F480786

General Info

Members Datasets Scaffolds Average Seq Length
786 345 1572 155

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10197484|Ga0207706_101974841
Length 184
Sequence MLRLKILASVVPLAVAALFARGEFLVGQRPCIEIAGRSVQIATLSWQAHRHVSFTSDPGRATVRVQISDSADAADFTVIDDVDTAESGACESNSPPALVAISGKPGEGDPVIYLTRDGPADYRIFVSSKSFSVRDAAALIVGARGQHHRVEAASLSILEHGLRANAFRVCREGKPASTFPGHAG

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
205 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
306 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
311 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
312 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
319 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
320 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
321 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
322 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
332 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
333 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
334 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
335 2791355199
336 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
337 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
338 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
339 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
340 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
341 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
342 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
343 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
344 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
345 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 1.27
Rhizoplane 7.51
Rhizosphere 73.41
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10197484 3300025933 Bacteria 1764
2 rootH2_10104916 3300003320 Bacteria 2516
3 rootL2_10144200 3300003322 Bacteria 1811
4 JGI25404J52841_10021953 3300003659 Bacteria 1381
5 Ga0070658_10495004 3300005327 Bacteria 1055
6 Ga0070676_10155196 3300005328 Bacteria 1469
7 Ga0070676_11003131 3300005328 Bacteria 627
8 Ga0070683_100386523 3300005329 Bacteria 1334
9 Ga0070690_100056075 3300005330 Bacteria 2525
10 Ga0070690_100319261 3300005330 Bacteria 1119
11 Ga0070690_100697566 3300005330 Bacteria 779
12 Ga0070670_100101019 3300005331 Bacteria 2483
13 Ga0068869_100050231 3300005334 Bacteria 3022
14 Ga0068869_100058856 3300005334 Bacteria 2811
15 Ga0070666_10093735 3300005335 Bacteria 2065
16 Ga0070666_10267595 3300005335 Bacteria 1213
17 Ga0070666_10913934 3300005335 Bacteria 649
18 Ga0070680_101447424 3300005336 Bacteria 595
19 Ga0070682_100162240 3300005337 Bacteria 1545
20 Ga0068868_100052909 3300005338 Bacteria 3197
21 Ga0068868_100260799 3300005338 Bacteria 1461
22 Ga0068868_100341923 3300005338 Bacteria 1280
23 Ga0068868_100483960 3300005338 Bacteria 1082
24 Ga0068868_101067994 3300005338 Bacteria 741
25 Ga0070660_100603394 3300005339 Bacteria 918
26 Ga0070689_100417446 3300005340 Bacteria 1137
27 Ga0070689_100870624 3300005340 Bacteria 796
28 Ga0070687_100353829 3300005343 Bacteria 949
29 Ga0070687_100579408 3300005343 Bacteria 768
30 Ga0070661_100171457 3300005344 Bacteria 1648
31 Ga0070661_100210671 3300005344 Bacteria 1487
32 Ga0070661_100283003 3300005344 Bacteria 1287
33 Ga0070661_100363693 3300005344 Bacteria 1137
34 Ga0070661_100466839 3300005344 Bacteria 1006
35 Ga0070668_100062410 3300005347 Bacteria 2887
36 Ga0070668_100066909 3300005347 Bacteria 2789
37 Ga0070668_100175674 3300005347 Bacteria 1746
38 Ga0070668_100182406 3300005347 Bacteria 1715
39 Ga0070668_100836420 3300005347 Bacteria 820
40 Ga0070669_100252431 3300005353 Bacteria 1405
41 Ga0070669_100277603 3300005353 Bacteria 1342
42 Ga0070675_100395138 3300005354 Bacteria 1233
43 Ga0070675_100595130 3300005354 Bacteria 1003
44 Ga0070675_100634740 3300005354 Bacteria 970
45 Ga0070675_101528615 3300005354 Bacteria 616
46 Ga0070671_100115922 3300005355 Bacteria 2252
47 Ga0070671_100534927 3300005355 Bacteria 1010
48 Ga0070674_100167286 3300005356 Bacteria 1673
49 Ga0070674_100316513 3300005356 Bacteria 1250
50 Ga0070674_100446419 3300005356 Bacteria 1067
51 Ga0070674_100723884 3300005356 Bacteria 853
52 Ga0070673_100289473 3300005364 Bacteria 1439
53 Ga0070673_100359545 3300005364 Bacteria 1294
54 Ga0070659_100148359 3300005366 Bacteria 1912
55 Ga0070659_100429066 3300005366 Bacteria 1119
56 Ga0070659_101395384 3300005366 Bacteria 623
57 Ga0070667_100060591 3300005367 Bacteria 3202
58 Ga0070667_101251627 3300005367 Bacteria 695
59 Ga0070667_101459083 3300005367 Bacteria 642
60 Ga0070710_10086088 3300005437 Bacteria 1845
61 Ga0070710_10662303 3300005437 Bacteria 733
62 Ga0070701_10369462 3300005438 Bacteria 901
63 Ga0070711_100023422 3300005439 Bacteria 4015
64 Ga0070700_100149576 3300005441 Bacteria 1595
65 Ga0070700_100150235 3300005441 Bacteria 1592
66 Ga0070700_100552038 3300005441 Bacteria 895
67 Ga0070663_100012307 3300005455 Bacteria 5407
68 Ga0070663_100073868 3300005455 Bacteria 2488
69 Ga0070663_100078350 3300005455 Bacteria 2422
70 Ga0070663_100235132 3300005455 Bacteria 1444
71 Ga0070678_100031128 3300005456 Bacteria 3676
72 Ga0070678_100093597 3300005456 Bacteria 2311
73 Ga0070678_100103337 3300005456 Bacteria 2213
74 Ga0070678_101579375 3300005456 Bacteria 616
75 Ga0070662_100222143 3300005457 Bacteria 1508
76 Ga0070662_100390710 3300005457 Bacteria 1147
77 Ga0070706_100316926 3300005467 Bacteria 1455
78 Ga0070684_101944343 3300005535 Bacteria 555
79 Ga0068853_100170181 3300005539 Bacteria 1971
80 Ga0068853_100225066 3300005539 Bacteria 1714
81 Ga0070672_100270710 3300005543 Bacteria 1434
82 Ga0070672_100670420 3300005543 Bacteria 907
83 Ga0070672_100827451 3300005543 Bacteria 815
84 Ga0070686_100020047 3300005544 Bacteria 3953
85 Ga0070695_100732684 3300005545 Bacteria 787
86 Ga0070696_100058612 3300005546 Bacteria 2689
87 Ga0070665_100004203 3300005548 Bacteria 15155
88 Ga0070665_100009471 3300005548 Bacteria 9855
89 Ga0070665_100077521 3300005548 Bacteria 3330
90 Ga0070665_100112322 3300005548 Bacteria 2727
91 Ga0070665_100124827 3300005548 Bacteria 2576
92 Ga0070665_100151199 3300005548 Bacteria 2324
93 Ga0070665_100184209 3300005548 Bacteria 2089
94 Ga0070665_100227808 3300005548 Bacteria 1864
95 Ga0070665_100305738 3300005548 Bacteria 1593
96 Ga0070665_100577963 3300005548 Bacteria 1136
97 Ga0070665_101698096 3300005548 Bacteria 639
98 Ga0068855_100102902 3300005563 Bacteria 3287
99 Ga0068855_100699865 3300005563 Bacteria 1084
100 Ga0068855_101015023 3300005563 Bacteria 871
101 Ga0070664_100057841 3300005564 Bacteria 3297
102 Ga0070664_100819432 3300005564 Bacteria 871
103 Ga0070664_100929488 3300005564 Bacteria 816
104 Ga0070664_101620012 3300005564 Bacteria 613
105 Ga0068857_100431555 3300005577 Bacteria 1230
106 Ga0068856_100043240 3300005614 Bacteria 4433
107 Ga0068856_100412336 3300005614 Bacteria 1371
108 Ga0068856_100629511 3300005614 Bacteria 1093
109 Ga0068856_101095015 3300005614 Bacteria 814
110 Ga0068852_100189509 3300005616 Bacteria 1939
111 Ga0068852_100278437 3300005616 Bacteria 1612
112 Ga0068852_100906621 3300005616 Bacteria 899
113 Ga0068852_101108698 3300005616 Bacteria 812
114 Ga0068859_100066012 3300005617 Bacteria 3653
115 Ga0068859_100172003 3300005617 Bacteria 2247
116 Ga0068859_100609553 3300005617 Bacteria 1184
117 Ga0068864_100028662 3300005618 Bacteria 4709
118 Ga0068864_100059050 3300005618 Bacteria 3317
119 Ga0068864_101977029 3300005618 Bacteria 589
