F480718

General Info

Members Datasets Scaffolds Average Seq Length
784 514 1568 141

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937843397|2937845901
Length 161
Sequence EHSRSNATVGKAAKSRRWAPGRAARNSVVLYAAVGLGSMAGGVTRALVSIASLELLGPAFPWGTLAANLAGSFLIGLYAALTEPGGRIFAGSAQRQFVMAGFCGGFTTFSLFSLETFQLILEDRWPTAVFYVAASLLAWFAAVWLGHVWGWRINRLRGKDI

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
336 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
339 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
340 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
343 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
344 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
347 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
348 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
353 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
354 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
355 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
356 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
357 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
358 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
359 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
360 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
361 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
362 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
363 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
364 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
365 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
366 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
367 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
368 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
369 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
370 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
371 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
372 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
373 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
374 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
375 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
376 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
377 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
378 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
379 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
380 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
381 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
382 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
383 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
384 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
385 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
386 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
387 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
388 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
389 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
390 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
391 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
392 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
393 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
394 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
395 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
396 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
397 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
398 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
399 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
400 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
401 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
402 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
403 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
404 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
405 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
406 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
407 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
408 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
409 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
410 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
411 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
412 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
413 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
414 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
415 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
416 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
417 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
418 2922368715
419 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
420 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
421 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
422 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
423 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
424 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
425 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
426 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
427 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
428 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
429 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
430 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
431 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
432 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
433 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
434 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
435 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
436 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
437 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
438 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
439 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
440 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
441 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
442 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
443 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
444 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
445 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
446 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
447 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
448 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
449 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
450 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
451 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
452 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
453 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
454 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
455 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
456 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
457 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
458 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
459 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
460 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
461 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
462 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
463 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
464 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
465 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
466 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
467 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
468 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
469 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
470 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
471 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
472 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
473 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
474 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
475 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
476 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
477 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
478 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
479 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
480 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
