F480718
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 514 | 1568 | 141 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2937843397|2937845901 |
| Length | 161 |
| Sequence | EHSRSNATVGKAAKSRRWAPGRAARNSVVLYAAVGLGSMAGGVTRALVSIASLELLGPAFPWGTLAANLAGSFLIGLYAALTEPGGRIFAGSAQRQFVMAGFCGGFTTFSLFSLETFQLILEDRWPTAVFYVAASLLAWFAAVWLGHVWGWRINRLRGKDI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 198 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 207 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 301 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 341 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 342 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 344 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 348 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 349 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 351 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 352 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 353 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 354 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 355 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 356 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 357 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 358 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 359 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 360 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 361 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 362 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 363 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 364 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 365 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 366 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 367 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 368 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 369 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 370 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 371 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 372 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 373 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 374 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 375 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 376 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 377 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 378 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 379 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 380 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 381 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 382 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 383 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 384 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 385 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 386 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 387 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 388 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 389 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 390 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 391 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 392 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 393 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 394 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 395 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 396 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 397 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 398 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 399 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 400 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 401 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 402 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 403 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 404 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 405 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 406 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 407 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 408 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 409 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 410 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 411 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 412 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 413 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 414 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 415 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 416 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 417 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 418 | 2922368715 | |||
| 419 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 420 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 421 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 422 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 423 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 424 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 425 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 426 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 427 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 428 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 429 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 430 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 431 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 432 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 433 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 434 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 435 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 436 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 437 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 438 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 439 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 440 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 441 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 442 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 443 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 444 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 445 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 446 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 447 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 448 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 449 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 450 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 451 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 452 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 453 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 454 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 455 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 456 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 457 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 458 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 459 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 460 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 461 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 462 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 463 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 464 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 465 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 466 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 467 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 468 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 469 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 470 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 471 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 472 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 473 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 474 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 475 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 476 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 477 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 478 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 479 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 480 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 481 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 482 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 483 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 484 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 485 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 486 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 487 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 488 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 489 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 490 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 491 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 492 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 493 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 494 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 495 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 496 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 497 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 498 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 499 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 500 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 501 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 502 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 503 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 504 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 505 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 506 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 507 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 508 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 509 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 510 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 511 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 512 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 513 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 514 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.31 |
| Metatranscriptomes | 0 |