120 Ga0068866_10067059 3300005718 Bacteria 1883
121 Ga0068866_10072159 3300005718 Bacteria 1828
122 Ga0068866_10077238 3300005718 Bacteria 1778
123 Ga0068866_10146133 3300005718 Bacteria 1363
124 Ga0068861_100082824 3300005719 Bacteria 2515
125 Ga0068861_100090685 3300005719 Bacteria 2412
126 Ga0068861_100250660 3300005719 Bacteria 1510
127 Ga0068861_100337141 3300005719 Bacteria 1318
128 Ga0068861_100423535 3300005719 Bacteria 1187
129 Ga0068851_10204645 3300005834 Bacteria 1103
130 Ga0068851_10461885 3300005834 Bacteria 756
131 Ga0068851_10848868 3300005834 Bacteria 570
132 Ga0068870_10083541 3300005840 Bacteria 1770
133 Ga0068870_10261051 3300005840 Bacteria 1078
134 Ga0068870_10340807 3300005840 Bacteria 959
135 Ga0068870_10735087 3300005840 Bacteria 684
136 Ga0068863_100105012 3300005841 Bacteria 2687
137 Ga0068863_100391160 3300005841 Bacteria 1359
138 Ga0068863_100732803 3300005841 Bacteria 984
139 Ga0068858_100049881 3300005842 Bacteria 3875
140 Ga0068858_100192587 3300005842 Bacteria 1927
141 Ga0068858_100201825 3300005842 Bacteria 1881
142 Ga0068858_100581291 3300005842 Bacteria 1086
143 Ga0068858_101319456 3300005842 Unclassified 710
144 Ga0068860_100058803 3300005843 Bacteria 3655
145 Ga0068860_100108629 3300005843 Bacteria 2651
146 Ga0068860_100359890 3300005843 Bacteria 1433
147 Ga0068860_100378241 3300005843 Bacteria 1397
148 Ga0068862_100177803 3300005844 Bacteria 1908
149 Ga0068862_100214213 3300005844 Bacteria 1741
150 Ga0068862_100279144 3300005844 Bacteria 1530
151 Ga0068862_100314700 3300005844 Bacteria 1443
152 Ga0068862_100642660 3300005844 Bacteria 1023
153 Ga0068862_100676855 3300005844 Bacteria 997
154 Ga0081455_10007513 3300005937 Bacteria 11465
155 Ga0081455_10080276 3300005937 Bacteria 2675
156 Ga0081540_1002549 3300005983 Bacteria 14782
157 Ga0081540_1003522 3300005983 Bacteria 12352
158 Ga0081540_1009485 3300005983 Bacteria 6704
159 Ga0081540_1029221 3300005983 Bacteria 3076
160 Ga0081540_1034399 3300005983 Bacteria 2734
161 Ga0081540_1035227 3300005983 Bacteria 2687
162 Ga0081540_1037441 3300005983 Bacteria 2572
163 Ga0081540_1058840 3300005983 Bacteria 1848
164 Ga0081540_1065600 3300005983 Bacteria 1706
165 Ga0081540_1070927 3300005983 Bacteria 1612
166 Ga0081539_10002259 3300005985 Bacteria 28018
167 Ga0081539_10040454 3300005985 Bacteria 2736
168 Ga0075365_10050170 3300006038 Bacteria 2753
169 Ga0075365_10063990 3300006038 Bacteria 2463
170 Ga0075365_10071281 3300006038 Bacteria 2339
171 Ga0075365_10148595 3300006038 Bacteria 1629
172 Ga0075365_10358692 3300006038 Bacteria 1028
173 Ga0075365_10362240 3300006038 Bacteria 1022
174 Ga0075368_10031546 3300006042 Bacteria 2055
175 Ga0075368_10148456 3300006042 Bacteria 979
176 Ga0075363_100009597 3300006048 Bacteria 4555
177 Ga0075363_100170012 3300006048 Bacteria 1237
178 Ga0075363_100219133 3300006048 Bacteria 1090
179 Ga0075363_100256158 3300006048 Bacteria 1008
180 Ga0075364_10121037 3300006051 Bacteria 1752
181 Ga0075364_10205693 3300006051 Bacteria 1335
182 Ga0070716_100441956 3300006173 Bacteria 946
183 Ga0070712_100168632 3300006175 Bacteria 1697
184 Ga0075362_10036045 3300006177 Bacteria 2162
185 Ga0075367_10003520 3300006178 Bacteria 7484
186 Ga0075367_10029963 3300006178 Bacteria 3116
187 Ga0075367_10130645 3300006178 Bacteria 1552
188 Ga0075367_10150157 3300006178 Bacteria 1446
189 Ga0075367_10541823 3300006178 Bacteria 739
190 Ga0075369_10029004 3300006186 Bacteria 2322
191 Ga0075369_10150151 3300006186 Bacteria 1065
192 Ga0075366_10057761 3300006195 Bacteria 2305
193 Ga0075366_10155797 3300006195 Bacteria 1383
194 Ga0075366_10341244 3300006195 Bacteria 919
195 Ga0097621_102263669 3300006237 Bacteria 520
196 Ga0075370_10018348 3300006353 Bacteria 3797
197 Ga0075370_10034805 3300006353 Bacteria 2824
198 Ga0075370_10052957 3300006353 Bacteria 2303
199 Ga0075370_10104761 3300006353 Bacteria 1639
200 Ga0068871_100012150 3300006358 Bacteria 6338
201 Ga0068871_100457600 3300006358 Bacteria 1145
202 Ga0068871_101477952 3300006358 Bacteria 642
203 Ga0075428_101350500 3300006844 Bacteria 749
204 Ga0075428_101397160 3300006844 Bacteria 735
205 Ga0075430_100300783 3300006846 Bacteria 1327
206 Ga0075431_101010994 3300006847 Bacteria 798
207 Ga0075433_10826858 3300006852 Bacteria 809
208 Ga0075434_100249710 3300006871 Bacteria 1793
209 Ga0068865_100105024 3300006881 Bacteria 2074
210 Ga0068865_100210589 3300006881 Bacteria 1514
211 Ga0068865_100400911 3300006881 Bacteria 1123
212 Ga0068865_100513870 3300006881 Bacteria 1001
213 Ga0068865_100521519 3300006881 Bacteria 994
214 Ga0075436_101181741 3300006914 Bacteria 577
215 Ga0097620_100066005 3300006931 Bacteria 3653
216 Ga0097620_100171999 3300006931 Bacteria 2247
217 Ga0097620_100609529 3300006931 Bacteria 1184
218 Ga0075435_100102763 3300007076 Bacteria 2369
219 Ga0099794_10182284 3300007265 Bacteria 1072
220 Ga0099795_10030957 3300007788 Bacteria 1840
221 Ga0105250_10010709 3300009092 Bacteria 3817
222 Ga0105240_10232630 3300009093 Bacteria 2141
223 Ga0105240_10289820 3300009093 Bacteria 1877
224 Ga0105240_10732734 3300009093 Bacteria 1076
225 Ga0111539_10632735 3300009094 Bacteria 1246
226 Ga0111539_10687070 3300009094 Bacteria 1191
227 Ga0105245_10154221 3300009098 Bacteria 2174
228 Ga0105245_10660941 3300009098 Bacteria 1076
229 Ga0105245_11037840 3300009098 Bacteria 865
230 Ga0105245_11737719 3300009098 Bacteria 676
231 Ga0105245_11809873 3300009098 Bacteria 663
232 Ga0105247_10056856 3300009101 Bacteria 2417
233 Ga0105247_10094995 3300009101 Bacteria 1898
234 Ga0105247_10218005 3300009101 Bacteria 1290
235 Ga0105247_10224527 3300009101 Bacteria 1273
236 Ga0114129_10340226 3300009147 Bacteria 1990
237 Ga0114129_10520407 3300009147 Bacteria 1551
238 Ga0105243_10191923 3300009148 Bacteria 1785
239 Ga0105243_10274048 3300009148 Bacteria 1516
240 Ga0105243_10500350 3300009148 Bacteria 1151
241 Ga0105241_10031978 3300009174 Bacteria 3941
242 Ga0105241_10583277 3300009174 Bacteria 1008
243 Ga0105241_10608832 3300009174 Bacteria 988
244 Ga0105242_10820502 3300009176 Bacteria 922
245 Ga0105248_10056455 3300009177 Bacteria 4405
246 Ga0105248_10284047 3300009177 Bacteria 1863
247 Ga0105248_10555013 3300009177 Bacteria 1296
248 Ga0105248_10989167 3300009177 Bacteria 950
249 Ga0105237_10277008 3300009545 Bacteria 1680
250 Ga0105237_10321090 3300009545 Bacteria 1552
251 Ga0105237_10349091 3300009545 Bacteria 1484
252 Ga0105237_10388607 3300009545 Bacteria 1400
253 Ga0105237_11533107 3300009545 Bacteria 673
254 Ga0105238_10056480 3300009551 Bacteria 3938
255 Ga0105238_10515559 3300009551 Bacteria 1198
256 Ga0105238_10910579 3300009551 Bacteria 898
257 Ga0105238_11003259 3300009551 Bacteria 856
258 Ga0105249_10235264 3300009553 Bacteria 1808
259 Ga0105249_11527778 3300009553 Bacteria 740
260 Ga0105239_10110518 3300010375 Bacteria 3047
261 Ga0105239_10123043 3300010375 Bacteria 2883
262 Ga0105239_10273304 3300010375 Bacteria 1901
263 Ga0105239_10306637 3300010375 Bacteria 1789
264 Ga0105239_10605370 3300010375 Bacteria 1250
265 Ga0105239_10919938 3300010375 Bacteria 1004
266 Ga0105246_10050528 3300011119 Bacteria 2852
267 Ga0105246_10081082 3300011119 Bacteria 2311
268 Ga0105246_10231528 3300011119 Bacteria 1455
269 Ga0105246_10480243 3300011119 Bacteria 1051
270 Ga0105246_10512460 3300011119 Bacteria 1021
271 Ga0105246_10586606 3300011119 Bacteria 961
272 Ga0157371_10757451 3300013102 Bacteria 729
273 Ga0157374_10018731 3300013296 Bacteria 6116