481 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
482 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
483 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
484 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
485 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
486 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
487 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
488 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
489 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
490 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
491 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
492 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
493 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
494 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
495 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
496 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
497 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
498 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
502 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
503 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
504 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
505 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
506 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
507 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
508 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
509 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
510 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
511 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
512 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
513 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
514 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.31
Metatranscriptomes 0
Isolates 20.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.1
Nodule 17.6
Rhizoplane 6.12
Rhizosphere 56.76
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007734 3300003203 Bacteria 4888
2 JGI25153J46596_10000853 3300003215 Bacteria 18697
3 JGI25153J46596_10013646 3300003215 Bacteria 3422
4 JGI25153J46596_10042922 3300003215 Bacteria 1375
5 rootH1_10004454 3300003316 Bacteria 1026
6 rootH2_10008939 3300003320 Bacteria 3165
7 rootH2_10151742 3300003320 Bacteria 1351
8 rootL2_10205672 3300003322 Bacteria 1939
9 rootH1_10128380 3300003323 Bacteria 1435
10 JGI25160J50197_1000926 3300003354 Bacteria 15441
11 JGI25160J50197_1002416 3300003354 Bacteria 8710
12 Ga0055542_1013863 3300003762 Bacteria 1341
13 Ga0055524_1039493 3300003775 Bacteria 1217
14 Ga0055531_10018479 3300003794 Bacteria 2873
15 Ga0065165_1014675 3300005262 Bacteria 3030
16 Ga0070658_10156978 3300005327 Bacteria 1907
17 Ga0070676_10561198 3300005328 Unclassified 818
18 Ga0070683_100017909 3300005329 Bacteria 6262
19 Ga0070683_100169944 3300005329 Bacteria 2069
20 Ga0070683_100416048 3300005329 Bacteria 1282
21 Ga0070666_10076752 3300005335 Bacteria 2280
22 Ga0070680_100057043 3300005336 Bacteria 3192
23 Ga0068868_100050735 3300005338 Bacteria 3260
24 Ga0070660_100112655 3300005339 Bacteria 2166
25 Ga0070660_100477563 3300005339 Bacteria 1036
26 Ga0070661_100722323 3300005344 Unclassified 813
27 Ga0070661_101368776 3300005344 Unclassified 595
28 Ga0070668_100039698 3300005347 Bacteria 3599
29 Ga0070668_100132908 3300005347 Bacteria 1998
30 Ga0070668_100439227 3300005347 Unclassified 1120
31 Ga0070671_100423786 3300005355 Bacteria 1140
32 Ga0070673_101172994 3300005364 Bacteria 719
33 Ga0070659_100157449 3300005366 Bacteria 1856
34 Ga0070667_100057832 3300005367 Bacteria 3278
35 Ga0070667_100731402 3300005367 Bacteria 917
36 Ga0070709_10119176 3300005434 Bacteria 1786
37 Ga0070709_10184010 3300005434 Bacteria 1469
38 Ga0070709_10220009 3300005434 Unclassified 1354
39 Ga0070714_100016729 3300005435 Bacteria 5930
40 Ga0070714_100099710 3300005435 Bacteria 2557
41 Ga0070714_100118753 3300005435 Bacteria 2350
42 Ga0070714_101401821 3300005435 Unclassified 682
43 Ga0070713_100008549 3300005436 Bacteria 7264
44 Ga0070713_100076076 3300005436 Bacteria 2850
45 Ga0070713_100119642 3300005436 Bacteria 2308
46 Ga0070710_10001667 3300005437 Bacteria 10462
47 Ga0070711_100186863 3300005439 Bacteria 1589
48 Ga0070705_100340312 3300005440 Bacteria 1090
49 Ga0070694_100089081 3300005444 Bacteria 2162
50 Ga0070663_100064735 3300005455 Bacteria 2643
51 Ga0070663_100924265 3300005455 Bacteria 755
52 Ga0070662_100422018 3300005457 Bacteria 1103
53 Ga0070662_100677094 3300005457 Bacteria 871
54 Ga0070681_10011710 3300005458 Bacteria 8689
55 Ga0070681_10746408 3300005458 Bacteria 895
56 Ga0068867_100056149 3300005459 Bacteria 2913
57 Ga0070679_100079922 3300005530 Bacteria 3259
58 Ga0070679_100088482 3300005530 Bacteria 3084
59 Ga0070684_100006061 3300005535 Bacteria 9319
60 Ga0070684_100043340 3300005535 Bacteria 3885
61 Ga0070697_100850165 3300005536 Bacteria 808
62 Ga0068853_100088835 3300005539 Bacteria 2713
63 Ga0068853_101210068 3300005539 Bacteria 729
64 Ga0068853_101239188 3300005539 Bacteria 720
65 Ga0070695_100181072 3300005545 Bacteria 1493
66 Ga0070696_100584339 3300005546 Bacteria 899
67 Ga0070696_100782785 3300005546 Bacteria 784
68 Ga0070693_100284914 3300005547 Bacteria 1108
69 Ga0070665_100466693 3300005548 Bacteria 1273
70 Ga0070704_100041436 3300005549 Bacteria 3178
71 Ga0068855_100141353 3300005563 Bacteria 2744
72 Ga0068855_100144379 3300005563 Bacteria 2711
73 Ga0068855_100282696 3300005563 Bacteria 1842
74 Ga0070664_100916624 3300005564 Bacteria 822
75 Ga0068857_100265734 3300005577 Bacteria 1576
76 Ga0068857_100418176 3300005577 Bacteria 1249
77 Ga0068857_100781668 3300005577 Bacteria 911
78 Ga0068857_101127442 3300005577 Bacteria 758
79 Ga0068854_100061469 3300005578 Bacteria 2721
80 Ga0068854_101272757 3300005578 Bacteria 661
81 Ga0068856_100053937 3300005614 Bacteria 3964
82 Ga0068856_101337351 3300005614 Unclassified 731
83 Ga0068852_100190613 3300005616 Bacteria 1934
84 Ga0068852_100356082 3300005616 Bacteria 1430
85 Ga0068852_101391393 3300005616 Bacteria 723
86 Ga0068859_101542298 3300005617 Bacteria 733
87 Ga0068861_100252605 3300005719 Bacteria 1505
88 Ga0068861_100943138 3300005719 Bacteria 820
89 Ga0068863_100095913 3300005841 Bacteria 2815
90 Ga0068858_100589770 3300005842 Bacteria 1078
91 Ga0068862_100183806 3300005844 Bacteria 1878
92 Ga0068862_100770168 3300005844 Bacteria 938
93 Ga0081540_1015533 3300005983 Bacteria 4817
94 Ga0081539_10005072 3300005985 Bacteria 13803
95 Ga0081539_10010606 3300005985 Bacteria 7443
96 Ga0070717_10058208 3300006028 Bacteria 3196
97 Ga0070717_10141687 3300006028 Bacteria 2074
98 Ga0070717_10203050 3300006028 Bacteria 1737
99 Ga0070717_11127577 3300006028 Bacteria 714
100 Ga0075365_10012372 3300006038 Bacteria 5067
101 Ga0075365_10016667 3300006038 Bacteria 4475
102 Ga0075365_10018063 3300006038 Bacteria 4329
103 Ga0075368_10000989 3300006042 Bacteria 8888
104 Ga0075368_10237413 3300006042 Bacteria 777
105 Ga0075363_100016183 3300006048 Bacteria 3680
106 Ga0075363_100062529 3300006048 Bacteria 2007
107 Ga0070715_10005523 3300006163 Bacteria 4223
108 Ga0070715_10760494 3300006163 Bacteria 584
109 Ga0070716_100072631 3300006173 Bacteria 2026
110 Ga0070716_100219950 3300006173 Bacteria 1275
111 Ga0070716_100981401 3300006173 Bacteria 667
112 Ga0075362_10006919 3300006177 Bacteria 4253
113 Ga0075367_10039462 3300006178 Bacteria 2753
114 Ga0075367_10144872 3300006178 Bacteria 1473
115 Ga0075369_10003294 3300006186 Bacteria 5865
116 Ga0075369_10257643 3300006186 Bacteria 811
117 Ga0075366_10211861 3300006195 Bacteria 1180
118 Ga0075366_10262655 3300006195 Bacteria 1054
119 Ga0075370_10147313 3300006353 Bacteria 1379
120 Ga0075370_10168579 3300006353 Bacteria 1286
121 Ga0075433_10073320 3300006852 Bacteria 3011
122 Ga0075433_10482247 3300006852 Unclassified 1092
123 Ga0075434_100176992 3300006871 Bacteria 2153
124 Ga0097620_101542265 3300006931 Bacteria 733
125 Ga0099824_1023338 3300006942 Bacteria 3857
126 Ga0075435_100315683 3300007076 Bacteria 1337
127 Ga0075435_100323470 3300007076 Bacteria 1320
128 Ga0105240_10004584 3300009093 Bacteria 20953
129 Ga0105240_10069753 3300009093 Bacteria 4350
