359 | Ga0496106_1094023 | |||
| 1360 | Ga0496107_0003984 | |||
| 1361 | Ga0496107_0041602 | |||
| 1362 | Ga0496107_0042495 | |||
| 1363 | Ga0496107_0053936 | |||
| 1364 | Ga0496107_0107065 | |||
| 1365 | Ga0496107_0179720 | |||
| 1366 | Ga0496107_0265702 | |||
| 1367 | Ga0496107_0337644 | |||
| 1368 | Ga0496107_0596270 | |||
| 1369 | Ga0496108_0014563 | |||
| 1370 | Ga0496108_0072847 | |||
| 1371 | Ga0496108_0141546 | |||
| 1372 | Ga0496108_0171325 | |||
| 1373 | Ga0496108_0183906 | |||
| 1374 | Ga0496109_0015200 | |||
| 1375 | Ga0496109_0057879 | |||
| 1376 | Ga0496109_0105965 | |||
| 1377 | Ga0496109_0143335 | |||
| 1378 | Ga0496109_0832679 | |||
| 1379 | Ga0496109_0944263 | |||
| 1380 | Ga0496110_0035464 | |||
| 1381 | Ga0496110_0039329 | |||
| 1382 | Ga0496110_0096751 | |||
| 1383 | Ga0496110_0159366 | |||
| 1384 | Ga0496110_0172801 | |||
| 1385 | Ga0496111_0010854 | |||
| 1386 | Ga0496111_0051111 | |||
| 1387 | Ga0496111_0184324 | |||
| 1388 | Ga0496111_0386636 | |||
| 1389 | Ga0496111_0415857 | |||
| 1390 | Ga0496112_0068160 | |||
| 1391 | Ga0496112_0182900 | |||
| 1392 | Ga0496112_0183341 | |||
| 1393 | Ga0496112_0225303 | |||
| 1394 | Ga0496112_0234008 | |||
| 1395 | Ga0496112_0336850 | |||
| 1396 | Ga0496112_0489198 | |||
| 1397 | Ga0496112_0671335 | |||
| 1398 | Ga0496112_0962164 | |||
| 1399 | Ga0496113_0153866 | |||
| 1400 | Ga0496113_0155626 | |||
| 1401 | Ga0496113_0364554 | |||
| 1402 | Ga0496113_0447155 | |||
| 1403 | Ga0496113_0532439 | |||
| 1404 | Ga0496113_0793059 | |||
| 1405 | Ga0496114_0000738 | |||
| 1406 | Ga0496114_0001824 | |||
| 1407 | Ga0496114_0007449 | |||
| 1408 | Ga0496114_0012587 | |||
| 1409 | Ga0496114_0111423 | |||
| 1410 | Ga0496114_0118060 | |||
| 1411 | Ga0496114_0132203 | |||
| 1412 | Ga0496114_0179627 | |||
| 1413 | Ga0496114_0363380 | |||
| 1414 | Ga0496114_0369513 | |||
| 1415 | Ga0496114_1025633 | |||
| 1416 | Ga0496115_0006958 | |||
| 1417 | Ga0496115_0033805 | |||
| 1418 | Ga0496115_0053391 | |||
| 1419 | Ga0496115_0065465 | |||
| 1420 | Ga0496115_0089006 | |||
| 1421 | Ga0496115_0094265 | |||
| 1422 | Ga0496115_0353627 | |||
| 1423 | Ga0496115_0356297 | |||
| 1424 | Ga0501031_0022549 | |||
| 1425 | Ga0501031_0120194 | |||
| 1426 | Ga0501032_0105246 | |||
| 1427 | Ga0501033_0079739 | |||
| 1428 | Ga0501036_0002956 | |||
| 1429 | Ga0501036_0024992 | |||
| 1430 | Ga0501036_0028630 | |||
| 1431 | Ga0501036_0098053 | |||
| 1432 | Ga0501037_0042490 | |||
| 1433 | Ga0501038_0009245 | |||
| 1434 | Ga0501038_0596238 | |||
| 1435 | Ga0501039_0004859 | |||
| 1436 | Ga0501039_0417990 | |||
| 1437 | Ga0501039_1052758 | |||
| 1438 | Ga0501040_0004267 | |||
| 1439 | Ga0501040_0064790 | |||
| 1440 | Ga0501040_0710737 | |||
| 1441 | Ga0501041_0096302 | |||
| 1442 | Ga0501041_0217575 | |||
| 1443 | Ga0501042_0000705 | |||
| 1444 | Ga0501042_0002132 | |||
| 1445 | Ga0501042_0286847 | |||