274 Ga0157374_10051454 3300013296 Bacteria 3833
275 Ga0157374_10433261 3300013296 Bacteria 1315
276 Ga0157378_10266102 3300013297 Bacteria 1647
277 Ga0157378_10271398 3300013297 Bacteria 1631
278 Ga0157378_11112613 3300013297 Bacteria 827
279 Ga0157378_11596446 3300013297 Bacteria 698
280 Ga0163162_10117403 3300013306 Bacteria 2762
281 Ga0163162_10219593 3300013306 Bacteria 2031
282 Ga0163162_10322849 3300013306 Bacteria 1676
283 Ga0163162_10544588 3300013306 Bacteria 1289
284 Ga0157372_12243697 3300013307 Bacteria 627
285 Ga0157372_12626389 3300013307 Bacteria 578
286 Ga0157375_10231676 3300013308 Bacteria 2006
287 Ga0157375_10472529 3300013308 Bacteria 1419
288 Ga0157375_10499816 3300013308 Bacteria 1380
289 Ga0157375_11103194 3300013308 Bacteria 929
290 Ga0157375_11385422 3300013308 Bacteria 828
291 Ga0163163_10382437 3300014325 Bacteria 1465
292 Ga0163163_10390701 3300014325 Bacteria 1449
293 Ga0163163_10412706 3300014325 Bacteria 1409
294 Ga0163163_10554950 3300014325 Bacteria 1211
295 Ga0163163_10786188 3300014325 Bacteria 1015
296 Ga0163163_11229493 3300014325 Bacteria 812
297 Ga0157380_10346838 3300014326 Bacteria 1387
298 Ga0157380_10535167 3300014326 Bacteria 1146
299 Ga0157380_10549582 3300014326 Bacteria 1132
300 Ga0157380_10592666 3300014326 Bacteria 1095
301 Ga0157380_10648775 3300014326 Bacteria 1052
302 Ga0157380_11161973 3300014326 Bacteria 814
303 Ga0157377_10067494 3300014745 Bacteria 2059
304 Ga0157377_10197473 3300014745 Bacteria 1275
305 Ga0157377_10368717 3300014745 Bacteria 969
306 Ga0157379_10121241 3300014968 Bacteria 2352
307 Ga0157379_10183366 3300014968 Bacteria 1891
308 Ga0157379_10548665 3300014968 Bacteria 1075
309 Ga0157379_10869370 3300014968 Bacteria 854
310 Ga0157379_11518385 3300014968 Bacteria 652
311 Ga0157379_11808138 3300014968 Bacteria 600
312 Ga0157376_10209764 3300014969 Bacteria 1798
313 Ga0157376_10282923 3300014969 Bacteria 1563
314 Ga0157376_10531823 3300014969 Bacteria 1160
315 Ga0157376_11237757 3300014969 Bacteria 775
316 Ga0163161_10171195 3300017792 Bacteria 1661
317 Ga0163161_10652617 3300017792 Bacteria 872
318 Ga0209758_1006620 3300025297 Bacteria 8210
319 Ga0209758_1023273 3300025297 Bacteria 2808
320 Ga0207697_10062544 3300025315 Bacteria 1550
321 Ga0207696_1058404 3300025711 Bacteria 1089
322 Ga0207692_10040762 3300025898 Bacteria 2294
323 Ga0207642_10093257 3300025899 Bacteria 1493
324 Ga0207642_10112362 3300025899 Bacteria 1390
325 Ga0207642_10162989 3300025899 Bacteria 1199
326 Ga0207642_10191577 3300025899 Bacteria 1122
327 Ga0207642_10457645 3300025899 Bacteria 774
328 Ga0207710_10456559 3300025900 Bacteria 660
329 Ga0207688_10053044 3300025901 Bacteria 2273
330 Ga0207688_10509250 3300025901 Bacteria 754
331 Ga0207680_10065184 3300025903 Bacteria 2235
332 Ga0207680_10148456 3300025903 Bacteria 1561
333 Ga0207647_10117577 3300025904 Bacteria 1569
334 Ga0207645_10050155 3300025907 Bacteria 2665
335 Ga0207645_10195363 3300025907 Bacteria 1330
336 Ga0207643_10027031 3300025908 Bacteria 3180
337 Ga0207643_10093287 3300025908 Bacteria 1757
338 Ga0207643_10185199 3300025908 Bacteria 1262
339 Ga0207643_10591296 3300025908 Bacteria 714
340 Ga0207705_10949218 3300025909 Bacteria 665
341 Ga0207654_10043586 3300025911 Bacteria 2544
342 Ga0207695_10208430 3300025913 Bacteria 1866
343 Ga0207671_10183049 3300025914 Bacteria 1631
344 Ga0207671_10299962 3300025914 Bacteria 1269
345 Ga0207671_10393774 3300025914 Bacteria 1101
346 Ga0207693_10392760 3300025915 Bacteria 1085
347 Ga0207663_10029308 3300025916 Bacteria 3231
348 Ga0207662_10124258 3300025918 Bacteria 1621
349 Ga0207657_10243596 3300025919 Bacteria 1435
350 Ga0207657_10832443 3300025919 Bacteria 713
351 Ga0207649_10091707 3300025920 Bacteria 1991
352 Ga0207649_10206911 3300025920 Bacteria 1390
353 Ga0207649_10279398 3300025920 Bacteria 1213
354 Ga0207649_10329072 3300025920 Bacteria 1125
355 Ga0207652_10044564 3300025921 Bacteria 3779
356 Ga0207681_10077879 3300025923 Bacteria 2332
357 Ga0207681_10123131 3300025923 Bacteria 1905
358 Ga0207694_10708790 3300025924 Bacteria 849
359 Ga0207694_10867886 3300025924 Bacteria 763
360 Ga0207650_10693470 3300025925 Bacteria 860
361 Ga0207659_10148531 3300025926 Bacteria 1828
362 Ga0207659_11305647 3300025926 Bacteria 623
363 Ga0207687_10112630 3300025927 Bacteria 2022
364 Ga0207687_10157950 3300025927 Bacteria 1737
365 Ga0207687_10551840 3300025927 Bacteria 967
366 Ga0207644_10061288 3300025931 Bacteria 2724
367 Ga0207644_10373537 3300025931 Bacteria 1162
368 Ga0207644_10763078 3300025931 Bacteria 808
369 Ga0207690_10070494 3300025932 Bacteria 2408
370 Ga0207690_10841313 3300025932 Bacteria 759
371 Ga0207706_10169596 3300025933 Bacteria 1918
372 Ga0207706_10326947 3300025933 Bacteria 1334
373 Ga0207706_10381971 3300025933 Bacteria 1222
374 Ga0207706_10997141 3300025933 Bacteria 704
375 Ga0207706_11016156 3300025933 Bacteria 696
376 Ga0207686_10625219 3300025934 Bacteria 850
377 Ga0207709_10010739 3300025935 Bacteria 5044
378 Ga0207709_10228373 3300025935 Bacteria 1347
379 Ga0207709_10436611 3300025935 Bacteria 1009
380 Ga0207709_11196915 3300025935 Bacteria 626
381 Ga0207670_10433982 3300025936 Bacteria 1056
382 Ga0207669_10053603 3300025937 Bacteria 2431
383 Ga0207669_10558324 3300025937 Bacteria 925
384 Ga0207669_10672711 3300025937 Bacteria 848
385 Ga0207704_10094491 3300025938 Bacteria 1974
386 Ga0207704_10350533 3300025938 Bacteria 1149
387 Ga0207704_10566371 3300025938 Bacteria 925
388 Ga0207704_10637672 3300025938 Bacteria 876
389 Ga0207665_10104988 3300025939 Bacteria 1978
390 Ga0207665_10394179 3300025939 Bacteria 1053
391 Ga0207691_10208471 3300025940 Bacteria 1699
392 Ga0207691_10336219 3300025940 Bacteria 1293
393 Ga0207691_11075556 3300025940 Bacteria 670
394 Ga0207711_10041759 3300025941 Bacteria 3907
395 Ga0207711_10216117 3300025941 Bacteria 1752
396 Ga0207711_10362056 3300025941 Bacteria 1344
397 Ga0207711_10629547 3300025941 Bacteria 1001
398 Ga0207689_10039433 3300025942 Bacteria 3910
399 Ga0207689_10067712 3300025942 Bacteria 2934
400 Ga0207689_10354933 3300025942 Bacteria 1219
401 Ga0207689_10553420 3300025942 Bacteria 966
402 Ga0207661_10105656 3300025944 Bacteria 2373
403 Ga0207679_10062689 3300025945 Bacteria 2772
404 Ga0207679_10117734 3300025945 Bacteria 2109
405 Ga0207679_10265087 3300025945 Bacteria 1467
406 Ga0207679_10424614 3300025945 Bacteria 1174
407 Ga0207679_10512255 3300025945 Bacteria 1072
408 Ga0207667_10080731 3300025949 Bacteria 3369
409 Ga0207667_10209621 3300025949 Bacteria 1997
410 Ga0207651_10245093 3300025960 Bacteria 1463
411 Ga0207651_11159151 3300025960 Bacteria 693
412 Ga0207712_10036980 3300025961 Bacteria 3328
413 Ga0207712_10089813 3300025961 Bacteria 2259
414 Ga0207668_10019940 3300025972 Bacteria 4250
415 Ga0207668_10023124 3300025972 Bacteria 3989
416 Ga0207668_10065657 3300025972 Bacteria 2569
417 Ga0207668_10246095 3300025972 Bacteria 1449
418 Ga0207668_10253503 3300025972 Bacteria 1430
419 Ga0207668_10265918 3300025972 Bacteria 1400
420 Ga0207668_10386500 3300025972 Bacteria 1179
421 Ga0207668_10700088 3300025972 Bacteria 890
422 Ga0207668_10826863 3300025972 Bacteria 821
423 Ga0207668_10828184 3300025972 Bacteria 820
424 Ga0207640_10349913 3300025981 Bacteria 1187
425 Ga0207658_10095459 3300025986 Bacteria 2317
426 Ga0207658_10369273 3300025986 Bacteria 1254
427 Ga0207677_10020729 3300026023 Bacteria 3998
428 Ga0207677_10097727 3300026023 Bacteria 2152
429 Ga0207677_10250716 3300026023 Bacteria 1437