130 Ga0105240_10244791 3300009093 Bacteria 2077
131 Ga0105240_11572669 3300009093 Unclassified 688
132 Ga0105240_11602264 3300009093 Bacteria 681
133 Ga0105245_10180057 3300009098 Bacteria 2019
134 Ga0105245_10865830 3300009098 Bacteria 944
135 Ga0105247_10197915 3300009101 Bacteria 1348
136 Ga0114129_10543086 3300009147 Bacteria 1512
137 Ga0105243_10106084 3300009148 Bacteria 2341
138 Ga0105241_10040754 3300009174 Bacteria 3506
139 Ga0105241_10044460 3300009174 Bacteria 3366
140 Ga0105241_10341948 3300009174 Bacteria 1297
141 Ga0105241_10715916 3300009174 Bacteria 915
142 Ga0105241_11121406 3300009174 Bacteria 742
143 Ga0105242_10449815 3300009176 Bacteria 1214
144 Ga0105242_11560416 3300009176 Bacteria 693
145 Ga0105248_10054112 3300009177 Bacteria 4501
146 Ga0105248_10462583 3300009177 Bacteria 1430
147 Ga0105237_10023098 3300009545 Bacteria 6377
148 Ga0105237_10047367 3300009545 Bacteria 4322
149 Ga0105237_10064969 3300009545 Bacteria 3645
150 Ga0105237_10201308 3300009545 Bacteria 1991
151 Ga0105237_10231407 3300009545 Bacteria 1849
152 Ga0105237_10670249 3300009545 Bacteria 1044
153 Ga0105238_10178245 3300009551 Bacteria 2102
154 Ga0105238_10217586 3300009551 Bacteria 1886
155 Ga0105249_10599983 3300009553 Bacteria 1156
156 Ga0105249_10700257 3300009553 Bacteria 1073
157 Ga0099796_10207935 3300010159 Bacteria 797
158 Ga0105239_10214259 3300010375 Bacteria 2159
159 Ga0105239_10353711 3300010375 Bacteria 1658
160 Ga0105239_10361934 3300010375 Bacteria 1638
161 Ga0105239_10549255 3300010375 Bacteria 1315
162 Ga0105239_10729338 3300010375 Bacteria 1134
163 Ga0105239_10882052 3300010375 Bacteria 1026
164 Ga0105239_11646611 3300010375 Bacteria 742
165 Ga0105246_10001672 3300011119 Bacteria 13215
166 Ga0105246_10301829 3300011119 Bacteria 1293
167 Ga0105246_10357717 3300011119 Bacteria 1198
168 Ga0157370_10040959 3300013104 Bacteria 4471
169 Ga0157370_10323113 3300013104 Bacteria 1423
170 Ga0157370_10636452 3300013104 Unclassified 975
171 Ga0157370_10771548 3300013104 Bacteria 875
172 Ga0157369_10009617 3300013105 Bacteria 11053
173 Ga0157369_10017510 3300013105 Bacteria 8052
174 Ga0157369_10035736 3300013105 Bacteria 5447
175 Ga0157374_10178120 3300013296 Bacteria 2076
176 Ga0157372_10182732 3300013307 Bacteria 2428
177 Ga0157372_10280047 3300013307 Bacteria 1939
178 Ga0157372_10289568 3300013307 Bacteria 1905
179 Ga0163163_10033755 3300014325 Bacteria 4952
180 Ga0163163_10116197 3300014325 Bacteria 2707
181 Ga0163163_10545170 3300014325 Bacteria 1222
182 Ga0157380_11927563 3300014326 Bacteria 652
183 Ga0182008_10922254 3300014497 Bacteria 515
184 Ga0157379_12186131 3300014968 Bacteria 549
185 Ga0157376_10373687 3300014969 Bacteria 1371
186 Ga0163161_10566321 3300017792 Bacteria 933
187 Ga0163161_10934786 3300017792 Bacteria 737
188 Ga0213872_10069255 3300021361 Bacteria 1591
189 Ga0213876_10164609 3300021384 Bacteria 1180
190 Ga0209148_1001125 3300025254 Bacteria 15820
191 Ga0209233_1001284 3300025261 Bacteria 10048
192 Ga0209233_1013491 3300025261 Bacteria 2332
193 Ga0209233_1036124 3300025261 Bacteria 1109
194 Ga0209455_1001274 3300025272 Bacteria 11798
195 Ga0209673_1036341 3300025273 Bacteria 1463
196 Ga0209564_1004893 3300025295 Bacteria 7945
197 Ga0209564_1025459 3300025295 Bacteria 1988
198 Ga0209758_1000011 3300025297 Bacteria 1049685
199 Ga0209758_1000120 3300025297 Bacteria 192212
200 Ga0209758_1001547 3300025297 Bacteria 26412
201 Ga0209758_1003623 3300025297 Bacteria 13819
202 Ga0209758_1051081 3300025297 Bacteria 1443
203 Ga0209758_1112845 3300025297 Bacteria 748
204 Ga0209256_1002195 3300025299 Bacteria 16729
205 Ga0207426_1000212 3300025302 Bacteria 137314
206 Ga0207426_1008337 3300025302 Bacteria 4201
207 Ga0207426_1044817 3300025302 Bacteria 1349
208 Ga0209051_1109437 3300025303 Bacteria 724
209 Ga0209257_1001276 3300025304 Bacteria 30845
210 Ga0209257_1024892 3300025304 Bacteria 2059
211 Ga0209257_1068782 3300025304 Bacteria 939
212 Ga0207697_10045996 3300025315 Bacteria 1797
213 Ga0207692_10001482 3300025898 Bacteria 8804
214 Ga0207710_10208115 3300025900 Bacteria 968
215 Ga0207688_10545517 3300025901 Bacteria 728
216 Ga0207680_10255399 3300025903 Bacteria 1212
217 Ga0207647_10237108 3300025904 Bacteria 1048
218 Ga0207647_10554538 3300025904 Bacteria 637
219 Ga0207685_10027127 3300025905 Bacteria 2001
220 Ga0207699_10032198 3300025906 Bacteria 2953
221 Ga0207699_10090245 3300025906 Bacteria 1922
222 Ga0207699_10163510 3300025906 Bacteria 1483
223 Ga0207699_10935051 3300025906 Bacteria 640
224 Ga0207645_10187157 3300025907 Bacteria 1360
225 Ga0207654_10062578 3300025911 Bacteria 2181
226 Ga0207654_10188560 3300025911 Bacteria 1350
227 Ga0207654_10577605 3300025911 Bacteria 800
228 Ga0207707_11496698 3300025912 Bacteria 535
229 Ga0207695_10000163 3300025913 Bacteria 197030
230 Ga0207695_10047532 3300025913 Bacteria 4540
231 Ga0207695_10117620 3300025913 Bacteria 2630
232 Ga0207671_10008503 3300025914 Bacteria 8696
233 Ga0207671_10022555 3300025914 Bacteria 4757
234 Ga0207671_10504191 3300025914 Bacteria 965
235 Ga0207671_10709221 3300025914 Bacteria 800
236 Ga0207693_10001156 3300025915 Bacteria 23542
237 Ga0207663_10000774 3300025916 Bacteria 14300
238 Ga0207663_10326618 3300025916 Unclassified 1154
239 Ga0207660_10345243 3300025917 Bacteria 1192
240 Ga0207657_10185200 3300025919 Bacteria 1682
241 Ga0207652_10070642 3300025921 Bacteria 3032
242 Ga0207681_10101475 3300025923 Bacteria 2076
243 Ga0207694_10081238 3300025924 Bacteria 2546
244 Ga0207694_10442381 3300025924 Bacteria 1085
245 Ga0207694_10506883 3300025924 Bacteria 1011
246 Ga0207687_10806432 3300025927 Bacteria 801
247 Ga0207700_10069520 3300025928 Bacteria 2703
248 Ga0207700_10123165 3300025928 Bacteria 2105
249 Ga0207700_10345523 3300025928 Bacteria 1294
250 Ga0207664_10006986 3300025929 Bacteria 7812
251 Ga0207664_10113258 3300025929 Bacteria 2259
252 Ga0207664_10288286 3300025929 Bacteria 1442
253 Ga0207664_11182723 3300025929 Unclassified 682
254 Ga0207644_10354925 3300025931 Bacteria 1191
255 Ga0207690_10130490 3300025932 Bacteria 1838
256 Ga0207706_10159994 3300025933 Bacteria 1980
257 Ga0207709_10090913 3300025935 Bacteria 1995
258 Ga0207665_10001062 3300025939 Bacteria 18496
259 Ga0207665_10096835 3300025939 Bacteria 2053
260 Ga0207665_11024231 3300025939 Bacteria 657
261 Ga0207711_10016867 3300025941 Bacteria 6065
262 Ga0207661_10000190 3300025944 Bacteria 39991
263 Ga0207661_10062281 3300025944 Bacteria 3017
264 Ga0207661_10340561 3300025944 Bacteria 1351
265 Ga0207661_11011680 3300025944 Bacteria 765
266 Ga0207679_10229673 3300025945 Bacteria 1566
267 Ga0207679_10273253 3300025945 Bacteria 1446
268 Ga0207667_10084727 3300025949 Bacteria 3281
269 Ga0207667_10221492 3300025949 Bacteria 1939
270 Ga0207667_10508999 3300025949 Bacteria 1220
271 Ga0207667_11674052 3300025949 Bacteria 603
272 Ga0207651_11138846 3300025960 Bacteria 700
273 Ga0207712_10633446 3300025961 Bacteria 928
274 Ga0207668_10083194 3300025972 Bacteria 2328
275 Ga0207640_10050050 3300025981 Bacteria 2709
276 Ga0207640_10339261 3300025981 Bacteria 1203
277 Ga0207640_10485003 3300025981 Bacteria 1026
278 Ga0207677_10105547 3300026023 Bacteria 2085
279 Ga0207703_11240908 3300026035 Bacteria 717
280 Ga0207639_10026248 3300026041 Bacteria 4232
281 Ga0207639_10613725 3300026041 Bacteria 1004
282 Ga0207639_11361525 3300026041 Bacteria 666
283 Ga0207678_10041188 3300026067 Bacteria 4004
284 Ga0207678_10286652 3300026067 Bacteria 1414
285 Ga0207678_10499649 3300026067 Bacteria 1060
286 Ga0207702_10031891 3300026078 Bacteria 4396
287 Ga0207702_10598867 3300026078 Bacteria 1081
288 Ga0207641_10057511 3300026088 Bacteria 3308
289 Ga0207648_10085270 3300026089 Bacteria 2756
290 Ga0207676_10910950 3300026095 Bacteria 863
291 Ga0207674_10015898 3300026116 Bacteria 8248
292 Ga0207674_10114889 3300026116 Bacteria 2664
293 Ga0207674_10647811 3300026116 Bacteria 1020
294 Ga0207674_10751436 3300026116 Bacteria 941
295 Ga0207675_100152003 3300026118 Bacteria 2203
296 Ga0207683_10112495 3300026121 Bacteria 2438
297 Ga0207698_10043427 3300026142 Bacteria 3367
298 Ga0207698_11010026 3300026142 Bacteria 843
299 Ga0209389_1000186 3300027296 Bacteria 47149