| Isolates | 20.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.1 |
| Nodule | 17.6 |
| Rhizoplane | 6.12 |
| Rhizosphere | 56.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007734 | 3300003203 | Bacteria | 4888 |
| 2 | JGI25153J46596_10000853 | 3300003215 | Bacteria | 18697 |
| 3 | JGI25153J46596_10013646 | 3300003215 | Bacteria | 3422 |
| 4 | JGI25153J46596_10042922 | 3300003215 | Bacteria | 1375 |
| 5 | rootH1_10004454 | 3300003316 | Bacteria | 1026 |
| 6 | rootH2_10008939 | 3300003320 | Bacteria | 3165 |
| 7 | rootH2_10151742 | 3300003320 | Bacteria | 1351 |
| 8 | rootL2_10205672 | 3300003322 | Bacteria | 1939 |
| 9 | rootH1_10128380 | 3300003323 | Bacteria | 1435 |
| 10 | JGI25160J50197_1000926 | 3300003354 | Bacteria | 15441 |
| 11 | JGI25160J50197_1002416 | 3300003354 | Bacteria | 8710 |
| 12 | Ga0055542_1013863 | 3300003762 | Bacteria | 1341 |
| 13 | Ga0055524_1039493 | 3300003775 | Bacteria | 1217 |
| 14 | Ga0055531_10018479 | 3300003794 | Bacteria | 2873 |
| 15 | Ga0065165_1014675 | 3300005262 | Bacteria | 3030 |
| 16 | Ga0070658_10156978 | 3300005327 | Bacteria | 1907 |
| 17 | Ga0070676_10561198 | 3300005328 | Unclassified | 818 |
| 18 | Ga0070683_100017909 | 3300005329 | Bacteria | 6262 |
| 19 | Ga0070683_100169944 | 3300005329 | Bacteria | 2069 |
| 20 | Ga0070683_100416048 | 3300005329 | Bacteria | 1282 |
| 21 | Ga0070666_10076752 | 3300005335 | Bacteria | 2280 |
| 22 | Ga0070680_100057043 | 3300005336 | Bacteria | 3192 |
| 23 | Ga0068868_100050735 | 3300005338 | Bacteria | 3260 |
| 24 | Ga0070660_100112655 | 3300005339 | Bacteria | 2166 |
| 25 | Ga0070660_100477563 | 3300005339 | Bacteria | 1036 |
| 26 | Ga0070661_100722323 | 3300005344 | Unclassified | 813 |
| 27 | Ga0070661_101368776 | 3300005344 | Unclassified | 595 |
| 28 | Ga0070668_100039698 | 3300005347 | Bacteria | 3599 |
| 29 | Ga0070668_100132908 | 3300005347 | Bacteria | 1998 |
| 30 | Ga0070668_100439227 | 3300005347 | Unclassified | 1120 |
| 31 | Ga0070671_100423786 | 3300005355 | Bacteria | 1140 |
| 32 | Ga0070673_101172994 | 3300005364 | Bacteria | 719 |
| 33 | Ga0070659_100157449 | 3300005366 | Bacteria | 1856 |
| 34 | Ga0070667_100057832 | 3300005367 | Bacteria | 3278 |
| 35 | Ga0070667_100731402 | 3300005367 | Bacteria | 917 |
| 36 | Ga0070709_10119176 | 3300005434 | Bacteria | 1786 |
| 37 | Ga0070709_10184010 | 3300005434 | Bacteria | 1469 |
| 38 | Ga0070709_10220009 | 3300005434 | Unclassified | 1354 |
| 39 | Ga0070714_100016729 | 3300005435 | Bacteria | 5930 |
| 40 | Ga0070714_100099710 | 3300005435 | Bacteria | 2557 |
| 41 | Ga0070714_100118753 | 3300005435 | Bacteria | 2350 |
| 42 | Ga0070714_101401821 | 3300005435 | Unclassified | 682 |
| 43 | Ga0070713_100008549 | 3300005436 | Bacteria | 7264 |
| 44 | Ga0070713_100076076 | 3300005436 | Bacteria | 2850 |
| 45 | Ga0070713_100119642 | 3300005436 | Bacteria | 2308 |
| 46 | Ga0070710_10001667 | 3300005437 | Bacteria | 10462 |
| 47 | Ga0070711_100186863 | 3300005439 | Bacteria | 1589 |
| 48 | Ga0070705_100340312 | 3300005440 | Bacteria | 1090 |
| 49 | Ga0070694_100089081 | 3300005444 | Bacteria | 2162 |
| 50 | Ga0070663_100064735 | 3300005455 | Bacteria | 2643 |
| 51 | Ga0070663_100924265 | 3300005455 | Bacteria | 755 |
| 52 | Ga0070662_100422018 | 3300005457 | Bacteria | 1103 |
| 53 | Ga0070662_100677094 | 3300005457 | Bacteria | 871 |
| 54 | Ga0070681_10011710 | 3300005458 | Bacteria | 8689 |
| 55 | Ga0070681_10746408 | 3300005458 | Bacteria | 895 |
| 56 | Ga0068867_100056149 | 3300005459 | Bacteria | 2913 |
| 57 | Ga0070679_100079922 | 3300005530 | Bacteria | 3259 |
| 58 | Ga0070679_100088482 | 3300005530 | Bacteria | 3084 |
| 59 | Ga0070684_100006061 | 3300005535 | Bacteria | 9319 |
| 60 | Ga0070684_100043340 | 3300005535 | Bacteria | 3885 |
| 61 | Ga0070697_100850165 | 3300005536 | Bacteria | 808 |
| 62 | Ga0068853_100088835 | 3300005539 | Bacteria | 2713 |
| 63 | Ga0068853_101210068 | 3300005539 | Bacteria | 729 |
| 64 | Ga0068853_101239188 | 3300005539 | Bacteria | 720 |
| 65 | Ga0070695_100181072 | 3300005545 | Bacteria | 1493 |
| 66 | Ga0070696_100584339 | 3300005546 | Bacteria | 899 |
| 67 | Ga0070696_100782785 | 3300005546 | Bacteria | 784 |
| 68 | Ga0070693_100284914 | 3300005547 | Bacteria | 1108 |
| 69 | Ga0070665_100466693 | 3300005548 | Bacteria | 1273 |
| 70 | Ga0070704_100041436 | 3300005549 | Bacteria | 3178 |
| 71 | Ga0068855_100141353 | 3300005563 | Bacteria | 2744 |
| 72 | Ga0068855_100144379 | 3300005563 | Bacteria | 2711 |
| 73 | Ga0068855_100282696 | 3300005563 | Bacteria | 1842 |
| 74 | Ga0070664_100916624 | 3300005564 | Bacteria | 822 |
| 75 | Ga0068857_100265734 | 3300005577 | Bacteria | 1576 |
| 76 | Ga0068857_100418176 | 3300005577 | Bacteria | 1249 |
| 77 | Ga0068857_100781668 | 3300005577 | Bacteria | 911 |
| 78 | Ga0068857_101127442 | 3300005577 | Bacteria | 758 |
| 79 | Ga0068854_100061469 | 3300005578 | Bacteria | 2721 |
| 80 | Ga0068854_101272757 | 3300005578 | Bacteria | 661 |
| 81 | Ga0068856_100053937 | 3300005614 | Bacteria | 3964 |
| 82 | Ga0068856_101337351 | 3300005614 | Unclassified | 731 |
| 83 | Ga0068852_100190613 | 3300005616 | Bacteria | 1934 |
| 84 | Ga0068852_100356082 | 3300005616 | Bacteria | 1430 |
| 85 | Ga0068852_101391393 | 3300005616 | Bacteria | 723 |
| 86 | Ga0068859_101542298 | 3300005617 | Bacteria | 733 |
| 87 | Ga0068861_100252605 | 3300005719 | Bacteria | 1505 |
| 88 | Ga0068861_100943138 | 3300005719 | Bacteria | 820 |
| 89 | Ga0068863_100095913 | 3300005841 | Bacteria | 2815 |
| 90 | Ga0068858_100589770 | 3300005842 | Bacteria | 1078 |
| 91 | Ga0068862_100183806 | 3300005844 | Bacteria | 1878 |
| 92 | Ga0068862_100770168 | 3300005844 | Bacteria | 938 |
| 93 | Ga0081540_1015533 | 3300005983 | Bacteria | 4817 |
| 94 | Ga0081539_10005072 | 3300005985 | Bacteria | 13803 |
| 95 | Ga0081539_10010606 | 3300005985 | Bacteria | 7443 |
| 96 | Ga0070717_10058208 | 3300006028 | Bacteria | 3196 |
| 97 | Ga0070717_10141687 | 3300006028 | Bacteria | 2074 |
| 98 | Ga0070717_10203050 | 3300006028 | Bacteria | 1737 |
| 99 | Ga0070717_11127577 | 3300006028 | Bacteria | 714 |
| 100 | Ga0075365_10012372 | 3300006038 | Bacteria | 5067 |
| 101 | Ga0075365_10016667 | 3300006038 | Bacteria | 4475 |
| 102 | Ga0075365_10018063 | 3300006038 | Bacteria | 4329 |
| 103 | Ga0075368_10000989 | 3300006042 | Bacteria | 8888 |
| 104 | Ga0075368_10237413 | 3300006042 | Bacteria | 777 |
| 105 | Ga0075363_100016183 | 3300006048 | Bacteria | 3680 |
| 106 | Ga0075363_100062529 | 3300006048 | Bacteria | 2007 |
| 107 | Ga0070715_10005523 | 3300006163 | Bacteria | 4223 |
| 108 | Ga0070715_10760494 | 3300006163 | Bacteria | 584 |
| 109 | Ga0070716_100072631 | 3300006173 | Bacteria | 2026 |
| 110 | Ga0070716_100219950 | 3300006173 | Bacteria | 1275 |
| 111 | Ga0070716_100981401 | 3300006173 | Bacteria | 667 |
| 112 | Ga0075362_10006919 | 3300006177 | Bacteria | 4253 |
| 113 | Ga0075367_10039462 | 3300006178 | Bacteria | 2753 |
| 114 | Ga0075367_10144872 | 3300006178 | Bacteria | 1473 |
| 115 | Ga0075369_10003294 | 3300006186 | Bacteria | 5865 |
| 116 | Ga0075369_10257643 | 3300006186 | Bacteria | 811 |
| 117 | Ga0075366_10211861 | 3300006195 | Bacteria | 1180 |
| 118 | Ga0075366_10262655 | 3300006195 | Bacteria | 1054 |
| 119 | Ga0075370_10147313 | 3300006353 | Bacteria | 1379 |
| 120 | Ga0075370_10168579 | 3300006353 | Bacteria | 1286 |
| 121 | Ga0075433_10073320 | 3300006852 | Bacteria | 3011 |
| 122 | Ga0075433_10482247 | 3300006852 | Unclassified | 1092 |
| 123 | Ga0075434_100176992 | 3300006871 | Bacteria | 2153 |
| 124 | Ga0097620_101542265 | 3300006931 | Bacteria | 733 |
| 125 | Ga0099824_1023338 | 3300006942 | Bacteria | 3857 |
| 126 | Ga0075435_100315683 | 3300007076 | Bacteria | 1337 |
| 127 | Ga0075435_100323470 | 3300007076 | Bacteria | 1320 |
| 128 | Ga0105240_10004584 | 3300009093 | Bacteria | 20953 |
| 129 | Ga0105240_10069753 | 3300009093 | Bacteria | 4350 |
| 130 | Ga0105240_10244791 | 3300009093 | Bacteria | 2077 |
| 131 | Ga0105240_11572669 | 3300009093 | Unclassified | 688 |
| 132 | Ga0105240_11602264 | 3300009093 | Bacteria | 681 |
| 133 | Ga0105245_10180057 | 3300009098 | Bacteria | 2019 |
| 134 | Ga0105245_10865830 | 3300009098 | Bacteria | 944 |
| 135 | Ga0105247_10197915 | 3300009101 | Bacteria | 1348 |
| 136 | Ga0114129_10543086 | 3300009147 | Bacteria | 1512 |
| 137 | Ga0105243_10106084 | 3300009148 | Bacteria | 2341 |
| 138 | Ga0105241_10040754 | 3300009174 | Bacteria | 3506 |
| 139 | Ga0105241_10044460 | 3300009174 | Bacteria | 3366 |
| 140 | Ga0105241_10341948 | 3300009174 | Bacteria | 1297 |
| 141 | Ga0105241_10715916 | 3300009174 | Bacteria | 915 |
| 142 | Ga0105241_11121406 | 3300009174 | Bacteria | 742 |
| 143 | Ga0105242_10449815 | 3300009176 | Bacteria | 1214 |
| 144 | Ga0105242_11560416 | 3300009176 | Bacteria | 693 |
| 145 | Ga0105248_10054112 | 3300009177 | Bacteria | 4501 |
| 146 | Ga0105248_10462583 | 3300009177 | Bacteria | 1430 |
| 147 | Ga0105237_10023098 | 3300009545 | Bacteria | 6377 |
| 148 | Ga0105237_10047367 | 3300009545 | Bacteria | 4322 |
| 149 | Ga0105237_10064969 | 3300009545 | Bacteria | 3645 |
| 150 | Ga0105237_10201308 | 3300009545 | Bacteria | 1991 |
| 151 | Ga0105237_10231407 | 3300009545 | Bacteria | 1849 |
| 152 | Ga0105237_10670249 | 3300009545 | Bacteria | 1044 |
| 153 | Ga0105238_10178245 | 3300009551 | Bacteria | 2102 |
| 154 | Ga0105238_10217586 | 3300009551 | Bacteria | 1886 |
| 155 | Ga0105249_10599983 | 3300009553 | Bacteria | 1156 |
| 156 | Ga0105249_10700257 | 3300009553 | Bacteria | 1073 |
| 157 | Ga0099796_10207935 | 3300010159 | Bacteria | 797 |
| 158 | Ga0105239_10214259 | 3300010375 | Bacteria | 2159 |
| 159 | Ga0105239_10353711 | 3300010375 | Bacteria | 1658 |
| 160 | Ga0105239_10361934 | 3300010375 | Bacteria | 1638 |
| 161 | Ga0105239_10549255 | 3300010375 | Bacteria | 1315 |
| 162 | Ga0105239_10729338 | 3300010375 | Bacteria | 1134 |
| 163 | Ga0105239_10882052 | 3300010375 | Bacteria | 1026 |
| 164 | Ga0105239_11646611 | 3300010375 | Bacteria | 742 |
| 165 | Ga0105246_10001672 | 3300011119 | Bacteria | 13215 |
| 166 | Ga0105246_10301829 | 3300011119 | Bacteria | 1293 |
| 167 | Ga0105246_10357717 | 3300011119 | Bacteria | 1198 |
| 168 | Ga0157370_10040959 | 3300013104 | Bacteria | 4471 |
| 169 | Ga0157370_10323113 | 3300013104 | Bacteria | 1423 |
| 170 | Ga0157370_10636452 | 3300013104 | Unclassified | 975 |
| 171 | Ga0157370_10771548 | 3300013104 | Bacteria | 875 |