430 Ga0207677_10699397 3300026023 Bacteria 899
431 Ga0207703_10114655 3300026035 Bacteria 2305
432 Ga0207703_10138276 3300026035 Bacteria 2111
433 Ga0207703_10219206 3300026035 Bacteria 1700
434 Ga0207639_10123795 3300026041 Bacteria 2129
435 Ga0207639_10226335 3300026041 Bacteria 1618
436 Ga0207639_10539757 3300026041 Bacteria 1070
437 Ga0207639_10970615 3300026041 Bacteria 795
438 Ga0207678_10032526 3300026067 Bacteria 4545
439 Ga0207678_10043098 3300026067 Bacteria 3906
440 Ga0207678_10061848 3300026067 Bacteria 3220
441 Ga0207678_10271563 3300026067 Bacteria 1454
442 Ga0207678_10577766 3300026067 Bacteria 984
443 Ga0207678_10756362 3300026067 Bacteria 857
444 Ga0207708_10077375 3300026075 Bacteria 2553
445 Ga0207708_10237664 3300026075 Bacteria 1464
446 Ga0207708_10423269 3300026075 Bacteria 1104
447 Ga0207708_10507752 3300026075 Bacteria 1011
448 Ga0207708_10675935 3300026075 Bacteria 881
449 Ga0207702_10046401 3300026078 Bacteria 3657
450 Ga0207702_11619720 3300026078 Bacteria 641
451 Ga0207641_10230182 3300026088 Bacteria 1722
452 Ga0207641_10233998 3300026088 Bacteria 1709
453 Ga0207641_10988089 3300026088 Bacteria 838
454 Ga0207648_10056377 3300026089 Bacteria 3430
455 Ga0207648_10277663 3300026089 Bacteria 1498
456 Ga0207648_10509395 3300026089 Bacteria 1102
457 Ga0207676_10040090 3300026095 Bacteria 3587
458 Ga0207676_10064028 3300026095 Bacteria 2922
459 Ga0207676_10508424 3300026095 Bacteria 1145
460 Ga0207676_11833737 3300026095 Bacteria 605
461 Ga0207674_10529027 3300026116 Bacteria 1139
462 Ga0207674_11490176 3300026116 Bacteria 646
463 Ga0207675_100028928 3300026118 Bacteria 5162
464 Ga0207675_100063858 3300026118 Bacteria 3440
465 Ga0207675_100195014 3300026118 Bacteria 1944
466 Ga0207675_100504980 3300026118 Bacteria 1204
467 Ga0207675_101547370 3300026118 Bacteria 684
468 Ga0207683_10027677 3300026121 Bacteria 4898
469 Ga0207683_10030892 3300026121 Bacteria 4645
470 Ga0207683_10117220 3300026121 Bacteria 2388
471 Ga0207683_10269089 3300026121 Bacteria 1556
472 Ga0207683_10410557 3300026121 Bacteria 1246
473 Ga0207683_10500174 3300026121 Bacteria 1123
474 Ga0207683_10770452 3300026121 Bacteria 893
475 Ga0207698_10137494 3300026142 Bacteria 2099
476 Ga0207698_11265862 3300026142 Bacteria 752
477 Ga0207698_11279665 3300026142 Bacteria 748
478 Ga0207698_12170278 3300026142 Bacteria 568
479 Ga0209588_1000800 3300027671 Bacteria 7985
480 Ga0209813_10066460 3300027866 Bacteria 1163
481 Ga0207428_10402407 3300027907 Bacteria 1002
482 Ga0268266_10006104 3300028379 Bacteria 11096
483 Ga0268266_10099968 3300028379 Bacteria 2554
484 Ga0268266_10168235 3300028379 Bacteria 1988
485 Ga0268266_10928574 3300028379 Bacteria 842
486 Ga0268265_10048108 3300028380 Bacteria 3199
487 Ga0268265_10093002 3300028380 Bacteria 2415
488 Ga0268265_10111628 3300028380 Bacteria 2233
489 Ga0268265_10141673 3300028380 Bacteria 2013
490 Ga0268265_10317726 3300028380 Bacteria 1409
491 Ga0268265_10478001 3300028380 Bacteria 1169
492 Ga0268265_10803871 3300028380 Bacteria 917
493 Ga0268264_10066935 3300028381 Bacteria 3031
494 Ga0268264_10516701 3300028381 Bacteria 1167
495 Ga0268264_10565213 3300028381 Bacteria 1117
496 Ga0268264_10851582 3300028381 Bacteria 913
497 Ga0307517_10001338 3300028786 Bacteria 41372
498 Ga0307515_10036525 3300028794 Bacteria 7944
499 Ga0307515_10448358 3300028794 Bacteria 906
500 Ga0307511_10212060 3300030521 Bacteria 987
501 Ga0307513_10340745 3300031456 Bacteria 1250
502 Ga0307408_100384323 3300031548 Bacteria 1201
503 Ga0307408_100431421 3300031548 Bacteria 1139
504 Ga0307516_10008231 3300031730 Bacteria 11840
505 Ga0307516_10029188 3300031730 Bacteria 5577
506 Ga0307516_10287509 3300031730 Bacteria 1324
507 Ga0307516_10634793 3300031730 Bacteria 723
508 Ga0307413_10034084 3300031824 Bacteria 2906
509 Ga0307413_11166642 3300031824 Bacteria 668
510 Ga0307406_10044603 3300031901 Bacteria 2780
511 Ga0307406_10587394 3300031901 Bacteria 917
512 Ga0307406_11072533 3300031901 Bacteria 694
513 Ga0307412_10090963 3300031911 Bacteria 2135
514 Ga0307412_10141464 3300031911 Bacteria 1763
515 Ga0307412_10645814 3300031911 Bacteria 902
516 Ga0307409_100267377 3300031995 Bacteria 1573
517 Ga0307416_100150540 3300032002 Bacteria 2133
518 Ga0307416_100293588 3300032002 Bacteria 1611
519 Ga0307416_100499659 3300032002 Bacteria 1280
520 Ga0307411_10241558 3300032005 Bacteria 1414
521 Ga0307411_11488467 3300032005 Bacteria 622
522 Ga0307415_100042079 3300032126 Bacteria 3038
523 Ga0307415_100066547 3300032126 Bacteria 2515
524 Ga0307415_100472074 3300032126 Bacteria 1090
525 Ga0307415_100832057 3300032126 Bacteria 845
526 Ga0307415_101200304 3300032126 Bacteria 715
527 Ga0307510_10001271 3300033180 Bacteria 27493
528 Ga0307510_10164389 3300033180 Bacteria 1810
529 Ga0373928_0120693 3300035084 Bacteria 702
530 Ga0373936_0040480 3300035113 Bacteria 1867
531 Ga0373927_0067522 3300035695 Bacteria 2314
532 Ga0373925_0383771 3300037068 Bacteria 1144
533 Ga0439465_0019851 3300041413 Bacteria 2102
534 Ga0451789_0204474 3300041443 Bacteria 880
535 Ga0451791_0697653 3300041451 Bacteria 875
536 Ga0451797_1323973 3300041453 Bacteria 779
537 Ga0451795_0306874 3300041456 Bacteria 958
538 Ga0451798_1097871 3300041458 Bacteria 727
539 Ga0451800_1593314 3300041459 Bacteria 900
540 Ga0451802_1059125 3300041460 Bacteria 859
541 Ga0451833_0077301 3300041491 Bacteria 829
542 Ga0451839_1189050 3300041496 Bacteria 597
543 Ga0451841_0118866 3300041498 Bacteria 618
544 Ga0451847_0131072 3300041503 Bacteria 725
545 Ga0451855_0645708 3300041511 Bacteria 555
546 Ga0451853_2093545 3300041512 Bacteria 683
547 Ga0451853_3973549 3300041512 Bacteria 1256
548 Ga0439431_0096058 3300041997 Bacteria 811
549 Ga0439459_0057244 3300042438 Bacteria 872
550 Ga0495603_0012846 3300046455 Bacteria 5063
551 Ga0495603_0063011 3300046455 Bacteria 2188
552 Ga0495590_0122970 3300046457 Bacteria 930
553 Ga0495638_0049454 3300046460 Bacteria 2628
554 Ga0495638_0056441 3300046460 Bacteria 2437
555 Ga0495638_0164633 3300046460 Bacteria 1277
556 Ga0495638_0337811 3300046460 Bacteria 799
557 Ga0495580_0724786 3300046472 Bacteria 649
558 Ga0495605_0112127 3300046474 Bacteria 1243
559 Ga0495605_0248588 3300046474 Bacteria 761
560 Ga0495639_0196217 3300046475 Bacteria 987
561 Ga0495584_0388112 3300046491 Bacteria 709
562 Ga0495585_0025931 3300046492 Bacteria 3352
563 Ga0495596_0115283 3300046500 Bacteria 1043
564 Ga0495607_0224148 3300046501 Bacteria 918
565 Ga0495606_0651257 3300046507 Bacteria 509
566 Ga0495616_0102165 3300046513 Bacteria 1343
567 Ga0495620_0067877 3300046515 Bacteria 1466
568 Ga0495620_0187352 3300046515 Bacteria 799
569 Ga0495631_0153362 3300046518 Bacteria 988
570 Ga0495631_0245149 3300046518 Bacteria 764
571 Ga0495632_0069355 3300046519 Bacteria 1697
572 Ga0495643_0294638 3300046522 Bacteria 742
573 Ga0495644_0081779 3300046523 Bacteria 1218
574 Ga0495644_0087035 3300046523 Bacteria 1178
575 Ga0495648_0313929 3300046524 Bacteria 729
576 Ga0495663_0133922 3300046525 Bacteria 837
577 Ga0495666_0159917 3300046526 Bacteria 1045
578 Ga0495642_0334175 3300046528 Bacteria 665
579 Ga0495665_0135927 3300046531 Bacteria 1286
580 Ga0495598_0017737 3300046537 Bacteria 1839
581 Ga0495609_0223398 3300046538 Bacteria 781
582 Ga0495621_0021383 3300046539 Bacteria 2132
583 Ga0495622_0118482 3300046557 Bacteria 1210
584 Ga0495622_0323091 3300046557 Bacteria 670
585 Ga0495633_0123773 3300046558 Bacteria 1197
586 Ga0495656_0030045 3300046615 Bacteria 2193