300 Ga0209389_1000261 3300027296 Bacteria 33507
301 Ga0209589_1001077 3300027357 Bacteria 43273
302 Ga0209489_100176 3300027361 Bacteria 100053
303 Ga0209489_107409 3300027361 Bacteria 16395
304 Ga0209700_101165 3300027363 Bacteria 53492
305 Ga0209813_10030253 3300027866 Bacteria 1590
306 Ga0268266_10117064 3300028379 Bacteria 2368
307 Ga0268266_10521717 3300028379 Bacteria 1136
308 Ga0265330_10140373 3300031235 Bacteria 1027
309 Ga0265325_10032964 3300031241 Bacteria 2763
310 Ga0265339_10013152 3300031249 Bacteria 5023
311 Ga0307508_10380130 3300031616 Bacteria 1003
312 Ga0265314_10379221 3300031711 Bacteria 770
313 Ga0307507_10481356 3300033179 Bacteria 675
314 Ga0307510_10286009 3300033180 Bacteria 1117
315 Ga0373926_0012014 3300035083 Bacteria 2923
316 Ga0373944_0190036 3300035089 Unclassified 740
317 Ga0373923_0011082 3300035111 Bacteria 3298
318 Ga0373936_0011222 3300035113 Bacteria 3388
319 Ga0373954_0076415 3300035118 Bacteria 1596
320 Ga0373956_0098972 3300035119 Bacteria 1351
321 Ga0373943_0015344 3300035170 Bacteria 3478
322 Ga0373946_0053370 3300035171 Bacteria 1697
323 Ga0373962_0396499 3300035242 Bacteria 507
324 Ga0373924_0023904 3300035410 Bacteria 2403
325 Ga0373924_0131754 3300035410 Bacteria 1088
326 Ga0373935_0133129 3300035692 Bacteria 1672
327 Ga0373927_0073192 3300035695 Bacteria 2218
328 Ga0373933_0083502 3300035724 Bacteria 1962
329 Ga0373933_0236463 3300035724 Bacteria 1174
330 Ga0373947_0026121 3300035725 Bacteria 3409
331 Ga0373937_0344386 3300036401 Bacteria 1411
332 Ga0373937_1210860 3300036401 Bacteria 704
333 Ga0373925_0046619 3300037068 Bacteria 3223
334 Ga0395899_0119304 3300037312 Bacteria 1891
335 Ga0395899_0231961 3300037312 Bacteria 1274
336 Ga0395900_0019004 3300037418 Bacteria 7008
337 Ga0395900_0193921 3300037418 Unclassified 2059
338 Ga0395898_0006007 3300037466 Bacteria 13037
339 Ga0395898_0011066 3300037466 Bacteria 9397
340 Ga0395898_0464568 3300037466 Bacteria 1205
341 Ga0395898_0746904 3300037466 Bacteria 920
342 Ga0395905_0003820 3300037471 Bacteria 15925
343 Ga0395905_0444058 3300037471 Bacteria 1195
344 Ga0395901_0034499 3300038443 Bacteria 5225
345 Ga0395901_0230035 3300038443 Bacteria 1936
346 Ga0395901_0258400 3300038443 Bacteria 1813
347 Ga0436365_0474195 3300039437 Bacteria 5476
348 Ga0436365_0716502 3300039437 Bacteria 864
349 Ga0436360_0119024 3300039438 Bacteria 999
350 Ga0436361_0072738 3300039447 Bacteria 2452
351 Ga0436363_0587036 3300039450 Bacteria 838
352 Ga0451795_1700028 3300041456 Bacteria 869
353 Ga0451841_0329692 3300041498 Bacteria 1342
354 Ga0451845_0481100 3300041501 Bacteria 787
355 Ga0451853_1845826 3300041512 Bacteria 845
356 Ga0466969_0025866 3300044656 Bacteria 3014
357 Ga0466972_0000394 3300044658 Bacteria 23185
358 Ga0466972_0025885 3300044658 Bacteria 2907
359 Ga0466965_0132210 3300044683 Bacteria 1295
360 Ga0466966_0001791 3300044684 Bacteria 13935
361 Ga0466961_0000005 3300044693 Bacteria 173105
362 Ga0466961_0908456 3300044693 Bacteria 524
363 Ga0466963_0053240 3300044694 Bacteria 2687
364 Ga0466963_0134134 3300044694 Bacteria 1712
365 Ga0466964_0043048 3300044706 Bacteria 1831
366 Ga0466968_0000345 3300044735 Bacteria 14999
367 Ga0466970_0263636 3300044765 Bacteria 967
368 Ga0466957_0098732 3300044842 Bacteria 1838
369 Ga0466957_0187800 3300044842 Bacteria 1352
370 Ga0466960_0008575 3300044901 Bacteria 4189
371 Ga0466959_0001046 3300045049 Bacteria 16580
372 Ga0466959_0158412 3300045049 Bacteria 1592
373 Ga0466959_0377237 3300045049 Bacteria 965
374 Ga0466958_0188986 3300045836 Bacteria 1309
375 Ga0466967_0768316 3300045976 Bacteria 956
376 Ga0466967_1328126 3300045976 Bacteria 716
377 Ga0495592_0124465 3300046454 Bacteria 1810
378 Ga0495603_0186196 3300046455 Unclassified 1201
379 Ga0495603_0307197 3300046455 Bacteria 911
380 Ga0495629_0001349 3300046459 Bacteria 19349
381 Ga0495629_0046141 3300046459 Bacteria 3057
382 Ga0495629_0544241 3300046459 Bacteria 780
383 Ga0495641_0149921 3300046461 Bacteria 1042
384 Ga0495651_0037351 3300046462 Bacteria 3781
385 Ga0495651_0285423 3300046462 Bacteria 1113
386 Ga0495653_0046667 3300046463 Bacteria 3354
387 Ga0495653_0260403 3300046463 Unclassified 1147
388 Ga0495580_0032957 3300046472 Bacteria 3733
389 Ga0495605_0062333 3300046474 Bacteria 1782
390 Ga0495639_0007468 3300046475 Bacteria 4692
391 Ga0495662_0033737 3300046476 Bacteria 2473
392 Ga0495664_0005395 3300046477 Bacteria 7020
393 Ga0495664_0009101 3300046477 Bacteria 5550
394 Ga0495664_0068001 3300046477 Bacteria 2126
395 Ga0495584_0267678 3300046491 Bacteria 869
396 Ga0495594_0153819 3300046499 Bacteria 1306
397 Ga0495594_0178103 3300046499 Bacteria 1210
398 Ga0495596_0046732 3300046500 Bacteria 1700
399 Ga0495607_0198441 3300046501 Bacteria 995
400 Ga0495583_0261396 3300046506 Bacteria 692
401 Ga0495583_0313339 3300046506 Bacteria 622
402 Ga0495606_0031464 3300046507 Bacteria 3689
403 Ga0495606_0061128 3300046507 Bacteria 2410
404 Ga0495606_0095256 3300046507 Bacteria 1823
405 Ga0495606_0437164 3300046507 Bacteria 673
406 Ga0495610_0287098 3300046512 Bacteria 639
407 Ga0495616_0030405 3300046513 Bacteria 2839
408 Ga0495618_0038330 3300046514 Bacteria 3012
409 Ga0495628_0044488 3300046516 Bacteria 3532
410 Ga0495630_0040595 3300046517 Bacteria 3478
411 Ga0495630_0082095 3300046517 Bacteria 2433
412 Ga0495630_0464646 3300046517 Bacteria 970
413 Ga0495630_0955098 3300046517 Bacteria 652
414 Ga0495643_0195959 3300046522 Bacteria 973
415 Ga0495648_0066376 3300046524 Bacteria 2115
416 Ga0495648_0230411 3300046524 Bacteria 907
417 Ga0495642_0114644 3300046528 Bacteria 1154
418 Ga0495652_0018046 3300046529 Bacteria 6294
419 Ga0495652_0116141 3300046529 Bacteria 2143
420 Ga0495665_0008372 3300046531 Bacteria 5609
421 Ga0495640_0046425 3300046533 Bacteria 3009
422 Ga0495640_0127369 3300046533 Bacteria 1650
423 Ga0495586_0059437 3300046535 Bacteria 2077
424 Ga0495587_0036830 3300046536 Bacteria 2941
425 Ga0495609_0176428 3300046538 Bacteria 901
426 Ga0495597_0270500 3300046542 Bacteria 664
427 Ga0495645_0084724 3300046543 Bacteria 2269
428 Ga0495645_0137875 3300046543 Bacteria 1705
429 Ga0495622_0022994 3300046557 Bacteria 2905
430 Ga0495622_0057029 3300046557 Bacteria 1811
431 Ga0495667_0144643 3300046559 Bacteria 1532
432 Ga0495667_0625366 3300046559 Bacteria 670
433 Ga0495668_0025808 3300046616 Bacteria 3337
434 Ga0495634_0039534 3300046642 Bacteria 3212
435 Ga0495634_0084636 3300046642 Bacteria 2067
436 Ga0495625_0066520 3300046660 Bacteria 2538
437 Ga0495625_0314387 3300046660 Bacteria 999
438 Ga0495635_0001321 3300046663 Bacteria 16507
439 Ga0495635_0242760 3300046663 Bacteria 1215
440 Ga0495635_0522754 3300046663 Bacteria 780
441 Ga0495661_0289692 3300046665 Bacteria 823
442 Ga0495588_0005349 3300046674 Bacteria 5710
443 Ga0495588_0299149 3300046674 Bacteria 847
444 Ga0495657_0011371 3300046675 Bacteria 6658
445 Ga0495657_0027251 3300046675 Bacteria 4035
446 Ga0495657_0342169 3300046675 Bacteria 886
447 Ga0495599_0363763 3300046678 Bacteria 866
448 Ga0495623_0005927 3300046679 Bacteria 7963
449 Ga0495623_0177932 3300046679 Bacteria 1238
450 Ga0495646_0076556 3300046680 Bacteria 1959
451 Ga0495646_0167554 3300046680 Bacteria 1212
452 Ga0495658_0102775 3300046683 Bacteria 1708
453 Ga0495613_0094799 3300046689 Bacteria 2159
454 Ga0495624_0019101 3300046690 Bacteria 4578
455 Ga0495624_0024259 3300046690 Bacteria 3992
456 Ga0495649_0063070 3300046694 Bacteria 1992
457 Ga0495649_0207707 3300046694 Bacteria 1015
458 Ga0495600_0002477 3300046809 Bacteria 10603
459 Ga0495600_0329867 3300046809 Bacteria 958
460 Ga0495581_0028575 3300047315 Bacteria 3232
461 Ga0495581_0098754 3300047315 Bacteria 1696
462 Ga0495604_0018932 3300047317 Bacteria 5514
463 Ga0495604_0027180 3300047317 Bacteria 4552
464 Ga0495674_0004826 3300047319 Bacteria 12966
465 Ga0495674_0020467 3300047319 Bacteria 6123
466 Ga0495674_1181351 3300047319 Bacteria 579
467 Ga0495672_0297999 3300047320 Bacteria 765
468 Ga0495676_0152022 3300047321 Bacteria 1646
469 Ga0495680_0002514 3300047322 Bacteria 18756
470 Ga0495683_0016642 3300047323 Bacteria 3816
471 Ga0495687_011407 3300047443 Bacteria 4783
472 Ga0495675_0047583 3300047444 Bacteria 2729
473 Ga0495675_0455676 3300047444 Bacteria 739