| 172 | Ga0157369_10009617 | 3300013105 | Bacteria | 11053 |
| 173 | Ga0157369_10017510 | 3300013105 | Bacteria | 8052 |
| 174 | Ga0157369_10035736 | 3300013105 | Bacteria | 5447 |
| 175 | Ga0157374_10178120 | 3300013296 | Bacteria | 2076 |
| 176 | Ga0157372_10182732 | 3300013307 | Bacteria | 2428 |
| 177 | Ga0157372_10280047 | 3300013307 | Bacteria | 1939 |
| 178 | Ga0157372_10289568 | 3300013307 | Bacteria | 1905 |
| 179 | Ga0163163_10033755 | 3300014325 | Bacteria | 4952 |
| 180 | Ga0163163_10116197 | 3300014325 | Bacteria | 2707 |
| 181 | Ga0163163_10545170 | 3300014325 | Bacteria | 1222 |
| 182 | Ga0157380_11927563 | 3300014326 | Bacteria | 652 |
| 183 | Ga0182008_10922254 | 3300014497 | Bacteria | 515 |
| 184 | Ga0157379_12186131 | 3300014968 | Bacteria | 549 |
| 185 | Ga0157376_10373687 | 3300014969 | Bacteria | 1371 |
| 186 | Ga0163161_10566321 | 3300017792 | Bacteria | 933 |
| 187 | Ga0163161_10934786 | 3300017792 | Bacteria | 737 |
| 188 | Ga0213872_10069255 | 3300021361 | Bacteria | 1591 |
| 189 | Ga0213876_10164609 | 3300021384 | Bacteria | 1180 |
| 190 | Ga0209148_1001125 | 3300025254 | Bacteria | 15820 |
| 191 | Ga0209233_1001284 | 3300025261 | Bacteria | 10048 |
| 192 | Ga0209233_1013491 | 3300025261 | Bacteria | 2332 |
| 193 | Ga0209233_1036124 | 3300025261 | Bacteria | 1109 |
| 194 | Ga0209455_1001274 | 3300025272 | Bacteria | 11798 |
| 195 | Ga0209673_1036341 | 3300025273 | Bacteria | 1463 |
| 196 | Ga0209564_1004893 | 3300025295 | Bacteria | 7945 |
| 197 | Ga0209564_1025459 | 3300025295 | Bacteria | 1988 |
| 198 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 199 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 200 | Ga0209758_1001547 | 3300025297 | Bacteria | 26412 |
| 201 | Ga0209758_1003623 | 3300025297 | Bacteria | 13819 |
| 202 | Ga0209758_1051081 | 3300025297 | Bacteria | 1443 |
| 203 | Ga0209758_1112845 | 3300025297 | Bacteria | 748 |
| 204 | Ga0209256_1002195 | 3300025299 | Bacteria | 16729 |
| 205 | Ga0207426_1000212 | 3300025302 | Bacteria | 137314 |
| 206 | Ga0207426_1008337 | 3300025302 | Bacteria | 4201 |
| 207 | Ga0207426_1044817 | 3300025302 | Bacteria | 1349 |
| 208 | Ga0209051_1109437 | 3300025303 | Bacteria | 724 |
| 209 | Ga0209257_1001276 | 3300025304 | Bacteria | 30845 |
| 210 | Ga0209257_1024892 | 3300025304 | Bacteria | 2059 |
| 211 | Ga0209257_1068782 | 3300025304 | Bacteria | 939 |
| 212 | Ga0207697_10045996 | 3300025315 | Bacteria | 1797 |
| 213 | Ga0207692_10001482 | 3300025898 | Bacteria | 8804 |
| 214 | Ga0207710_10208115 | 3300025900 | Bacteria | 968 |
| 215 | Ga0207688_10545517 | 3300025901 | Bacteria | 728 |
| 216 | Ga0207680_10255399 | 3300025903 | Bacteria | 1212 |
| 217 | Ga0207647_10237108 | 3300025904 | Bacteria | 1048 |
| 218 | Ga0207647_10554538 | 3300025904 | Bacteria | 637 |
| 219 | Ga0207685_10027127 | 3300025905 | Bacteria | 2001 |
| 220 | Ga0207699_10032198 | 3300025906 | Bacteria | 2953 |
| 221 | Ga0207699_10090245 | 3300025906 | Bacteria | 1922 |
| 222 | Ga0207699_10163510 | 3300025906 | Bacteria | 1483 |
| 223 | Ga0207699_10935051 | 3300025906 | Bacteria | 640 |
| 224 | Ga0207645_10187157 | 3300025907 | Bacteria | 1360 |
| 225 | Ga0207654_10062578 | 3300025911 | Bacteria | 2181 |
| 226 | Ga0207654_10188560 | 3300025911 | Bacteria | 1350 |
| 227 | Ga0207654_10577605 | 3300025911 | Bacteria | 800 |
| 228 | Ga0207707_11496698 | 3300025912 | Bacteria | 535 |
| 229 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 230 | Ga0207695_10047532 | 3300025913 | Bacteria | 4540 |
| 231 | Ga0207695_10117620 | 3300025913 | Bacteria | 2630 |
| 232 | Ga0207671_10008503 | 3300025914 | Bacteria | 8696 |
| 233 | Ga0207671_10022555 | 3300025914 | Bacteria | 4757 |
| 234 | Ga0207671_10504191 | 3300025914 | Bacteria | 965 |
| 235 | Ga0207671_10709221 | 3300025914 | Bacteria | 800 |
| 236 | Ga0207693_10001156 | 3300025915 | Bacteria | 23542 |
| 237 | Ga0207663_10000774 | 3300025916 | Bacteria | 14300 |
| 238 | Ga0207663_10326618 | 3300025916 | Unclassified | 1154 |
| 239 | Ga0207660_10345243 | 3300025917 | Bacteria | 1192 |
| 240 | Ga0207657_10185200 | 3300025919 | Bacteria | 1682 |
| 241 | Ga0207652_10070642 | 3300025921 | Bacteria | 3032 |
| 242 | Ga0207681_10101475 | 3300025923 | Bacteria | 2076 |
| 243 | Ga0207694_10081238 | 3300025924 | Bacteria | 2546 |
| 244 | Ga0207694_10442381 | 3300025924 | Bacteria | 1085 |
| 245 | Ga0207694_10506883 | 3300025924 | Bacteria | 1011 |
| 246 | Ga0207687_10806432 | 3300025927 | Bacteria | 801 |
| 247 | Ga0207700_10069520 | 3300025928 | Bacteria | 2703 |
| 248 | Ga0207700_10123165 | 3300025928 | Bacteria | 2105 |
| 249 | Ga0207700_10345523 | 3300025928 | Bacteria | 1294 |
| 250 | Ga0207664_10006986 | 3300025929 | Bacteria | 7812 |
| 251 | Ga0207664_10113258 | 3300025929 | Bacteria | 2259 |
| 252 | Ga0207664_10288286 | 3300025929 | Bacteria | 1442 |
| 253 | Ga0207664_11182723 | 3300025929 | Unclassified | 682 |
| 254 | Ga0207644_10354925 | 3300025931 | Bacteria | 1191 |
| 255 | Ga0207690_10130490 | 3300025932 | Bacteria | 1838 |
| 256 | Ga0207706_10159994 | 3300025933 | Bacteria | 1980 |
| 257 | Ga0207709_10090913 | 3300025935 | Bacteria | 1995 |
| 258 | Ga0207665_10001062 | 3300025939 | Bacteria | 18496 |
| 259 | Ga0207665_10096835 | 3300025939 | Bacteria | 2053 |
| 260 | Ga0207665_11024231 | 3300025939 | Bacteria | 657 |
| 261 | Ga0207711_10016867 | 3300025941 | Bacteria | 6065 |
| 262 | Ga0207661_10000190 | 3300025944 | Bacteria | 39991 |
| 263 | Ga0207661_10062281 | 3300025944 | Bacteria | 3017 |
| 264 | Ga0207661_10340561 | 3300025944 | Bacteria | 1351 |
| 265 | Ga0207661_11011680 | 3300025944 | Bacteria | 765 |
| 266 | Ga0207679_10229673 | 3300025945 | Bacteria | 1566 |
| 267 | Ga0207679_10273253 | 3300025945 | Bacteria | 1446 |
| 268 | Ga0207667_10084727 | 3300025949 | Bacteria | 3281 |
| 269 | Ga0207667_10221492 | 3300025949 | Bacteria | 1939 |
| 270 | Ga0207667_10508999 | 3300025949 | Bacteria | 1220 |
| 271 | Ga0207667_11674052 | 3300025949 | Bacteria | 603 |
| 272 | Ga0207651_11138846 | 3300025960 | Bacteria | 700 |
| 273 | Ga0207712_10633446 | 3300025961 | Bacteria | 928 |
| 274 | Ga0207668_10083194 | 3300025972 | Bacteria | 2328 |
| 275 | Ga0207640_10050050 | 3300025981 | Bacteria | 2709 |
| 276 | Ga0207640_10339261 | 3300025981 | Bacteria | 1203 |
| 277 | Ga0207640_10485003 | 3300025981 | Bacteria | 1026 |
| 278 | Ga0207677_10105547 | 3300026023 | Bacteria | 2085 |
| 279 | Ga0207703_11240908 | 3300026035 | Bacteria | 717 |
| 280 | Ga0207639_10026248 | 3300026041 | Bacteria | 4232 |
| 281 | Ga0207639_10613725 | 3300026041 | Bacteria | 1004 |
| 282 | Ga0207639_11361525 | 3300026041 | Bacteria | 666 |
| 283 | Ga0207678_10041188 | 3300026067 | Bacteria | 4004 |
| 284 | Ga0207678_10286652 | 3300026067 | Bacteria | 1414 |
| 285 | Ga0207678_10499649 | 3300026067 | Bacteria | 1060 |
| 286 | Ga0207702_10031891 | 3300026078 | Bacteria | 4396 |
| 287 | Ga0207702_10598867 | 3300026078 | Bacteria | 1081 |
| 288 | Ga0207641_10057511 | 3300026088 | Bacteria | 3308 |
| 289 | Ga0207648_10085270 | 3300026089 | Bacteria | 2756 |
| 290 | Ga0207676_10910950 | 3300026095 | Bacteria | 863 |
| 291 | Ga0207674_10015898 | 3300026116 | Bacteria | 8248 |
| 292 | Ga0207674_10114889 | 3300026116 | Bacteria | 2664 |
| 293 | Ga0207674_10647811 | 3300026116 | Bacteria | 1020 |
| 294 | Ga0207674_10751436 | 3300026116 | Bacteria | 941 |
| 295 | Ga0207675_100152003 | 3300026118 | Bacteria | 2203 |
| 296 | Ga0207683_10112495 | 3300026121 | Bacteria | 2438 |
| 297 | Ga0207698_10043427 | 3300026142 | Bacteria | 3367 |
| 298 | Ga0207698_11010026 | 3300026142 | Bacteria | 843 |
| 299 | Ga0209389_1000186 | 3300027296 | Bacteria | 47149 |
| 300 | Ga0209389_1000261 | 3300027296 | Bacteria | 33507 |
| 301 | Ga0209589_1001077 | 3300027357 | Bacteria | 43273 |
| 302 | Ga0209489_100176 | 3300027361 | Bacteria | 100053 |
| 303 | Ga0209489_107409 | 3300027361 | Bacteria | 16395 |
| 304 | Ga0209700_101165 | 3300027363 | Bacteria | 53492 |
| 305 | Ga0209813_10030253 | 3300027866 | Bacteria | 1590 |
| 306 | Ga0268266_10117064 | 3300028379 | Bacteria | 2368 |
| 307 | Ga0268266_10521717 | 3300028379 | Bacteria | 1136 |
| 308 | Ga0265330_10140373 | 3300031235 | Bacteria | 1027 |
| 309 | Ga0265325_10032964 | 3300031241 | Bacteria | 2763 |
| 310 | Ga0265339_10013152 | 3300031249 | Bacteria | 5023 |
| 311 | Ga0307508_10380130 | 3300031616 | Bacteria | 1003 |
| 312 | Ga0265314_10379221 | 3300031711 | Bacteria | 770 |
| 313 | Ga0307507_10481356 | 3300033179 | Bacteria | 675 |
| 314 | Ga0307510_10286009 | 3300033180 | Bacteria | 1117 |
| 315 | Ga0373926_0012014 | 3300035083 | Bacteria | 2923 |
| 316 | Ga0373944_0190036 | 3300035089 | Unclassified | 740 |
| 317 | Ga0373923_0011082 | 3300035111 | Bacteria | 3298 |
| 318 | Ga0373936_0011222 | 3300035113 | Bacteria | 3388 |
| 319 | Ga0373954_0076415 | 3300035118 | Bacteria | 1596 |
| 320 | Ga0373956_0098972 | 3300035119 | Bacteria | 1351 |
| 321 | Ga0373943_0015344 | 3300035170 | Bacteria | 3478 |
| 322 | Ga0373946_0053370 | 3300035171 | Bacteria | 1697 |
| 323 | Ga0373962_0396499 | 3300035242 | Bacteria | 507 |
| 324 | Ga0373924_0023904 | 3300035410 | Bacteria | 2403 |
| 325 | Ga0373924_0131754 | 3300035410 | Bacteria | 1088 |
| 326 | Ga0373935_0133129 | 3300035692 | Bacteria | 1672 |
| 327 | Ga0373927_0073192 | 3300035695 | Bacteria | 2218 |
| 328 | Ga0373933_0083502 | 3300035724 | Bacteria | 1962 |
| 329 | Ga0373933_0236463 | 3300035724 | Bacteria | 1174 |
| 330 | Ga0373947_0026121 | 3300035725 | Bacteria | 3409 |
| 331 | Ga0373937_0344386 | 3300036401 | Bacteria | 1411 |
| 332 | Ga0373937_1210860 | 3300036401 | Bacteria | 704 |
| 333 | Ga0373925_0046619 | 3300037068 | Bacteria | 3223 |
| 334 | Ga0395899_0119304 | 3300037312 | Bacteria | 1891 |
| 335 | Ga0395899_0231961 | 3300037312 | Bacteria | 1274 |
| 336 | Ga0395900_0019004 | 3300037418 | Bacteria | 7008 |
| 337 | Ga0395900_0193921 | 3300037418 | Unclassified | 2059 |
| 338 | Ga0395898_0006007 | 3300037466 | Bacteria | 13037 |
| 339 | Ga0395898_0011066 | 3300037466 | Bacteria | 9397 |
| 340 | Ga0395898_0464568 | 3300037466 | Bacteria | 1205 |
| 341 | Ga0395898_0746904 | 3300037466 | Bacteria | 920 |
| 342 | Ga0395905_0003820 | 3300037471 | Bacteria | 15925 |
| 343 | Ga0395905_0444058 | 3300037471 | Bacteria | 1195 |
| 344 | Ga0395901_0034499 | 3300038443 | Bacteria | 5225 |
| 345 | Ga0395901_0230035 | 3300038443 | Bacteria | 1936 |