587 Ga0495656_0063752 3300046615 Bacteria 1616
588 Ga0495668_0300981 3300046616 Bacteria 879
589 Ga0495611_0058435 3300046648 Bacteria 1749
590 Ga0495611_0115176 3300046648 Bacteria 1252
591 Ga0495625_0153785 3300046660 Bacteria 1545
592 Ga0495625_0637374 3300046660 Bacteria 636
593 Ga0495635_0795537 3300046663 Bacteria 609
594 Ga0495659_0195683 3300046664 Bacteria 827
595 Ga0495661_0096281 3300046665 Bacteria 1674
596 Ga0495588_0213977 3300046674 Bacteria 1017
597 Ga0495647_0478380 3300046681 Bacteria 578
598 Ga0495658_0156962 3300046683 Bacteria 1401
599 Ga0495658_0542700 3300046683 Bacteria 744
600 Ga0495669_0020508 3300046684 Bacteria 2862
601 Ga0495669_0131600 3300046684 Bacteria 1177
602 Ga0495613_0430161 3300046689 Bacteria 897
603 Ga0495670_0305380 3300046691 Bacteria 853
604 Ga0495671_0126575 3300046692 Bacteria 1246
605 Ga0495589_0072700 3300046794 Bacteria 1679
606 Ga0495589_0086022 3300046794 Bacteria 1527
607 Ga0495589_0142507 3300046794 Bacteria 1147
608 Ga0495660_0384487 3300046810 Bacteria 618
609 Ga0495581_0011636 3300047315 Bacteria 5093
610 Ga0495581_0127403 3300047315 Bacteria 1483
611 Ga0495581_0223174 3300047315 Bacteria 1102
612 Ga0495581_0318460 3300047315 Bacteria 909
613 Ga0495581_0327529 3300047315 Bacteria 895
614 Ga0495604_0842035 3300047317 Bacteria 576
615 Ga0495636_0049548 3300047318 Bacteria 1756
616 Ga0495636_0058864 3300047318 Bacteria 1621
617 Ga0495636_0089460 3300047318 Bacteria 1335
618 Ga0495636_0224001 3300047318 Bacteria 864
619 Ga0495674_0489472 3300047319 Bacteria 985
620 Ga0495672_0013417 3300047320 Bacteria 5654
621 Ga0495676_0098498 3300047321 Bacteria 2169
622 Ga0495680_0684864 3300047322 Bacteria 678
623 Ga0495673_0019319 3300047469 Bacteria 3415
624 Ga0495673_0221110 3300047469 Bacteria 701
625 Ga0495686_0041319 3300047472 Bacteria 2937
626 Ga0495626_0231595 3300048091 Bacteria 747
627 Ga0496100_0507350 3300048903 Bacteria 930
628 Ga0496100_1376761 3300048903 Bacteria 557
629 Ga0496101_0023371 3300048904 Bacteria 4270
630 Ga0496101_0239352 3300048904 Bacteria 1412
631 Ga0496101_0280213 3300048904 Bacteria 1303
632 Ga0496101_0823504 3300048904 Bacteria 732
633 Ga0496102_0017911 3300048905 Bacteria 6213
634 Ga0496102_0213461 3300048905 Bacteria 1819
635 Ga0496102_0256941 3300048905 Bacteria 1647
636 Ga0496102_0265852 3300048905 Bacteria 1617
637 Ga0496102_0415197 3300048905 Bacteria 1264
638 Ga0496102_0864138 3300048905 Bacteria 827
639 Ga0496103_0071587 3300048906 Bacteria 2170
640 Ga0496103_0082938 3300048906 Bacteria 2018
641 Ga0496103_0186298 3300048906 Bacteria 1334
642 Ga0496104_0411505 3300048907 Bacteria 1264
643 Ga0496104_0623369 3300048907 Bacteria 988
644 Ga0496104_0900353 3300048907 Bacteria 790
645 Ga0496105_0014175 3300048908 Bacteria 6344
646 Ga0496105_0412879 3300048908 Bacteria 1070
647 Ga0496105_0615052 3300048908 Bacteria 842
648 Ga0496106_0001014 3300048909 Bacteria 20581
649 Ga0496106_0030569 3300048909 Bacteria 4014
650 Ga0496106_0094937 3300048909 Bacteria 2306
651 Ga0496106_0213387 3300048909 Bacteria 1538
652 Ga0496107_0073340 3300048910 Bacteria 2489
653 Ga0496107_0129708 3300048910 Bacteria 1861
654 Ga0496107_0218747 3300048910 Bacteria 1417
655 Ga0496108_0050866 3300048911 Bacteria 3470
656 Ga0496108_0071509 3300048911 Bacteria 2927
657 Ga0496108_0463217 3300048911 Bacteria 1107
658 Ga0496109_0186380 3300048912 Bacteria 1949
659 Ga0496109_0538515 3300048912 Bacteria 1102
660 Ga0496110_0142157 3300048913 Bacteria 2169
661 Ga0496111_0033983 3300048914 Bacteria 3639
662 Ga0496111_0064866 3300048914 Bacteria 2650
663 Ga0496112_0277580 3300048915 Bacteria 1623
664 Ga0496112_0448601 3300048915 Bacteria 1228
665 Ga0496113_0103626 3300048916 Bacteria 2207
666 Ga0496113_0482690 3300048916 Bacteria 995
667 Ga0496114_0008301 3300048917 Bacteria 8230
668 Ga0496114_0032009 3300048917 Bacteria 4327
669 Ga0496114_0035932 3300048917 Bacteria 4094
670 Ga0496114_0594040 3300048917 Bacteria 976
671 Ga0496114_0604744 3300048917 Bacteria 967
672 Ga0496114_0679275 3300048917 Bacteria 904
673 Ga0496114_0928793 3300048917 Bacteria 752
674 Ga0496115_0004376 3300048918 Bacteria 10231
675 Ga0496115_0230254 3300048918 Bacteria 1528
676 Ga0496115_0286128 3300048918 Bacteria 1353
677 Ga0496115_0378341 3300048918 Bacteria 1152
678 Ga0496115_0501252 3300048918 Bacteria 976
679 Ga0496118_0153486 3300048921 Bacteria 1437
680 Ga0496119_0124996 3300048922 Bacteria 1408
681 Ga0496121_0175233 3300048924 Bacteria 1553
682 Ga0496121_0193014 3300048924 Bacteria 1458
683 Ga0496121_0195571 3300048924 Bacteria 1446
684 Ga0496121_0296112 3300048924 Bacteria 1100
685 Ga0496121_0722042 3300048924 Bacteria 596
686 Ga0496124_0082915 3300048927 Bacteria 2631
687 Ga0496124_0168126 3300048927 Bacteria 1702
688 Ga0496124_0445202 3300048927 Bacteria 885
689 Ga0496124_0567626 3300048927 Bacteria 745
690 Ga0496125_0090129 3300048928 Bacteria 2303
691 Ga0496125_0242471 3300048928 Bacteria 1143
692 Ga0496125_0437223 3300048928 Bacteria 753
693 Ga0496126_0002460 3300048929 Bacteria 24974
694 Ga0496126_0056061 3300048929 Bacteria 3563
695 Ga0496126_0103546 3300048929 Bacteria 2487
696 Ga0496126_0132946 3300048929 Bacteria 2148
697 Ga0496126_0135890 3300048929 Bacteria 2121
698 Ga0496126_0441969 3300048929 Bacteria 1048
699 Ga0496126_1125551 3300048929 Bacteria 582
700 Ga0495682_0285903 3300049460 Bacteria 582
701 Ga0501039_1090913 3300049575 Bacteria 619
702 nmdc:mga03683_27750_c1 3300050489 Bacteria 2245
703 nmdc:mga03683_29035_c1 3300050489 Bacteria 2203
704 nmdc:mga03n38_533221_c1 3300050490 Bacteria 662
705 nmdc:mga03n38_84131_c1 3300050490 Bacteria 1501
706 nmdc:mga03n38_93190_c1 3300050490 Bacteria 1438
707 nmdc:mga03n38_983_c1 3300050490 Bacteria 7778
708 nmdc:mga00v17_141946_c1 3300050491 Bacteria 1540
709 nmdc:mga00v17_171470_c1 3300050491 Bacteria 1399
710 nmdc:mga00v17_195751_c1 3300050491 Bacteria 1306
711 nmdc:mga00v17_38844_c1 3300050491 Bacteria 2848
712 nmdc:mga00v17_96637_c1 3300050491 Bacteria 1861
713 nmdc:mga0yw44_18229_c1 3300050492 Bacteria 3839
714 nmdc:mga0yw44_184596_c1 3300050492 Bacteria 1374
715 nmdc:mga0yw44_201729_c1 3300050492 Bacteria 1314
716 nmdc:mga0yw44_218528_c1 3300050492 Bacteria 1262
717 nmdc:mga0k408_31768_c1 3300050493 Bacteria 3017
718 nmdc:mga0k408_66541_c1 3300050493 Bacteria 2099
719 nmdc:mga0k408_857948_c1 3300050493 Bacteria 528
720 nmdc:mga06z11_112434_c1 3300050494 Bacteria 1510
721 nmdc:mga06z11_37966_c1 3300050494 Bacteria 2389
722 nmdc:mga06z11_80134_c1 3300050494 Bacteria 1750
723 nmdc:mga04h51_74902_c1 3300050495 Bacteria 1190
724 nmdc:mga04h51_85263_c1 3300050495 Bacteria 1128
725 nmdc:mga07m45_156015_c1 3300050496 Bacteria 1324
726 nmdc:mga07m45_76608_c1 3300050496 Bacteria 1907
727 nmdc:mga05p37_624977_c1 3300050507 Bacteria 1211
728 nmdc:mga08y16_320063_c1 3300050511 Bacteria 1597
729 nmdc:mga0n895_306810_c1 3300050512 Bacteria 1609
730 nmdc:mga0rr50_175827_c1 3300050513 Bacteria 1747
731 nmdc:mga08x19_703636_c1 3300050514 Bacteria 717
732 nmdc:mga0a205_295163_c1 3300050515 Bacteria 1494
733 nmdc:mga0a205_785997_c1 3300050515 Bacteria 800
734 nmdc:mga0sz30_43832_c1 3300050516 Bacteria 1884
735 Ga0500610_0317223 3300053079 Bacteria 678
736 Ga0495655_0042595 3300053083 Bacteria 1167
737 Ga0500578_0195299 3300053086 Bacteria 1241
738 Ga0500643_042060 3300053087 Bacteria 1339
739 Ga0500643_186881 3300053087 Bacteria 556
740 Ga0500644_0177051 3300053088 Bacteria 871
741 Ga0500646_0162299 3300053090 Bacteria 747