| 1446 | Ga0501043_0176078 | |||
| 1447 | Ga0501043_0777290 | |||
| 1448 | Ga0501043_0805651 | |||
| 1449 | Ga0501046_0150605 | |||
| 1450 | Ga0501047_0151168 | |||
| 1451 | Ga0501047_0236102 | |||
| 1452 | Ga0501047_0439236 | |||
| 1453 | Ga0501048_0006802 | |||
| 1454 | Ga0501048_0021655 | |||
| 1455 | Ga0501048_0429647 | |||
| 1456 | Ga0501067_0032930 | |||
| 1457 | Ga0501067_0034045 | |||
| 1458 | Ga0501067_0054767 | |||
| 1459 | Ga0501068_0002477 | |||
| 1460 | Ga0501068_0115584 | |||
| 1461 | Ga0501069_0001978 | |||
| 1462 | Ga0501069_0094125 | |||
| 1463 | Ga0501069_0176705 | |||
| 1464 | Ga0501070_0007718 | |||
| 1465 | Ga0501070_0021104 | |||
| 1466 | Ga0501070_0126755 | |||
| 1467 | Ga0501071_0016021 | |||
| 1468 | Ga0501071_0053561 | |||
| 1469 | Ga0501071_0067322 | |||
| 1470 | Ga0501071_0077372 | |||
| 1471 | Ga0501072_0009496 | |||
| 1472 | Ga0501072_0016046 | |||
| 1473 | Ga0501072_0020916 | |||
| 1474 | Ga0501072_0081216 | |||
| 1475 | Ga0501072_0518318 | |||
| 1476 | Ga0501073_0053229 | |||
| 1477 | Ga0501074_0003699 | |||
| 1478 | Ga0501074_0060397 | |||
| 1479 | Ga0501074_0181025 | |||
| 1480 | Ga0501074_0268687 | |||
| 1481 | Ga0501075_0018650 | |||
| 1482 | Ga0501075_0077919 | |||
| 1483 | Ga0501075_0601482 | |||
| 1484 | Ga0501076_0100415 | |||
| 1485 | Ga0501076_0164683 | |||
| 1486 | Ga0501076_0295922 | |||
| 1487 | Ga0501076_0628928 | |||
| 1488 | Ga0501076_0685720 | |||
| 1489 | Ga0501077_0001990 | |||
| 1490 | Ga0501077_0016106 | |||
| 1491 | Ga0501077_0059144 | |||
| 1492 | Ga0501077_0107966 | |||
| 1493 | Ga0501079_0002900 | |||
| 1494 | Ga0501079_0011433 | |||
| 1495 | Ga0501079_0095808 | |||
| 1496 | Ga0501079_0195407 | |||
| 1497 | Ga0501080_0001672 | |||
| 1498 | Ga0501080_0040889 | |||
| 1499 | Ga0501080_0305536 | |||
| 1500 | Ga0501080_0555757 | |||
| 1501 | Ga0501080_0577234 | |||
| 1502 | Ga0501080_0653036 | |||
| 1503 | Ga0501080_1715952 | |||
| 1504 | Ga0501081_0002697 | |||
| 1505 | Ga0501081_0061625 | |||
| 1506 | Ga0501081_0344888 | |||
| 1507 | Ga0501083_0011641 | |||
| 1508 | Ga0501083_0020149 | |||
| 1509 | Ga0501083_0099304 | |||
| 1510 | Ga0501035_0004148 | |||
| 1511 | Ga0501035_0103459 | |||
| 1512 | Ga0501044_0144461 | |||
| 1513 | Ga0501044_0659097 | |||
| 1514 | Ga0501045_0027482 | |||
| 1515 | Ga0501045_0049597 | |||
| 1516 | Ga0501045_0241708 | |||
| 1517 | Ga0501045_0540226 | |||
| 1518 | nmdc:mga07m45_446661_c1 | |||
| 1519 | nmdc:mga05p37_18903_c1 | |||
| 1520 | nmdc:mga05p37_36234_c1 | |||
| 1521 | nmdc:mga05p37_5176_c1 | |||
| 1522 | nmdc:mga05p37_559034_c1 | |||
| 1523 | nmdc:mga05p37_73052_c1 | |||
| 1524 | nmdc:mga09592_1284842_c1 | |||
| 1525 | nmdc:mga0qj67_5458_c1 | |||
| 1526 | nmdc:mga06r32_264645_c1 | |||
| 1527 | nmdc:mga06r32_39189_c1 | |||
| 1528 | nmdc:mga06r32_418015_c1 | |||
| 1529 | nmdc:mga08y16_211901_c1 | |||