| 346 | Ga0395901_0258400 | 3300038443 | Bacteria | 1813 |
| 347 | Ga0436365_0474195 | 3300039437 | Bacteria | 5476 |
| 348 | Ga0436365_0716502 | 3300039437 | Bacteria | 864 |
| 349 | Ga0436360_0119024 | 3300039438 | Bacteria | 999 |
| 350 | Ga0436361_0072738 | 3300039447 | Bacteria | 2452 |
| 351 | Ga0436363_0587036 | 3300039450 | Bacteria | 838 |
| 352 | Ga0451795_1700028 | 3300041456 | Bacteria | 869 |
| 353 | Ga0451841_0329692 | 3300041498 | Bacteria | 1342 |
| 354 | Ga0451845_0481100 | 3300041501 | Bacteria | 787 |
| 355 | Ga0451853_1845826 | 3300041512 | Bacteria | 845 |
| 356 | Ga0466969_0025866 | 3300044656 | Bacteria | 3014 |
| 357 | Ga0466972_0000394 | 3300044658 | Bacteria | 23185 |
| 358 | Ga0466972_0025885 | 3300044658 | Bacteria | 2907 |
| 359 | Ga0466965_0132210 | 3300044683 | Bacteria | 1295 |
| 360 | Ga0466966_0001791 | 3300044684 | Bacteria | 13935 |
| 361 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 362 | Ga0466961_0908456 | 3300044693 | Bacteria | 524 |
| 363 | Ga0466963_0053240 | 3300044694 | Bacteria | 2687 |
| 364 | Ga0466963_0134134 | 3300044694 | Bacteria | 1712 |
| 365 | Ga0466964_0043048 | 3300044706 | Bacteria | 1831 |
| 366 | Ga0466968_0000345 | 3300044735 | Bacteria | 14999 |
| 367 | Ga0466970_0263636 | 3300044765 | Bacteria | 967 |
| 368 | Ga0466957_0098732 | 3300044842 | Bacteria | 1838 |
| 369 | Ga0466957_0187800 | 3300044842 | Bacteria | 1352 |
| 370 | Ga0466960_0008575 | 3300044901 | Bacteria | 4189 |
| 371 | Ga0466959_0001046 | 3300045049 | Bacteria | 16580 |
| 372 | Ga0466959_0158412 | 3300045049 | Bacteria | 1592 |
| 373 | Ga0466959_0377237 | 3300045049 | Bacteria | 965 |
| 374 | Ga0466958_0188986 | 3300045836 | Bacteria | 1309 |
| 375 | Ga0466967_0768316 | 3300045976 | Bacteria | 956 |
| 376 | Ga0466967_1328126 | 3300045976 | Bacteria | 716 |
| 377 | Ga0495592_0124465 | 3300046454 | Bacteria | 1810 |
| 378 | Ga0495603_0186196 | 3300046455 | Unclassified | 1201 |
| 379 | Ga0495603_0307197 | 3300046455 | Bacteria | 911 |
| 380 | Ga0495629_0001349 | 3300046459 | Bacteria | 19349 |
| 381 | Ga0495629_0046141 | 3300046459 | Bacteria | 3057 |
| 382 | Ga0495629_0544241 | 3300046459 | Bacteria | 780 |
| 383 | Ga0495641_0149921 | 3300046461 | Bacteria | 1042 |
| 384 | Ga0495651_0037351 | 3300046462 | Bacteria | 3781 |
| 385 | Ga0495651_0285423 | 3300046462 | Bacteria | 1113 |
| 386 | Ga0495653_0046667 | 3300046463 | Bacteria | 3354 |
| 387 | Ga0495653_0260403 | 3300046463 | Unclassified | 1147 |
| 388 | Ga0495580_0032957 | 3300046472 | Bacteria | 3733 |
| 389 | Ga0495605_0062333 | 3300046474 | Bacteria | 1782 |
| 390 | Ga0495639_0007468 | 3300046475 | Bacteria | 4692 |
| 391 | Ga0495662_0033737 | 3300046476 | Bacteria | 2473 |
| 392 | Ga0495664_0005395 | 3300046477 | Bacteria | 7020 |
| 393 | Ga0495664_0009101 | 3300046477 | Bacteria | 5550 |
| 394 | Ga0495664_0068001 | 3300046477 | Bacteria | 2126 |
| 395 | Ga0495584_0267678 | 3300046491 | Bacteria | 869 |
| 396 | Ga0495594_0153819 | 3300046499 | Bacteria | 1306 |
| 397 | Ga0495594_0178103 | 3300046499 | Bacteria | 1210 |
| 398 | Ga0495596_0046732 | 3300046500 | Bacteria | 1700 |
| 399 | Ga0495607_0198441 | 3300046501 | Bacteria | 995 |
| 400 | Ga0495583_0261396 | 3300046506 | Bacteria | 692 |
| 401 | Ga0495583_0313339 | 3300046506 | Bacteria | 622 |
| 402 | Ga0495606_0031464 | 3300046507 | Bacteria | 3689 |
| 403 | Ga0495606_0061128 | 3300046507 | Bacteria | 2410 |
| 404 | Ga0495606_0095256 | 3300046507 | Bacteria | 1823 |
| 405 | Ga0495606_0437164 | 3300046507 | Bacteria | 673 |
| 406 | Ga0495610_0287098 | 3300046512 | Bacteria | 639 |
| 407 | Ga0495616_0030405 | 3300046513 | Bacteria | 2839 |
| 408 | Ga0495618_0038330 | 3300046514 | Bacteria | 3012 |
| 409 | Ga0495628_0044488 | 3300046516 | Bacteria | 3532 |
| 410 | Ga0495630_0040595 | 3300046517 | Bacteria | 3478 |
| 411 | Ga0495630_0082095 | 3300046517 | Bacteria | 2433 |
| 412 | Ga0495630_0464646 | 3300046517 | Bacteria | 970 |
| 413 | Ga0495630_0955098 | 3300046517 | Bacteria | 652 |
| 414 | Ga0495643_0195959 | 3300046522 | Bacteria | 973 |
| 415 | Ga0495648_0066376 | 3300046524 | Bacteria | 2115 |
| 416 | Ga0495648_0230411 | 3300046524 | Bacteria | 907 |
| 417 | Ga0495642_0114644 | 3300046528 | Bacteria | 1154 |
| 418 | Ga0495652_0018046 | 3300046529 | Bacteria | 6294 |
| 419 | Ga0495652_0116141 | 3300046529 | Bacteria | 2143 |
| 420 | Ga0495665_0008372 | 3300046531 | Bacteria | 5609 |
| 421 | Ga0495640_0046425 | 3300046533 | Bacteria | 3009 |
| 422 | Ga0495640_0127369 | 3300046533 | Bacteria | 1650 |
| 423 | Ga0495586_0059437 | 3300046535 | Bacteria | 2077 |
| 424 | Ga0495587_0036830 | 3300046536 | Bacteria | 2941 |
| 425 | Ga0495609_0176428 | 3300046538 | Bacteria | 901 |
| 426 | Ga0495597_0270500 | 3300046542 | Bacteria | 664 |
| 427 | Ga0495645_0084724 | 3300046543 | Bacteria | 2269 |
| 428 | Ga0495645_0137875 | 3300046543 | Bacteria | 1705 |
| 429 | Ga0495622_0022994 | 3300046557 | Bacteria | 2905 |
| 430 | Ga0495622_0057029 | 3300046557 | Bacteria | 1811 |
| 431 | Ga0495667_0144643 | 3300046559 | Bacteria | 1532 |
| 432 | Ga0495667_0625366 | 3300046559 | Bacteria | 670 |
| 433 | Ga0495668_0025808 | 3300046616 | Bacteria | 3337 |
| 434 | Ga0495634_0039534 | 3300046642 | Bacteria | 3212 |
| 435 | Ga0495634_0084636 | 3300046642 | Bacteria | 2067 |
| 436 | Ga0495625_0066520 | 3300046660 | Bacteria | 2538 |
| 437 | Ga0495625_0314387 | 3300046660 | Bacteria | 999 |
| 438 | Ga0495635_0001321 | 3300046663 | Bacteria | 16507 |
| 439 | Ga0495635_0242760 | 3300046663 | Bacteria | 1215 |
| 440 | Ga0495635_0522754 | 3300046663 | Bacteria | 780 |
| 441 | Ga0495661_0289692 | 3300046665 | Bacteria | 823 |
| 442 | Ga0495588_0005349 | 3300046674 | Bacteria | 5710 |
| 443 | Ga0495588_0299149 | 3300046674 | Bacteria | 847 |
| 444 | Ga0495657_0011371 | 3300046675 | Bacteria | 6658 |
| 445 | Ga0495657_0027251 | 3300046675 | Bacteria | 4035 |
| 446 | Ga0495657_0342169 | 3300046675 | Bacteria | 886 |
| 447 | Ga0495599_0363763 | 3300046678 | Bacteria | 866 |
| 448 | Ga0495623_0005927 | 3300046679 | Bacteria | 7963 |
| 449 | Ga0495623_0177932 | 3300046679 | Bacteria | 1238 |
| 450 | Ga0495646_0076556 | 3300046680 | Bacteria | 1959 |
| 451 | Ga0495646_0167554 | 3300046680 | Bacteria | 1212 |
| 452 | Ga0495658_0102775 | 3300046683 | Bacteria | 1708 |
| 453 | Ga0495613_0094799 | 3300046689 | Bacteria | 2159 |
| 454 | Ga0495624_0019101 | 3300046690 | Bacteria | 4578 |
| 455 | Ga0495624_0024259 | 3300046690 | Bacteria | 3992 |
| 456 | Ga0495649_0063070 | 3300046694 | Bacteria | 1992 |
| 457 | Ga0495649_0207707 | 3300046694 | Bacteria | 1015 |
| 458 | Ga0495600_0002477 | 3300046809 | Bacteria | 10603 |
| 459 | Ga0495600_0329867 | 3300046809 | Bacteria | 958 |
| 460 | Ga0495581_0028575 | 3300047315 | Bacteria | 3232 |
| 461 | Ga0495581_0098754 | 3300047315 | Bacteria | 1696 |
| 462 | Ga0495604_0018932 | 3300047317 | Bacteria | 5514 |
| 463 | Ga0495604_0027180 | 3300047317 | Bacteria | 4552 |
| 464 | Ga0495674_0004826 | 3300047319 | Bacteria | 12966 |
| 465 | Ga0495674_0020467 | 3300047319 | Bacteria | 6123 |
| 466 | Ga0495674_1181351 | 3300047319 | Bacteria | 579 |
| 467 | Ga0495672_0297999 | 3300047320 | Bacteria | 765 |
| 468 | Ga0495676_0152022 | 3300047321 | Bacteria | 1646 |
| 469 | Ga0495680_0002514 | 3300047322 | Bacteria | 18756 |
| 470 | Ga0495683_0016642 | 3300047323 | Bacteria | 3816 |
| 471 | Ga0495687_011407 | 3300047443 | Bacteria | 4783 |
| 472 | Ga0495675_0047583 | 3300047444 | Bacteria | 2729 |
| 473 | Ga0495675_0455676 | 3300047444 | Bacteria | 739 |
| 474 | Ga0495675_0489409 | 3300047444 | Unclassified | 707 |
| 475 | Ga0495677_0208465 | 3300047445 | Bacteria | 760 |
| 476 | Ga0495685_187606 | 3300047447 | Bacteria | 665 |
| 477 | Ga0495673_0056674 | 3300047469 | Bacteria | 1694 |
| 478 | Ga0495673_0112432 | 3300047469 | Bacteria | 1087 |
| 479 | Ga0495673_0351081 | 3300047469 | Bacteria | 520 |
| 480 | Ga0495684_0023802 | 3300047471 | Bacteria | 4709 |
| 481 | Ga0495684_0550805 | 3300047471 | Bacteria | 785 |
| 482 | Ga0495686_0190737 | 3300047472 | Bacteria | 1182 |
| 483 | Ga0495593_0021510 | 3300047673 | Bacteria | 3602 |
| 484 | Ga0495593_0050639 | 3300047673 | Bacteria | 2200 |
| 485 | Ga0495602_0021970 | 3300048088 | Bacteria | 6257 |
| 486 | Ga0495602_0199872 | 3300048088 | Bacteria | 1526 |
| 487 | Ga0495602_0630935 | 3300048088 | Bacteria | 734 |
| 488 | Ga0495602_1163322 | 3300048088 | Bacteria | 504 |
| 489 | Ga0495614_0250556 | 3300048089 | Unclassified | 810 |
| 490 | Ga0496100_0366780 | 3300048903 | Bacteria | 1091 |
| 491 | Ga0496100_0446077 | 3300048903 | Bacteria | 991 |
| 492 | Ga0496101_0241042 | 3300048904 | Bacteria | 1407 |
| 493 | Ga0496101_0294036 | 3300048904 | Bacteria | 1271 |
| 494 | Ga0496101_0323288 | 3300048904 | Bacteria | 1210 |
| 495 | Ga0496101_0694559 | 3300048904 | Bacteria | 803 |
| 496 | Ga0496102_0041667 | 3300048905 | Bacteria | 4159 |
| 497 | Ga0496102_0092325 | 3300048905 | Bacteria | 2803 |
| 498 | Ga0496102_0105120 | 3300048905 | Bacteria | 2627 |
| 499 | Ga0496102_0480590 | 3300048905 | Bacteria | 1164 |
| 500 | Ga0496103_0008108 | 3300048906 | Bacteria | 6238 |
| 501 | Ga0496103_0114068 | 3300048906 | Bacteria | 1718 |
| 502 | Ga0496104_0167585 | 3300048907 | Bacteria | 2106 |
| 503 | Ga0496104_0177900 | 3300048907 | Bacteria | 2037 |
| 504 | Ga0496104_0478564 | 3300048907 | Bacteria | 1156 |
| 505 | Ga0496105_0007693 | 3300048908 | Bacteria | 8356 |
| 506 | Ga0496105_0090967 | 3300048908 | Bacteria | 2520 |
| 507 | Ga0496105_0185299 | 3300048908 | Bacteria | 1703 |
| 508 | Ga0496105_0220093 | 3300048908 | Bacteria | 1546 |
| 509 | Ga0496106_0002906 | 3300048909 | Bacteria | 12746 |
| 510 | Ga0496107_0109400 | 3300048910 | Bacteria | 2030 |
| 511 | Ga0496108_0029631 | 3300048911 | Bacteria | 4534 |
| 512 | Ga0496108_0466442 | 3300048911 | Bacteria | 1103 |
| 513 | Ga0496108_0510089 | 3300048911 | Bacteria | 1050 |
| 514 | Ga0496109_0021733 | 3300048912 | Bacteria | 5678 |
| 515 | Ga0496109_0295026 | 3300048912 | Bacteria | 1529 |
| 516 | Ga0496109_0454468 | 3300048912 | Bacteria | 1210 |
| 517 | Ga0496110_0026859 | 3300048913 | Bacteria | 4930 |
| 518 | Ga0496110_0092468 | 3300048913 | Bacteria | 2707 |
| 519 | Ga0496110_0102619 | 3300048913 | Bacteria | 2565 |
| 520 | Ga0496110_0682797 | 3300048913 | Bacteria | 928 |
| 521 | Ga0496110_0859777 | 3300048913 | Bacteria | 812 |
| 522 | Ga0496111_0626187 | 3300048914 | Bacteria | 786 |