742 Ga0500646_0276771 3300053090 Bacteria 597
743 Ga0500583_0168680 3300053092 Bacteria 1090
744 Ga0500566_0311815 3300053094 Bacteria 736
745 Ga0500641_0001979 3300053096 Bacteria 7275
746 Ga0500641_0004753 3300053096 Bacteria 4806
747 Ga0500641_0048387 3300053096 Bacteria 1741
748 Ga0500569_077676 3300053109 Bacteria 1057
749 Ga0500592_081340 3300053116 Bacteria 539
750 Ga0500594_0137620 3300053118 Bacteria 777
751 Ga0500595_067699 3300053119 Bacteria 1064
752 Ga0500621_192249 3300053126 Bacteria 730
753 Ga0500642_0165832 3300053130 Bacteria 1035
754 Ga0500642_0177611 3300053130 Bacteria 996
755 Ga0500655_019362 3300053133 Bacteria 1268
756 Ga0500658_0298125 3300053134 Bacteria 741
757 Ga0500561_0221398 3300053137 Bacteria 600
758 Ga0500589_027270 3300053147 Bacteria 2650
759 Ga0500589_188955 3300053147 Bacteria 802
760 Ga0500589_193055 3300053147 Bacteria 789
761 Ga0500590_092717 3300053148 Bacteria 1464
762 Ga0500603_190334 3300053150 Bacteria 648
763 Ga0500604_0029825 3300053151 Bacteria 1592
764 Ga0500616_0000127 3300053153 Bacteria 134777
765 Ga0500622_0285217 3300053156 Bacteria 710
766 Ga0500633_0142958 3300053160 Bacteria 896
767 Ga0500634_0056200 3300053161 Bacteria 2103
768 Ga0500638_163195 3300053162 Bacteria 979
769 Ga0500637_0309310 3300053178 Bacteria 858
770 Ga0500611_034917 3300053727 Bacteria 1068
771 Ga0500645_147305 3300053730 Bacteria 649
772 Ga0500609_038710 3300053731 Bacteria 659
773 2513695083 2513237101 Bacteria 7952346
774 2723841615 2721755755 Bacteria 8322773
775 2728754962 2728368998 Bacteria 8720350
776 2793081654
777 2874608091 2874604998 Bacteria 7834745
778 2876810823 2876808645 Bacteria 8824342
779 2879112142 2879110137 Bacteria 8907982
780 2889035520 2889033259 Bacteria 9099371
781 2922364029 2922361189 Bacteria 7436256
782 2922392538 2922386360 Bacteria 7017218
783 8006969332 8006964411 Bacteria 8966052
784 8006990894 8006984368 Bacteria 9651211
785 8006996538 8006994254 Bacteria 8309700
786 8056675715 8056673599 Bacteria 7871253
787 Ga0207706_10197484
788 rootH2_10104916
789 rootL2_10144200
790 JGI25404J52841_10021953
791 Ga0070658_10495004
792 Ga0070676_10155196
793 Ga0070676_11003131
794 Ga0070683_100386523
795 Ga0070690_100056075
796 Ga0070690_100319261
797 Ga0070690_100697566
798 Ga0070670_100101019
799 Ga0068869_100050231
800 Ga0068869_100058856
801 Ga0070666_10093735
802 Ga0070666_10267595
803 Ga0070666_10913934
804 Ga0070680_101447424
805 Ga0070682_100162240
806 Ga0068868_100052909
807 Ga0068868_100260799
808 Ga0068868_100341923
809 Ga0068868_100483960
810 Ga0068868_101067994
811 Ga0070660_100603394
812 Ga0070689_100417446
813 Ga0070689_100870624
814 Ga0070687_100353829
815 Ga0070687_100579408
816 Ga0070661_100171457
817 Ga0070661_100210671
818 Ga0070661_100283003
819 Ga0070661_100363693
820 Ga0070661_100466839
821 Ga0070668_100062410
822 Ga0070668_100066909
823 Ga0070668_100175674
824 Ga0070668_100182406
825 Ga0070668_100836420
826 Ga0070669_100252431
827 Ga0070669_100277603
828 Ga0070675_100395138
829 Ga0070675_100595130
830 Ga0070675_100634740
831 Ga0070675_101528615
832 Ga0070671_100115922
833 Ga0070671_100534927
834 Ga0070674_100167286
835 Ga0070674_100316513
836 Ga0070674_100446419
837 Ga0070674_100723884
838 Ga0070673_100289473
839 Ga0070673_100359545
840 Ga0070659_100148359
841 Ga0070659_100429066
842 Ga0070659_101395384
843 Ga0070667_100060591
844 Ga0070667_101251627
845 Ga0070667_101459083
846 Ga0070710_10086088
847 Ga0070710_10662303
848 Ga0070701_10369462
849 Ga0070711_100023422
850 Ga0070700_100149576
851 Ga0070700_100150235
852 Ga0070700_100552038
853 Ga0070663_100012307
854 Ga0070663_100073868
855 Ga0070663_100078350
856 Ga0070663_100235132
857 Ga0070678_100031128
858 Ga0070678_100093597
859 Ga0070678_100103337
860 Ga0070678_101579375
861 Ga0070662_100222143
862 Ga0070662_100390710
863 Ga0070706_100316926
864 Ga0070684_101944343
865 Ga0068853_100170181
866 Ga0068853_100225066
867 Ga0070672_100270710
868 Ga0070672_100670420
869 Ga0070672_100827451
870 Ga0070686_100020047
871 Ga0070695_100732684
872 Ga0070696_100058612
873 Ga0070665_100004203
874 Ga0070665_100009471
875 Ga0070665_100077521
876 Ga0070665_100112322
877 Ga0070665_100124827
878 Ga0070665_100151199
879 Ga0070665_100184209
880 Ga0070665_100227808
881 Ga0070665_100305738
882 Ga0070665_100577963
883 Ga0070665_101698096
884 Ga0068855_100102902
885 Ga0068855_100699865
886 Ga0068855_101015023
887 Ga0070664_100057841
888 Ga0070664_100819432
889 Ga0070664_100929488
890 Ga0070664_101620012
891 Ga0068857_100431555
892 Ga0068856_100043240
893 Ga0068856_100412336
894 Ga0068856_100629511
895 Ga0068856_101095015
896 Ga0068852_100189509
897 Ga0068852_100278437
898 Ga0068852_100906621
899 Ga0068852_101108698
900 Ga0068859_100066012
901 Ga0068859_100172003
902 Ga0068859_100609553
903 Ga0068864_100028662
904 Ga0068864_100059050
905 Ga0068864_101977029
906 Ga0068866_10067059
907 Ga0068866_10072159
908 Ga0068866_10077238
909 Ga0068866_10146133
910 Ga0068861_100082824
911 Ga0068861_100090685
912 Ga0068861_100250660
913 Ga0068861_100337141
914 Ga0068861_100423535
915 Ga0068851_10204645
916 Ga0068851_10461885
917 Ga0068851_10848868
918 Ga0068870_10083541
919 Ga0068870_10261051
920 Ga0068870_10340807
921 Ga0068870_10735087
922 Ga0068863_100105012
923 Ga0068863_100391160
924 Ga0068863_100732803
925 Ga0068858_100049881
926 Ga0068858_100192587
927 Ga0068858_100201825
928 Ga0068858_100581291
929 Ga0068858_101319456
930 Ga0068860_100058803
931 Ga0068860_100108629
932 Ga0068860_100359890
933 Ga0068860_100378241
934 Ga0068862_100177803
935 Ga0068862_100214213
936 Ga0068862_100279144
937 Ga0068862_100314700
938 Ga0068862_100642660
939 Ga0068862_100676855
940 Ga0081455_10007513
941 Ga0081455_10080276
942 Ga0081540_1002549
943 Ga0081540_1003522
944 Ga0081540_1009485
945 Ga0081540_1029221
946 Ga0081540_1034399
947 Ga0081540_1035227
948 Ga0081540_1037441
949 Ga0081540_1058840
950 Ga0081540_1065600
951 Ga0081540_1070927
952 Ga0081539_10002259
953 Ga0081539_10040454
954 Ga0075365_10050170
955 Ga0075365_10063990
956 Ga0075365_10071281
957 Ga0075365_10148595
958 Ga0075365_10358692
959 Ga0075365_10362240
960 Ga0075368_10031546
961 Ga0075368_10148456
962 Ga0075363_100009597
963 Ga0075363_100170012
964 Ga0075363_100219133
965 Ga0075363_100256158
966 Ga0075364_10121037
967 Ga0075364_10205693
968 Ga0070716_100441956
969 Ga0070712_100168632
970 Ga0075362_10036045
971 Ga0075367_10003520
972 Ga0075367_10029963
973 Ga0075367_10130645
974 Ga0075367_10150157
975 Ga0075367_10541823
976 Ga0075369_10029004
977 Ga0075369_10150151
978 Ga0075366_10057761
979 Ga0075366_10155797
980 Ga0075366_10341244
981 Ga0097621_102263669
982 Ga0075370_10018348
983 Ga0075370_10034805
984 Ga0075370_10052957
985 Ga0075370_10104761
986 Ga0068871_100012150
987 Ga0068871_100457600
988 Ga0068871_101477952
989 Ga0075428_101350500
990 Ga0075428_101397160
991 Ga0075430_100300783
992 Ga0075431_101010994
993 Ga0075433_10826858
994 Ga0075434_100249710
995 Ga0068865_100105024
996 Ga0068865_100210589
997 Ga0068865_100400911
998 Ga0068865_100513870
999 Ga0068865_100521519
1000 Ga0075436_101181741
1001 Ga0097620_100066005
1002 Ga0097620_100171999
1003 Ga0097620_100609529
1004 Ga0075435_100102763
1005 Ga0099794_10182284
1006 Ga0099795_10030957
1007 Ga0105250_10010709
1008 Ga0105240_10232630
1009 Ga0105240_10289820
1010 Ga0105240_10732734
1011 Ga0111539_10632735
1012 Ga0111539_10687070
1013 Ga0105245_10154221
1014 Ga0105245_10660941
1015 Ga0105245_11037840
1016 Ga0105245_11737719
1017 Ga0105245_11809873
1018 Ga0105247_10056856
1019 Ga0105247_10094995
1020 Ga0105247_10218005
1021 Ga0105247_10224527
1022 Ga0114129_10340226
1023 Ga0114129_10520407
1024 Ga0105243_10191923
1025 Ga0105243_10274048
1026 Ga0105243_10500350
1027 Ga0105241_10031978
1028 Ga0105241_10583277
1029 Ga0105241_10608832
1030 Ga0105242_10820502
1031 Ga0105248_10056455
1032 Ga0105248_10284047
1033 Ga0105248_10555013
1034 Ga0105248_10989167
1035 Ga0105237_10277008
1036 Ga0105237_10321090
1037 Ga0105237_10349091
1038 Ga0105237_10388607
1039 Ga0105237_11533107
1040 Ga0105238_10056480
1041 Ga0105238_10515559
1042 Ga0105238_10910579
1043 Ga0105238_11003259
1044 Ga0105249_10235264
1045 Ga0105249_11527778
1046 Ga0105239_10110518
1047 Ga0105239_10123043
1048 Ga0105239_10273304
1049 Ga0105239_10306637
1050 Ga0105239_10605370
1051 Ga0105239_10919938
1052 Ga0105246_10050528
1053 Ga0105246_10081082
1054 Ga0105246_10231528
1055 Ga0105246_10480243
1056 Ga0105246_10512460
1057 Ga0105246_10586606
1058 Ga0157371_10757451
1059 Ga0157374_10018731
1060 Ga0157374_10051454
1061 Ga0157374_10433261
1062 Ga0157378_10266102
1063 Ga0157378_10271398
1064 Ga0157378_11112613
1065 Ga0157378_11596446
1066 Ga0163162_10117403
1067 Ga0163162_10219593
1068 Ga0163162_10322849
1069 Ga0163162_10544588
1070 Ga0157372_12243697
1071 Ga0157372_12626389
1072 Ga0157375_10231676
1073 Ga0157375_10472529
1074 Ga0157375_10499816
1075 Ga0157375_11103194
1076 Ga0157375_11385422
1077 Ga0163163_10382437
1078 Ga0163163_10390701
1079 Ga0163163_10412706
1080 Ga0163163_10554950
1081 Ga0163163_10786188
1082 Ga0163163_11229493
1083 Ga0157380_10346838
1084 Ga0157380_10535167
1085 Ga0157380_10549582
1086 Ga0157380_10592666
1087 Ga0157380_10648775
1088 Ga0157380_11161973
1089 Ga0157377_10067494
1090 Ga0157377_10197473
1091 Ga0157377_10368717
1092 Ga0157379_10121241
1093 Ga0157379_10183366
1094 Ga0157379_10548665
1095 Ga0157379_10869370
1096 Ga0157379_11518385
1097 Ga0157379_11808138
1098 Ga0157376_10209764
1099 Ga0157376_10282923
1100 Ga0157376_10531823
1101 Ga0157376_11237757
1102 Ga0163161_10171195
1103 Ga0163161_10652617
1104 Ga0209758_1006620
1105 Ga0209758_1023273
1106 Ga0207697_10062544
1107 Ga0207696_1058404
1108 Ga0207692_10040762
1109 Ga0207642_10093257
1110 Ga0207642_10112362
1111 Ga0207642_10162989
1112 Ga0207642_10191577
1113 Ga0207642_10457645
1114 Ga0207710_10456559
1115 Ga0207688_10053044
1116 Ga0207688_10509250
1117 Ga0207680_10065184
1118 Ga0207680_10148456
1119 Ga0207647_10117577
1120 Ga0207645_10050155
1121 Ga0207645_10195363
1122 Ga0207643_10027031
1123 Ga0207643_10093287
1124 Ga0207643_10185199
1125 Ga0207643_10591296
1126 Ga0207705_10949218
1127 Ga0207654_10043586
1128 Ga0207695_10208430
1129 Ga0207671_10183049
1130 Ga0207671_10299962
1131 Ga0207671_10393774
1132 Ga0207693_10392760
1133 Ga0207663_10029308
1134 Ga0207662_10124258
1135 Ga0207657_10243596
1136 Ga0207657_10832443
1137 Ga0207649_10091707
1138 Ga0207649_10206911
1139 Ga0207649_10279398
1140 Ga0207649_10329072
1141 Ga0207652_10044564
1142 Ga0207681_10077879
1143 Ga0207681_10123131
1144 Ga0207694_10708790
1145 Ga0207694_10867886
1146 Ga0207650_10693470
1147 Ga0207659_10148531
1148 Ga0207659_11305647
1149 Ga0207687_10112630
1150 Ga0207687_10157950
1151 Ga0207687_10551840
1152 Ga0207644_10061288
1153 Ga0207644_10373537
1154 Ga0207644_10763078
1155 Ga0207690_10070494
1156 Ga0207690_10841313
1157 Ga0207706_10169596
1158 Ga0207706_10326947
1159 Ga0207706_10381971
1160 Ga0207706_10997141
1161 Ga0207706_11016156
1162 Ga0207686_10625219
1163 Ga0207709_10010739
1164 Ga0207709_10228373
1165 Ga0207709_10436611
1166 Ga0207709_11196915
1167 Ga0207670_10433982
1168 Ga0207669_10053603
1169 Ga0207669_10558324
1170 Ga0207669_10672711
1171 Ga0207704_10094491
1172 Ga0207704_10350533
1173 Ga0207704_10566371
1174 Ga0207704_10637672
1175 Ga0207665_10104988
1176 Ga0207665_10394179
1177 Ga0207691_10208471
1178 Ga0207691_10336219
1179 Ga0207691_11075556
1180 Ga0207711_10041759
1181 Ga0207711_10216117
1182 Ga0207711_10362056
1183 Ga0207711_10629547
1184 Ga0207689_10039433
1185 Ga0207689_10067712
1186 Ga0207689_10354933
1187 Ga0207689_10553420
1188 Ga0207661_10105656
1189 Ga0207679_10062689
1190 Ga0207679_10117734
1191 Ga0207679_10265087
1192 Ga0207679_10424614
1193 Ga0207679_10512255
1194 Ga0207667_10080731
1195 Ga0207667_10209621
1196 Ga0207651_10245093
1197 Ga0207651_11159151
1198 Ga0207712_10036980
1199 Ga0207712_10089813
1200 Ga0207668_10019940
1201 Ga0207668_10023124
1202 Ga0207668_10065657
1203 Ga0207668_10246095
1204 Ga0207668_10253503
1205 Ga0207668_10265918
1206 Ga0207668_10386500
1207 Ga0207668_10700088
1208 Ga0207668_10826863
1209 Ga0207668_10828184
1210 Ga0207640_10349913
1211 Ga0207658_10095459
1212 Ga0207658_10369273
1213 Ga0207677_10020729
1214 Ga0207677_10097727
1215 Ga0207677_10250716
1216 Ga0207677_10699397
1217 Ga0207703_10114655
1218 Ga0207703_10138276
1219 Ga0207703_10219206
1220 Ga0207639_10123795
1221 Ga0207639_10226335
1222 Ga0207639_10539757
1223 Ga0207639_10970615
1224 Ga0207678_10032526
1225 Ga0207678_10043098
1226 Ga0207678_10061848
1227 Ga0207678_10271563
1228 Ga0207678_10577766
1229 Ga0207678_10756362
1230 Ga0207708_10077375
1231 Ga0207708_10237664
1232 Ga0207708_10423269
1233 Ga0207708_10507752
1234 Ga0207708_10675935
1235 Ga0207702_10046401
1236 Ga0207702_11619720
1237 Ga0207641_10230182
1238 Ga0207641_10233998
1239 Ga0207641_10988089
1240 Ga0207648_10056377
1241 Ga0207648_10277663
1242 Ga0207648_10509395
1243 Ga0207676_10040090
1244 Ga0207676_10064028
1245 Ga0207676_10508424
1246 Ga0207676_11833737
1247 Ga0207674_10529027
1248 Ga0207674_11490176
1249 Ga0207675_100028928
1250 Ga0207675_100063858
1251 Ga0207675_100195014
1252 Ga0207675_100504980
1253 Ga0207675_101547370
1254 Ga0207683_10027677
1255 Ga0207683_10030892
1256 Ga0207683_10117220
1257 Ga0207683_10269089
1258 Ga0207683_10410557
1259 Ga0207683_10500174
1260 Ga0207683_10770452
1261 Ga0207698_10137494
1262 Ga0207698_11265862
1263 Ga0207698_11279665
1264 Ga0207698_12170278
1265 Ga0209588_1000800
1266 Ga0209813_10066460
1267 Ga0207428_10402407
1268 Ga0268266_10006104
1269 Ga0268266_10099968
1270 Ga0268266_10168235
1271 Ga0268266_10928574
1272 Ga0268265_10048108
1273 Ga0268265_10093002
1274 Ga0268265_10111628
1275 Ga0268265_10141673
1276 Ga0268265_10317726
1277 Ga0268265_10478001
1278 Ga0268265_10803871
1279 Ga0268264_10066935
1280 Ga0268264_10516701
1281 Ga0268264_10565213
1282 Ga0268264_10851582
1283 Ga0307517_10001338
1284 Ga0307515_10036525
1285 Ga0307515_10448358
1286 Ga0307511_10212060
1287 Ga0307513_10340745
1288 Ga0307408_100384323
1289 Ga0307408_100431421
1290 Ga0307516_10008231
1291 Ga0307516_10029188
1292 Ga0307516_10287509
1293 Ga0307516_10634793
1294 Ga0307413_10034084
1295 Ga0307413_11166642
1296 Ga0307406_10044603
1297 Ga0307406_10587394
1298 Ga0307406_11072533
1299 Ga0307412_10090963
1300 Ga0307412_10141464
1301 Ga0307412_10645814
1302 Ga0307409_100267377
1303 Ga0307416_100150540
1304 Ga0307416_100293588
1305 Ga0307416_100499659
1306 Ga0307411_10241558
1307 Ga0307411_11488467
1308 Ga0307415_100042079
1309 Ga0307415_100066547
1310 Ga0307415_100472074
1311 Ga0307415_100832057
1312 Ga0307415_101200304
1313 Ga0307510_10001271
1314 Ga0307510_10164389
1315 Ga0373928_0120693
1316 Ga0373936_0040480
1317 Ga0373927_0067522
1318 Ga0373925_0383771
1319 Ga0439465_0019851
1320 Ga0451789_0204474
1321 Ga0451791_0697653
1322 Ga0451797_1323973
1323 Ga0451795_0306874
1324 Ga0451798_1097871
1325 Ga0451800_1593314
1326 Ga0451802_1059125
1327 Ga0451833_0077301
1328 Ga0451839_1189050
1329 Ga0451841_0118866
1330 Ga0451847_0131072
1331 Ga0451855_0645708
1332 Ga0451853_2093545
1333 Ga0451853_3973549
1334 Ga0439431_0096058
1335 Ga0439459_0057244
1336 Ga0495603_0012846
1337 Ga0495603_0063011
1338 Ga0495590_0122970
1339 Ga0495638_0049454
1340 Ga0495638_0056441
1341 Ga0495638_0164633
1342 Ga0495638_0337811
1343 Ga0495580_0724786
1344 Ga0495605_0112127
1345 Ga0495605_0248588
1346 Ga0495639_0196217
1347 Ga0495584_0388112
1348 Ga0495585_0025931
1349 Ga0495596_0115283
1350 Ga0495607_0224148
1351 Ga0495606_0651257
1352 Ga0495616_0102165
1353 Ga0495620_0067877
1354 Ga0495620_0187352
1355 Ga0495631_0153362
1356 Ga0495631_0245149
1357 Ga0495632_0069355
1358 Ga0495643_0294638
1359 Ga0495644_0081779
1360 Ga0495644_0087035
1361 Ga0495648_0313929
1362 Ga0495663_0133922
1363 Ga0495666_0159917
1364 Ga0495642_0334175
1365 Ga0495665_0135927
1366 Ga0495598_0017737
1367 Ga0495609_0223398
1368 Ga0495621_0021383
1369 Ga0495622_0118482
1370 Ga0495622_0323091
1371 Ga0495633_0123773
1372 Ga0495656_0030045
1373 Ga0495656_0063752
1374 Ga0495668_0300981
1375 Ga0495611_0058435
1376 Ga0495611_0115176
1377 Ga0495625_0153785
1378 Ga0495625_0637374
1379 Ga0495635_0795537
1380 Ga0495659_0195683
1381 Ga0495661_0096281
1382 Ga0495588_0213977
1383 Ga0495647_0478380
1384 Ga0495658_0156962
1385 Ga0495658_0542700
1386 Ga0495669_0020508
1387 Ga0495669_0131600
1388 Ga0495613_0430161
1389 Ga0495670_0305380
1390 Ga0495671_0126575
1391 Ga0495589_0072700
1392 Ga0495589_0086022
1393 Ga0495589_0142507
1394 Ga0495660_0384487
1395 Ga0495581_0011636
1396 Ga0495581_0127403
1397 Ga0495581_0223174
1398 Ga0495581_0318460
1399 Ga0495581_0327529
1400 Ga0495604_0842035
1401 Ga0495636_0049548
1402 Ga0495636_0058864
1403 Ga0495636_0089460
1404 Ga0495636_0224001
1405 Ga0495674_0489472
1406 Ga0495672_0013417
1407 Ga0495676_0098498
1408 Ga0495680_0684864
1409 Ga0495673_0019319
1410 Ga0495673_0221110
1411 Ga0495686_0041319
1412 Ga0495626_0231595
1413 Ga0496100_0507350
1414 Ga0496100_1376761
1415 Ga0496101_0023371
1416 Ga0496101_0239352
1417 Ga0496101_0280213
1418 Ga0496101_0823504
1419 Ga0496102_0017911
1420 Ga0496102_0213461
1421 Ga0496102_0256941
1422 Ga0496102_0265852
1423 Ga0496102_0415197
1424 Ga0496102_0864138
1425 Ga0496103_0071587
1426 Ga0496103_0082938
1427 Ga0496103_0186298
1428 Ga0496104_0411505
1429 Ga0496104_0623369
1430 Ga0496104_0900353
1431 Ga0496105_0014175
1432 Ga0496105_0412879
1433 Ga0496105_0615052
1434 Ga0496106_0001014
1435 Ga0496106_0030569
1436 Ga0496106_0094937
1437 Ga0496106_0213387
1438 Ga0496107_0073340
1439 Ga0496107_0129708
1440 Ga0496107_0218747
1441 Ga0496108_0050866
1442 Ga0496108_0071509
1443 Ga0496108_0463217
1444 Ga0496109_0186380
1445 Ga0496109_0538515
1446 Ga0496110_0142157
1447 Ga0496111_0033983
1448 Ga0496111_0064866
1449 Ga0496112_0277580
1450 Ga0496112_0448601
1451 Ga0496113_0103626
1452 Ga0496113_0482690
1453 Ga0496114_0008301
1454 Ga0496114_0032009
1455 Ga0496114_0035932
1456 Ga0496114_0594040
1457 Ga0496114_0604744
1458 Ga0496114_0679275
1459 Ga0496114_0928793
1460 Ga0496115_0004376
1461 Ga0496115_0230254
1462 Ga0496115_0286128
1463 Ga0496115_0378341
1464 Ga0496115_0501252
1465 Ga0496118_0153486
1466 Ga0496119_0124996
1467 Ga0496121_0175233
1468 Ga0496121_0193014
1469 Ga0496121_0195571
1470 Ga0496121_0296112
1471 Ga0496121_0722042
1472 Ga0496124_0082915
1473 Ga0496124_0168126
1474 Ga0496124_0445202
1475 Ga0496124_0567626
1476 Ga0496125_0090129
1477 Ga0496125_0242471
1478 Ga0496125_0437223
1479 Ga0496126_0002460
1480 Ga0496126_0056061
1481 Ga0496126_0103546
1482 Ga0496126_0132946
1483 Ga0496126_0135890
1484 Ga0496126_0441969
1485 Ga0496126_1125551
1486 Ga0495682_0285903
1487 Ga0501039_1090913
1488 nmdc:mga03683_27750_c1
1489 nmdc:mga03683_29035_c1
1490 nmdc:mga03n38_533221_c1
1491 nmdc:mga03n38_84131_c1
1492 nmdc:mga03n38_93190_c1
1493 nmdc:mga03n38_983_c1
1494 nmdc:mga00v17_141946_c1
1495 nmdc:mga00v17_171470_c1
1496 nmdc:mga00v17_195751_c1
1497 nmdc:mga00v17_38844_c1
1498 nmdc:mga00v17_96637_c1
1499 nmdc:mga0yw44_18229_c1
1500 nmdc:mga0yw44_184596_c1
1501 nmdc:mga0yw44_201729_c1
1502 nmdc:mga0yw44_218528_c1
1503 nmdc:mga0k408_31768_c1
1504 nmdc:mga0k408_66541_c1
1505 nmdc:mga0k408_857948_c1
1506 nmdc:mga06z11_112434_c1
1507 nmdc:mga06z11_37966_c1
1508 nmdc:mga06z11_80134_c1
1509 nmdc:mga04h51_74902_c1
1510 nmdc:mga04h51_85263_c1
1511 nmdc:mga07m45_156015_c1
1512 nmdc:mga07m45_76608_c1
1513 nmdc:mga05p37_624977_c1
1514 nmdc:mga08y16_320063_c1
1515 nmdc:mga0n895_306810_c1
1516 nmdc:mga0rr50_175827_c1
1517 nmdc:mga08x19_703636_c1
1518 nmdc:mga0a205_295163_c1
1519 nmdc:mga0a205_785997_c1
1520 nmdc:mga0sz30_43832_c1
1521 Ga0500610_0317223
1522 Ga0495655_0042595
1523 Ga0500578_0195299
1524 Ga0500643_042060
1525 Ga0500643_186881
1526 Ga0500644_0177051
1527 Ga0500646_0162299
1528 Ga0500646_0276771
1529 Ga0500583_0168680
1530 Ga0500566_0311815
1531 Ga0500641_0001979
1532 Ga0500641_0004753
1533 Ga0500641_0048387
1534 Ga0500569_077676
1535 Ga0500592_081340
1536 Ga0500594_0137620
1537 Ga0500595_067699
1538 Ga0500621_192249
1539 Ga0500642_0165832
1540 Ga0500642_0177611
1541 Ga0500655_019362
1542 Ga0500658_0298125
1543 Ga0500561_0221398
1544 Ga0500589_027270
1545 Ga0500589_188955
1546 Ga0500589_193055
1547 Ga0500590_092717
1548 Ga0500603_190334
1549 Ga0500604_0029825
1550 Ga0500616_0000127
1551 Ga0500622_0285217
1552 Ga0500633_0142958
1553 Ga0500634_0056200
1554 Ga0500638_163195
1555 Ga0500637_0309310
1556 Ga0500611_034917
1557 Ga0500645_147305
1558 Ga0500609_038710
1559 2513695083
1560 2723841615
1561 2728754962
1562 2793081654
1563 2874608091
1564 2876810823
1565 2879112142
1566 2889035520
1567 2922364029
1568 2922392538
1569 8006969332
1570 8006990894
1571 8006996538
1572 8056675715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q1w-assembly1.cif.gz_B mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance 0.327 28 57
3oy4-assembly1.cif.gz_B crystal structure of hiv-1 l76v protease in complex with the protease inhibitor darunavir. 0.3089 28 58
4q1x-assembly1.cif.gz_B mutations outside the active site of hiv-1 protease alter enzyme structure and dynamic ensemble of the active site to confer drug resistance 0.3082 28 58
4obg-assembly2.cif.gz_C crystal structure of nelfinavir-resistant, inactive hiv-1 protease (d30n/n88d) in complex with the p1-p6 substrate. 0.3035 28 58
3jvy-assembly1.cif.gz_B hiv-1 protease mutant g86a with darunavir 0.3033 28 58
ID Description Score Start End Superfamily
af_C6T8X9_163_323_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.3596 50 119 3.40.1280.10
af_F4J7U9_265_379_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.3406 12 45 2.40.70.10
1wec001 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.3119 31 56 2.40.70.10
af_A4I142_25_204_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.2751 57 144 3.40.1280.10
af_Q54DY1_210_295_3.30.2330.10 Alpha Beta;2-Layer Sandwich;arginine biosynthesis bifunctional protein fold;arginine biosynthesis bifunctional protein suprefamily 0.2358 64 144 3.30.2330.10
ID Description Score Start End GO Terms
AF-A0A4Q8R3J2-F1-model_v4 Uncharacterized protein 0.8926 15 146
AF-H0TJT8-F1-model_v4 Uncharacterized protein 0.8413 28 146
AF-A0A4Q8R3J2-F1-model_v4 Uncharacterized protein 0.8256 15 146
AF-Q13E45-F1-model_v4 Uncharacterized protein 0.8137 1 155
AF-Q13E45-F1-model_v4 Uncharacterized protein 0.8041 1 155

Map