474 Ga0495675_0489409 3300047444 Unclassified 707
475 Ga0495677_0208465 3300047445 Bacteria 760
476 Ga0495685_187606 3300047447 Bacteria 665
477 Ga0495673_0056674 3300047469 Bacteria 1694
478 Ga0495673_0112432 3300047469 Bacteria 1087
479 Ga0495673_0351081 3300047469 Bacteria 520
480 Ga0495684_0023802 3300047471 Bacteria 4709
481 Ga0495684_0550805 3300047471 Bacteria 785
482 Ga0495686_0190737 3300047472 Bacteria 1182
483 Ga0495593_0021510 3300047673 Bacteria 3602
484 Ga0495593_0050639 3300047673 Bacteria 2200
485 Ga0495602_0021970 3300048088 Bacteria 6257
486 Ga0495602_0199872 3300048088 Bacteria 1526
487 Ga0495602_0630935 3300048088 Bacteria 734
488 Ga0495602_1163322 3300048088 Bacteria 504
489 Ga0495614_0250556 3300048089 Unclassified 810
490 Ga0496100_0366780 3300048903 Bacteria 1091
491 Ga0496100_0446077 3300048903 Bacteria 991
492 Ga0496101_0241042 3300048904 Bacteria 1407
493 Ga0496101_0294036 3300048904 Bacteria 1271
494 Ga0496101_0323288 3300048904 Bacteria 1210
495 Ga0496101_0694559 3300048904 Bacteria 803
496 Ga0496102_0041667 3300048905 Bacteria 4159
497 Ga0496102_0092325 3300048905 Bacteria 2803
498 Ga0496102_0105120 3300048905 Bacteria 2627
499 Ga0496102_0480590 3300048905 Bacteria 1164
500 Ga0496103_0008108 3300048906 Bacteria 6238
501 Ga0496103_0114068 3300048906 Bacteria 1718
502 Ga0496104_0167585 3300048907 Bacteria 2106
503 Ga0496104_0177900 3300048907 Bacteria 2037
504 Ga0496104_0478564 3300048907 Bacteria 1156
505 Ga0496105_0007693 3300048908 Bacteria 8356
506 Ga0496105_0090967 3300048908 Bacteria 2520
507 Ga0496105_0185299 3300048908 Bacteria 1703
508 Ga0496105_0220093 3300048908 Bacteria 1546
509 Ga0496106_0002906 3300048909 Bacteria 12746
510 Ga0496107_0109400 3300048910 Bacteria 2030
511 Ga0496108_0029631 3300048911 Bacteria 4534
512 Ga0496108_0466442 3300048911 Bacteria 1103
513 Ga0496108_0510089 3300048911 Bacteria 1050
514 Ga0496109_0021733 3300048912 Bacteria 5678
515 Ga0496109_0295026 3300048912 Bacteria 1529
516 Ga0496109_0454468 3300048912 Bacteria 1210
517 Ga0496110_0026859 3300048913 Bacteria 4930
518 Ga0496110_0092468 3300048913 Bacteria 2707
519 Ga0496110_0102619 3300048913 Bacteria 2565
520 Ga0496110_0682797 3300048913 Bacteria 928
521 Ga0496110_0859777 3300048913 Bacteria 812
522 Ga0496111_0626187 3300048914 Bacteria 786
523 Ga0496111_0662585 3300048914 Unclassified 761
524 Ga0496112_0020223 3300048915 Bacteria 6304
525 Ga0496112_0057068 3300048915 Bacteria 3843
526 Ga0496112_1121637 3300048915 Bacteria 704
527 Ga0496113_0188784 3300048916 Bacteria 1635
528 Ga0496113_0227362 3300048916 Bacteria 1487
529 Ga0496113_0319323 3300048916 Bacteria 1245
530 Ga0496113_0924216 3300048916 Bacteria 689
531 Ga0496113_1545756 3300048916 Bacteria 511
532 Ga0496113_1605449 3300048916 Bacteria 500
533 Ga0496114_0037855 3300048917 Bacteria 3991
534 Ga0496114_0065276 3300048917 Bacteria 3050
535 Ga0496115_0192853 3300048918 Bacteria 1683
536 Ga0496115_0793048 3300048918 Bacteria 738
537 Ga0496116_0025848 3300048919 Bacteria 4306
538 Ga0496117_0085016 3300048920 Bacteria 2062
539 Ga0496118_0026627 3300048921 Bacteria 4919
540 Ga0496118_0043946 3300048921 Bacteria 3505
541 Ga0496118_0504902 3300048921 Bacteria 600
542 Ga0496119_0051350 3300048922 Bacteria 2534
543 Ga0496119_0320577 3300048922 Bacteria 759
544 Ga0496119_0411445 3300048922 Bacteria 643
545 Ga0496120_0009584 3300048923 Bacteria 6849
546 Ga0496121_0015186 3300048924 Bacteria 8095
547 Ga0496121_0075045 3300048924 Bacteria 2703
548 Ga0496121_0480750 3300048924 Bacteria 793
549 Ga0496122_0265287 3300048925 Bacteria 950
550 Ga0496123_0520210 3300048926 Bacteria 516
551 Ga0496124_0389107 3300048927 Bacteria 972
552 Ga0496125_0099157 3300048928 Bacteria 2153
553 Ga0496125_0176586 3300048928 Bacteria 1428
554 Ga0496126_0048084 3300048929 Bacteria 3901
555 Ga0496126_0208530 3300048929 Bacteria 1646
556 Ga0496126_0283239 3300048929 Bacteria 1372
557 Ga0495682_0025954 3300049460 Bacteria 2178
558 Ga0501033_0051200 3300049570 Bacteria 3061
559 Ga0501034_0018357 3300049571 Bacteria 7174
560 Ga0501034_0642648 3300049571 Bacteria 963
561 Ga0501034_0935725 3300049571 Bacteria 753
562 Ga0501042_0161495 3300049578 Bacteria 1617
563 Ga0501047_0041969 3300049581 Bacteria 4421
564 Ga0501067_0338820 3300049583 Bacteria 838
565 Ga0501070_0019833 3300049586 Bacteria 5638
566 Ga0501072_0757656 3300049588 Bacteria 761
567 Ga0501073_0029828 3300049589 Bacteria 3897
568 Ga0501074_0465170 3300049590 Bacteria 896
569 Ga0501080_0006437 3300049742 Bacteria 10542
570 Ga0501044_0098698 3300049823 Bacteria 2940
571 Ga0501044_0133258 3300049823 Bacteria 2478
572 nmdc:mga03n38_45266_c1 3300050490 Bacteria 1937
573 nmdc:mga03n38_86694_c1 3300050490 Bacteria 1482
574 nmdc:mga00v17_123735_c1 3300050491 Bacteria 1649
575 nmdc:mga0yw44_13038_c1 3300050492 Bacteria 4358
576 nmdc:mga0yw44_150764_c1 3300050492 Bacteria 1516
577 nmdc:mga0yw44_152419_c1 3300050492 Bacteria 1509
578 nmdc:mga0yw44_85313_c1 3300050492 Bacteria 1987
579 nmdc:mga0k408_217551_c1 3300050493 Bacteria 1140
580 nmdc:mga0k408_447071_c1 3300050493 Bacteria 768
581 nmdc:mga06z11_7726_c1 3300050494 Bacteria 4441
582 nmdc:mga04h51_36009_c1 3300050495 Bacteria 1590
583 nmdc:mga07m45_19690_c1 3300050496 Bacteria 3657
584 nmdc:mga07m45_4626_c1 3300050496 Bacteria 6748
585 nmdc:mga07m45_547610_c1 3300050496 Bacteria 669
586 nmdc:mga0n895_137781_c1 3300050512 Bacteria 2468
587 nmdc:mga0n895_303833_c1 3300050512 Bacteria 1617
588 nmdc:mga0rr50_1765440_c1 3300050513 Bacteria 521
589 nmdc:mga0rr50_318310_c1 3300050513 Bacteria 1304
590 nmdc:mga0a205_659102_c1 3300050515 Bacteria 898
591 nmdc:mga0a205_674679_c1 3300050515 Unclassified 568
592 nmdc:mga0sz30_279168_c1 3300050516 Bacteria 744
593 nmdc:mga0sz30_357280_c1 3300050516 Bacteria 653
594 nmdc:mga0sz30_41349_c1 3300050516 Bacteria 1938
595 nmdc:mga0sz30_422726_c1 3300050516 Bacteria 598
596 Ga0495601_0070963 3300053077 Bacteria 2224
597 Ga0495612_0073638 3300053078 Bacteria 1427
598 Ga0500610_0065760 3300053079 Bacteria 1891
599 Ga0495619_0034521 3300053085 Bacteria 3289
600 Ga0495619_0042664 3300053085 Bacteria 2972
601 Ga0495619_0530840 3300053085 Bacteria 808
602 Ga0500578_0412790 3300053086 Bacteria 775
603 Ga0500647_0071734 3300053091 Bacteria 1664
604 Ga0500651_0055502 3300053093 Bacteria 2481
605 Ga0500566_0081543 3300053094 Bacteria 1799
606 Ga0500566_0112688 3300053094 Bacteria 1477
607 Ga0500640_142154 3300053095 Bacteria 929
608 Ga0500557_000025 3300053105 Bacteria 84884
609 Ga0500569_076776 3300053109 Bacteria 1061
610 Ga0500595_073576 3300053119 Bacteria 1010
611 Ga0500608_110623 3300053122 Bacteria 1260
612 Ga0500642_0000021 3300053130 Bacteria 146938
613 Ga0500559_0010250 3300053136 Bacteria 4029
614 Ga0500577_0372396 3300053142 Bacteria 625
615 Ga0500620_001486 3300053155 Bacteria 4359
616 Ga0500639_107596 3300053163 Bacteria 1362
617 Ga0500639_232197 3300053163 Bacteria 758
618 Ga0500636_0002008 3300053177 Bacteria 11199
619 Ga0500636_0067434 3300053177 Bacteria 2079
620 Ga0500625_025869 3300053729 Bacteria 2777
621 Ga0500609_004769 3300053731 Bacteria 1866
622 2937845901 2937843397 Bacteria 5256375
623 2507507386 2507262055 Bacteria 8048963
624 2508541438 2508501009 Bacteria 7784016
625 2508693234 2508501042 Bacteria 8719808
626 2509154158 2508501128 Bacteria 8613869
627 2513621531 2513237092 Bacteria 8341956
628 2513636984 2513237094 Bacteria 8789602
629 2513652076 2513237095 Bacteria 8976980
630 2513722056 2513237104 Bacteria 10034502
631 2513879844 2513237139 Bacteria 8737671
632 2513892265 2513237141 Bacteria 8496279
633 2514011576 2513237161 Bacteria 8871253
634 2515629780 2515154112 Bacteria 8294334
635 2517104685 2517093001 Bacteria 9002274
636 2524441208 2524023205 Bacteria 8918781
637 2528850517 2528768022 Bacteria 10457665
638 2617351915 2617270735 Bacteria 9163226
639 2745078669 2744054633 Bacteria 8678936
640 2793061149 2791355196 Bacteria 7323613
641 2805918532 2802429603 Bacteria 8777136
642 2818236874 2816332527 Bacteria 8933356
643 2824670023 2824661429 Bacteria 9877870
644 2824677830 2824671348 Bacteria 8369588
645 2824686211 2824679649 Bacteria 8248951
646 2824694178 2824687955 Bacteria 8360029