| 523 | Ga0496111_0662585 | 3300048914 | Unclassified | 761 |
| 524 | Ga0496112_0020223 | 3300048915 | Bacteria | 6304 |
| 525 | Ga0496112_0057068 | 3300048915 | Bacteria | 3843 |
| 526 | Ga0496112_1121637 | 3300048915 | Bacteria | 704 |
| 527 | Ga0496113_0188784 | 3300048916 | Bacteria | 1635 |
| 528 | Ga0496113_0227362 | 3300048916 | Bacteria | 1487 |
| 529 | Ga0496113_0319323 | 3300048916 | Bacteria | 1245 |
| 530 | Ga0496113_0924216 | 3300048916 | Bacteria | 689 |
| 531 | Ga0496113_1545756 | 3300048916 | Bacteria | 511 |
| 532 | Ga0496113_1605449 | 3300048916 | Bacteria | 500 |
| 533 | Ga0496114_0037855 | 3300048917 | Bacteria | 3991 |
| 534 | Ga0496114_0065276 | 3300048917 | Bacteria | 3050 |
| 535 | Ga0496115_0192853 | 3300048918 | Bacteria | 1683 |
| 536 | Ga0496115_0793048 | 3300048918 | Bacteria | 738 |
| 537 | Ga0496116_0025848 | 3300048919 | Bacteria | 4306 |
| 538 | Ga0496117_0085016 | 3300048920 | Bacteria | 2062 |
| 539 | Ga0496118_0026627 | 3300048921 | Bacteria | 4919 |
| 540 | Ga0496118_0043946 | 3300048921 | Bacteria | 3505 |
| 541 | Ga0496118_0504902 | 3300048921 | Bacteria | 600 |
| 542 | Ga0496119_0051350 | 3300048922 | Bacteria | 2534 |
| 543 | Ga0496119_0320577 | 3300048922 | Bacteria | 759 |
| 544 | Ga0496119_0411445 | 3300048922 | Bacteria | 643 |
| 545 | Ga0496120_0009584 | 3300048923 | Bacteria | 6849 |
| 546 | Ga0496121_0015186 | 3300048924 | Bacteria | 8095 |
| 547 | Ga0496121_0075045 | 3300048924 | Bacteria | 2703 |
| 548 | Ga0496121_0480750 | 3300048924 | Bacteria | 793 |
| 549 | Ga0496122_0265287 | 3300048925 | Bacteria | 950 |
| 550 | Ga0496123_0520210 | 3300048926 | Bacteria | 516 |
| 551 | Ga0496124_0389107 | 3300048927 | Bacteria | 972 |
| 552 | Ga0496125_0099157 | 3300048928 | Bacteria | 2153 |
| 553 | Ga0496125_0176586 | 3300048928 | Bacteria | 1428 |
| 554 | Ga0496126_0048084 | 3300048929 | Bacteria | 3901 |
| 555 | Ga0496126_0208530 | 3300048929 | Bacteria | 1646 |
| 556 | Ga0496126_0283239 | 3300048929 | Bacteria | 1372 |
| 557 | Ga0495682_0025954 | 3300049460 | Bacteria | 2178 |
| 558 | Ga0501033_0051200 | 3300049570 | Bacteria | 3061 |
| 559 | Ga0501034_0018357 | 3300049571 | Bacteria | 7174 |
| 560 | Ga0501034_0642648 | 3300049571 | Bacteria | 963 |
| 561 | Ga0501034_0935725 | 3300049571 | Bacteria | 753 |
| 562 | Ga0501042_0161495 | 3300049578 | Bacteria | 1617 |
| 563 | Ga0501047_0041969 | 3300049581 | Bacteria | 4421 |
| 564 | Ga0501067_0338820 | 3300049583 | Bacteria | 838 |
| 565 | Ga0501070_0019833 | 3300049586 | Bacteria | 5638 |
| 566 | Ga0501072_0757656 | 3300049588 | Bacteria | 761 |
| 567 | Ga0501073_0029828 | 3300049589 | Bacteria | 3897 |
| 568 | Ga0501074_0465170 | 3300049590 | Bacteria | 896 |
| 569 | Ga0501080_0006437 | 3300049742 | Bacteria | 10542 |
| 570 | Ga0501044_0098698 | 3300049823 | Bacteria | 2940 |
| 571 | Ga0501044_0133258 | 3300049823 | Bacteria | 2478 |
| 572 | nmdc:mga03n38_45266_c1 | 3300050490 | Bacteria | 1937 |
| 573 | nmdc:mga03n38_86694_c1 | 3300050490 | Bacteria | 1482 |
| 574 | nmdc:mga00v17_123735_c1 | 3300050491 | Bacteria | 1649 |
| 575 | nmdc:mga0yw44_13038_c1 | 3300050492 | Bacteria | 4358 |
| 576 | nmdc:mga0yw44_150764_c1 | 3300050492 | Bacteria | 1516 |
| 577 | nmdc:mga0yw44_152419_c1 | 3300050492 | Bacteria | 1509 |
| 578 | nmdc:mga0yw44_85313_c1 | 3300050492 | Bacteria | 1987 |
| 579 | nmdc:mga0k408_217551_c1 | 3300050493 | Bacteria | 1140 |
| 580 | nmdc:mga0k408_447071_c1 | 3300050493 | Bacteria | 768 |
| 581 | nmdc:mga06z11_7726_c1 | 3300050494 | Bacteria | 4441 |
| 582 | nmdc:mga04h51_36009_c1 | 3300050495 | Bacteria | 1590 |
| 583 | nmdc:mga07m45_19690_c1 | 3300050496 | Bacteria | 3657 |
| 584 | nmdc:mga07m45_4626_c1 | 3300050496 | Bacteria | 6748 |
| 585 | nmdc:mga07m45_547610_c1 | 3300050496 | Bacteria | 669 |
| 586 | nmdc:mga0n895_137781_c1 | 3300050512 | Bacteria | 2468 |
| 587 | nmdc:mga0n895_303833_c1 | 3300050512 | Bacteria | 1617 |
| 588 | nmdc:mga0rr50_1765440_c1 | 3300050513 | Bacteria | 521 |
| 589 | nmdc:mga0rr50_318310_c1 | 3300050513 | Bacteria | 1304 |
| 590 | nmdc:mga0a205_659102_c1 | 3300050515 | Bacteria | 898 |
| 591 | nmdc:mga0a205_674679_c1 | 3300050515 | Unclassified | 568 |
| 592 | nmdc:mga0sz30_279168_c1 | 3300050516 | Bacteria | 744 |
| 593 | nmdc:mga0sz30_357280_c1 | 3300050516 | Bacteria | 653 |
| 594 | nmdc:mga0sz30_41349_c1 | 3300050516 | Bacteria | 1938 |
| 595 | nmdc:mga0sz30_422726_c1 | 3300050516 | Bacteria | 598 |
| 596 | Ga0495601_0070963 | 3300053077 | Bacteria | 2224 |
| 597 | Ga0495612_0073638 | 3300053078 | Bacteria | 1427 |
| 598 | Ga0500610_0065760 | 3300053079 | Bacteria | 1891 |
| 599 | Ga0495619_0034521 | 3300053085 | Bacteria | 3289 |
| 600 | Ga0495619_0042664 | 3300053085 | Bacteria | 2972 |
| 601 | Ga0495619_0530840 | 3300053085 | Bacteria | 808 |
| 602 | Ga0500578_0412790 | 3300053086 | Bacteria | 775 |
| 603 | Ga0500647_0071734 | 3300053091 | Bacteria | 1664 |
| 604 | Ga0500651_0055502 | 3300053093 | Bacteria | 2481 |
| 605 | Ga0500566_0081543 | 3300053094 | Bacteria | 1799 |
| 606 | Ga0500566_0112688 | 3300053094 | Bacteria | 1477 |
| 607 | Ga0500640_142154 | 3300053095 | Bacteria | 929 |
| 608 | Ga0500557_000025 | 3300053105 | Bacteria | 84884 |
| 609 | Ga0500569_076776 | 3300053109 | Bacteria | 1061 |
| 610 | Ga0500595_073576 | 3300053119 | Bacteria | 1010 |
| 611 | Ga0500608_110623 | 3300053122 | Bacteria | 1260 |
| 612 | Ga0500642_0000021 | 3300053130 | Bacteria | 146938 |
| 613 | Ga0500559_0010250 | 3300053136 | Bacteria | 4029 |
| 614 | Ga0500577_0372396 | 3300053142 | Bacteria | 625 |
| 615 | Ga0500620_001486 | 3300053155 | Bacteria | 4359 |
| 616 | Ga0500639_107596 | 3300053163 | Bacteria | 1362 |
| 617 | Ga0500639_232197 | 3300053163 | Bacteria | 758 |
| 618 | Ga0500636_0002008 | 3300053177 | Bacteria | 11199 |
| 619 | Ga0500636_0067434 | 3300053177 | Bacteria | 2079 |
| 620 | Ga0500625_025869 | 3300053729 | Bacteria | 2777 |
| 621 | Ga0500609_004769 | 3300053731 | Bacteria | 1866 |
| 622 | 2937845901 | 2937843397 | Bacteria | 5256375 |
| 623 | 2507507386 | 2507262055 | Bacteria | 8048963 |
| 624 | 2508541438 | 2508501009 | Bacteria | 7784016 |
| 625 | 2508693234 | 2508501042 | Bacteria | 8719808 |
| 626 | 2509154158 | 2508501128 | Bacteria | 8613869 |
| 627 | 2513621531 | 2513237092 | Bacteria | 8341956 |
| 628 | 2513636984 | 2513237094 | Bacteria | 8789602 |
| 629 | 2513652076 | 2513237095 | Bacteria | 8976980 |
| 630 | 2513722056 | 2513237104 | Bacteria | 10034502 |
| 631 | 2513879844 | 2513237139 | Bacteria | 8737671 |
| 632 | 2513892265 | 2513237141 | Bacteria | 8496279 |
| 633 | 2514011576 | 2513237161 | Bacteria | 8871253 |
| 634 | 2515629780 | 2515154112 | Bacteria | 8294334 |
| 635 | 2517104685 | 2517093001 | Bacteria | 9002274 |
| 636 | 2524441208 | 2524023205 | Bacteria | 8918781 |
| 637 | 2528850517 | 2528768022 | Bacteria | 10457665 |
| 638 | 2617351915 | 2617270735 | Bacteria | 9163226 |
| 639 | 2745078669 | 2744054633 | Bacteria | 8678936 |
| 640 | 2793061149 | 2791355196 | Bacteria | 7323613 |
| 641 | 2805918532 | 2802429603 | Bacteria | 8777136 |
| 642 | 2818236874 | 2816332527 | Bacteria | 8933356 |
| 643 | 2824670023 | 2824661429 | Bacteria | 9877870 |
| 644 | 2824677830 | 2824671348 | Bacteria | 8369588 |
| 645 | 2824686211 | 2824679649 | Bacteria | 8248951 |
| 646 | 2824694178 | 2824687955 | Bacteria | 8360029 |
| 647 | 2824701897 | 2824696289 | Bacteria | 8335049 |
| 648 | 2824710752 | 2824704595 | Bacteria | 9667483 |
| 649 | 2824757760 | 2824753945 | Bacteria | 9787441 |
| 650 | 2824768728 | 2824763712 | Bacteria | 9792355 |
| 651 | 2824777231 | 2824773399 | Bacteria | 8360218 |
| 652 | 2838127229 | 2838122688 | Bacteria | 8803140 |
| 653 | 2841947470 | 2841941048 | Bacteria | 8688029 |
| 654 | 2841956259 | 2841949485 | Bacteria | 8680857 |
| 655 | 2841962567 | 2841957949 | Bacteria | 8652217 |
| 656 | 2841974492 | 2841966195 | Bacteria | 8673214 |
| 657 | 2841980758 | 2841974524 | Bacteria | 8931498 |
| 658 | 2841987329 | 2841983080 | Bacteria | 8395090 |
| 659 | 2842040961 | 2842038055 | Bacteria | 8002051 |
| 660 | 2842046094 | 2842045827 | Bacteria | 8006841 |
| 661 | 2844320281 | 2844315083 | Bacteria | 8138177 |
| 662 | 2847937610 | 2847930680 | Bacteria | 9342022 |
| 663 | 2847948055 | 2847939898 | Bacteria | 8606328 |
| 664 | 2874592854 | 2874590934 | Bacteria | 8299676 |
| 665 | 2874614389 | 2874612657 | Bacteria | 8252029 |
| 666 | 2874623780 | 2874620515 | Bacteria | 8290088 |
| 667 | 2874633057 | 2874628541 | Bacteria | 8630250 |
| 668 | 2874650702 | 2874645413 | Bacteria | 8214782 |
| 669 | 2876768479 | 2876761206 | Bacteria | 10111113 |
| 670 | 2876776294 | 2876771140 | Bacteria | 8287509 |
| 671 | 2876822254 | 2876818435 | Bacteria | 8274608 |
| 672 | 2879080383 | 2879074833 | Bacteria | 8279565 |
| 673 | 2879084106 | 2879083081 | Bacteria | 8587928 |
| 674 | 2879103563 | 2879099564 | Bacteria | 10442239 |
| 675 | 2879133459 | 2879127579 | Bacteria | 8294491 |
| 676 | 2879145782 | 2879142872 | Bacteria | 8267021 |
| 677 | 2881370244 | 2881364244 | Bacteria | 7710352 |
| 678 | 2881667165 | 2881665667 | Bacteria | 8175609 |
| 679 | 2885370270 | 2885366525 | Bacteria | 8326213 |
| 680 | 2885418542 | 2885409591 | Bacteria | 9235467 |
| 681 | 2888385797 | 2888378607 | Bacteria | 9652610 |
| 682 | 2903731561 | 2903727486 | Bacteria | 8281579 |
| 683 | 2904674009 | 2904666416 | Bacteria | 8226587 |
| 684 | 2904711608 | 2904711408 | Bacteria | 9771557 |
| 685 | 2906608330 | 2906602504 | Bacteria | 8295279 |
| 686 | 2906634266 | 2906626472 | Bacteria | 8826946 |
| 687 | 2906645179 | 2906643746 | Bacteria | 8722424 |
| 688 | 2922376045 | |||
| 689 | 2922393691 | 2922393267 | Bacteria | 8285685 |
| 690 | 2929622876 | 2929615660 | Bacteria | 9193770 |
| 691 | 2929631413 | 2929624759 | Bacteria | 9339455 |
| 692 | 2932785294 | 2932784394 | Bacteria | 9704911 |
| 693 | 2932808660 | 2932801729 | Bacteria | 7987968 |
| 694 | 2932810327 | 2932809354 | Bacteria | 9135765 |
| 695 | 2932821900 | 2932818245 | Bacteria | 9955613 |
| 696 | 2932831863 | 2932828146 | Bacteria | 9745859 |
| 697 | 2933584920 | 2933577622 | Bacteria | 9116884 |
| 698 | 2935610238 | 2935608549 | Bacteria | 8203142 |
| 699 | 2935619450 | 2935616580 | Bacteria | 9032984 |
| 700 | 2935638430 | 2935638405 | Bacteria | 10015038 |
| 701 | 2935651211 | 2935648319 | Bacteria | 8801166 |
| 702 | 2935659391 | 2935656913 | Bacteria | 8965014 |