| 1530 | nmdc:mga08y16_69846_c1 | |||
| 1531 | nmdc:mga08y16_92398_c1 | |||
| 1532 | nmdc:mga0n895_1102213_c1 | |||
| 1533 | nmdc:mga0n895_141836_c1 | |||
| 1534 | nmdc:mga0n895_142054_c1 | |||
| 1535 | nmdc:mga0n895_4986_c1 | |||
| 1536 | nmdc:mga0n895_729809_c1 | |||
| 1537 | nmdc:mga0n895_89090_c1 | |||
| 1538 | nmdc:mga0rr50_10747_c1 | |||
| 1539 | nmdc:mga0rr50_509466_c1 | |||
| 1540 | nmdc:mga0rr50_571133_c1 | |||
| 1541 | nmdc:mga08x19_43308_c1 | |||
| 1542 | nmdc:mga08x19_608458_c1 | |||
| 1543 | nmdc:mga0a205_83789_c1 | |||
| 1544 | nmdc:mga0a205_99090_c1 | |||
| 1545 | Ga0495601_0010855 | |||
| 1546 | Ga0495601_0018014 | |||
| 1547 | Ga0495601_0056380 | |||
| 1548 | Ga0495612_0007348 | |||
| 1549 | Ga0495612_0012807 | |||
| 1550 | Ga0495612_0078784 | |||
| 1551 | Ga0495595_0015659 | |||
| 1552 | Ga0495595_0023531 | |||
| 1553 | Ga0495595_0054429 | |||
| 1554 | Ga0495619_0039923 | |||
| 1555 | Ga0495619_0052920 | |||
| 1556 | Ga0495619_0062531 | |||
| 1557 | Ga0501084_0004887 | |||
| 1558 | Ga0501084_0030054 | |||
| 1559 | Ga0501084_0243478 | |||
| 1560 | Ga0501084_0291805 | |||
| 1561 | Ga0501084_0307685 | |||
| 1562 | Ga0501084_0409819 | |||
| 1563 | Ga0501082_0010686 | |||
| 1564 | Ga0501082_0189554 | |||
| 1565 | Ga0501082_0251727 | |||
| 1566 | Ga0501082_1161305 | |||
| 1567 | Ga0466962_0003041 | |||
| 1568 | Ga0466962_0006424 | |||
| 1569 | Ga0530510_0001506 | |||
| 1570 | Ga0530510_0112292 | |||
| 1571 | Ga0530510_0216551 | |||
| 1572 | Ga0530510_1169756 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8855 | 5 | 137 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8097 | 5 | 137 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7483 | 7 | 107 |
| 3ku0-assembly2.cif.gz_B | structure of gap31 with adenine at its binding pocket | 0.7065 | 58 | 90 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.6999 | 7 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.7733 | 5 | 134 | 3.90.1590.10 |
| af_A0A1D6EPM0_14_114_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7651 | 7 | 104 | 2.170.150.70 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.7375 | 5 | 134 | 3.90.1590.10 |
| af_K7MPT9_9_124_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7332 | 8 | 114 | 2.170.150.70 |
| af_A0A0P0X332_29_163_3.40.420.10 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.7281 | 60 | 88 | 3.40.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0WGL9-F1-model_v4 | deleted | 0.9722 | 3 | 156 |
|
| AF-A0A627Z5T9-F1-model_v4 | Aldehyde-activating protein | 0.9718 | 7 | 155 |
GO:0016846
GO:0046872 |
| AF-A0A534BLW2-F1-model_v4 | GFA family protein | 0.9707 | 6 | 125 |
GO:0016846
GO:0046872 |
| AF-A0A534CBF8-F1-model_v4 | GFA family protein | 0.9703 | 4 | 156 |
GO:0016846
GO:0046872 |
| AF-A0A6P2FQ69-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9686 | 1 | 160 |
GO:0016846
GO:0046872 |