647 2824701897 2824696289 Bacteria 8335049
648 2824710752 2824704595 Bacteria 9667483
649 2824757760 2824753945 Bacteria 9787441
650 2824768728 2824763712 Bacteria 9792355
651 2824777231 2824773399 Bacteria 8360218
652 2838127229 2838122688 Bacteria 8803140
653 2841947470 2841941048 Bacteria 8688029
654 2841956259 2841949485 Bacteria 8680857
655 2841962567 2841957949 Bacteria 8652217
656 2841974492 2841966195 Bacteria 8673214
657 2841980758 2841974524 Bacteria 8931498
658 2841987329 2841983080 Bacteria 8395090
659 2842040961 2842038055 Bacteria 8002051
660 2842046094 2842045827 Bacteria 8006841
661 2844320281 2844315083 Bacteria 8138177
662 2847937610 2847930680 Bacteria 9342022
663 2847948055 2847939898 Bacteria 8606328
664 2874592854 2874590934 Bacteria 8299676
665 2874614389 2874612657 Bacteria 8252029
666 2874623780 2874620515 Bacteria 8290088
667 2874633057 2874628541 Bacteria 8630250
668 2874650702 2874645413 Bacteria 8214782
669 2876768479 2876761206 Bacteria 10111113
670 2876776294 2876771140 Bacteria 8287509
671 2876822254 2876818435 Bacteria 8274608
672 2879080383 2879074833 Bacteria 8279565
673 2879084106 2879083081 Bacteria 8587928
674 2879103563 2879099564 Bacteria 10442239
675 2879133459 2879127579 Bacteria 8294491
676 2879145782 2879142872 Bacteria 8267021
677 2881370244 2881364244 Bacteria 7710352
678 2881667165 2881665667 Bacteria 8175609
679 2885370270 2885366525 Bacteria 8326213
680 2885418542 2885409591 Bacteria 9235467
681 2888385797 2888378607 Bacteria 9652610
682 2903731561 2903727486 Bacteria 8281579
683 2904674009 2904666416 Bacteria 8226587
684 2904711608 2904711408 Bacteria 9771557
685 2906608330 2906602504 Bacteria 8295279
686 2906634266 2906626472 Bacteria 8826946
687 2906645179 2906643746 Bacteria 8722424
688 2922376045
689 2922393691 2922393267 Bacteria 8285685
690 2929622876 2929615660 Bacteria 9193770
691 2929631413 2929624759 Bacteria 9339455
692 2932785294 2932784394 Bacteria 9704911
693 2932808660 2932801729 Bacteria 7987968
694 2932810327 2932809354 Bacteria 9135765
695 2932821900 2932818245 Bacteria 9955613
696 2932831863 2932828146 Bacteria 9745859
697 2933584920 2933577622 Bacteria 9116884
698 2935610238 2935608549 Bacteria 8203142
699 2935619450 2935616580 Bacteria 9032984
700 2935638430 2935638405 Bacteria 10015038
701 2935651211 2935648319 Bacteria 8801166
702 2935659391 2935656913 Bacteria 8965014
703 2935666718 2935665750 Bacteria 9571747
704 2935682090 2935675223 Bacteria 9928132
705 2935691249 2935684952 Bacteria 9590419
706 2935694322 2935694250 Bacteria 9291695
707 2935703434 2935703347 Bacteria 10242284
708 2935718630 2935713505 Bacteria 9608509
709 2935727390 2935722832 Bacteria 9608746
710 2935736093 2935732158 Bacteria 9706831
711 2935745473 2935741537 Bacteria 9707219
712 2935755854 2935750917 Bacteria 9590372
713 2935760887 2935760218 Bacteria 9817913
714 2935771222 2935769743 Bacteria 7878163
715 2935781013 2935777560 Bacteria 8077691
716 2935786077 2935785616 Bacteria 7962367
717 2935797740 2935793552 Bacteria 8012592
718 2935801573 2935801545 Bacteria 9301974
719 2935815019 2935810662 Bacteria 9401221
720 2935823399 2935819856 Bacteria 8261050
721 2935827924 2935827899 Bacteria 10038562
722 2935842129 2935837841 Bacteria 9454360
723 2935848883 2935847175 Bacteria 8228321
724 2935858234 2935855204 Bacteria 9035059
725 2935872047 2935864058 Bacteria 9784707
726 2935873838 2935873716 Bacteria 9632195
727 2935912987 2935908558 Bacteria 8568796
728 2935924440 2935916978 Bacteria 9113783
729 2935930120 2935926038 Bacteria 8601059
730 2935939021 2935934488 Bacteria 8602579
731 2935945968 2935942939 Bacteria 8599779
732 2935955305 2935951376 Bacteria 8602333
733 2935963004 2935959822 Bacteria 7869783
734 2935972324 2935967501 Bacteria 8603075
735 2935976249 2935975950 Bacteria 8347125
736 2935986255 2935984226 Bacteria 8302647
737 2935993238 2935992306 Bacteria 9802711
738 2936003175 2936002035 Bacteria 9362176
739 2936013806 2936011229 Bacteria 8801034
740 2936022670 2936019824 Bacteria 8804134
741 2936033277 2936028420 Bacteria 8965941
742 2936040337 2936037263 Bacteria 9446081
743 2936048912 2936046547 Bacteria 8903709
744 2936060510 2936055302 Bacteria 8785755
745 2940562171 2940556831 Bacteria 9590747
746 2941531486 2941531003 Bacteria 7653939
747 2941542178 2941538514 Bacteria 9402094
748 3005488553 3005483717 Bacteria 7877331
749 3005588374 3005587118 Bacteria 7794411
750 3005600654 3005594810 Bacteria 8716512
751 3005723433 3005718088 Bacteria 8283608
752 8006927771 8006926726 Bacteria 6749210
753 8016520323 8016511872 Bacteria 9921665
754 8016528380 8016522445 Bacteria 8156687
755 8016533528 8016530956 Bacteria 8155261
756 8016546757 8016539877 Bacteria 8155419
757 8016555359 8016548790 Bacteria 8155074
758 8016563720 8016557553 Bacteria 8154380
759 8016571860 8016566248 Bacteria 8158151
760 8016576074 8016575299 Bacteria 8154085
761 8016594739 8016583857 Bacteria 10421953
762 8016601450 8016595262 Bacteria 8149947
763 8016608651 8016603502 Bacteria 8731218
764 8016616223 8016613128 Bacteria 8794220
765 8016625019 8016622563 Bacteria 7999408
766 8016638858 8016630954 Bacteria 9217207
767 8017065246 8017057580 Bacteria 10023680
768 8019533320 8019530166 Bacteria 8155624
769 8019546716 8019538911 Bacteria 7872763
770 8019552055 8019547302 Bacteria 7996444
771 8019584641 8019576017 Bacteria 10049540
772 8019592413 8019586578 Bacteria 10212056
773 8019598864 8019597564 Bacteria 10041141
774 8019609511 8019608314 Bacteria 10042931
775 8019620114 8019619141 Bacteria 9218857
776 8019632991 8019629233 Bacteria 8687553
777 8019646931 8019638758 Bacteria 9062356
778 8019655761 8019648815 Bacteria 10014479
779 8019660858 8019659431 Bacteria 8577854
780 8019670408 8019668869 Bacteria 8791617
781 8019685822 8019678201 Bacteria 8863603
782 8019691996 8019687851 Bacteria 8712826
783 8055744762 8055742211 Bacteria 9226248
784 8056974776 8056967851 Bacteria 9038162
785 JGI25406J46586_10007734
786 JGI25153J46596_10000853
787 JGI25153J46596_10013646
788 JGI25153J46596_10042922
789 rootH1_10004454
790 rootH2_10008939
791 rootH2_10151742
792 rootL2_10205672
793 rootH1_10128380
794 JGI25160J50197_1000926
795 JGI25160J50197_1002416
796 Ga0055542_1013863
797 Ga0055524_1039493
798 Ga0055531_10018479
799 Ga0065165_1014675
800 Ga0070658_10156978
801 Ga0070676_10561198
802 Ga0070683_100017909
803 Ga0070683_100169944
804 Ga0070683_100416048
805 Ga0070666_10076752
806 Ga0070680_100057043
807 Ga0068868_100050735
808 Ga0070660_100112655
809 Ga0070660_100477563
810 Ga0070661_100722323
811 Ga0070661_101368776
812 Ga0070668_100039698
813 Ga0070668_100132908
814 Ga0070668_100439227
815 Ga0070671_100423786
816 Ga0070673_101172994
817 Ga0070659_100157449
818 Ga0070667_100057832
819 Ga0070667_100731402
820 Ga0070709_10119176
821 Ga0070709_10184010
822 Ga0070709_10220009
823 Ga0070714_100016729
824 Ga0070714_100099710
825 Ga0070714_100118753
826 Ga0070714_101401821
827 Ga0070713_100008549
828 Ga0070713_100076076
829 Ga0070713_100119642
830 Ga0070710_10001667
831 Ga0070711_100186863
832 Ga0070705_100340312
833 Ga0070694_100089081
834 Ga0070663_100064735
835 Ga0070663_100924265
836 Ga0070662_100422018
837 Ga0070662_100677094
838 Ga0070681_10011710
839 Ga0070681_10746408
840 Ga0068867_100056149
841 Ga0070679_100079922
842 Ga0070679_100088482
843 Ga0070684_100006061
844 Ga0070684_100043340
845 Ga0070697_100850165
846 Ga0068853_100088835
847 Ga0068853_101210068
848 Ga0068853_101239188
849 Ga0070695_100181072
850 Ga0070696_100584339
851 Ga0070696_100782785
852 Ga0070693_100284914
853 Ga0070665_100466693
854 Ga0070704_100041436
855 Ga0068855_100141353
856 Ga0068855_100144379
857 Ga0068855_100282696
858 Ga0070664_100916624
859 Ga0068857_100265734
860 Ga0068857_100418176
861 Ga0068857_100781668
862 Ga0068857_101127442
863 Ga0068854_100061469
864 Ga0068854_101272757
865 Ga0068856_100053937
866 Ga0068856_101337351
867 Ga0068852_100190613
868 Ga0068852_100356082
869 Ga0068852_101391393
870 Ga0068859_101542298
871 Ga0068861_100252605
872 Ga0068861_100943138
873 Ga0068863_100095913
874 Ga0068858_100589770
875 Ga0068862_100183806
876 Ga0068862_100770168
877 Ga0081540_1015533
878 Ga0081539_10005072
879 Ga0081539_10010606
880 Ga0070717_10058208
881 Ga0070717_10141687
882 Ga0070717_10203050
883 Ga0070717_11127577
884 Ga0075365_10012372
885 Ga0075365_10016667
886 Ga0075365_10018063
887 Ga0075368_10000989
888 Ga0075368_10237413
889 Ga0075363_100016183
890 Ga0075363_100062529
891 Ga0070715_10005523
892 Ga0070715_10760494
893 Ga0070716_100072631
894 Ga0070716_100219950
895 Ga0070716_100981401
896 Ga0075362_10006919
897 Ga0075367_10039462
898 Ga0075367_10144872
899 Ga0075369_10003294
900 Ga0075369_10257643
901 Ga0075366_10211861
902 Ga0075366_10262655
903 Ga0075370_10147313
904 Ga0075370_10168579
905 Ga0075433_10073320
906 Ga0075433_10482247
907 Ga0075434_100176992
908 Ga0097620_101542265
909 Ga0099824_1023338
910 Ga0075435_100315683
911 Ga0075435_100323470
912 Ga0105240_10004584
913 Ga0105240_10069753
914 Ga0105240_10244791
915 Ga0105240_11572669
916 Ga0105240_11602264
917 Ga0105245_10180057
918 Ga0105245_10865830
919 Ga0105247_10197915
920 Ga0114129_10543086
921 Ga0105243_10106084
922 Ga0105241_10040754
923 Ga0105241_10044460
924 Ga0105241_10341948
925 Ga0105241_10715916
926 Ga0105241_11121406
927 Ga0105242_10449815
928 Ga0105242_11560416
929 Ga0105248_10054112
930 Ga0105248_10462583
931 Ga0105237_10023098
932 Ga0105237_10047367
933 Ga0105237_10064969
934 Ga0105237_10201308
935 Ga0105237_10231407
936 Ga0105237_10670249
937 Ga0105238_10178245
938 Ga0105238_10217586
939 Ga0105249_10599983
940 Ga0105249_10700257
941 Ga0099796_10207935
942 Ga0105239_10214259
943 Ga0105239_10353711
944 Ga0105239_10361934
945 Ga0105239_10549255
946 Ga0105239_10729338
947 Ga0105239_10882052
948 Ga0105239_11646611
949 Ga0105246_10001672
950 Ga0105246_10301829
951 Ga0105246_10357717
952 Ga0157370_10040959
953 Ga0157370_10323113
954 Ga0157370_10636452
955 Ga0157370_10771548
956 Ga0157369_10009617
957 Ga0157369_10017510
958 Ga0157369_10035736
959 Ga0157374_10178120
960 Ga0157372_10182732
961 Ga0157372_10280047
962 Ga0157372_10289568
963 Ga0163163_10033755
964 Ga0163163_10116197
965 Ga0163163_10545170
966 Ga0157380_11927563
967 Ga0182008_10922254
968 Ga0157379_12186131
969 Ga0157376_10373687
970 Ga0163161_10566321
971 Ga0163161_10934786
972 Ga0213872_10069255
973 Ga0213876_10164609
974 Ga0209148_1001125
975 Ga0209233_1001284
976 Ga0209233_1013491
977 Ga0209233_1036124
978 Ga0209455_1001274
979 Ga0209673_1036341
980 Ga0209564_1004893
981 Ga0209564_1025459
982 Ga0209758_1000011
983 Ga0209758_1000120
984 Ga0209758_1001547
985 Ga0209758_1003623
986 Ga0209758_1051081
987 Ga0209758_1112845
988 Ga0209256_1002195
989 Ga0207426_1000212
990 Ga0207426_1008337
991 Ga0207426_1044817
992 Ga0209051_1109437
993 Ga0209257_1001276
994 Ga0209257_1024892
995 Ga0209257_1068782
996 Ga0207697_10045996
997 Ga0207692_10001482
998 Ga0207710_10208115
999 Ga0207688_10545517
1000 Ga0207680_10255399
1001 Ga0207647_10237108
1002 Ga0207647_10554538
1003 Ga0207685_10027127
1004 Ga0207699_10032198
1005 Ga0207699_10090245
1006 Ga0207699_10163510
1007 Ga0207699_10935051
1008 Ga0207645_10187157
1009 Ga0207654_10062578
1010 Ga0207654_10188560
1011 Ga0207654_10577605
1012 Ga0207707_11496698
1013 Ga0207695_10000163
1014 Ga0207695_10047532
1015 Ga0207695_10117620
1016 Ga0207671_10008503
1017 Ga0207671_10022555
1018 Ga0207671_10504191
1019 Ga0207671_10709221
1020 Ga0207693_10001156
1021 Ga0207663_10000774
1022 Ga0207663_10326618
1023 Ga0207660_10345243
1024 Ga0207657_10185200
1025 Ga0207652_10070642
1026 Ga0207681_10101475
1027 Ga0207694_10081238
1028 Ga0207694_10442381
1029 Ga0207694_10506883
1030 Ga0207687_10806432
1031 Ga0207700_10069520
1032 Ga0207700_10123165
1033 Ga0207700_10345523
1034 Ga0207664_10006986
1035 Ga0207664_10113258
1036 Ga0207664_10288286
1037 Ga0207664_11182723
1038 Ga0207644_10354925
1039 Ga0207690_10130490
1040 Ga0207706_10159994
1041 Ga0207709_10090913
1042 Ga0207665_10001062
1043 Ga0207665_10096835
1044 Ga0207665_11024231
1045 Ga0207711_10016867
1046 Ga0207661_10000190
1047 Ga0207661_10062281
1048 Ga0207661_10340561
1049 Ga0207661_11011680
1050 Ga0207679_10229673
1051 Ga0207679_10273253
1052 Ga0207667_10084727
1053 Ga0207667_10221492
1054 Ga0207667_10508999
1055 Ga0207667_11674052
1056 Ga0207651_11138846
1057 Ga0207712_10633446
1058 Ga0207668_10083194
1059 Ga0207640_10050050
1060 Ga0207640_10339261
1061 Ga0207640_10485003
1062 Ga0207677_10105547
1063 Ga0207703_11240908
1064 Ga0207639_10026248
1065 Ga0207639_10613725
1066 Ga0207639_11361525
1067 Ga0207678_10041188
1068 Ga0207678_10286652
1069 Ga0207678_10499649
1070 Ga0207702_10031891
1071 Ga0207702_10598867
1072 Ga0207641_10057511
1073 Ga0207648_10085270
1074 Ga0207676_10910950
1075 Ga0207674_10015898
1076 Ga0207674_10114889
1077 Ga0207674_10647811
1078 Ga0207674_10751436
1079 Ga0207675_100152003
1080 Ga0207683_10112495
1081 Ga0207698_10043427
1082 Ga0207698_11010026
1083 Ga0209389_1000186
1084 Ga0209389_1000261
1085 Ga0209589_1001077
1086 Ga0209489_100176
1087 Ga0209489_107409
1088 Ga0209700_101165
1089 Ga0209813_10030253
1090 Ga0268266_10117064
1091 Ga0268266_10521717
1092 Ga0265330_10140373
1093 Ga0265325_10032964
1094 Ga0265339_10013152
1095 Ga0307508_10380130
1096 Ga0265314_10379221
1097 Ga0307507_10481356
1098 Ga0307510_10286009
1099 Ga0373926_0012014
1100 Ga0373944_0190036
1101 Ga0373923_0011082
1102 Ga0373936_0011222
1103 Ga0373954_0076415
1104 Ga0373956_0098972
1105 Ga0373943_0015344
1106 Ga0373946_0053370
1107 Ga0373962_0396499
1108 Ga0373924_0023904
1109 Ga0373924_0131754
1110 Ga0373935_0133129
1111 Ga0373927_0073192
1112 Ga0373933_0083502
1113 Ga0373933_0236463
1114 Ga0373947_0026121
1115 Ga0373937_0344386
1116 Ga0373937_1210860
1117 Ga0373925_0046619
1118 Ga0395899_0119304
1119 Ga0395899_0231961
1120 Ga0395900_0019004
1121 Ga0395900_0193921
1122 Ga0395898_0006007
1123 Ga0395898_0011066
1124 Ga0395898_0464568
1125 Ga0395898_0746904
1126 Ga0395905_0003820
1127 Ga0395905_0444058
1128 Ga0395901_0034499
1129 Ga0395901_0230035
1130 Ga0395901_0258400
1131 Ga0436365_0474195
1132 Ga0436365_0716502
1133 Ga0436360_0119024
1134 Ga0436361_0072738
1135 Ga0436363_0587036
1136 Ga0451795_1700028
1137 Ga0451841_0329692
1138 Ga0451845_0481100
1139 Ga0451853_1845826
1140 Ga0466969_0025866
1141 Ga0466972_0000394
1142 Ga0466972_0025885
1143 Ga0466965_0132210
1144 Ga0466966_0001791
1145 Ga0466961_0000005
1146 Ga0466961_0908456
1147 Ga0466963_0053240
1148 Ga0466963_0134134
1149 Ga0466964_0043048
1150 Ga0466968_0000345
1151 Ga0466970_0263636
1152 Ga0466957_0098732
1153 Ga0466957_0187800
1154 Ga0466960_0008575
1155 Ga0466959_0001046
1156 Ga0466959_0158412
1157 Ga0466959_0377237
1158 Ga0466958_0188986
1159 Ga0466967_0768316
1160 Ga0466967_1328126
1161 Ga0495592_0124465
1162 Ga0495603_0186196
1163 Ga0495603_0307197
1164 Ga0495629_0001349
1165 Ga0495629_0046141
1166 Ga0495629_0544241
1167 Ga0495641_0149921
1168 Ga0495651_0037351
1169 Ga0495651_0285423
1170 Ga0495653_0046667
1171 Ga0495653_0260403
1172 Ga0495580_0032957
1173 Ga0495605_0062333
1174 Ga0495639_0007468
1175 Ga0495662_0033737
1176 Ga0495664_0005395
1177 Ga0495664_0009101
1178 Ga0495664_0068001
1179 Ga0495584_0267678
1180 Ga0495594_0153819
1181 Ga0495594_0178103
1182 Ga0495596_0046732
1183 Ga0495607_0198441
1184 Ga0495583_0261396
1185 Ga0495583_0313339
1186 Ga0495606_0031464
1187 Ga0495606_0061128
1188 Ga0495606_0095256
1189 Ga0495606_0437164
1190 Ga0495610_0287098
1191 Ga0495616_0030405
1192 Ga0495618_0038330
1193 Ga0495628_0044488
1194 Ga0495630_0040595
1195 Ga0495630_0082095
1196 Ga0495630_0464646
1197 Ga0495630_0955098
1198 Ga0495643_0195959
1199 Ga0495648_0066376
1200 Ga0495648_0230411
1201 Ga0495642_0114644
1202 Ga0495652_0018046
1203 Ga0495652_0116141
1204 Ga0495665_0008372
1205 Ga0495640_0046425
1206 Ga0495640_0127369
1207 Ga0495586_0059437
1208 Ga0495587_0036830
1209 Ga0495609_0176428
1210 Ga0495597_0270500
1211 Ga0495645_0084724
1212 Ga0495645_0137875
1213 Ga0495622_0022994
1214 Ga0495622_0057029
1215 Ga0495667_0144643
1216 Ga0495667_0625366
1217 Ga0495668_0025808
1218 Ga0495634_0039534
1219 Ga0495634_0084636
1220 Ga0495625_0066520
1221 Ga0495625_0314387
1222 Ga0495635_0001321
1223 Ga0495635_0242760
1224 Ga0495635_0522754
1225 Ga0495661_0289692
1226 Ga0495588_0005349
1227 Ga0495588_0299149
1228 Ga0495657_0011371
1229 Ga0495657_0027251
1230 Ga0495657_0342169
1231 Ga0495599_0363763
1232 Ga0495623_0005927
1233 Ga0495623_0177932
1234 Ga0495646_0076556
1235 Ga0495646_0167554
1236 Ga0495658_0102775
1237 Ga0495613_0094799
1238 Ga0495624_0019101
1239 Ga0495624_0024259
1240 Ga0495649_0063070
1241 Ga0495649_0207707
1242 Ga0495600_0002477
1243 Ga0495600_0329867
1244 Ga0495581_0028575
1245 Ga0495581_0098754
1246 Ga0495604_0018932
1247 Ga0495604_0027180
1248 Ga0495674_0004826
1249 Ga0495674_0020467
1250 Ga0495674_1181351
1251 Ga0495672_0297999
1252 Ga0495676_0152022
1253 Ga0495680_0002514
1254 Ga0495683_0016642
1255 Ga0495687_011407
1256 Ga0495675_0047583
1257 Ga0495675_0455676
1258 Ga0495675_0489409
1259 Ga0495677_0208465
1260 Ga0495685_187606
1261 Ga0495673_0056674
1262 Ga0495673_0112432
1263 Ga0495673_0351081
1264 Ga0495684_0023802
1265 Ga0495684_0550805
1266 Ga0495686_0190737
1267 Ga0495593_0021510
1268 Ga0495593_0050639
1269 Ga0495602_0021970
1270 Ga0495602_0199872
1271 Ga0495602_0630935
1272 Ga0495602_1163322
1273 Ga0495614_0250556
1274 Ga0496100_0366780
1275 Ga0496100_0446077
1276 Ga0496101_0241042
1277 Ga0496101_0294036
1278 Ga0496101_0323288
1279 Ga0496101_0694559
1280 Ga0496102_0041667
1281 Ga0496102_0092325
1282 Ga0496102_0105120
1283 Ga0496102_0480590
1284 Ga0496103_0008108
1285 Ga0496103_0114068
1286 Ga0496104_0167585
1287 Ga0496104_0177900
1288 Ga0496104_0478564
1289 Ga0496105_0007693
1290 Ga0496105_0090967
1291 Ga0496105_0185299
1292 Ga0496105_0220093
1293 Ga0496106_0002906
1294 Ga0496107_0109400
1295 Ga0496108_0029631
1296 Ga0496108_0466442
1297 Ga0496108_0510089
1298 Ga0496109_0021733
1299 Ga0496109_0295026
1300 Ga0496109_0454468
1301 Ga0496110_0026859
1302 Ga0496110_0092468
1303 Ga0496110_0102619
1304 Ga0496110_0682797
1305 Ga0496110_0859777
1306 Ga0496111_0626187
1307 Ga0496111_0662585
1308 Ga0496112_0020223
1309 Ga0496112_0057068
1310 Ga0496112_1121637
1311 Ga0496113_0188784
1312 Ga0496113_0227362
1313 Ga0496113_0319323
1314 Ga0496113_0924216
1315 Ga0496113_1545756
1316 Ga0496113_1605449
1317 Ga0496114_0037855
1318 Ga0496114_0065276
1319 Ga0496115_0192853
1320 Ga0496115_0793048
1321 Ga0496116_0025848
1322 Ga0496117_0085016
1323 Ga0496118_0026627
1324 Ga0496118_0043946
1325 Ga0496118_0504902
1326 Ga0496119_0051350
1327 Ga0496119_0320577
1328 Ga0496119_0411445
1329 Ga0496120_0009584
1330 Ga0496121_0015186
1331 Ga0496121_0075045
1332 Ga0496121_0480750
1333 Ga0496122_0265287
1334 Ga0496123_0520210
1335 Ga0496124_0389107
1336 Ga0496125_0099157
1337 Ga0496125_0176586
1338 Ga0496126_0048084
1339 Ga0496126_0208530
1340 Ga0496126_0283239
1341 Ga0495682_0025954
1342 Ga0501033_0051200
1343 Ga0501034_0018357
1344 Ga0501034_0642648
1345 Ga0501034_0935725
1346 Ga0501042_0161495
1347 Ga0501047_0041969
1348 Ga0501067_0338820
1349 Ga0501070_0019833
1350 Ga0501072_0757656
1351 Ga0501073_0029828
1352 Ga0501074_0465170
1353 Ga0501080_0006437
1354 Ga0501044_0098698
1355 Ga0501044_0133258
1356 nmdc:mga03n38_45266_c1
1357 nmdc:mga03n38_86694_c1
1358 nmdc:mga00v17_123735_c1
1359 nmdc:mga0yw44_13038_c1
1360 nmdc:mga0yw44_150764_c1
1361 nmdc:mga0yw44_152419_c1
1362 nmdc:mga0yw44_85313_c1
1363 nmdc:mga0k408_217551_c1
1364 nmdc:mga0k408_447071_c1
1365 nmdc:mga06z11_7726_c1
1366 nmdc:mga04h51_36009_c1
1367 nmdc:mga07m45_19690_c1
1368 nmdc:mga07m45_4626_c1
1369 nmdc:mga07m45_547610_c1
1370 nmdc:mga0n895_137781_c1
1371 nmdc:mga0n895_303833_c1
1372 nmdc:mga0rr50_1765440_c1
1373 nmdc:mga0rr50_318310_c1
1374 nmdc:mga0a205_659102_c1
1375 nmdc:mga0a205_674679_c1
1376 nmdc:mga0sz30_279168_c1
1377 nmdc:mga0sz30_357280_c1
1378 nmdc:mga0sz30_41349_c1
1379 nmdc:mga0sz30_422726_c1
1380 Ga0495601_0070963
1381 Ga0495612_0073638
1382 Ga0500610_0065760
1383 Ga0495619_0034521
1384 Ga0495619_0042664
1385 Ga0495619_0530840
1386 Ga0500578_0412790
1387 Ga0500647_0071734
1388 Ga0500651_0055502
1389 Ga0500566_0081543
1390 Ga0500566_0112688
1391 Ga0500640_142154
1392 Ga0500557_000025
1393 Ga0500569_076776
1394 Ga0500595_073576
1395 Ga0500608_110623
1396 Ga0500642_0000021
1397 Ga0500559_0010250
1398 Ga0500577_0372396
1399 Ga0500620_001486
1400 Ga0500639_107596
1401 Ga0500639_232197
1402 Ga0500636_0002008
1403 Ga0500636_0067434
1404 Ga0500625_025869
1405 Ga0500609_004769
1406 2937845901
1407 2507507386
1408 2508541438
1409 2508693234
1410 2509154158
1411 2513621531
1412 2513636984
1413 2513652076
1414 2513722056
1415 2513879844
1416 2513892265
1417 2514011576
1418 2515629780
1419 2517104685
1420 2524441208
1421 2528850517
1422 2617351915
1423 2745078669
1424 2793061149
1425 2805918532
1426 2818236874
1427 2824670023
1428 2824677830
1429 2824686211
1430 2824694178
1431 2824701897
1432 2824710752
1433 2824757760
1434 2824768728
1435 2824777231
1436 2838127229
1437 2841947470
1438 2841956259
1439 2841962567
1440 2841974492
1441 2841980758
1442 2841987329
1443 2842040961
1444 2842046094
1445 2844320281
1446 2847937610
1447 2847948055
1448 2874592854
1449 2874614389
1450 2874623780
1451 2874633057
1452 2874650702
1453 2876768479
1454 2876776294
1455 2876822254
1456 2879080383
1457 2879084106
1458 2879103563
1459 2879133459
1460 2879145782
1461 2881370244
1462 2881667165
1463 2885370270
1464 2885418542
1465 2888385797
1466 2903731561
1467 2904674009
1468 2904711608
1469 2906608330
1470 2906634266
1471 2906645179
1472 2922376045
1473 2922393691
1474 2929622876
1475 2929631413
1476 2932785294
1477 2932808660
1478 2932810327
1479 2932821900
1480 2932831863
1481 2933584920
1482 2935610238
1483 2935619450
1484 2935638430
1485 2935651211
1486 2935659391
1487 2935666718
1488 2935682090
1489 2935691249
1490 2935694322
1491 2935703434
1492 2935718630
1493 2935727390
1494 2935736093
1495 2935745473
1496 2935755854
1497 2935760887
1498 2935771222
1499 2935781013
1500 2935786077
1501 2935797740
1502 2935801573
1503 2935815019
1504 2935823399
1505 2935827924
1506 2935842129
1507 2935848883
1508 2935858234
1509 2935872047
1510 2935873838
1511 2935912987
1512 2935924440
1513 2935930120
1514 2935939021
1515 2935945968
1516 2935955305
1517 2935963004
1518 2935972324
1519 2935976249
1520 2935986255
1521 2935993238
1522 2936003175
1523 2936013806
1524 2936022670
1525 2936033277
1526 2936040337
1527 2936048912
1528 2936060510
1529 2940562171
1530 2941531486
1531 2941542178
1532 3005488553
1533 3005588374
1534 3005600654
1535 3005723433
1536 8006927771
1537 8016520323
1538 8016528380
1539 8016533528
1540 8016546757
1541 8016555359
1542 8016563720
1543 8016571860
1544 8016576074
1545 8016594739
1546 8016601450
1547 8016608651
1548 8016616223
1549 8016625019
1550 8016638858
1551 8017065246
1552 8019533320
1553 8019546716
1554 8019552055
1555 8019584641
1556 8019592413
1557 8019598864
1558 8019609511
1559 8019620114
1560 8019632991
1561 8019646931
1562 8019655761
1563 8019660858
1564 8019670408
1565 8019685822
1566 8019691996
1567 8055744762
1568 8056974776

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

32

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9324 12 135
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9223 12 133
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.9111 10 135
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.911 12 135
7kk9-assembly1.cif.gz_A fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.9099 11 135
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9331 15 129 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9168 15 129 1.10.287.70
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9017 15 128 1.10.287.70
af_P9WP63_10_123_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8874 15 129 1.10.287.70
af_Q2FXE5_5_115_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8864 15 128 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7R7CLK9-F1-model_v4 Fluoride-specific ion channel FluC 0.9721 2 138 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A2E1XVB5-F1-model_v4 deleted 0.9695 13 140
AF-D7A8E4-F1-model_v4 Fluoride-specific ion channel FluC 0.9686 9 137 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A3M1JXV6-F1-model_v4 Fluoride-specific ion channel FluC 0.9676 12 136 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A432UZG4-F1-model_v4 Fluoride-specific ion channel FluC 0.9675 2 141 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Map