| 703 | 2935666718 | 2935665750 | Bacteria | 9571747 |
| 704 | 2935682090 | 2935675223 | Bacteria | 9928132 |
| 705 | 2935691249 | 2935684952 | Bacteria | 9590419 |
| 706 | 2935694322 | 2935694250 | Bacteria | 9291695 |
| 707 | 2935703434 | 2935703347 | Bacteria | 10242284 |
| 708 | 2935718630 | 2935713505 | Bacteria | 9608509 |
| 709 | 2935727390 | 2935722832 | Bacteria | 9608746 |
| 710 | 2935736093 | 2935732158 | Bacteria | 9706831 |
| 711 | 2935745473 | 2935741537 | Bacteria | 9707219 |
| 712 | 2935755854 | 2935750917 | Bacteria | 9590372 |
| 713 | 2935760887 | 2935760218 | Bacteria | 9817913 |
| 714 | 2935771222 | 2935769743 | Bacteria | 7878163 |
| 715 | 2935781013 | 2935777560 | Bacteria | 8077691 |
| 716 | 2935786077 | 2935785616 | Bacteria | 7962367 |
| 717 | 2935797740 | 2935793552 | Bacteria | 8012592 |
| 718 | 2935801573 | 2935801545 | Bacteria | 9301974 |
| 719 | 2935815019 | 2935810662 | Bacteria | 9401221 |
| 720 | 2935823399 | 2935819856 | Bacteria | 8261050 |
| 721 | 2935827924 | 2935827899 | Bacteria | 10038562 |
| 722 | 2935842129 | 2935837841 | Bacteria | 9454360 |
| 723 | 2935848883 | 2935847175 | Bacteria | 8228321 |
| 724 | 2935858234 | 2935855204 | Bacteria | 9035059 |
| 725 | 2935872047 | 2935864058 | Bacteria | 9784707 |
| 726 | 2935873838 | 2935873716 | Bacteria | 9632195 |
| 727 | 2935912987 | 2935908558 | Bacteria | 8568796 |
| 728 | 2935924440 | 2935916978 | Bacteria | 9113783 |
| 729 | 2935930120 | 2935926038 | Bacteria | 8601059 |
| 730 | 2935939021 | 2935934488 | Bacteria | 8602579 |
| 731 | 2935945968 | 2935942939 | Bacteria | 8599779 |
| 732 | 2935955305 | 2935951376 | Bacteria | 8602333 |
| 733 | 2935963004 | 2935959822 | Bacteria | 7869783 |
| 734 | 2935972324 | 2935967501 | Bacteria | 8603075 |
| 735 | 2935976249 | 2935975950 | Bacteria | 8347125 |
| 736 | 2935986255 | 2935984226 | Bacteria | 8302647 |
| 737 | 2935993238 | 2935992306 | Bacteria | 9802711 |
| 738 | 2936003175 | 2936002035 | Bacteria | 9362176 |
| 739 | 2936013806 | 2936011229 | Bacteria | 8801034 |
| 740 | 2936022670 | 2936019824 | Bacteria | 8804134 |
| 741 | 2936033277 | 2936028420 | Bacteria | 8965941 |
| 742 | 2936040337 | 2936037263 | Bacteria | 9446081 |
| 743 | 2936048912 | 2936046547 | Bacteria | 8903709 |
| 744 | 2936060510 | 2936055302 | Bacteria | 8785755 |
| 745 | 2940562171 | 2940556831 | Bacteria | 9590747 |
| 746 | 2941531486 | 2941531003 | Bacteria | 7653939 |
| 747 | 2941542178 | 2941538514 | Bacteria | 9402094 |
| 748 | 3005488553 | 3005483717 | Bacteria | 7877331 |
| 749 | 3005588374 | 3005587118 | Bacteria | 7794411 |
| 750 | 3005600654 | 3005594810 | Bacteria | 8716512 |
| 751 | 3005723433 | 3005718088 | Bacteria | 8283608 |
| 752 | 8006927771 | 8006926726 | Bacteria | 6749210 |
| 753 | 8016520323 | 8016511872 | Bacteria | 9921665 |
| 754 | 8016528380 | 8016522445 | Bacteria | 8156687 |
| 755 | 8016533528 | 8016530956 | Bacteria | 8155261 |
| 756 | 8016546757 | 8016539877 | Bacteria | 8155419 |
| 757 | 8016555359 | 8016548790 | Bacteria | 8155074 |
| 758 | 8016563720 | 8016557553 | Bacteria | 8154380 |
| 759 | 8016571860 | 8016566248 | Bacteria | 8158151 |
| 760 | 8016576074 | 8016575299 | Bacteria | 8154085 |
| 761 | 8016594739 | 8016583857 | Bacteria | 10421953 |
| 762 | 8016601450 | 8016595262 | Bacteria | 8149947 |
| 763 | 8016608651 | 8016603502 | Bacteria | 8731218 |
| 764 | 8016616223 | 8016613128 | Bacteria | 8794220 |
| 765 | 8016625019 | 8016622563 | Bacteria | 7999408 |
| 766 | 8016638858 | 8016630954 | Bacteria | 9217207 |
| 767 | 8017065246 | 8017057580 | Bacteria | 10023680 |
| 768 | 8019533320 | 8019530166 | Bacteria | 8155624 |
| 769 | 8019546716 | 8019538911 | Bacteria | 7872763 |
| 770 | 8019552055 | 8019547302 | Bacteria | 7996444 |
| 771 | 8019584641 | 8019576017 | Bacteria | 10049540 |
| 772 | 8019592413 | 8019586578 | Bacteria | 10212056 |
| 773 | 8019598864 | 8019597564 | Bacteria | 10041141 |
| 774 | 8019609511 | 8019608314 | Bacteria | 10042931 |
| 775 | 8019620114 | 8019619141 | Bacteria | 9218857 |
| 776 | 8019632991 | 8019629233 | Bacteria | 8687553 |
| 777 | 8019646931 | 8019638758 | Bacteria | 9062356 |
| 778 | 8019655761 | 8019648815 | Bacteria | 10014479 |
| 779 | 8019660858 | 8019659431 | Bacteria | 8577854 |
| 780 | 8019670408 | 8019668869 | Bacteria | 8791617 |
| 781 | 8019685822 | 8019678201 | Bacteria | 8863603 |
| 782 | 8019691996 | 8019687851 | Bacteria | 8712826 |
| 783 | 8055744762 | 8055742211 | Bacteria | 9226248 |
| 784 | 8056974776 | 8056967851 | Bacteria | 9038162 |
| 785 | JGI25406J46586_10007734 | |||
| 786 | JGI25153J46596_10000853 | |||
| 787 | JGI25153J46596_10013646 | |||
| 788 | JGI25153J46596_10042922 | |||
| 789 | rootH1_10004454 | |||
| 790 | rootH2_10008939 | |||
| 791 | rootH2_10151742 | |||
| 792 | rootL2_10205672 | |||
| 793 | rootH1_10128380 | |||
| 794 | JGI25160J50197_1000926 | |||
| 795 | JGI25160J50197_1002416 | |||
| 796 | Ga0055542_1013863 | |||
| 797 | Ga0055524_1039493 | |||
| 798 | Ga0055531_10018479 | |||
| 799 | Ga0065165_1014675 | |||
| 800 | Ga0070658_10156978 | |||
| 801 | Ga0070676_10561198 | |||
| 802 | Ga0070683_100017909 | |||
| 803 | Ga0070683_100169944 | |||
| 804 | Ga0070683_100416048 | |||
| 805 | Ga0070666_10076752 | |||
| 806 | Ga0070680_100057043 | |||
| 807 | Ga0068868_100050735 | |||
| 808 | Ga0070660_100112655 | |||
| 809 | Ga0070660_100477563 | |||
| 810 | Ga0070661_100722323 | |||
| 811 | Ga0070661_101368776 | |||
| 812 | Ga0070668_100039698 | |||
| 813 | Ga0070668_100132908 | |||
| 814 | Ga0070668_100439227 | |||
| 815 | Ga0070671_100423786 | |||
| 816 | Ga0070673_101172994 | |||
| 817 | Ga0070659_100157449 | |||
| 818 | Ga0070667_100057832 | |||
| 819 | Ga0070667_100731402 | |||
| 820 | Ga0070709_10119176 | |||
| 821 | Ga0070709_10184010 | |||
| 822 | Ga0070709_10220009 | |||
| 823 | Ga0070714_100016729 | |||
| 824 | Ga0070714_100099710 | |||
| 825 | Ga0070714_100118753 | |||
| 826 | Ga0070714_101401821 | |||
| 827 | Ga0070713_100008549 | |||
| 828 | Ga0070713_100076076 | |||
| 829 | Ga0070713_100119642 | |||
| 830 | Ga0070710_10001667 | |||
| 831 | Ga0070711_100186863 | |||
| 832 | Ga0070705_100340312 | |||
| 833 | Ga0070694_100089081 | |||
| 834 | Ga0070663_100064735 | |||
| 835 | Ga0070663_100924265 | |||
| 836 | Ga0070662_100422018 | |||
| 837 | Ga0070662_100677094 | |||
| 838 | Ga0070681_10011710 | |||
| 839 | Ga0070681_10746408 | |||
| 840 | Ga0068867_100056149 | |||
| 841 | Ga0070679_100079922 | |||
| 842 | Ga0070679_100088482 | |||
| 843 | Ga0070684_100006061 | |||
| 844 | Ga0070684_100043340 | |||
| 845 | Ga0070697_100850165 | |||
| 846 | Ga0068853_100088835 | |||
| 847 | Ga0068853_101210068 | |||
| 848 | Ga0068853_101239188 | |||
| 849 | Ga0070695_100181072 | |||
| 850 | Ga0070696_100584339 | |||
| 851 | Ga0070696_100782785 | |||
| 852 | Ga0070693_100284914 | |||
| 853 | Ga0070665_100466693 | |||
| 854 | Ga0070704_100041436 | |||
| 855 | Ga0068855_100141353 | |||
| 856 | Ga0068855_100144379 | |||
| 857 | Ga0068855_100282696 | |||
| 858 | Ga0070664_100916624 | |||
| 859 | Ga0068857_100265734 | |||
| 860 | Ga0068857_100418176 | |||
| 861 | Ga0068857_100781668 | |||
| 862 | Ga0068857_101127442 | |||
| 863 | Ga0068854_100061469 | |||
| 864 | Ga0068854_101272757 | |||
| 865 | Ga0068856_100053937 | |||
| 866 | Ga0068856_101337351 | |||
| 867 | Ga0068852_100190613 | |||
| 868 | Ga0068852_100356082 | |||
| 869 | Ga0068852_101391393 | |||
| 870 | Ga0068859_101542298 | |||
| 871 | Ga0068861_100252605 | |||
| 872 | Ga0068861_100943138 | |||
| 873 | Ga0068863_100095913 | |||
| 874 | Ga0068858_100589770 | |||
| 875 | Ga0068862_100183806 | |||
| 876 | Ga0068862_100770168 | |||
| 877 | Ga0081540_1015533 | |||
| 878 | Ga0081539_10005072 | |||
| 879 | Ga0081539_10010606 | |||
| 880 | Ga0070717_10058208 | |||
| 881 | Ga0070717_10141687 | |||
| 882 | Ga0070717_10203050 | |||
| 883 | Ga0070717_11127577 | |||
| 884 | Ga0075365_10012372 | |||
| 885 | Ga0075365_10016667 | |||
| 886 | Ga0075365_10018063 | |||
| 887 | Ga0075368_10000989 | |||
| 888 | Ga0075368_10237413 | |||
| 889 | Ga0075363_100016183 | |||
| 890 | Ga0075363_100062529 | |||
| 891 | Ga0070715_10005523 | |||
| 892 | Ga0070715_10760494 | |||
| 893 | Ga0070716_100072631 | |||
| 894 | Ga0070716_100219950 | |||
| 895 | Ga0070716_100981401 | |||
| 896 | Ga0075362_10006919 | |||
| 897 | Ga0075367_10039462 | |||
| 898 | Ga0075367_10144872 | |||
| 899 | Ga0075369_10003294 | |||
| 900 | Ga0075369_10257643 | |||
| 901 | Ga0075366_10211861 | |||
| 902 | Ga0075366_10262655 | |||
| 903 | Ga0075370_10147313 | |||
| 904 | Ga0075370_10168579 | |||
| 905 | Ga0075433_10073320 | |||
| 906 | Ga0075433_10482247 | |||
| 907 | Ga0075434_100176992 | |||
| 908 | Ga0097620_101542265 | |||
| 909 | Ga0099824_1023338 | |||
| 910 | Ga0075435_100315683 | |||
| 911 | Ga0075435_100323470 | |||
| 912 | Ga0105240_10004584 | |||
| 913 | Ga0105240_10069753 | |||
| 914 | Ga0105240_10244791 | |||
| 915 | Ga0105240_11572669 | |||
| 916 | Ga0105240_11602264 | |||
| 917 | Ga0105245_10180057 | |||
| 918 | Ga0105245_10865830 | |||
| 919 | Ga0105247_10197915 | |||
| 920 | Ga0114129_10543086 | |||
| 921 | Ga0105243_10106084 | |||
| 922 | Ga0105241_10040754 | |||
| 923 | Ga0105241_10044460 | |||
| 924 | Ga0105241_10341948 | |||
| 925 | Ga0105241_10715916 | |||
| 926 | Ga0105241_11121406 | |||
| 927 | Ga0105242_10449815 | |||
| 928 | Ga0105242_11560416 | |||
| 929 | Ga0105248_10054112 | |||
| 930 | Ga0105248_10462583 | |||
| 931 | Ga0105237_10023098 | |||
| 932 | Ga0105237_10047367 | |||
| 933 | Ga0105237_10064969 | |||
| 934 | Ga0105237_10201308 | |||
| 935 | Ga0105237_10231407 | |||
| 936 | Ga0105237_10670249 | |||
| 937 | Ga0105238_10178245 | |||
| 938 | Ga0105238_10217586 | |||
| 939 | Ga0105249_10599983 | |||
| 940 | Ga0105249_10700257 | |||
| 941 | Ga0099796_10207935 | |||
| 942 | Ga0105239_10214259 | |||
| 943 | Ga0105239_10353711 | |||
| 944 | Ga0105239_10361934 | |||
| 945 | Ga0105239_10549255 | |||
| 946 | Ga0105239_10729338 | |||
| 947 | Ga0105239_10882052 | |||
| 948 | Ga0105239_11646611 | |||
| 949 | Ga0105246_10001672 | |||
| 950 | Ga0105246_10301829 | |||
| 951 | Ga0105246_10357717 | |||
| 952 | Ga0157370_10040959 | |||
| 953 | Ga0157370_10323113 | |||
| 954 | Ga0157370_10636452 | |||
| 955 | Ga0157370_10771548 | |||
| 956 | Ga0157369_10009617 | |||
| 957 | Ga0157369_10017510 | |||
| 958 | Ga0157369_10035736 | |||
| 959 | Ga0157374_10178120 | |||
| 960 | Ga0157372_10182732 | |||
| 961 | Ga0157372_10280047 | |||
| 962 | Ga0157372_10289568 | |||
| 963 | Ga0163163_10033755 | |||
| 964 | Ga0163163_10116197 | |||
| 965 | Ga0163163_10545170 | |||
| 966 | Ga0157380_11927563 | |||
| 967 | Ga0182008_10922254 | |||
| 968 | Ga0157379_12186131 | |||
| 969 | Ga0157376_10373687 | |||
| 970 | Ga0163161_10566321 | |||
| 971 | Ga0163161_10934786 | |||
| 972 | Ga0213872_10069255 | |||
| 973 | Ga0213876_10164609 | |||
| 974 | Ga0209148_1001125 | |||
| 975 | Ga0209233_1001284 | |||
| 976 | Ga0209233_1013491 | |||
| 977 | Ga0209233_1036124 | |||
| 978 | Ga0209455_1001274 | |||
| 979 | Ga0209673_1036341 | |||
| 980 | Ga0209564_1004893 | |||
| 981 | Ga0209564_1025459 | |||
| 982 | Ga0209758_1000011 | |||
| 983 | Ga0209758_1000120 | |||
| 984 | Ga0209758_1001547 | |||
| 985 | Ga0209758_1003623 | |||
| 986 | Ga0209758_1051081 | |||
| 987 | Ga0209758_1112845 | |||
| 988 | Ga0209256_1002195 | |||
| 989 | Ga0207426_1000212 | |||
| 990 | Ga0207426_1008337 | |||
| 991 | Ga0207426_1044817 | |||
| 992 | Ga0209051_1109437 | |||
| 993 | Ga0209257_1001276 | |||
| 994 | Ga0209257_1024892 | |||
| 995 | Ga0209257_1068782 | |||
| 996 | Ga0207697_10045996 | |||
| 997 | Ga0207692_10001482 | |||
| 998 | Ga0207710_10208115 | |||
| 999 | Ga0207688_10545517 | |||
| 1000 | Ga0207680_10255399 | |||
| 1001 | Ga0207647_10237108 | |||
| 1002 | Ga0207647_10554538 | |||
| 1003 | Ga0207685_10027127 | |||
| 1004 | Ga0207699_10032198 | |||
| 1005 | Ga0207699_10090245 | |||
| 1006 | Ga0207699_10163510 | |||
| 1007 | Ga0207699_10935051 | |||
| 1008 | Ga0207645_10187157 | |||
| 1009 | Ga0207654_10062578 | |||
| 1010 | Ga0207654_10188560 | |||
| 1011 | Ga0207654_10577605 | |||
| 1012 | Ga0207707_11496698 | |||
| 1013 | Ga0207695_10000163 | |||
| 1014 | Ga0207695_10047532 | |||
| 1015 | Ga0207695_10117620 | |||
| 1016 | Ga0207671_10008503 | |||
| 1017 | Ga0207671_10022555 | |||
| 1018 | Ga0207671_10504191 | |||
| 1019 | Ga0207671_10709221 | |||
| 1020 | Ga0207693_10001156 | |||
| 1021 | Ga0207663_10000774 | |||
| 1022 | Ga0207663_10326618 | |||
| 1023 | Ga0207660_10345243 | |||
| 1024 | Ga0207657_10185200 | |||
| 1025 | Ga0207652_10070642 | |||
| 1026 | Ga0207681_10101475 | |||
| 1027 | Ga0207694_10081238 | |||
| 1028 | Ga0207694_10442381 | |||
| 1029 | Ga0207694_10506883 | |||
| 1030 | Ga0207687_10806432 | |||
| 1031 | Ga0207700_10069520 | |||
| 1032 | Ga0207700_10123165 | |||
| 1033 | Ga0207700_10345523 | |||
| 1034 | Ga0207664_10006986 | |||
| 1035 | Ga0207664_10113258 | |||
| 1036 | Ga0207664_10288286 | |||
| 1037 | Ga0207664_11182723 | |||
| 1038 | Ga0207644_10354925 | |||
| 1039 | Ga0207690_10130490 | |||
| 1040 | Ga0207706_10159994 | |||
| 1041 | Ga0207709_10090913 | |||
| 1042 | Ga0207665_10001062 | |||
| 1043 | Ga0207665_10096835 | |||
| 1044 | Ga0207665_11024231 | |||
| 1045 | Ga0207711_10016867 | |||
| 1046 | Ga0207661_10000190 | |||
| 1047 | Ga0207661_10062281 | |||
| 1048 | Ga0207661_10340561 | |||
| 1049 | Ga0207661_11011680 | |||
| 1050 | Ga0207679_10229673 | |||
| 1051 | Ga0207679_10273253 | |||
| 1052 | Ga0207667_10084727 | |||
| 1053 | Ga0207667_10221492 | |||
| 1054 | Ga0207667_10508999 | |||
| 1055 | Ga0207667_11674052 | |||
| 1056 | Ga0207651_11138846 | |||
| 1057 | Ga0207712_10633446 | |||
| 1058 | Ga0207668_10083194 | |||
| 1059 | Ga0207640_10050050 | |||
| 1060 | Ga0207640_10339261 | |||
| 1061 | Ga0207640_10485003 | |||
| 1062 | Ga0207677_10105547 | |||
| 1063 | Ga0207703_11240908 | |||
| 1064 | Ga0207639_10026248 | |||
| 1065 | Ga0207639_10613725 | |||
| 1066 | Ga0207639_11361525 | |||
| 1067 | Ga0207678_10041188 | |||
| 1068 | Ga0207678_10286652 | |||
| 1069 | Ga0207678_10499649 | |||
| 1070 | Ga0207702_10031891 | |||
| 1071 | Ga0207702_10598867 | |||
| 1072 | Ga0207641_10057511 | |||
| 1073 | Ga0207648_10085270 | |||
| 1074 | Ga0207676_10910950 | |||
| 1075 | Ga0207674_10015898 | |||
| 1076 | Ga0207674_10114889 | |||
| 1077 | Ga0207674_10647811 | |||
| 1078 | Ga0207674_10751436 | |||
| 1079 | Ga0207675_100152003 | |||
| 1080 | Ga0207683_10112495 | |||
| 1081 | Ga0207698_10043427 | |||
| 1082 | Ga0207698_11010026 | |||
| 1083 | Ga0209389_1000186 | |||
| 1084 | Ga0209389_1000261 | |||
| 1085 | Ga0209589_1001077 | |||
| 1086 | Ga0209489_100176 | |||
| 1087 | Ga0209489_107409 | |||
| 1088 | Ga0209700_101165 | |||
| 1089 | Ga0209813_10030253 | |||
| 1090 | Ga0268266_10117064 | |||
| 1091 | Ga0268266_10521717 | |||
| 1092 | Ga0265330_10140373 | |||
| 1093 | Ga0265325_10032964 | |||
| 1094 | Ga0265339_10013152 | |||
| 1095 | Ga0307508_10380130 | |||
| 1096 | Ga0265314_10379221 | |||
| 1097 | Ga0307507_10481356 | |||
| 1098 | Ga0307510_10286009 | |||
| 1099 | Ga0373926_0012014 | |||
| 1100 | Ga0373944_0190036 | |||
| 1101 | Ga0373923_0011082 | |||
| 1102 | Ga0373936_0011222 | |||
| 1103 | Ga0373954_0076415 | |||
| 1104 | Ga0373956_0098972 | |||
| 1105 | Ga0373943_0015344 | |||
| 1106 | Ga0373946_0053370 | |||
| 1107 | Ga0373962_0396499 | |||
| 1108 | Ga0373924_0023904 | |||
| 1109 | Ga0373924_0131754 | |||
| 1110 | Ga0373935_0133129 | |||
| 1111 | Ga0373927_0073192 | |||
| 1112 | Ga0373933_0083502 | |||
| 1113 | Ga0373933_0236463 | |||
| 1114 | Ga0373947_0026121 | |||
| 1115 | Ga0373937_0344386 | |||
| 1116 | Ga0373937_1210860 | |||
| 1117 | Ga0373925_0046619 | |||
| 1118 | Ga0395899_0119304 | |||
| 1119 | Ga0395899_0231961 | |||
| 1120 | Ga0395900_0019004 | |||
| 1121 | Ga0395900_0193921 | |||
| 1122 | Ga0395898_0006007 | |||
| 1123 | Ga0395898_0011066 | |||
| 1124 | Ga0395898_0464568 | |||
| 1125 | Ga0395898_0746904 | |||
| 1126 | Ga0395905_0003820 | |||
| 1127 | Ga0395905_0444058 | |||
| 1128 | Ga0395901_0034499 | |||
| 1129 | Ga0395901_0230035 | |||
| 1130 | Ga0395901_0258400 | |||
| 1131 | Ga0436365_0474195 | |||
| 1132 | Ga0436365_0716502 | |||
| 1133 | Ga0436360_0119024 | |||
| 1134 | Ga0436361_0072738 | |||
| 1135 | Ga0436363_0587036 | |||
| 1136 | Ga0451795_1700028 | |||
| 1137 | Ga0451841_0329692 | |||
| 1138 | Ga0451845_0481100 | |||
| 1139 | Ga0451853_1845826 | |||
| 1140 | Ga0466969_0025866 | |||
| 1141 | Ga0466972_0000394 | |||
| 1142 | Ga0466972_0025885 | |||
| 1143 | Ga0466965_0132210 | |||
| 1144 | Ga0466966_0001791 | |||
| 1145 | Ga0466961_0000005 | |||
| 1146 | Ga0466961_0908456 | |||
| 1147 | Ga0466963_0053240 | |||
| 1148 | Ga0466963_0134134 | |||
| 1149 | Ga0466964_0043048 | |||
| 1150 | Ga0466968_0000345 | |||
| 1151 | Ga0466970_0263636 | |||
| 1152 | Ga0466957_0098732 | |||
| 1153 | Ga0466957_0187800 | |||
| 1154 | Ga0466960_0008575 | |||
| 1155 | Ga0466959_0001046 | |||
| 1156 | Ga0466959_0158412 | |||
| 1157 | Ga0466959_0377237 | |||
| 1158 | Ga0466958_0188986 | |||
| 1159 | Ga0466967_0768316 | |||
| 1160 | Ga0466967_1328126 | |||
| 1161 | Ga0495592_0124465 | |||
| 1162 | Ga0495603_0186196 | |||
| 1163 | Ga0495603_0307197 | |||
| 1164 | Ga0495629_0001349 | |||
| 1165 | Ga0495629_0046141 | |||
| 1166 | Ga0495629_0544241 | |||
| 1167 | Ga0495641_0149921 | |||
| 1168 | Ga0495651_0037351 | |||
| 1169 | Ga0495651_0285423 | |||
| 1170 | Ga0495653_0046667 | |||
| 1171 | Ga0495653_0260403 | |||
| 1172 | Ga0495580_0032957 | |||
| 1173 | Ga0495605_0062333 | |||
| 1174 | Ga0495639_0007468 | |||
| 1175 | Ga0495662_0033737 | |||
| 1176 | Ga0495664_0005395 | |||
| 1177 | Ga0495664_0009101 | |||
| 1178 | Ga0495664_0068001 | |||
| 1179 | Ga0495584_0267678 | |||
| 1180 | Ga0495594_0153819 | |||
| 1181 | Ga0495594_0178103 | |||
| 1182 | Ga0495596_0046732 | |||
| 1183 | Ga0495607_0198441 | |||
| 1184 | Ga0495583_0261396 | |||
| 1185 | Ga0495583_0313339 | |||
| 1186 | Ga0495606_0031464 | |||
| 1187 | Ga0495606_0061128 | |||
| 1188 | Ga0495606_0095256 | |||
| 1189 | Ga0495606_0437164 | |||
| 1190 | Ga0495610_0287098 | |||
| 1191 | Ga0495616_0030405 | |||
| 1192 | Ga0495618_0038330 | |||
| 1193 | Ga0495628_0044488 | |||
| 1194 | Ga0495630_0040595 | |||
| 1195 | Ga0495630_0082095 | |||
| 1196 | Ga0495630_0464646 | |||
| 1197 | Ga0495630_0955098 | |||
| 1198 | Ga0495643_0195959 | |||
| 1199 | Ga0495648_0066376 | |||
| 1200 | Ga0495648_0230411 | |||
| 1201 | Ga0495642_0114644 | |||
| 1202 | Ga0495652_0018046 | |||
| 1203 | Ga0495652_0116141 | |||
| 1204 | Ga0495665_0008372 | |||
| 1205 | Ga0495640_0046425 | |||
| 1206 | Ga0495640_0127369 | |||
| 1207 | Ga0495586_0059437 | |||
| 1208 | Ga0495587_0036830 | |||
| 1209 | Ga0495609_0176428 | |||
| 1210 | Ga0495597_0270500 | |||
| 1211 | Ga0495645_0084724 | |||
| 1212 | Ga0495645_0137875 | |||
| 1213 | Ga0495622_0022994 | |||
| 1214 | Ga0495622_0057029 | |||
| 1215 | Ga0495667_0144643 | |||
| 1216 | Ga0495667_0625366 | |||
| 1217 | Ga0495668_0025808 | |||
| 1218 | Ga0495634_0039534 | |||
| 1219 | Ga0495634_0084636 | |||
| 1220 | Ga0495625_0066520 | |||
| 1221 | Ga0495625_0314387 | |||
| 1222 | Ga0495635_0001321 | |||
| 1223 | Ga0495635_0242760 | |||
| 1224 | Ga0495635_0522754 | |||
| 1225 | Ga0495661_0289692 | |||
| 1226 | Ga0495588_0005349 | |||
| 1227 | Ga0495588_0299149 | |||
| 1228 | Ga0495657_0011371 | |||
| 1229 | Ga0495657_0027251 | |||
| 1230 | Ga0495657_0342169 | |||
| 1231 | Ga0495599_0363763 | |||
| 1232 | Ga0495623_0005927 | |||
| 1233 | Ga0495623_0177932 | |||
| 1234 | Ga0495646_0076556 | |||
| 1235 | Ga0495646_0167554 | |||
| 1236 | Ga0495658_0102775 | |||
| 1237 | Ga0495613_0094799 | |||
| 1238 | Ga0495624_0019101 | |||
| 1239 | Ga0495624_0024259 | |||
| 1240 | Ga0495649_0063070 | |||
| 1241 | Ga0495649_0207707 | |||
| 1242 | Ga0495600_0002477 | |||
| 1243 | Ga0495600_0329867 | |||
| 1244 | Ga0495581_0028575 | |||
| 1245 | Ga0495581_0098754 | |||
| 1246 | Ga0495604_0018932 | |||
| 1247 | Ga0495604_0027180 | |||
| 1248 | Ga0495674_0004826 | |||
| 1249 | Ga0495674_0020467 | |||
| 1250 | Ga0495674_1181351 | |||
| 1251 | Ga0495672_0297999 | |||
| 1252 | Ga0495676_0152022 | |||
| 1253 | Ga0495680_0002514 | |||
| 1254 | Ga0495683_0016642 | |||
| 1255 | Ga0495687_011407 | |||
| 1256 | Ga0495675_0047583 | |||
| 1257 | Ga0495675_0455676 | |||
| 1258 | Ga0495675_0489409 | |||
| 1259 | Ga0495677_0208465 | |||
| 1260 | Ga0495685_187606 | |||
| 1261 | Ga0495673_0056674 | |||
| 1262 | Ga0495673_0112432 | |||
| 1263 | Ga0495673_0351081 | |||
| 1264 | Ga0495684_0023802 | |||
| 1265 | Ga0495684_0550805 | |||
| 1266 | Ga0495686_0190737 | |||
| 1267 | Ga0495593_0021510 | |||
| 1268 | Ga0495593_0050639 | |||
| 1269 | Ga0495602_0021970 | |||
| 1270 | Ga0495602_0199872 | |||
| 1271 | Ga0495602_0630935 | |||
| 1272 | Ga0495602_1163322 | |||
| 1273 | Ga0495614_0250556 | |||
| 1274 | Ga0496100_0366780 | |||
| 1275 | Ga0496100_0446077 | |||
| 1276 | Ga0496101_0241042 | |||
| 1277 | Ga0496101_0294036 | |||
| 1278 | Ga0496101_0323288 | |||
| 1279 | Ga0496101_0694559 | |||
| 1280 | Ga0496102_0041667 | |||
| 1281 | Ga0496102_0092325 | |||
| 1282 | Ga0496102_0105120 | |||
| 1283 | Ga0496102_0480590 | |||
| 1284 | Ga0496103_0008108 | |||
| 1285 | Ga0496103_0114068 | |||
| 1286 | Ga0496104_0167585 | |||
| 1287 | Ga0496104_0177900 | |||
| 1288 | Ga0496104_0478564 | |||
| 1289 | Ga0496105_0007693 | |||
| 1290 | Ga0496105_0090967 | |||
| 1291 | Ga0496105_0185299 | |||
| 1292 | Ga0496105_0220093 | |||
| 1293 | Ga0496106_0002906 | |||
| 1294 | Ga0496107_0109400 | |||
| 1295 | Ga0496108_0029631 | |||
| 1296 | Ga0496108_0466442 | |||
| 1297 | Ga0496108_0510089 | |||
| 1298 | Ga0496109_0021733 | |||
| 1299 | Ga0496109_0295026 | |||
| 1300 | Ga0496109_0454468 | |||
| 1301 | Ga0496110_0026859 | |||
| 1302 | Ga0496110_0092468 | |||
| 1303 | Ga0496110_0102619 | |||
| 1304 | Ga0496110_0682797 | |||
| 1305 | Ga0496110_0859777 | |||
| 1306 | Ga0496111_0626187 | |||
| 1307 | Ga0496111_0662585 | |||
| 1308 | Ga0496112_0020223 | |||
| 1309 | Ga0496112_0057068 | |||
| 1310 | Ga0496112_1121637 | |||
| 1311 | Ga0496113_0188784 | |||
| 1312 | Ga0496113_0227362 | |||
| 1313 | Ga0496113_0319323 | |||
| 1314 | Ga0496113_0924216 | |||
| 1315 | Ga0496113_1545756 | |||
| 1316 | Ga0496113_1605449 | |||
| 1317 | Ga0496114_0037855 | |||
| 1318 | Ga0496114_0065276 | |||
| 1319 | Ga0496115_0192853 | |||
| 1320 | Ga0496115_0793048 | |||
| 1321 | Ga0496116_0025848 | |||
| 1322 | Ga0496117_0085016 | |||
| 1323 | Ga0496118_0026627 | |||
| 1324 | Ga0496118_0043946 | |||
| 1325 | Ga0496118_0504902 | |||
| 1326 | Ga0496119_0051350 | |||
| 1327 | Ga0496119_0320577 | |||
| 1328 | Ga0496119_0411445 | |||
| 1329 | Ga0496120_0009584 | |||
| 1330 | Ga0496121_0015186 | |||
| 1331 | Ga0496121_0075045 | |||
| 1332 | Ga0496121_0480750 | |||
| 1333 | Ga0496122_0265287 | |||
| 1334 | Ga0496123_0520210 | |||
| 1335 | Ga0496124_0389107 | |||
| 1336 | Ga0496125_0099157 | |||
| 1337 | Ga0496125_0176586 | |||
| 1338 | Ga0496126_0048084 | |||
| 1339 | Ga0496126_0208530 | |||
| 1340 | Ga0496126_0283239 | |||
| 1341 | Ga0495682_0025954 | |||
| 1342 | Ga0501033_0051200 | |||
| 1343 | Ga0501034_0018357 | |||
| 1344 | Ga0501034_0642648 | |||
| 1345 | Ga0501034_0935725 | |||
| 1346 | Ga0501042_0161495 | |||
| 1347 | Ga0501047_0041969 | |||
| 1348 | Ga0501067_0338820 | |||
| 1349 | Ga0501070_0019833 | |||
| 1350 | Ga0501072_0757656 | |||
| 1351 | Ga0501073_0029828 | |||
| 1352 | Ga0501074_0465170 | |||
| 1353 | Ga0501080_0006437 | |||
| 1354 | Ga0501044_0098698 | |||
| 1355 | Ga0501044_0133258 | |||
| 1356 | nmdc:mga03n38_45266_c1 | |||
| 1357 | nmdc:mga03n38_86694_c1 | |||
| 1358 | nmdc:mga00v17_123735_c1 | |||
| 1359 | nmdc:mga0yw44_13038_c1 | |||
| 1360 | nmdc:mga0yw44_150764_c1 | |||
| 1361 | nmdc:mga0yw44_152419_c1 | |||
| 1362 | nmdc:mga0yw44_85313_c1 | |||
| 1363 | nmdc:mga0k408_217551_c1 | |||
| 1364 | nmdc:mga0k408_447071_c1 | |||
| 1365 | nmdc:mga06z11_7726_c1 | |||
| 1366 | nmdc:mga04h51_36009_c1 | |||
| 1367 | nmdc:mga07m45_19690_c1 | |||
| 1368 | nmdc:mga07m45_4626_c1 | |||
| 1369 | nmdc:mga07m45_547610_c1 | |||
| 1370 | nmdc:mga0n895_137781_c1 | |||
| 1371 | nmdc:mga0n895_303833_c1 | |||
| 1372 | nmdc:mga0rr50_1765440_c1 | |||
| 1373 | nmdc:mga0rr50_318310_c1 | |||
| 1374 | nmdc:mga0a205_659102_c1 | |||
| 1375 | nmdc:mga0a205_674679_c1 | |||
| 1376 | nmdc:mga0sz30_279168_c1 | |||
| 1377 | nmdc:mga0sz30_357280_c1 | |||
| 1378 | nmdc:mga0sz30_41349_c1 | |||
| 1379 | nmdc:mga0sz30_422726_c1 | |||
| 1380 | Ga0495601_0070963 | |||
| 1381 | Ga0495612_0073638 | |||
| 1382 | Ga0500610_0065760 | |||
| 1383 | Ga0495619_0034521 | |||
| 1384 | Ga0495619_0042664 | |||
| 1385 | Ga0495619_0530840 | |||
| 1386 | Ga0500578_0412790 | |||
| 1387 | Ga0500647_0071734 | |||
| 1388 | Ga0500651_0055502 | |||
| 1389 | Ga0500566_0081543 | |||
| 1390 | Ga0500566_0112688 | |||
| 1391 | Ga0500640_142154 | |||
| 1392 | Ga0500557_000025 | |||
| 1393 | Ga0500569_076776 | |||
| 1394 | Ga0500595_073576 | |||
| 1395 | Ga0500608_110623 | |||
| 1396 | Ga0500642_0000021 | |||
| 1397 | Ga0500559_0010250 | |||
| 1398 | Ga0500577_0372396 | |||
| 1399 | Ga0500620_001486 | |||
| 1400 | Ga0500639_107596 | |||
| 1401 | Ga0500639_232197 | |||
| 1402 | Ga0500636_0002008 | |||
| 1403 | Ga0500636_0067434 | |||
| 1404 | Ga0500625_025869 | |||
| 1405 | Ga0500609_004769 | |||
| 1406 | 2937845901 | |||
| 1407 | 2507507386 | |||
| 1408 | 2508541438 | |||
| 1409 | 2508693234 | |||
| 1410 | 2509154158 | |||
| 1411 | 2513621531 | |||
| 1412 | 2513636984 | |||
| 1413 | 2513652076 | |||
| 1414 | 2513722056 | |||
| 1415 | 2513879844 | |||
| 1416 | 2513892265 | |||
| 1417 | 2514011576 | |||
| 1418 | 2515629780 | |||
| 1419 | 2517104685 | |||
| 1420 | 2524441208 | |||
| 1421 | 2528850517 | |||
| 1422 | 2617351915 | |||
| 1423 | 2745078669 | |||
| 1424 | 2793061149 | |||
| 1425 | 2805918532 | |||
| 1426 | 2818236874 | |||
| 1427 | 2824670023 | |||
| 1428 | 2824677830 | |||
| 1429 | 2824686211 | |||
| 1430 | 2824694178 | |||
| 1431 | 2824701897 | |||
| 1432 | 2824710752 | |||
| 1433 | 2824757760 | |||
| 1434 | 2824768728 | |||
| 1435 | 2824777231 | |||
| 1436 | 2838127229 | |||
| 1437 | 2841947470 | |||
| 1438 | 2841956259 | |||
| 1439 | 2841962567 | |||
| 1440 | 2841974492 | |||
| 1441 | 2841980758 | |||
| 1442 | 2841987329 | |||
| 1443 | 2842040961 | |||
| 1444 | 2842046094 | |||
| 1445 | 2844320281 | |||
| 1446 | 2847937610 | |||
| 1447 | 2847948055 | |||
| 1448 | 2874592854 | |||
| 1449 | 2874614389 | |||
| 1450 | 2874623780 | |||
| 1451 | 2874633057 | |||
| 1452 | 2874650702 | |||
| 1453 | 2876768479 | |||
| 1454 | 2876776294 | |||
| 1455 | 2876822254 | |||
| 1456 | 2879080383 | |||
| 1457 | 2879084106 | |||
| 1458 | 2879103563 | |||
| 1459 | 2879133459 | |||
| 1460 | 2879145782 | |||
| 1461 | 2881370244 | |||
| 1462 | 2881667165 | |||
| 1463 | 2885370270 | |||
| 1464 | 2885418542 | |||
| 1465 | 2888385797 | |||
| 1466 | 2903731561 | |||
| 1467 | 2904674009 | |||
| 1468 | 2904711608 | |||
| 1469 | 2906608330 | |||
| 1470 | 2906634266 | |||
| 1471 | 2906645179 | |||
| 1472 | 2922376045 | |||
| 1473 | 2922393691 | |||
| 1474 | 2929622876 | |||
| 1475 | 2929631413 | |||
| 1476 | 2932785294 | |||
| 1477 | 2932808660 | |||
| 1478 | 2932810327 | |||
| 1479 | 2932821900 | |||
| 1480 | 2932831863 | |||
| 1481 | 2933584920 | |||
| 1482 | 2935610238 | |||
| 1483 | 2935619450 | |||
| 1484 | 2935638430 | |||
| 1485 | 2935651211 | |||
| 1486 | 2935659391 | |||
| 1487 | 2935666718 | |||
| 1488 | 2935682090 | |||
| 1489 | 2935691249 | |||
| 1490 | 2935694322 | |||
| 1491 | 2935703434 | |||
| 1492 | 2935718630 | |||
| 1493 | 2935727390 | |||
| 1494 | 2935736093 | |||
| 1495 | 2935745473 | |||
| 1496 | 2935755854 | |||
| 1497 | 2935760887 | |||
| 1498 | 2935771222 | |||
| 1499 | 2935781013 | |||
| 1500 | 2935786077 | |||
| 1501 | 2935797740 | |||
| 1502 | 2935801573 | |||
| 1503 | 2935815019 | |||
| 1504 | 2935823399 | |||
| 1505 | 2935827924 | |||
| 1506 | 2935842129 | |||
| 1507 | 2935848883 | |||
| 1508 | 2935858234 | |||
| 1509 | 2935872047 | |||
| 1510 | 2935873838 | |||
| 1511 | 2935912987 | |||
| 1512 | 2935924440 | |||
| 1513 | 2935930120 | |||
| 1514 | 2935939021 | |||
| 1515 | 2935945968 | |||
| 1516 | 2935955305 | |||
| 1517 | 2935963004 | |||
| 1518 | 2935972324 | |||
| 1519 | 2935976249 | |||
| 1520 | 2935986255 | |||
| 1521 | 2935993238 | |||
| 1522 | 2936003175 | |||
| 1523 | 2936013806 | |||
| 1524 | 2936022670 | |||
| 1525 | 2936033277 | |||
| 1526 | 2936040337 | |||
| 1527 | 2936048912 | |||
| 1528 | 2936060510 | |||
| 1529 | 2940562171 | |||
| 1530 | 2941531486 | |||
| 1531 | 2941542178 | |||
| 1532 | 3005488553 | |||
| 1533 | 3005588374 | |||
| 1534 | 3005600654 | |||
| 1535 | 3005723433 | |||
| 1536 | 8006927771 | |||
| 1537 | 8016520323 | |||
| 1538 | 8016528380 | |||
| 1539 | 8016533528 | |||
| 1540 | 8016546757 | |||
| 1541 | 8016555359 | |||
| 1542 | 8016563720 | |||
| 1543 | 8016571860 | |||
| 1544 | 8016576074 | |||
| 1545 | 8016594739 | |||
| 1546 | 8016601450 | |||
| 1547 | 8016608651 | |||
| 1548 | 8016616223 | |||
| 1549 | 8016625019 | |||
| 1550 | 8016638858 | |||
| 1551 | 8017065246 | |||
| 1552 | 8019533320 | |||
| 1553 | 8019546716 | |||
| 1554 | 8019552055 | |||
| 1555 | 8019584641 | |||
| 1556 | 8019592413 | |||
| 1557 | 8019598864 | |||
| 1558 | 8019609511 | |||
| 1559 | 8019620114 | |||
| 1560 | 8019632991 | |||
| 1561 | 8019646931 | |||
| 1562 | 8019655761 | |||
| 1563 | 8019660858 | |||
| 1564 | 8019670408 | |||
| 1565 | 8019685822 | |||
| 1566 | 8019691996 | |||
| 1567 | 8055744762 | |||
| 1568 | 8056974776 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bqo-assembly1.cif.gz_A | structure of a dual topology fluoride channel with monobody s8 | 0.9324 | 12 | 135 |
| 6bqo-assembly2.cif.gz_B-2 | structure of a dual topology fluoride channel with monobody s8 | 0.9223 | 12 | 133 |
| 6bx5-assembly1.cif.gz_A | the crystal structure of fluoride channel fluc ec2 with monobody s12 | 0.9111 | 10 | 135 |
| 5a40-assembly2.cif.gz_C | crystal structure of a dual topology fluoride ion channel. | 0.911 | 12 | 135 |
| 7kk9-assembly1.cif.gz_A | fluoride channel fluc-ec2 mutant s81a/t82a with bromide | 0.9099 | 11 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9331 | 15 | 129 | 1.10.287.70 |
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9168 | 15 | 129 | 1.10.287.70 |
| af_Q2FXE6_4_114_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9017 | 15 | 128 | 1.10.287.70 |
| af_P9WP63_10_123_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8874 | 15 | 129 | 1.10.287.70 |
| af_Q2FXE5_5_115_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8864 | 15 | 128 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R7CLK9-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9721 | 2 | 138 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A2E1XVB5-F1-model_v4 | deleted | 0.9695 | 13 | 140 |
|
| AF-D7A8E4-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9686 | 9 | 137 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A3M1JXV6-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9676 | 12 | 136 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A432UZG4-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9675 | 2 | 141 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |