F480688

General Info

Members Datasets Scaffolds Average Seq Length
784 209 784 248

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100151640|Ga0070663_1001516402
Length 276
Sequence MSGAPERPRPHPAAMTRSASRTLLVSIHDVSPRFEGEVDRLLDLLAPHVGERLAMLVVPNHWGDSPIVPGSPFAGRLRRWADQGVEMFLHGYLHRDEASHDGLSDRLRARVMTAGEGEFLGLSRDVAMERIRDGRSLIADVIGRDVDGFVAPAWLYGRGAIEALETCAMPLAEDHWRVWSPAERRNLARGPVITWASRTRARLASSLAAAAALRRLPVPVLRVGVHPPDCRHPALVRSIETTLAVTARGRRVARYGDLLGTELEPRRTRPAASELA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 3.19
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1843357 2162886007 Bacteria 25494
2 JGI24740J21852_10004489 3300001979 Bacteria 6005
3 JGI24740J21852_10016434 3300001979 Bacteria 2675
4 JGI24740J21852_10024084 3300001979 Unclassified 2069
5 JGI24735J21928_10004640 3300002067 Bacteria 4597
6 JGI24735J21928_10005457 3300002067 Bacteria 4219
7 JGI24745J21846_1006377 3300002073 Bacteria 1308
8 JGI24751J29686_10000087 3300002459 Bacteria 51968
9 rootH2_10090107 3300003320 Viruses 1456
10 rootH1_10130588 3300003323 Bacteria 3166
11 Ga0070658_10017972 3300005327 Bacteria 5656
12 Ga0070658_10043041 3300005327 Bacteria 3649
13 Ga0070658_10050932 3300005327 Bacteria 3356
14 Ga0070658_10058523 3300005327 Bacteria 3137
15 Ga0070658_10059463 3300005327 Bacteria 3112
16 Ga0070658_10062801 3300005327 Bacteria 3027
17 Ga0070658_10073367 3300005327 Bacteria 2806
18 Ga0070658_10161336 3300005327 Unclassified 1881
19 Ga0070658_10187855 3300005327 Bacteria 1741
20 Ga0070658_10225842 3300005327 Bacteria 1584
21 Ga0070658_10292398 3300005327 Bacteria 1388
22 Ga0070658_10572921 3300005327 Bacteria 977
23 Ga0070676_10017478 3300005328 Bacteria 3969
24 Ga0070683_100019230 3300005329 Bacteria 6066
25 Ga0070683_100056411 3300005329 Bacteria 3648
26 Ga0070683_100623650 3300005329 Bacteria 1032
27 Ga0070670_100000060 3300005331 Bacteria 113477
28 Ga0070670_100000213 3300005331 Bacteria 53498
29 Ga0070670_100019993 3300005331 Bacteria 5749
30 Ga0070670_100024901 3300005331 Bacteria 5149
31 Ga0070670_100218490 3300005331 Bacteria 1658
32 Ga0068869_100136798 3300005334 Unclassified 1888
33 Ga0070666_10009548 3300005335 Bacteria 6051
34 Ga0070666_10086947 3300005335 Bacteria 2142
35 Ga0070666_10344797 3300005335 Unclassified 1065
36 Ga0070680_100003062 3300005336 Bacteria 12405
37 Ga0070680_100003967 3300005336 Bacteria 11072
38 Ga0070680_100010341 3300005336 Bacteria 7192
39 Ga0070680_100010837 3300005336 Bacteria 7039
40 Ga0070680_100067105 3300005336 Bacteria 2942
41 Ga0070680_100080662 3300005336 Bacteria 2684
42 Ga0070682_100023811 3300005337 Bacteria 3639
43 Ga0070682_100069901 3300005337 Bacteria 2243
44 Ga0068868_100030423 3300005338 Bacteria 4140
45 Ga0068868_100040163 3300005338 Bacteria 3640
46 Ga0068868_100171377 3300005338 Bacteria 1797
47 Ga0068868_100676000 3300005338 Bacteria 921
48 Ga0070660_100001490 3300005339 Bacteria 16029
49 Ga0070660_100001805 3300005339 Bacteria 14689
50 Ga0070660_100003283 3300005339 Bacteria 11111
51 Ga0070660_100016860 3300005339 Bacteria 5313
52 Ga0070660_100025210 3300005339 Bacteria 4419
53 Ga0070660_100058297 3300005339 Bacteria 2993
54 Ga0070660_100076300 3300005339 Bacteria 2625
55 Ga0070660_100186257 3300005339 Bacteria 1681
56 Ga0070660_100210217 3300005339 Bacteria 1579
57 Ga0070660_100273095 3300005339 Unclassified 1382
58 Ga0070660_100358027 3300005339 Bacteria 1202
59 Ga0070660_100397379 3300005339 Bacteria 1139
60 Ga0070660_100456020 3300005339 Bacteria 1061
61 Ga0070691_10005320 3300005341 Bacteria 5853
62 Ga0070661_100007431 3300005344 Bacteria 7554
63 Ga0070661_100008124 3300005344 Bacteria 7239
64 Ga0070661_100012707 3300005344 Bacteria 5892
65 Ga0070661_100025335 3300005344 Bacteria 4262
66 Ga0070661_100056100 3300005344 Bacteria 2885
67 Ga0070661_100058638 3300005344 Bacteria 2821
68 Ga0070661_100069190 3300005344 Bacteria 2595
69 Ga0070661_100079322 3300005344 Bacteria 2422
70 Ga0070661_100104066 3300005344 Bacteria 2114
71 Ga0070661_100345793 3300005344 Bacteria 1166
72 Ga0070692_10059321 3300005345 Bacteria 2011
73 Ga0070692_10073740 3300005345 Bacteria 1824
74 Ga0070668_100000049 3300005347 Bacteria 74953
75 Ga0070668_100064670 3300005347 Bacteria 2836
76 Ga0070669_100000053 3300005353 Bacteria 113601
77 Ga0070675_100026769 3300005354 Bacteria 4627
78 Ga0070675_100051056 3300005354 Bacteria 3397
79 Ga0070675_100843994 3300005354 Bacteria 838
80 Ga0070671_100000805 3300005355 Bacteria 22666
81 Ga0070671_100005071 3300005355 Bacteria 10499
82 Ga0070671_100024124 3300005355 Bacteria 4978
83 Ga0070671_100043107 3300005355 Bacteria 3751
84 Ga0070671_100296906 3300005355 Bacteria 1375
85 Ga0070671_100296908 3300005355 Bacteria 1375
86 Ga0070674_100002749 3300005356 Bacteria 9725
87 Ga0070674_100063737 3300005356 Bacteria 2580
88 Ga0070674_100295224 3300005356 Unclassified 1290
89 Ga0070673_100028786 3300005364 Bacteria 4136
90 Ga0070673_100164211 3300005364 Bacteria 1890
91 Ga0070673_100173018 3300005364 Bacteria 1844
92 Ga0070673_100182616 3300005364 Bacteria 1797
93 Ga0070673_100206408 3300005364 Unclassified 1694
94 Ga0070673_100279664 3300005364 Bacteria 1463
95 Ga0070673_100457741 3300005364 Bacteria 1148
96 Ga0070673_100534640 3300005364 Bacteria 1063
97 Ga0070659_100004081 3300005366 Bacteria 10404
98 Ga0070659_100004213 3300005366 Bacteria 10266
99 Ga0070659_100007874 3300005366 Bacteria 7759
100 Ga0070659_100011217 3300005366 Bacteria 6621
101 Ga0070659_100024027 3300005366 Bacteria 4669
102 Ga0070659_100024807 3300005366 Bacteria 4600
103 Ga0070659_100073409 3300005366 Bacteria 2723
104 Ga0070659_100139444 3300005366 Bacteria 1974
105 Ga0070659_100154191 3300005366 Bacteria 1875
106 Ga0070659_100164389 3300005366 Bacteria 1815
107 Ga0070659_100375006 3300005366 Bacteria 1197
108 Ga0070659_100419726 3300005366 Bacteria 1131
109 Ga0070667_100000009 3300005367 Bacteria 281488
110 Ga0070667_100012743 3300005367 Bacteria 6952
111 Ga0070667_100028427 3300005367 Bacteria 4655
112 Ga0070667_100193311 3300005367 Bacteria 1803
113 Ga0070714_100051557 3300005435 Bacteria 3508
114 Ga0070714_100344008 3300005435 Bacteria 1399
115 Ga0070714_100458760 3300005435 Bacteria 1211
116 Ga0070713_100793737 3300005436 Bacteria 907
117 Ga0070663_100023044 3300005455 Bacteria 4169
118 Ga0070663_100027417 3300005455 Bacteria 3868
119 Ga0070663_100075005 3300005455 Bacteria 2471
120 Ga0070663_100094545 3300005455 Bacteria 2220
121 Ga0070663_100151640 3300005455 Bacteria 1778
122 Ga0070663_100306295 3300005455 Unclassified 1273
123 Ga0070678_100018355 3300005456 Bacteria 4532
124 Ga0070678_100676570 3300005456 Bacteria 928
125 Ga0070662_100036407 3300005457 Bacteria 3481
126 Ga0070662_100036987 3300005457 Bacteria 3458
127 Ga0070662_100042056 3300005457 Bacteria 3263
128 Ga0070662_100049394 3300005457 Bacteria 3034
129 Ga0070662_100052452 3300005457 Bacteria 2948
130 Ga0070662_100118842 3300005457 Bacteria 2023
131 Ga0070662_100292900 3300005457 Unclassified 1320
132 Ga0070681_10053751 3300005458 Bacteria 4013
133 Ga0070681_10061620 3300005458 Bacteria 3725
134 Ga0070681_10063519 3300005458 Bacteria 3664
135 Ga0070681_10280261 3300005458 Bacteria 1578
136 Ga0068867_100031507 3300005459 Bacteria 3829
137 Ga0068867_100375195 3300005459 Bacteria 1193
138 Ga0068867_100396720 3300005459 Bacteria 1163
139 Ga0070679_100004910 3300005530 Bacteria 12335
140 Ga0070679_100091169 3300005530 Bacteria 3035
141 Ga0070679_100096192 3300005530 Bacteria 2949
142 Ga0070679_100186496 3300005530 Bacteria 2045
143 Ga0070679_100368923 3300005530 Bacteria 1383
144 Ga0070679_100369671 3300005530 Bacteria 1381
145 Ga0070679_100765498 3300005530 Bacteria 908
146 Ga0070684_100002471 3300005535 Bacteria 13605
147 Ga0070684_100016175 3300005535 Bacteria 6094
148 Ga0070684_100069990 3300005535 Bacteria 3086
149 Ga0068853_100006410 3300005539 Bacteria 9351
150 Ga0068853_100036912 3300005539 Bacteria 4156
151 Ga0068853_100051129 3300005539 Bacteria 3556
152 Ga0068853_100055248 3300005539 Bacteria 3422
153 Ga0068853_100066845 3300005539 Bacteria 3122
154 Ga0068853_100078425 3300005539 Bacteria 2887
155 Ga0068853_100098468 3300005539 Bacteria 2582
156 Ga0068853_100142627 3300005539 Bacteria 2151
157 Ga0068853_100261844 3300005539 Unclassified 1590
158 Ga0068853_100266601 3300005539 Unclassified 1576
159 Ga0068853_100372928 3300005539 Bacteria 1332
160 Ga0068853_100429457 3300005539 Bacteria 1240
161 Ga0068853_100519078 3300005539 Bacteria 1126
162 Ga0070672_100058682 3300005543 Bacteria 3026
163 Ga0070693_100435622 3300005547 Unclassified 917
164 Ga0070665_100115767 3300005548 Bacteria 2684
165 Ga0070665_100430137 3300005548 Bacteria 1329
166 Ga0068855_100022028 3300005563 Bacteria 7639
167 Ga0068855_100031936 3300005563 Bacteria 6286
168 Ga0068855_100046944 3300005563 Bacteria 5104
169 Ga0068855_100234167 3300005563 Bacteria 2054
170 Ga0068855_100245725 3300005563 Bacteria 1997
171 Ga0068855_100306949 3300005563 Bacteria 1756
172 Ga0068855_100384942 3300005563 Bacteria 1539
173 Ga0068855_100391813 3300005563 Bacteria 1524
174 Ga0068855_100427930 3300005563 Bacteria 1447
175 Ga0070664_100001418 3300005564 Bacteria 19109
176 Ga0070664_100005291 3300005564 Bacteria 10356
177 Ga0070664_100008643 3300005564 Bacteria 8242
178 Ga0070664_100009887 3300005564 Bacteria 7731
179 Ga0070664_100010531 3300005564 Bacteria 7496
180 Ga0070664_100015275 3300005564 Bacteria 6276
181 Ga0070664_100058867 3300005564 Bacteria 3268
182 Ga0070664_100130705 3300005564 Bacteria 2205
183 Ga0070664_100215037 3300005564 Bacteria 1718
184 Ga0070664_100556028 3300005564 Bacteria 1061
185 Ga0068857_100003142 3300005577 Bacteria 13671
186 Ga0068857_100010041 3300005577 Bacteria 8224
187 Ga0068857_100054570 3300005577 Bacteria 3546
188 Ga0068857_100062133 3300005577 Bacteria 3320
189 Ga0068857_100063422 3300005577 Bacteria 3285
190 Ga0068857_100082025 3300005577 Bacteria 2880
191 Ga0068857_100169187 3300005577 Bacteria 1986
192 Ga0068857_100348004 3300005577 Bacteria 1372
193 Ga0068857_100508666 3300005577 Bacteria 1131
194 Ga0068857_100693776 3300005577 Unclassified 967
195 Ga0068854_100005814 3300005578 Bacteria 7813
196 Ga0068854_100053173 3300005578 Bacteria 2907
197 Ga0068854_100081546 3300005578 Bacteria 2389
198 Ga0068854_100095717 3300005578 Bacteria 2217
199 Ga0068856_100018907 3300005614 Bacteria 6682
200 Ga0068856_100055471 3300005614 Bacteria 3910
201 Ga0068856_100056945 3300005614 Bacteria 3859
202 Ga0068856_100059483 3300005614 Bacteria 3774
203 Ga0068856_100185294 3300005614 Bacteria 2095
204 Ga0068856_100816909 3300005614 Unclassified 952
205 Ga0068856_100840331 3300005614 Unclassified 937
206 Ga0068852_100002160 3300005616 Bacteria 13498
207 Ga0068852_100008660 3300005616 Bacteria 7518
208 Ga0068852_100019724 3300005616 Bacteria 5345
209 Ga0068852_100028499 3300005616 Bacteria 4572
210 Ga0068852_100062988 3300005616 Bacteria 3227
211 Ga0068852_100063391 3300005616 Bacteria 3218
212 Ga0068852_100066969 3300005616 Bacteria 3139
213 Ga0068852_100116631 3300005616 Bacteria 2437
214 Ga0068852_100157005 3300005616 Bacteria 2120
215 Ga0068852_100266529 3300005616 Bacteria 1647
216 Ga0068852_100649286 3300005616 Bacteria 1062
217 Ga0068859_100033975 3300005617 Bacteria 5120
218 Ga0068859_100059140 3300005617 Bacteria 3861
219 Ga0068859_100091431 3300005617 Bacteria 3094
220 Ga0068859_100713384 3300005617 Unclassified 1093
221 Ga0068864_100000069 3300005618 Bacteria 114134
222 Ga0068864_100001173 3300005618 Bacteria 21814
223 Ga0068864_100029285 3300005618 Bacteria 4660
224 Ga0068864_100072987 3300005618 Bacteria 2992
225 Ga0068866_10028402 3300005718 Bacteria 2665
226 Ga0068861_100250695 3300005719 Bacteria 1510
227 Ga0068861_100298726 3300005719 Bacteria 1394
228 Ga0068851_10007073 3300005834 Bacteria 5140
229 Ga0068851_10210280 3300005834 Bacteria 1089
230 Ga0068851_10249183 3300005834 Bacteria 1007
231 Ga0068851_10249751 3300005834 Unclassified 1006
232 Ga0068851_10365840 3300005834 Bacteria 842
233 Ga0068863_100006701 3300005841 Bacteria 11300
234 Ga0068863_100008241 3300005841 Bacteria 10182
235 Ga0068863_100010827 3300005841 Bacteria 8842
236 Ga0068863_100166662 3300005841 Bacteria 2113
237 Ga0068863_100300258 3300005841 Bacteria 1558
238 Ga0068858_100001456 3300005842 Bacteria 24348
239 Ga0068858_100073544 3300005842 Bacteria 3172
240 Ga0068860_100000042 3300005843 Bacteria 227404
241 Ga0068860_100110962 3300005843 Bacteria 2622
242 Ga0068860_100181378 3300005843 Bacteria 2035
243 Ga0068862_100000082 3300005844 Bacteria 113125
244 Ga0068862_100000411 3300005844 Bacteria 46404
245 Ga0068862_100003765 3300005844 Bacteria 12942
246 Ga0070717_10009189 3300006028 Bacteria 7428
247 Ga0070712_100012000 3300006175 Bacteria 5505
248 Ga0070712_100209514 3300006175 Bacteria 1536
249 Ga0097621_100037234 3300006237 Bacteria 3896
250 Ga0097621_100221665 3300006237 Bacteria 1648
251 Ga0068871_100018095 3300006358 Bacteria 5349
252 Ga0068871_100183413 3300006358 Bacteria 1800
253 Ga0068871_100201836 3300006358 Bacteria 1717
254 Ga0068865_100015606 3300006881 Bacteria 4845
255 Ga0097620_100033976 3300006931 Bacteria 5120
256 Ga0097620_100059136 3300006931 Bacteria 3861
257 Ga0097620_100091431 3300006931 Bacteria 3094
258 Ga0097620_100713466 3300006931 Unclassified 1093
259 Ga0105240_10026853 3300009093 Bacteria 7550
260 Ga0105240_10041949 3300009093 Bacteria 5835
261 Ga0105240_10053186 3300009093 Bacteria 5085
262 Ga0105240_10073601 3300009093 Bacteria 4218
263 Ga0105245_10031518 3300009098 Bacteria 4692
264 Ga0105245_10121626 3300009098 Bacteria 2439
265 Ga0105241_10028305 3300009174 Bacteria 4176
266 Ga0105241_10119494 3300009174 Bacteria 2120
267 Ga0105248_10000101 3300009177 Bacteria 95328
268 Ga0105248_10020861 3300009177 Bacteria 7260
269 Ga0105248_10034033 3300009177 Bacteria 5696
270 Ga0105248_10134256 3300009177 Bacteria 2792
271 Ga0105237_10050096 3300009545 Bacteria 4197
272 Ga0105237_10463711 3300009545 Bacteria 1273
273 Ga0105237_10651303 3300009545 Bacteria 1060
274 Ga0105237_10710346 3300009545 Bacteria 1012
275 Ga0105238_10003202 3300009551 Bacteria 16341
276 Ga0105238_10019895 3300009551 Bacteria 6832
277 Ga0105238_10035976 3300009551 Bacteria 5034
278 Ga0105238_10222718 3300009551 Bacteria 1863
279 Ga0105238_10272253 3300009551 Unclassified 1674
280 Ga0105239_10116974 3300010375 Bacteria 2959
281 Ga0105239_10195912 3300010375 Bacteria 2263
282 Ga0157373_10011118 3300013100 Bacteria 6626
283 Ga0157373_10025618 3300013100 Bacteria 4264
284 Ga0157373_10053361 3300013100 Bacteria 2875
285 Ga0157373_10056144 3300013100 Bacteria 2797
286 Ga0157373_10078057 3300013100 Bacteria 2335
287 Ga0157373_10115430 3300013100 Bacteria 1887
288 Ga0157373_10198150 3300013100 Unclassified 1416
289 Ga0157371_10008861 3300013102 Bacteria 7969
290 Ga0157371_10009508 3300013102 Bacteria 7645
291 Ga0157371_10019086 3300013102 Bacteria 5062
292 Ga0157371_10033237 3300013102 Bacteria 3707
293 Ga0157371_10056140 3300013102 Bacteria 2793
294 Ga0157371_10182844 3300013102 Bacteria 1500
295 Ga0157371_10201870 3300013102 Bacteria 1425
296 Ga0157371_10243173 3300013102 Unclassified 1295
297 Ga0157371_10251109 3300013102 Bacteria 1273
298 Ga0157371_10255308 3300013102 Bacteria 1263
299 Ga0157371_10344946 3300013102 Bacteria 1083
300 Ga0157370_10012870 3300013104 Bacteria 8650
301 Ga0157370_10043065 3300013104 Bacteria 4347
302 Ga0157370_10045485 3300013104 Bacteria 4211
303 Ga0157370_10082638 3300013104 Bacteria 3021
304 Ga0157370_10116786 3300013104 Bacteria 2492
305 Ga0157370_10205798 3300013104 Unclassified 1825
306 Ga0157370_10260897 3300013104 Bacteria 1601
307 Ga0157369_10010903 3300013105 Bacteria 10352
308 Ga0157369_10019218 3300013105 Bacteria 7645
309 Ga0157369_10030484 3300013105 Bacteria 5948
310 Ga0157369_10030814 3300013105 Bacteria 5913
311 Ga0157369_10094073 3300013105 Bacteria 3199
312 Ga0157369_10095019 3300013105 Bacteria 3182
313 Ga0157369_10105332 3300013105 Bacteria 3003
314 Ga0157369_10183847 3300013105 Bacteria 2198
315 Ga0157369_10292549 3300013105 Bacteria 1695
316 Ga0157369_10380587 3300013105 Bacteria 1465
317 Ga0157369_10403322 3300013105 Unclassified 1418
318 Ga0157369_10629646 3300013105 Bacteria 1107
319 Ga0157369_10843899 3300013105 Bacteria 941
320 Ga0157374_10045728 3300013296 Bacteria 4052
321 Ga0157374_10062123 3300013296 Bacteria 3500
322 Ga0157374_10064977 3300013296 Bacteria 3426
323 Ga0157374_10139639 3300013296 Bacteria 2351
324 Ga0157374_10323563 3300013296 Bacteria 1528
325 Ga0157374_11109435 3300013296 Bacteria 812
326 Ga0157378_10021856 3300013297 Bacteria 5626
327 Ga0157378_10295755 3300013297 Bacteria 1565
328 Ga0163162_10061874 3300013306 Bacteria 3782
329 Ga0163162_10367925 3300013306 Unclassified 1571
330 Ga0157372_10045150 3300013307 Bacteria 4886
331 Ga0157372_10080052 3300013307 Bacteria 3696
332 Ga0157372_10219436 3300013307 Bacteria 2204
333 Ga0157372_10249107 3300013307 Unclassified 2062
334 Ga0157372_10288580 3300013307 Bacteria 1908
335 Ga0157372_10919588 3300013307 Bacteria 1014
336 Ga0157375_10085446 3300013308 Bacteria 3205
337 Ga0157375_10108167 3300013308 Bacteria 2875
338 Ga0157375_11139712 3300013308 Bacteria 914
339 Ga0163163_10031637 3300014325 Bacteria 5108
340 Ga0163163_10040675 3300014325 Bacteria 4540
341 Ga0157380_10000964 3300014326 Bacteria 18221
342 Ga0157380_10091798 3300014326 Bacteria 2508
343 Ga0157377_10034335 3300014745 Bacteria 2775
344 Ga0163161_10044103 3300017792 Bacteria 3212
345 Ga0163161_10059933 3300017792 Bacteria 2769
346 Ga0206353_10312903 3300020082 Bacteria 927
347 Ga0206353_10453333 3300020082 Bacteria 903
348 Ga0206353_11302302 3300020082 Bacteria 3205
349 Ga0213876_10180302 3300021384 Bacteria 1123
350 Ga0213875_10006472 3300021388 Bacteria 6141
351 Ga0209050_1000605 3300025298 Bacteria 57026
352 Ga0207697_10009804 3300025315 Bacteria 4118
353 Ga0207656_10045634 3300025321 Unclassified 1876
354 Ga0207656_10073307 3300025321 Bacteria 1526
355 Ga0207642_10006965 3300025899 Bacteria 3789
356 Ga0207688_10003700 3300025901 Bacteria 8353
357 Ga0207680_10030844 3300025903 Bacteria 3030
358 Ga0207647_10005869 3300025904 Bacteria 8951
359 Ga0207647_10008967 3300025904 Bacteria 7125
360 Ga0207647_10013540 3300025904 Bacteria 5648
361 Ga0207647_10029680 3300025904 Bacteria 3534
362 Ga0207647_10056214 3300025904 Bacteria 2415
363 Ga0207647_10080869 3300025904 Bacteria 1948
364 Ga0207647_10087456 3300025904 Bacteria 1861
365 Ga0207699_10021667 3300025906 Bacteria 3468
366 Ga0207645_10015478 3300025907 Bacteria 5065
367 Ga0207645_10041148 3300025907 Bacteria 2959
368 Ga0207645_10413334 3300025907 Bacteria 908
369 Ga0207705_10002195 3300025909 Bacteria 15094
370 Ga0207705_10004391 3300025909 Bacteria 10652
371 Ga0207705_10005360 3300025909 Bacteria 9588
372 Ga0207705_10011657 3300025909 Bacteria 6351
373 Ga0207705_10040847 3300025909 Bacteria 3327
374 Ga0207705_10066087 3300025909 Bacteria 2615
375 Ga0207705_10069108 3300025909 Unclassified 2558
376 Ga0207705_10175606 3300025909 Bacteria 1614
377 Ga0207705_10180886 3300025909 Bacteria 1591
378 Ga0207705_10208461 3300025909 Bacteria 1482
379 Ga0207705_10274819 3300025909 Bacteria 1289
380 Ga0207705_10286261 3300025909 Bacteria 1262
381 Ga0207705_10337715 3300025909 Bacteria 1159
382 Ga0207705_10437623 3300025909 Bacteria 1013
383 Ga0207654_10198635 3300025911 Bacteria 1319
384 Ga0207707_10010567 3300025912 Bacteria 8014
385 Ga0207707_10133018 3300025912 Bacteria 2175
386 Ga0207695_10079062 3300025913 Bacteria 3335
387 Ga0207695_10225379 3300025913 Bacteria 1781
388 Ga0207671_10125047 3300025914 Bacteria 1969
389 Ga0207671_10263413 3300025914 Bacteria 1357
390 Ga0207671_10609395 3300025914 Unclassified 870
391 Ga0207693_10019856 3300025915 Bacteria 5344
392 Ga0207660_10000241 3300025917 Bacteria 35515
393 Ga0207660_10009126 3300025917 Bacteria 6421
394 Ga0207660_10023836 3300025917 Bacteria 4137
395 Ga0207660_10115111 3300025917 Bacteria 2029
396 Ga0207660_10306963 3300025917 Bacteria 1264
397 Ga0207657_10000919 3300025919 Bacteria 31133
398 Ga0207657_10002737 3300025919 Bacteria 18988
399 Ga0207657_10004878 3300025919 Bacteria 14116
400 Ga0207657_10006363 3300025919 Bacteria 12267
401 Ga0207657_10010417 3300025919 Bacteria 9280
402 Ga0207657_10010698 3300025919 Bacteria 9137
403 Ga0207657_10014968 3300025919 Bacteria 7536
404 Ga0207657_10020650 3300025919 Bacteria 6218
405 Ga0207657_10025919 3300025919 Bacteria 5398
406 Ga0207657_10047481 3300025919 Bacteria 3754
407 Ga0207657_10052756 3300025919 Bacteria 3528
408 Ga0207657_10073096 3300025919 Bacteria 2899
409 Ga0207657_10075373 3300025919 Bacteria 2847
410 Ga0207657_10109121 3300025919 Bacteria 2288
411 Ga0207657_10290933 3300025919 Unclassified 1295
412 Ga0207657_10413348 3300025919 Bacteria 1061
413 Ga0207649_10025575 3300025920 Bacteria 3442
414 Ga0207649_10027930 3300025920 Bacteria 3317
415 Ga0207649_10056167 3300025920 Bacteria 2457
416 Ga0207649_10150934 3300025920 Unclassified 1600
417 Ga0207649_10176498 3300025920 Bacteria 1492
418 Ga0207649_10180646 3300025920 Bacteria 1477
419 Ga0207652_10004605 3300025921 Bacteria 11175
420 Ga0207652_10012856 3300025921 Bacteria 6768
421 Ga0207652_10042682 3300025921 Bacteria 3861
422 Ga0207652_10186638 3300025921 Bacteria 1864
423 Ga0207652_10223453 3300025921 Bacteria 1697
424 Ga0207652_10275526 3300025921 Bacteria 1518
425 Ga0207652_10433000 3300025921 Bacteria 1186
426 Ga0207681_10000003 3300025923 Bacteria 713245
427 Ga0207694_10002833 3300025924 Bacteria 13987
428 Ga0207694_10034414 3300025924 Bacteria 3884
429 Ga0207694_10079674 3300025924 Bacteria 2569
430 Ga0207650_10000148 3300025925 Bacteria 85425
431 Ga0207650_10000766 3300025925 Bacteria 24658
432 Ga0207650_10085237 3300025925 Bacteria 2403
433 Ga0207650_10141365 3300025925 Bacteria 1893
434 Ga0207659_10269263 3300025926 Bacteria 1389
435 Ga0207664_10327633 3300025929 Bacteria 1352
436 Ga0207644_10000088 3300025931 Bacteria 65977
437 Ga0207644_10003563 3300025931 Bacteria 10073
438 Ga0207644_10012208 3300025931 Bacteria 5700
439 Ga0207644_10068856 3300025931 Bacteria 2583
440 Ga0207644_10264792 3300025931 Bacteria 1375
441 Ga0207644_10548734 3300025931 Bacteria 956
442 Ga0207690_10001815 3300025932 Bacteria 13100
443 Ga0207690_10004942 3300025932 Bacteria 7870
444 Ga0207690_10007360 3300025932 Bacteria 6533
445 Ga0207690_10008949 3300025932 Bacteria 5942
446 Ga0207690_10030736 3300025932 Bacteria 3429
447 Ga0207690_10033463 3300025932 Bacteria 3305
448 Ga0207690_10094395 3300025932 Bacteria 2122
449 Ga0207690_10163137 3300025932 Bacteria 1663
450 Ga0207690_10221559 3300025932 Bacteria 1447
451 Ga0207690_10279827 3300025932 Bacteria 1299
452 Ga0207706_10005493 3300025933 Bacteria 11819
453 Ga0207706_10006514 3300025933 Bacteria 10830
454 Ga0207706_10009166 3300025933 Bacteria 9100
455 Ga0207706_10024480 3300025933 Bacteria 5412
456 Ga0207706_10030507 3300025933 Bacteria 4809
457 Ga0207706_10031530 3300025933 Bacteria 4722
458 Ga0207706_10053152 3300025933 Bacteria 3576
459 Ga0207706_10080291 3300025933 Bacteria 2868
460 Ga0207706_10081953 3300025933 Bacteria 2836
461 Ga0207706_10388314 3300025933 Bacteria 1211
462 Ga0207686_10069381 3300025934 Bacteria 2261
463 Ga0207669_10003659 3300025937 Bacteria 6676
464 Ga0207704_10065401 3300025938 Bacteria 2276
465 Ga0207665_10037236 3300025939 Bacteria 3238
466 Ga0207691_10004041 3300025940 Bacteria 14222
467 Ga0207691_10010388 3300025940 Bacteria 8931
468 Ga0207691_10021422 3300025940 Bacteria 6103
469 Ga0207711_10007450 3300025941 Bacteria 9156
470 Ga0207711_10094385 3300025941 Bacteria 2636
471 Ga0207711_10193367 3300025941 Bacteria 1855
472 Ga0207689_10066209 3300025942 Bacteria 2971
473 Ga0207661_10116791 3300025944 Bacteria 2265
474 Ga0207661_10164447 3300025944 Bacteria 1927
475 Ga0207679_10002108 3300025945 Bacteria 12350
476 Ga0207679_10044151 3300025945 Bacteria 3214
477 Ga0207679_10050153 3300025945 Bacteria 3048
478 Ga0207679_10140818 3300025945 Bacteria 1949
479 Ga0207679_10197575 3300025945 Bacteria 1678
480 Ga0207679_10244565 3300025945 Bacteria 1522
481 Ga0207667_10012617 3300025949 Bacteria 9715
482 Ga0207667_10016106 3300025949 Bacteria 8456
483 Ga0207667_10023916 3300025949 Bacteria 6721
484 Ga0207667_10080909 3300025949 Bacteria 3365
485 Ga0207667_10111173 3300025949 Bacteria 2826
486 Ga0207667_10457626 3300025949 Unclassified 1296
487 Ga0207651_10003947 3300025960 Bacteria 7365
488 Ga0207651_10167564 3300025960 Unclassified 1729
489 Ga0207651_10430265 3300025960 Bacteria 1128
490 Ga0207668_10000077 3300025972 Bacteria 73595
491 Ga0207668_10028445 3300025972 Bacteria 3655
492 Ga0207640_10006188 3300025981 Bacteria 6552
493 Ga0207640_10059837 3300025981 Bacteria 2515
494 Ga0207640_10060157 3300025981 Bacteria 2510
495 Ga0207640_10133814 3300025981 Bacteria 1796
496 Ga0207640_10172663 3300025981 Unclassified 1612
497 Ga0207658_10000009 3300025986 Bacteria 264118
498 Ga0207658_10008532 3300025986 Bacteria 6970
499 Ga0207658_10086443 3300025986 Bacteria 2418
500 Ga0207677_10009921 3300026023 Bacteria 5370
501 Ga0207677_10011852 3300026023 Bacteria 4988
502 Ga0207677_10254806 3300026023 Bacteria 1427
503 Ga0207677_10300171 3300026023 Unclassified 1326
504 Ga0207703_10016173 3300026035 Bacteria 5814
505 Ga0207703_10147298 3300026035 Bacteria 2049
506 Ga0207639_10000776 3300026041 Bacteria 21757
507 Ga0207639_10053244 3300026041 Bacteria 3087
508 Ga0207639_10125919 3300026041 Bacteria 2113
509 Ga0207639_10132989 3300026041 Bacteria 2062
510 Ga0207639_10283038 3300026041 Unclassified 1459
511 Ga0207639_10292144 3300026041 Bacteria 1438
512 Ga0207639_10292306 3300026041 Bacteria 1437
513 Ga0207639_10356398 3300026041 Unclassified 1308
514 Ga0207639_10407755 3300026041 Bacteria 1226
515 Ga0207639_10444262 3300026041 Bacteria 1176
516 Ga0207678_10001811 3300026067 Bacteria 19579
517 Ga0207678_10008776 3300026067 Bacteria 8893
518 Ga0207678_10014097 3300026067 Bacteria 7029
519 Ga0207678_10015800 3300026067 Bacteria 6636
520 Ga0207678_10020604 3300026067 Bacteria 5782
521 Ga0207678_10030153 3300026067 Bacteria 4735
522 Ga0207678_10035640 3300026067 Bacteria 4332
523 Ga0207678_10043718 3300026067 Bacteria 3875
524 Ga0207678_10044369 3300026067 Bacteria 3846
525 Ga0207678_10080141 3300026067 Bacteria 2795
526 Ga0207678_10113031 3300026067 Bacteria 2317
527 Ga0207678_10143419 3300026067 Bacteria 2038
528 Ga0207702_10023767 3300026078 Bacteria 5084
529 Ga0207702_10050366 3300026078 Bacteria 3516
530 Ga0207702_10095124 3300026078 Bacteria 2617
531 Ga0207702_10177030 3300026078 Bacteria 1961
532 Ga0207702_10379406 3300026078 Bacteria 1359
533 Ga0207641_10006534 3300026088 Bacteria 9805
534 Ga0207641_10009145 3300026088 Bacteria 8183
535 Ga0207641_10098972 3300026088 Bacteria 2565
536 Ga0207648_10005572 3300026089 Bacteria 12668
537 Ga0207648_10031127 3300026089 Bacteria 4718
538 Ga0207648_10153996 3300026089 Bacteria 2029
539 Ga0207676_10000009 3300026095 Bacteria 545256
540 Ga0207676_10001713 3300026095 Bacteria 16173
541 Ga0207676_10002519 3300026095 Bacteria 13061
542 Ga0207676_10643015 3300026095 Bacteria 1023
543 Ga0207674_10005438 3300026116 Bacteria 15125
544 Ga0207674_10009300 3300026116 Bacteria 11256
545 Ga0207674_10028796 3300026116 Bacteria 5856
546 Ga0207674_10141143 3300026116 Unclassified 2368
547 Ga0207674_10146699 3300026116 Bacteria 2318
548 Ga0207674_10287625 3300026116 Bacteria 1592
549 Ga0207674_10350435 3300026116 Bacteria 1427
550 Ga0207675_100000162 3300026118 Bacteria 59062
551 Ga0207675_100236877 3300026118 Bacteria 1762
552 Ga0207675_100278768 3300026118 Bacteria 1624
553 Ga0207683_10002539 3300026121 Bacteria 15929
554 Ga0207683_10004440 3300026121 Bacteria 12117
555 Ga0207698_10002441 3300026142 Bacteria 11016
556 Ga0207698_10013354 3300026142 Bacteria 5416
557 Ga0207698_10017186 3300026142 Bacteria 4900
558 Ga0207698_10031198 3300026142 Bacteria 3843
559 Ga0207698_10031969 3300026142 Bacteria 3807
560 Ga0207698_10039152 3300026142 Bacteria 3509
561 Ga0207698_10085639 3300026142 Unclassified 2560
562 Ga0207698_10105349 3300026142 Bacteria 2349
563 Ga0207698_10138730 3300026142 Bacteria 2091
564 Ga0207698_10260354 3300026142 Bacteria 1593
565 Ga0207698_10290882 3300026142 Bacteria 1516
566 Ga0207698_10465249 3300026142 Bacteria 1224
567 Ga0268266_10404658 3300028379 Bacteria 1291
568 Ga0268265_10000030 3300028380 Bacteria 228157
569 Ga0268265_10000580 3300028380 Bacteria 37079
570 Ga0268265_10002838 3300028380 Bacteria 12735
571 Ga0268264_10000001 3300028381 Bacteria 1221000
572 Ga0373930_0053521 3300034816 Bacteria 887
573 Ga0373943_0049689 3300035170 Bacteria 2059
574 Ga0373946_0012232 3300035171 Bacteria 3210
575 Ga0373935_0031869 3300035692 Bacteria 3273
576 Ga0373937_0217503 3300036401 Bacteria 1798
577 Ga0395899_0000432 3300037312 Bacteria 48281
578 Ga0395899_0000882 3300037312 Bacteria 28508
579 Ga0395899_0003237 3300037312 Bacteria 12919
580 Ga0395899_0013471 3300037312 Bacteria 6252
581 Ga0395899_0022133 3300037312 Bacteria 4820
582 Ga0395899_0039866 3300037312 Bacteria 3514
583 Ga0395899_0054528 3300037312 Bacteria 2958
584 Ga0395899_0075751 3300037312 Bacteria 2456
585 Ga0395899_0087867 3300037312 Bacteria 2255
586 Ga0395899_0250156 3300037312 Unclassified 1216
587 Ga0395899_0320840 3300037312 Bacteria 1043
588 Ga0395900_0000432 3300037418 Bacteria 60134
589 Ga0395900_0001148 3300037418 Bacteria 33301
590 Ga0395900_0005773 3300037418 Bacteria 12931
591 Ga0395900_0009108 3300037418 Bacteria 10169
592 Ga0395900_0015479 3300037418 Bacteria 7776
593 Ga0395900_0018490 3300037418 Bacteria 7107
594 Ga0395900_0022846 3300037418 Bacteria 6399
595 Ga0395900_0025214 3300037418 Bacteria 6087
596 Ga0395900_0027226 3300037418 Bacteria 5854
597 Ga0395900_0039974 3300037418 Bacteria 4834
598 Ga0395900_0050304 3300037418 Unclassified 4293
599 Ga0395900_0063446 3300037418 Bacteria 3797
600 Ga0395900_0063453 3300037418 Bacteria 3797
601 Ga0395900_0091909 3300037418 Bacteria 3118
602 Ga0395900_0164368 3300037418 Bacteria 2262
603 Ga0395900_0195120 3300037418 Bacteria 2052
604 Ga0395900_0291786 3300037418 Bacteria 1619
605 Ga0395900_0306109 3300037418 Bacteria 1574
606 Ga0395900_0309720 3300037418 Bacteria 1562
607 Ga0395900_0337528 3300037418 Bacteria 1483
608 Ga0395900_0346153 3300037418 Bacteria 1461
609 Ga0395900_0399171 3300037418 Bacteria 1340
610 Ga0395900_0512470 3300037418 Bacteria 1148
611 Ga0395900_0540114 3300037418 Bacteria 1111
612 Ga0395900_0690755 3300037418 Unclassified 954
613 Ga0395900_0745956 3300037418 Bacteria 909
614 Ga0395900_0761635 3300037418 Unclassified 898
615 Ga0395898_0000021 3300037466 Bacteria 393971
616 Ga0395898_0001152 3300037466 Bacteria 40373
617 Ga0395898_0002234 3300037466 Bacteria 23570
618 Ga0395898_0011941 3300037466 Bacteria 8995
619 Ga0395898_0018713 3300037466 Bacteria 7060
620 Ga0395898_0033555 3300037466 Bacteria 5121
621 Ga0395898_0035995 3300037466 Bacteria 4919
622 Ga0395898_0046303 3300037466 Bacteria 4272
623 Ga0395898_0048450 3300037466 Bacteria 4167
624 Ga0395898_0088371 3300037466 Bacteria 2983
625 Ga0395898_0112804 3300037466 Bacteria 2605
626 Ga0395898_0121320 3300037466 Bacteria 2504
627 Ga0395898_0176084 3300037466 Unclassified 2044
628 Ga0395898_0210857 3300037466 Bacteria 1853
629 Ga0395898_0343629 3300037466 Bacteria 1423
630 Ga0395898_0543035 3300037466 Bacteria 1104
631 Ga0395898_0630405 3300037466 Bacteria 1014
632 Ga0395898_0666502 3300037466 Bacteria 982
633 Ga0395898_0739059 3300037466 Unclassified 925
634 Ga0395905_0000413 3300037471 Bacteria 60132
635 Ga0395905_0000649 3300037471 Bacteria 46291
636 Ga0395905_0001939 3300037471 Bacteria 23712
637 Ga0395905_0002317 3300037471 Bacteria 21322
638 Ga0395905_0004074 3300037471 Bacteria 15319
639 Ga0395905_0004189 3300037471 Bacteria 15085
640 Ga0395905_0011151 3300037471 Bacteria 8691
641 Ga0395905_0011366 3300037471 Bacteria 8607
642 Ga0395905_0011559 3300037471 Bacteria 8531
643 Ga0395905_0016312 3300037471 Bacteria 7059
644 Ga0395905_0032222 3300037471 Bacteria 4930
645 Ga0395905_0033690 3300037471 Bacteria 4810
646 Ga0395905_0033936 3300037471 Bacteria 4792
647 Ga0395905_0074912 3300037471 Bacteria 3172
648 Ga0395905_0075369 3300037471 Bacteria 3162
649 Ga0395905_0093771 3300037471 Bacteria 2816
650 Ga0395905_0094763 3300037471 Bacteria 2800
651 Ga0395905_0099739 3300037471 Bacteria 2727
652 Ga0395905_0101322 3300037471 Bacteria 2703
653 Ga0395905_0129591 3300037471 Bacteria 2372
654 Ga0395905_0130282 3300037471 Bacteria 2366
655 Ga0395905_0138077 3300037471 Bacteria 2294
656 Ga0395905_0216523 3300037471 Bacteria 1793
657 Ga0395905_0310044 3300037471 Bacteria 1466
658 Ga0395905_0315422 3300037471 Bacteria 1452
659 Ga0395905_0320545 3300037471 Bacteria 1439
660 Ga0436364_1516603 3300037853 Bacteria 34550
661 Ga0395901_0000386 3300038443 Bacteria 52804
662 Ga0395901_0002452 3300038443 Bacteria 18805
663 Ga0395901_0004674 3300038443 Bacteria 13804
664 Ga0395901_0014797 3300038443 Bacteria 7927
665 Ga0395901_0018970 3300038443 Bacteria 7033
666 Ga0395901_0021930 3300038443 Bacteria 6547
667 Ga0395901_0032252 3300038443 Bacteria 5406
668 Ga0395901_0040709 3300038443 Bacteria 4813
669 Ga0395901_0043818 3300038443 Bacteria 4641
670 Ga0395901_0050524 3300038443 Bacteria 4319
671 Ga0395901_0072091 3300038443 Bacteria 3600
672 Ga0395901_0085845 3300038443 Bacteria 3290
673 Ga0395901_0100874 3300038443 Bacteria 3028
674 Ga0395901_0126945 3300038443 Bacteria 2680
675 Ga0395901_0174364 3300038443 Bacteria 2255
676 Ga0395901_0184686 3300038443 Unclassified 2187
677 Ga0395901_0192157 3300038443 Unclassified 2140
678 Ga0395901_0251556 3300038443 Unclassified 1841
679 Ga0395901_0263505 3300038443 Unclassified 1793
680 Ga0395901_0373687 3300038443 Bacteria 1468
681 Ga0395901_0470586 3300038443 Unclassified 1283
682 Ga0395901_0875719 3300038443 Bacteria 881
683 Ga0436365_0252990 3300039437 Bacteria 6991
684 Ga0439448_0009713 3300042005 Bacteria 2841
685 Ga0439455_0018531 3300042012 Bacteria 1633
686 Ga0439458_0000497 3300042157 Bacteria 10086
687 Ga0439458_0000646 3300042157 Bacteria 8999
688 Ga0451577_0008460 3300042876 Bacteria 10012
689 Ga0466969_0006183 3300044656 Bacteria 6373
690 Ga0466972_0052315 3300044658 Bacteria 1969
691 Ga0466966_0000004 3300044684 Bacteria 223594
692 Ga0466966_0001899 3300044684 Bacteria 13571
693 Ga0466966_0054690 3300044684 Bacteria 2528
694 Ga0466963_0005520 3300044694 Bacteria 7402
695 Ga0466963_0006155 3300044694 Bacteria 7084
696 Ga0466963_0006896 3300044694 Bacteria 6759
697 Ga0466963_0030580 3300044694 Bacteria 3476
698 Ga0466963_0031349 3300044694 Bacteria 3436
699 Ga0466963_0109802 3300044694 Bacteria 1892
700 Ga0466963_0224239 3300044694 Unclassified 1317
701 Ga0466964_0016774 3300044706 Bacteria 2799
702 Ga0466964_0037911 3300044706 Bacteria 1937
703 Ga0466964_0167061 3300044706 Bacteria 1033
704 Ga0453684_0000633 3300044712 Bacteria 127483
705 Ga0466971_0001844 3300044719 Bacteria 9013
706 Ga0466970_0002797 3300044765 Bacteria 8427
707 Ga0466957_0008686 3300044842 Bacteria 5785
708 Ga0466957_0013181 3300044842 Bacteria 4793
709 Ga0466957_0018520 3300044842 Bacteria 4090
710 Ga0466957_0062046 3300044842 Bacteria 2295
711 Ga0466960_0061141 3300044901 Unclassified 1848
712 Ga0466959_0012407 3300045049 Bacteria 6157
713 Ga0466959_0014602 3300045049 Bacteria 5714
714 Ga0466959_0095039 3300045049 Bacteria 2137
715 Ga0466959_0285245 3300045049 Bacteria 1133
716 Ga0466958_0002919 3300045836 Bacteria 8738
717 Ga0466958_0003408 3300045836 Bacteria 8249
718 Ga0466958_0009788 3300045836 Bacteria 5349
719 Ga0466958_0024679 3300045836 Bacteria 3538
720 Ga0466958_0514673 3300045836 Bacteria 777
721 Ga0466967_0000192 3300045976 Bacteria 25501
722 Ga0466967_0004665 3300045976 Bacteria 9301
723 Ga0466967_0007036 3300045976 Bacteria 8056
724 Ga0466967_0057230 3300045976 Bacteria 3441
725 Ga0466967_0078038 3300045976 Bacteria 2982
726 Ga0466967_0090910 3300045976 Bacteria 2773
727 Ga0466967_0183938 3300045976 Bacteria 1972
728 Ga0466967_0187537 3300045976 Bacteria 1953
729 Ga0466967_0226200 3300045976 Bacteria 1780
730 Ga0466967_0276480 3300045976 Bacteria 1610
731 Ga0466967_0386537 3300045976 Unclassified 1359
732 Ga0495629_0224592 3300046459 Bacteria 1295
733 Ga0495596_0001388 3300046500 Bacteria 13905
734 Ga0495606_0017189 3300046507 Bacteria 5480
735 Ga0495610_0000795 3300046512 Bacteria 29605
736 Ga0495598_0001742 3300046537 Bacteria 4366
737 Ga0495621_0000540 3300046539 Bacteria 9396
738 Ga0495668_0040091 3300046616 Plasmid 2613
739 Ga0495669_0039189 3300046684 Bacteria 2098
740 Ga0495670_0003431 3300046691 Bacteria 7790
741 Ga0495686_0000623 3300047472 Bacteria 48691
742 Ga0495626_0000477 3300048091 Bacteria 40436
743 Ga0496100_0044669 3300048903 Bacteria 2839
744 Ga0496101_0037134 3300048904 Bacteria 3454
745 Ga0496101_0319577 3300048904 Bacteria 1218
746 Ga0496103_0026300 3300048906 Bacteria 3523
747 Ga0496104_0313991 3300048907 Bacteria 1480
748 Ga0496106_0024830 3300048909 Bacteria 4456
749 Ga0496107_0009837 3300048910 Bacteria 6631
750 Ga0496107_0021291 3300048910 Bacteria 4583
751 Ga0496107_0091079 3300048910 Bacteria 2228
752 Ga0496108_0077986 3300048911 Bacteria 2803
753 Ga0496108_0085594 3300048911 Bacteria 2676
754 Ga0496108_0614589 3300048911 Bacteria 946
755 Ga0496109_0579218 3300048912 Bacteria 1058
756 Ga0496110_0010722 3300048913 Bacteria 7463
757 Ga0496110_0034180 3300048913 Bacteria 4403
758 Ga0496111_0008768 3300048914 Bacteria 6713
759 Ga0496111_0035846 3300048914 Bacteria 3547
760 Ga0496111_0251229 3300048914 Bacteria 1313
761 Ga0496112_0020028 3300048915 Bacteria 6333
762 Ga0496112_0022510 3300048915 Bacteria 6006
763 Ga0496112_0064806 3300048915 Bacteria 3606
764 Ga0496112_0594331 3300048915 Bacteria 1039
765 Ga0496113_0012159 3300048916 Bacteria 5776
766 Ga0496113_0072787 3300048916 Bacteria 2617
767 Ga0496114_0000023 3300048917 Bacteria 219092
768 Ga0496116_0000248 3300048919 Bacteria 97391
769 Ga0496117_0048754 3300048920 Bacteria 3021
770 Ga0496118_0017871 3300048921 Bacteria 6434
771 Ga0496119_0044232 3300048922 Bacteria 2806
772 Ga0496121_0002179 3300048924 Bacteria 30646
773 Ga0496122_0002452 3300048925 Bacteria 26242
774 Ga0496124_0001327 3300048927 Bacteria 37246
775 Ga0496124_0025896 3300048927 Bacteria 5300
776 Ga0496125_0005948 3300048928 Bacteria 13363
777 Ga0496126_0000097 3300048929 Bacteria 206014
778 Ga0501033_0009198 3300049570 Bacteria 7610
779 Ga0501038_0035503 3300049574 Bacteria 4377
780 Ga0501043_0011919 3300049579 Bacteria 6803
781 Ga0501067_0212300 3300049583 Bacteria 1078
782 Ga0501044_0016660 3300049823 Bacteria 7892
783 Ga0466962_0005633 3300061719 Bacteria 6014
784 Ga0466962_0009471 3300061719 Bacteria 4670

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034816 Ga0373930_0053521 Ga0373930_0053521_18_686 208
2 3300005336 Ga0070680_100003062 Ga0070680_1000030624 227
3 3300005614 Ga0068856_100816909 Ga0068856_1008169092 227
4 3300025931 Ga0207644_10548734 Ga0207644_105487341 228
5 3300037471 Ga0395905_0074912 Ga0395905_0074912_1981_2721 228
6 3300046616 Ga0495668_0040091 Ga0495668_0040091_64_804 228
7 3300045049 Ga0466959_0285245 Ga0466959_0285245_213_911 231
8 3300045836 Ga0466958_0514673 Ga0466958_0514673_64_762 231
9 3300048910 Ga0496107_0091079 Ga0496107_0091079_953_1693 232
10 3300001979 JGI24740J21852_10024084 JGI24740J21852_100240842 233
11 3300005336 Ga0070680_100003967 Ga0070680_1000039673 233
12 3300005344 Ga0070661_100008124 Ga0070661_1000081243 233
13 3300005344 Ga0070661_100069190 Ga0070661_1000691902 233
14 3300005366 Ga0070659_100024027 Ga0070659_1000240275 233
15 3300005539 Ga0068853_100055248 Ga0068853_1000552483 233
16 3300005539 Ga0068853_100078425 Ga0068853_1000784253 233
17 3300005547 Ga0070693_100435622 Ga0070693_1004356221 233
18 3300005564 Ga0070664_100005291 Ga0070664_1000052913 233
19 3300025909 Ga0207705_10002195 Ga0207705_1000219516 233
20 3300025912 Ga0207707_10133018 Ga0207707_101330182 233
21 3300025919 Ga0207657_10004878 Ga0207657_1000487810 233
22 3300025921 Ga0207652_10012856 Ga0207652_100128566 233
23 3300026041 Ga0207639_10125919 Ga0207639_101259192 233
24 3300026067 Ga0207678_10113031 Ga0207678_101130313 233
25 3300005563 Ga0068855_100384942 Ga0068855_1003849422 234
26 3300005578 Ga0068854_100081546 Ga0068854_1000815462 234
27 3300005614 Ga0068856_100059483 Ga0068856_1000594832 234
28 3300005616 Ga0068852_100028499 Ga0068852_1000284994 234
29 3300009093 Ga0105240_10073601 Ga0105240_100736011 234
30 3300013102 Ga0157371_10344946 Ga0157371_103449461 234
31 3300013104 Ga0157370_10043065 Ga0157370_100430651 234
32 3300013105 Ga0157369_10629646 Ga0157369_106296462 234
33 3300013307 Ga0157372_10219436 Ga0157372_102194362 234
34 3300025981 Ga0207640_10059837 Ga0207640_100598372 234
35 3300026142 Ga0207698_10260354 Ga0207698_102603542 234
36 3300005563 Ga0068855_100031936 Ga0068855_1000319362 235
37 3300037471 Ga0395905_0004189 Ga0395905_0004189_9364_10104 235
38 3300038443 Ga0395901_0184686 Ga0395901_0184686_44_799 235
39 3300038443 Ga0395901_0373687 Ga0395901_0373687_146_886 235
40 3300025917 Ga0207660_10000241 Ga0207660_1000024118 236
41 3300037418 Ga0395900_0306109 Ga0395900_0306109_196_909 236
42 3300005327 Ga0070658_10073367 Ga0070658_100733673 237
43 3300005530 Ga0070679_100091169 Ga0070679_1000911693 237
44 3300005616 Ga0068852_100019724 Ga0068852_1000197243 237
45 3300013105 Ga0157369_10292549 Ga0157369_102925492 237
46 3300013105 Ga0157369_10380587 Ga0157369_103805872 237
47 3300025917 Ga0207660_10306963 Ga0207660_103069632 237
48 3300026142 Ga0207698_10017186 Ga0207698_100171863 237
49 3300037466 Ga0395898_0666502 Ga0395898_0666502_36_752 237
50 3300037471 Ga0395905_0315422 Ga0395905_0315422_701_1417 237
51 3300038443 Ga0395901_0100874 Ga0395901_0100874_1775_2491 237
52 3300038443 Ga0395901_0174364 Ga0395901_0174364_1046_1762 237
53 3300002067 JGI24735J21928_10005457 JGI24735J21928_100054572 238
54 3300005336 Ga0070680_100080662 Ga0070680_1000806623 238
55 3300005339 Ga0070660_100025210 Ga0070660_1000252102 238
56 3300005341 Ga0070691_10005320 Ga0070691_100053204 238
57 3300005344 Ga0070661_100007431 Ga0070661_1000074316 238
58 3300005364 Ga0070673_100182616 Ga0070673_1001826162 238
59 3300005366 Ga0070659_100004213 Ga0070659_1000042138 238
60 3300005458 Ga0070681_10063519 Ga0070681_100635193 238
61 3300005539 Ga0068853_100142627 Ga0068853_1001426272 238
62 3300005563 Ga0068855_100245725 Ga0068855_1002457252 238
63 3300005577 Ga0068857_100062133 Ga0068857_1000621331 238
64 3300005577 Ga0068857_100063422 Ga0068857_1000634222 238
65 3300005616 Ga0068852_100002160 Ga0068852_1000021608 238
66 3300005834 Ga0068851_10365840 Ga0068851_103658401 238
67 3300009093 Ga0105240_10053186 Ga0105240_100531864 238
68 3300009177 Ga0105248_10020861 Ga0105248_100208613 238
69 3300009545 Ga0105237_10050096 Ga0105237_100500964 238
70 3300009551 Ga0105238_10003202 Ga0105238_100032025 238
71 3300010375 Ga0105239_10195912 Ga0105239_101959123 238
72 3300013100 Ga0157373_10025618 Ga0157373_100256183 238
73 3300013102 Ga0157371_10008861 Ga0157371_100088618 238
74 3300013104 Ga0157370_10012870 Ga0157370_100128704 238
75 3300013105 Ga0157369_10094073 Ga0157369_100940733 238
76 3300013307 Ga0157372_10080052 Ga0157372_100800524 238
77 3300021384 Ga0213876_10180302 Ga0213876_101803022 238
78 3300025321 Ga0207656_10073307 Ga0207656_100733071 238
79 3300025904 Ga0207647_10029680 Ga0207647_100296804 238
80 3300025909 Ga0207705_10175606 Ga0207705_101756061 238
81 3300025913 Ga0207695_10225379 Ga0207695_102253792 238
82 3300025914 Ga0207671_10125047 Ga0207671_101250471 238
83 3300025919 Ga0207657_10010698 Ga0207657_100106988 238
84 3300025920 Ga0207649_10025575 Ga0207649_100255753 238
85 3300025924 Ga0207694_10002833 Ga0207694_100028335 238
86 3300025932 Ga0207690_10004942 Ga0207690_100049424 238
87 3300025949 Ga0207667_10080909 Ga0207667_100809092 238
88 3300025949 Ga0207667_10457626 Ga0207667_104576262 238
89 3300025960 Ga0207651_10167564 Ga0207651_101675642 238
90 3300026041 Ga0207639_10000776 Ga0207639_1000077620 238
91 3300026116 Ga0207674_10009300 Ga0207674_100093002 238
92 3300037418 Ga0395900_0091909 Ga0395900_0091909_907_1647 238
93 3300037471 Ga0395905_0004074 Ga0395905_0004074_4835_5575 238
94 3300037471 Ga0395905_0093771 Ga0395905_0093771_33_752 238
95 3300038443 Ga0395901_0018970 Ga0395901_0018970_4981_5721 238
96 3300038443 Ga0395901_0040709 Ga0395901_0040709_2008_2727 238
97 3300039437 Ga0436365_0252990 Ga0436365_0252990_4462_5184 238
98 3300049574 Ga0501038_0035503 Ga0501038_0035503_350_1069 238
99 3300049583 Ga0501067_0212300 Ga0501067_0212300_19_738 238
100 3300005539 Ga0068853_100519078 Ga0068853_1005190781 239
101 3300026041 Ga0207639_10444262 Ga0207639_104442622 239
102 3300037312 Ga0395899_0000432 Ga0395899_0000432_42003_42725 239
103 3300037312 Ga0395899_0075751 Ga0395899_0075751_862_1584 239
104 3300037312 Ga0395899_0087867 Ga0395899_0087867_668_1408 239
105 3300037418 Ga0395900_0000432 Ga0395900_0000432_54882_55604 239
106 3300037466 Ga0395898_0000021 Ga0395898_0000021_388716_389438 239
107 3300037466 Ga0395898_0018713 Ga0395898_0018713_4881_5621 239
108 3300037466 Ga0395898_0048450 Ga0395898_0048450_2522_3244 239
109 3300037471 Ga0395905_0000413 Ga0395905_0000413_54882_55604 239
110 3300037471 Ga0395905_0011366 Ga0395905_0011366_6715_7437 239
111 3300037471 Ga0395905_0310044 Ga0395905_0310044_202_942 239
112 3300038443 Ga0395901_0004674 Ga0395901_0004674_8460_9182 239
113 3300038443 Ga0395901_0021930 Ga0395901_0021930_2522_3244 239
114 3300038443 Ga0395901_0126945 Ga0395901_0126945_123_863 239
115 3300005328 Ga0070676_10017478 Ga0070676_100174782 240
116 3300005335 Ga0070666_10086947 Ga0070666_100869471 240
117 3300005338 Ga0068868_100171377 Ga0068868_1001713772 240
118 3300005339 Ga0070660_100058297 Ga0070660_1000582973 240
119 3300005344 Ga0070661_100058638 Ga0070661_1000586382 240
120 3300005354 Ga0070675_100843994 Ga0070675_1008439941 240
121 3300005364 Ga0070673_100279664 Ga0070673_1002796641 240
122 3300005366 Ga0070659_100375006 Ga0070659_1003750062 240
123 3300005459 Ga0068867_100396720 Ga0068867_1003967201 240
124 3300005577 Ga0068857_100054570 Ga0068857_1000545704 240
125 3300025321 Ga0207656_10045634 Ga0207656_100456342 240
126 3300025907 Ga0207645_10015478 Ga0207645_100154787 240
127 3300025909 Ga0207705_10286261 Ga0207705_102862611 240
128 3300025919 Ga0207657_10047481 Ga0207657_100474813 240
129 3300025932 Ga0207690_10033463 Ga0207690_100334632 240
130 3300025933 Ga0207706_10030507 Ga0207706_100305072 240
131 3300026041 Ga0207639_10132989 Ga0207639_101329892 240
132 3300026067 Ga0207678_10043718 Ga0207678_100437182 240
133 3300026142 Ga0207698_10105349 Ga0207698_101053491 240
134 3300005355 Ga0070671_100024124 Ga0070671_1000241242 241
135 3300005364 Ga0070673_100173018 Ga0070673_1001730182 241
136 3300025919 Ga0207657_10073096 Ga0207657_100730963 241
137 3300025941 Ga0207711_10094385 Ga0207711_100943853 241
138 3300048914 Ga0496111_0035846 Ga0496111_0035846_856_1584 241
139 3300048915 Ga0496112_0064806 Ga0496112_0064806_1636_2364 241
140 3300005339 Ga0070660_100186257 Ga0070660_1001862572 242
141 3300005345 Ga0070692_10073740 Ga0070692_100737402 242
142 3300005366 Ga0070659_100164389 Ga0070659_1001643892 242
143 3300005458 Ga0070681_10280261 Ga0070681_102802611 242
144 3300005539 Ga0068853_100051129 Ga0068853_1000511293 242
145 3300005564 Ga0070664_100008643 Ga0070664_1000086433 242
146 3300005616 Ga0068852_100649286 Ga0068852_1006492862 242
147 3300013296 Ga0157374_10045728 Ga0157374_100457282 242
148 3300025919 Ga0207657_10052756 Ga0207657_100527562 242
149 3300026067 Ga0207678_10001811 Ga0207678_1000181112 242
150 3300001979 JGI24740J21852_10016434 JGI24740J21852_100164342 243
151 3300005327 Ga0070658_10050932 Ga0070658_100509322 243
152 3300005331 Ga0070670_100218490 Ga0070670_1002184902 243
153 3300005335 Ga0070666_10344797 Ga0070666_103447972 243
154 3300005336 Ga0070680_100010837 Ga0070680_1000108373 243
155 3300005339 Ga0070660_100001490 Ga0070660_10000149013 243
156 3300005339 Ga0070660_100076300 Ga0070660_1000763003 243
157 3300005355 Ga0070671_100043107 Ga0070671_1000431073 243
158 3300005435 Ga0070714_100344008 Ga0070714_1003440082 243
159 3300005457 Ga0070662_100292900 Ga0070662_1002929001 243
160 3300005458 Ga0070681_10053751 Ga0070681_100537513 243
161 3300005530 Ga0070679_100004910 Ga0070679_10000491012 243
162 3300005535 Ga0070684_100069990 Ga0070684_1000699902 243
163 3300005539 Ga0068853_100266601 Ga0068853_1002666012 243
164 3300005539 Ga0068853_100429457 Ga0068853_1004294572 243
165 3300005563 Ga0068855_100046944 Ga0068855_1000469443 243
166 3300005564 Ga0070664_100001418 Ga0070664_1000014185 243
167 3300005578 Ga0068854_100005814 Ga0068854_1000058144 243
168 3300005578 Ga0068854_100053173 Ga0068854_1000531732 243
169 3300005614 Ga0068856_100055471 Ga0068856_1000554712 243
170 3300005834 Ga0068851_10249183 Ga0068851_102491832 243
171 3300005834 Ga0068851_10249751 Ga0068851_102497512 243
172 3300009551 Ga0105238_10272253 Ga0105238_102722532 243
173 3300013100 Ga0157373_10198150 Ga0157373_101981502 243
174 3300013102 Ga0157371_10201870 Ga0157371_102018702 243
175 3300013104 Ga0157370_10082638 Ga0157370_100826382 243
176 3300013105 Ga0157369_10095019 Ga0157369_100950192 243
177 3300020082 Ga0206353_10312903 Ga0206353_103129031 243
178 3300025904 Ga0207647_10087456 Ga0207647_100874562 243
179 3300025907 Ga0207645_10041148 Ga0207645_100411483 243
180 3300025909 Ga0207705_10004391 Ga0207705_100043913 243
181 3300025909 Ga0207705_10437623 Ga0207705_104376232 243
182 3300025912 Ga0207707_10010567 Ga0207707_100105675 243
183 3300025917 Ga0207660_10023836 Ga0207660_100238363 243
184 3300025919 Ga0207657_10002737 Ga0207657_1000273717 243
185 3300025919 Ga0207657_10290933 Ga0207657_102909332 243
186 3300025921 Ga0207652_10004605 Ga0207652_100046052 243
187 3300025925 Ga0207650_10141365 Ga0207650_101413653 243
188 3300025931 Ga0207644_10068856 Ga0207644_100688563 243
189 3300025933 Ga0207706_10031530 Ga0207706_100315304 243
190 3300025933 Ga0207706_10080291 Ga0207706_100802911 243
191 3300025945 Ga0207679_10002108 Ga0207679_100021086 243
192 3300025949 Ga0207667_10012617 Ga0207667_100126172 243
193 3300025981 Ga0207640_10006188 Ga0207640_100061884 243
194 3300025981 Ga0207640_10060157 Ga0207640_100601572 243
195 3300026041 Ga0207639_10292144 Ga0207639_102921443 243
196 3300026041 Ga0207639_10407755 Ga0207639_104077552 243
197 3300026067 Ga0207678_10008776 Ga0207678_100087765 243
198 3300026067 Ga0207678_10014097 Ga0207678_100140975 243
199 3300026089 Ga0207648_10031127 Ga0207648_100311274 243
200 3300037418 Ga0395900_0022846 Ga0395900_0022846_1548_2282 243
201 3300037466 Ga0395898_0001152 Ga0395898_0001152_4571_5305 243
202 3300037471 Ga0395905_0101322 Ga0395905_0101322_699_1433 243
203 3300038443 Ga0395901_0000386 Ga0395901_0000386_16875_17609 243
204 3300048904 Ga0496101_0319577 Ga0496101_0319577_193_948 243
205 3300048913 Ga0496110_0034180 Ga0496110_0034180_697_1431 243
206 3300048914 Ga0496111_0251229 Ga0496111_0251229_102_836 243
207 3300005327 Ga0070658_10058523 Ga0070658_100585232 244
208 3300005327 Ga0070658_10059463 Ga0070658_100594633 244
209 3300005435 Ga0070714_100458760 Ga0070714_1004587602 244
210 3300005616 Ga0068852_100062988 Ga0068852_1000629883 244
211 3300013296 Ga0157374_10062123 Ga0157374_100621233 244
212 3300021388 Ga0213875_10006472 Ga0213875_100064723 244
213 3300025909 Ga0207705_10208461 Ga0207705_102084612 244
214 3300025921 Ga0207652_10223453 Ga0207652_102234532 244
215 3300025921 Ga0207652_10433000 Ga0207652_104330002 244
216 3300026142 Ga0207698_10290882 Ga0207698_102908822 244
217 3300037418 Ga0395900_0025214 Ga0395900_0025214_4911_5648 244
218 3300037418 Ga0395900_0399171 Ga0395900_0399171_247_1035 244
219 3300037466 Ga0395898_0002234 Ga0395898_0002234_17989_18726 244
220 3300037471 Ga0395905_0016312 Ga0395905_0016312_4854_5591 244
221 3300037853 Ga0436364_1516603 Ga0436364_1516603_11662_12399 244
222 3300038443 Ga0395901_0002452 Ga0395901_0002452_4853_5590 244
223 3300005327 Ga0070658_10043041 Ga0070658_100430414 245
224 3300005327 Ga0070658_10161336 Ga0070658_101613362 245
225 3300005337 Ga0070682_100069901 Ga0070682_1000699012 245
226 3300005339 Ga0070660_100016860 Ga0070660_1000168602 245
227 3300005339 Ga0070660_100273095 Ga0070660_1002730953 245
228 3300005339 Ga0070660_100456020 Ga0070660_1004560202 245
229 3300005344 Ga0070661_100012707 Ga0070661_1000127073 245
230 3300005344 Ga0070661_100104066 Ga0070661_1001040662 245
231 3300005366 Ga0070659_100007874 Ga0070659_1000078743 245
232 3300005366 Ga0070659_100024807 Ga0070659_1000248071 245
233 3300005457 Ga0070662_100042056 Ga0070662_1000420562 245
234 3300005457 Ga0070662_100049394 Ga0070662_1000493942 245
235 3300005530 Ga0070679_100186496 Ga0070679_1001864963 245
236 3300005539 Ga0068853_100036912 Ga0068853_1000369124 245
237 3300005539 Ga0068853_100261844 Ga0068853_1002618442 245
238 3300005564 Ga0070664_100215037 Ga0070664_1002150372 245
239 3300005577 Ga0068857_100169187 Ga0068857_1001691872 245
240 3300005577 Ga0068857_100508666 Ga0068857_1005086662 245
241 3300005578 Ga0068854_100095717 Ga0068854_1000957172 245
242 3300005616 Ga0068852_100063391 Ga0068852_1000633913 245
243 3300005616 Ga0068852_100116631 Ga0068852_1001166313 245
244 3300006175 Ga0070712_100209514 Ga0070712_1002095141 245
245 3300009545 Ga0105237_10710346 Ga0105237_107103461 245
246 3300013100 Ga0157373_10053361 Ga0157373_100533612 245
247 3300013102 Ga0157371_10243173 Ga0157371_102431732 245
248 3300013102 Ga0157371_10251109 Ga0157371_102511092 245
249 3300013104 Ga0157370_10045485 Ga0157370_100454852 245
250 3300013105 Ga0157369_10030484 Ga0157369_100304842 245
251 3300013105 Ga0157369_10403322 Ga0157369_104033222 245
252 3300013307 Ga0157372_10288580 Ga0157372_102885803 245
253 3300025904 Ga0207647_10008967 Ga0207647_100089673 245
254 3300025909 Ga0207705_10005360 Ga0207705_100053609 245
255 3300025909 Ga0207705_10274819 Ga0207705_102748191 245
256 3300025919 Ga0207657_10025919 Ga0207657_100259193 245
257 3300025919 Ga0207657_10413348 Ga0207657_104133482 245
258 3300025924 Ga0207694_10034414 Ga0207694_100344144 245
259 3300025932 Ga0207690_10001815 Ga0207690_1000181515 245
260 3300025932 Ga0207690_10008949 Ga0207690_100089493 245
261 3300025933 Ga0207706_10024480 Ga0207706_100244802 245
262 3300025933 Ga0207706_10053152 Ga0207706_100531523 245
263 3300025945 Ga0207679_10140818 Ga0207679_101408182 245
264 3300026041 Ga0207639_10283038 Ga0207639_102830382 245
265 3300026041 Ga0207639_10356398 Ga0207639_103563982 245
266 3300026078 Ga0207702_10095124 Ga0207702_100951242 245
267 3300026078 Ga0207702_10379406 Ga0207702_103794062 245
268 3300026116 Ga0207674_10146699 Ga0207674_101466992 245
269 3300026142 Ga0207698_10031969 Ga0207698_100319693 245
270 3300026142 Ga0207698_10039152 Ga0207698_100391521 245
271 3300026142 Ga0207698_10138730 Ga0207698_101387302 245
272 3300037312 Ga0395899_0022133 Ga0395899_0022133_2758_3498 245
273 3300037418 Ga0395900_0001148 Ga0395900_0001148_2600_3340 245
274 3300037418 Ga0395900_0195120 Ga0395900_0195120_1241_1981 245
275 3300037418 Ga0395900_0346153 Ga0395900_0346153_507_1247 245
276 3300037471 Ga0395905_0000649 Ga0395905_0000649_41027_41767 245
277 3300037471 Ga0395905_0011559 Ga0395905_0011559_930_1670 245
278 3300037471 Ga0395905_0099739 Ga0395905_0099739_80_820 245
279 3300037471 Ga0395905_0129591 Ga0395905_0129591_199_939 245
280 3300038443 Ga0395901_0072091 Ga0395901_0072091_2257_2997 245
281 3300038443 Ga0395901_0251556 Ga0395901_0251556_394_1134 245
282 3300038443 Ga0395901_0263505 Ga0395901_0263505_806_1588 245
283 3300042005 Ga0439448_0009713 Ga0439448_0009713_1233_1973 245
284 3300042012 Ga0439455_0018531 Ga0439455_0018531_391_1131 245
285 3300042157 Ga0439458_0000497 Ga0439458_0000497_4184_4924 245
286 3300042157 Ga0439458_0000646 Ga0439458_0000646_6266_7006 245
287 3300044694 Ga0466963_0006896 Ga0466963_0006896_5586_6326 245
288 3300044706 Ga0466964_0037911 Ga0466964_0037911_1184_1924 245
289 3300045976 Ga0466967_0000192 Ga0466967_0000192_2296_3036 245
290 3300001979 JGI24740J21852_10004489 JGI24740J21852_100044895 246
291 3300002067 JGI24735J21928_10004640 JGI24735J21928_100046403 246
292 3300002073 JGI24745J21846_1006377 JGI24745J21846_10063772 246
293 3300005327 Ga0070658_10017972 Ga0070658_100179723 246
294 3300005327 Ga0070658_10572921 Ga0070658_105729211 246
295 3300005329 Ga0070683_100019230 Ga0070683_1000192302 246
296 3300005331 Ga0070670_100019993 Ga0070670_1000199932 246
297 3300005331 Ga0070670_100024901 Ga0070670_1000249014 246
298 3300005334 Ga0068869_100136798 Ga0068869_1001367982 246
299 3300005335 Ga0070666_10009548 Ga0070666_100095485 246
300 3300005336 Ga0070680_100010341 Ga0070680_1000103415 246
301 3300005336 Ga0070680_100067105 Ga0070680_1000671053 246
302 3300005338 Ga0068868_100030423 Ga0068868_1000304234 246
303 3300005338 Ga0068868_100040163 Ga0068868_1000401632 246
304 3300005338 Ga0068868_100676000 Ga0068868_1006760001 246
305 3300005339 Ga0070660_100003283 Ga0070660_1000032839 246
306 3300005339 Ga0070660_100397379 Ga0070660_1003973792 246
307 3300005344 Ga0070661_100056100 Ga0070661_1000561002 246
308 3300005344 Ga0070661_100079322 Ga0070661_1000793222 246
309 3300005344 Ga0070661_100345793 Ga0070661_1003457931 246
310 3300005354 Ga0070675_100026769 Ga0070675_1000267692 246
311 3300005354 Ga0070675_100051056 Ga0070675_1000510563 246
312 3300005355 Ga0070671_100296906 Ga0070671_1002969061 246
313 3300005355 Ga0070671_100296908 Ga0070671_1002969081 246
314 3300005356 Ga0070674_100002749 Ga0070674_1000027498 246
315 3300005356 Ga0070674_100063737 Ga0070674_1000637372 246
316 3300005356 Ga0070674_100295224 Ga0070674_1002952242 246
317 3300005364 Ga0070673_100028786 Ga0070673_1000287862 246
318 3300005364 Ga0070673_100164211 Ga0070673_1001642111 246
319 3300005364 Ga0070673_100206408 Ga0070673_1002064082 246
320 3300005364 Ga0070673_100457741 Ga0070673_1004577411 246
321 3300005364 Ga0070673_100534640 Ga0070673_1005346402 246
322 3300005366 Ga0070659_100004081 Ga0070659_1000040818 246
323 3300005366 Ga0070659_100011217 Ga0070659_1000112172 246
324 3300005366 Ga0070659_100073409 Ga0070659_1000734092 246
325 3300005366 Ga0070659_100139444 Ga0070659_1001394442 246
326 3300005366 Ga0070659_100154191 Ga0070659_1001541911 246
327 3300005367 Ga0070667_100028427 Ga0070667_1000284273 246
328 3300005367 Ga0070667_100193311 Ga0070667_1001933113 246
329 3300005435 Ga0070714_100051557 Ga0070714_1000515573 246
330 3300005436 Ga0070713_100793737 Ga0070713_1007937371 246
331 3300005455 Ga0070663_100027417 Ga0070663_1000274172 246
332 3300005455 Ga0070663_100075005 Ga0070663_1000750052 246
333 3300005456 Ga0070678_100018355 Ga0070678_1000183553 246
334 3300005456 Ga0070678_100676570 Ga0070678_1006765701 246
335 3300005457 Ga0070662_100036407 Ga0070662_1000364073 246
336 3300005457 Ga0070662_100036987 Ga0070662_1000369872 246
337 3300005457 Ga0070662_100118842 Ga0070662_1001188422 246
338 3300005458 Ga0070681_10061620 Ga0070681_100616203 246
339 3300005459 Ga0068867_100031507 Ga0068867_1000315072 246
340 3300005459 Ga0068867_100375195 Ga0068867_1003751951 246
341 3300005530 Ga0070679_100096192 Ga0070679_1000961923 246
342 3300005535 Ga0070684_100002471 Ga0070684_1000024715 246
343 3300005539 Ga0068853_100006410 Ga0068853_1000064105 246
344 3300005539 Ga0068853_100066845 Ga0068853_1000668452 246
345 3300005548 Ga0070665_100115767 Ga0070665_1001157672 246
346 3300005563 Ga0068855_100306949 Ga0068855_1003069492 246
347 3300005563 Ga0068855_100391813 Ga0068855_1003918132 246
348 3300005563 Ga0068855_100427930 Ga0068855_1004279302 246
349 3300005564 Ga0070664_100010531 Ga0070664_1000105313 246
350 3300005564 Ga0070664_100015275 Ga0070664_1000152752 246
351 3300005564 Ga0070664_100058867 Ga0070664_1000588673 246
352 3300005564 Ga0070664_100130705 Ga0070664_1001307052 246
353 3300005577 Ga0068857_100082025 Ga0068857_1000820253 246
354 3300005614 Ga0068856_100056945 Ga0068856_1000569452 246
355 3300005614 Ga0068856_100840331 Ga0068856_1008403312 246
356 3300005616 Ga0068852_100066969 Ga0068852_1000669693 246
357 3300005617 Ga0068859_100059140 Ga0068859_1000591402 246
358 3300005617 Ga0068859_100713384 Ga0068859_1007133841 246
359 3300005618 Ga0068864_100029285 Ga0068864_1000292856 246
360 3300005618 Ga0068864_100072987 Ga0068864_1000729872 246
361 3300005718 Ga0068866_10028402 Ga0068866_100284022 246
362 3300005834 Ga0068851_10007073 Ga0068851_100070733 246
363 3300005834 Ga0068851_10210280 Ga0068851_102102802 246
364 3300005841 Ga0068863_100006701 Ga0068863_1000067013 246
365 3300005841 Ga0068863_100010827 Ga0068863_1000108273 246
366 3300005842 Ga0068858_100073544 Ga0068858_1000735443 246
367 3300005843 Ga0068860_100110962 Ga0068860_1001109623 246
368 3300005843 Ga0068860_100181378 Ga0068860_1001813781 246
369 3300006028 Ga0070717_10009189 Ga0070717_100091894 246
370 3300006175 Ga0070712_100012000 Ga0070712_1000120002 246
371 3300006237 Ga0097621_100037234 Ga0097621_1000372342 246
372 3300006358 Ga0068871_100018095 Ga0068871_1000180952 246
373 3300006358 Ga0068871_100201836 Ga0068871_1002018362 246
374 3300006881 Ga0068865_100015606 Ga0068865_1000156063 246
375 3300006931 Ga0097620_100059136 Ga0097620_1000591363 246
376 3300006931 Ga0097620_100713466 Ga0097620_1007134662 246
377 3300009093 Ga0105240_10041949 Ga0105240_100419491 246
378 3300009098 Ga0105245_10031518 Ga0105245_100315183 246
379 3300009098 Ga0105245_10121626 Ga0105245_101216261 246
380 3300009174 Ga0105241_10119494 Ga0105241_101194942 246
381 3300009177 Ga0105248_10034033 Ga0105248_100340335 246
382 3300009545 Ga0105237_10463711 Ga0105237_104637112 246
383 3300009551 Ga0105238_10019895 Ga0105238_100198956 246
384 3300009551 Ga0105238_10035976 Ga0105238_100359765 246
385 3300010375 Ga0105239_10116974 Ga0105239_101169743 246
386 3300013100 Ga0157373_10011118 Ga0157373_100111185 246
387 3300013100 Ga0157373_10056144 Ga0157373_100561443 246
388 3300013100 Ga0157373_10078057 Ga0157373_100780573 246
389 3300013102 Ga0157371_10019086 Ga0157371_100190864 246
390 3300013102 Ga0157371_10033237 Ga0157371_100332372 246
391 3300013104 Ga0157370_10116786 Ga0157370_101167863 246
392 3300013105 Ga0157369_10843899 Ga0157369_108438991 246
393 3300013296 Ga0157374_10064977 Ga0157374_100649773 246
394 3300013296 Ga0157374_10139639 Ga0157374_101396392 246
395 3300013296 Ga0157374_10323563 Ga0157374_103235632 246
396 3300013296 Ga0157374_11109435 Ga0157374_111094351 246
397 3300013297 Ga0157378_10021856 Ga0157378_100218564 246
398 3300013297 Ga0157378_10295755 Ga0157378_102957552 246
399 3300013306 Ga0163162_10061874 Ga0163162_100618746 246
400 3300013307 Ga0157372_10045150 Ga0157372_100451505 246
401 3300013308 Ga0157375_10085446 Ga0157375_100854463 246
402 3300013308 Ga0157375_10108167 Ga0157375_101081671 246
403 3300013308 Ga0157375_11139712 Ga0157375_111397122 246
404 3300014325 Ga0163163_10031637 Ga0163163_100316373 246
405 3300014326 Ga0157380_10091798 Ga0157380_100917981 246
406 3300014745 Ga0157377_10034335 Ga0157377_100343353 246
407 3300020082 Ga0206353_11302302 Ga0206353_113023022 246
408 3300025315 Ga0207697_10009804 Ga0207697_100098042 246
409 3300025899 Ga0207642_10006965 Ga0207642_100069652 246
410 3300025901 Ga0207688_10003700 Ga0207688_100037009 246
411 3300025903 Ga0207680_10030844 Ga0207680_100308442 246
412 3300025904 Ga0207647_10013540 Ga0207647_100135402 246
413 3300025904 Ga0207647_10080869 Ga0207647_100808692 246
414 3300025906 Ga0207699_10021667 Ga0207699_100216672 246
415 3300025907 Ga0207645_10413334 Ga0207645_104133341 246
416 3300025909 Ga0207705_10011657 Ga0207705_100116573 246
417 3300025909 Ga0207705_10040847 Ga0207705_100408473 246
418 3300025909 Ga0207705_10069108 Ga0207705_100691082 246
419 3300025911 Ga0207654_10198635 Ga0207654_101986352 246
420 3300025914 Ga0207671_10263413 Ga0207671_102634132 246
421 3300025915 Ga0207693_10019856 Ga0207693_100198563 246
422 3300025917 Ga0207660_10115111 Ga0207660_101151113 246
423 3300025919 Ga0207657_10006363 Ga0207657_100063634 246
424 3300025919 Ga0207657_10014968 Ga0207657_100149689 246
425 3300025919 Ga0207657_10020650 Ga0207657_100206503 246
426 3300025919 Ga0207657_10075373 Ga0207657_100753733 246
427 3300025919 Ga0207657_10109121 Ga0207657_101091213 246
428 3300025920 Ga0207649_10027930 Ga0207649_100279302 246
429 3300025921 Ga0207652_10042682 Ga0207652_100426823 246
430 3300025924 Ga0207694_10079674 Ga0207694_100796742 246
431 3300025925 Ga0207650_10085237 Ga0207650_100852372 246
432 3300025926 Ga0207659_10269263 Ga0207659_102692632 246
433 3300025931 Ga0207644_10003563 Ga0207644_100035633 246
434 3300025931 Ga0207644_10012208 Ga0207644_100122083 246
435 3300025931 Ga0207644_10264792 Ga0207644_102647922 246
436 3300025932 Ga0207690_10030736 Ga0207690_100307363 246
437 3300025932 Ga0207690_10094395 Ga0207690_100943952 246
438 3300025932 Ga0207690_10163137 Ga0207690_101631372 246
439 3300025933 Ga0207706_10005493 Ga0207706_100054933 246
440 3300025933 Ga0207706_10009166 Ga0207706_100091669 246
441 3300025933 Ga0207706_10081953 Ga0207706_100819532 246
442 3300025933 Ga0207706_10388314 Ga0207706_103883141 246
443 3300025934 Ga0207686_10069381 Ga0207686_100693812 246
444 3300025937 Ga0207669_10003659 Ga0207669_100036599 246
445 3300025938 Ga0207704_10065401 Ga0207704_100654012 246
446 3300025939 Ga0207665_10037236 Ga0207665_100372362 246
447 3300025940 Ga0207691_10004041 Ga0207691_100040414 246
448 3300025940 Ga0207691_10010388 Ga0207691_1001038810 246
449 3300025940 Ga0207691_10021422 Ga0207691_100214223 246
450 3300025941 Ga0207711_10007450 Ga0207711_1000745010 246
451 3300025941 Ga0207711_10193367 Ga0207711_101933672 246
452 3300025942 Ga0207689_10066209 Ga0207689_100662092 246
453 3300025945 Ga0207679_10044151 Ga0207679_100441512 246
454 3300025945 Ga0207679_10050153 Ga0207679_100501532 246
455 3300025949 Ga0207667_10111173 Ga0207667_101111733 246
456 3300025960 Ga0207651_10003947 Ga0207651_100039474 246
457 3300025960 Ga0207651_10430265 Ga0207651_104302652 246
458 3300025981 Ga0207640_10172663 Ga0207640_101726632 246
459 3300025986 Ga0207658_10086443 Ga0207658_100864432 246
460 3300026023 Ga0207677_10009921 Ga0207677_100099213 246
461 3300026023 Ga0207677_10011852 Ga0207677_100118522 246
462 3300026023 Ga0207677_10254806 Ga0207677_102548061 246
463 3300026023 Ga0207677_10300171 Ga0207677_103001712 246
464 3300026035 Ga0207703_10147298 Ga0207703_101472982 246
465 3300026041 Ga0207639_10053244 Ga0207639_100532443 246
466 3300026067 Ga0207678_10030153 Ga0207678_100301532 246
467 3300026067 Ga0207678_10080141 Ga0207678_100801412 246
468 3300026078 Ga0207702_10177030 Ga0207702_101770302 246
469 3300026089 Ga0207648_10005572 Ga0207648_1000557213 246
470 3300026095 Ga0207676_10002519 Ga0207676_100025192 246
471 3300026095 Ga0207676_10643015 Ga0207676_106430152 246
472 3300026116 Ga0207674_10028796 Ga0207674_100287963 246
473 3300026116 Ga0207674_10287625 Ga0207674_102876253 246
474 3300026118 Ga0207675_100278768 Ga0207675_1002787682 246
475 3300026121 Ga0207683_10002539 Ga0207683_100025395 246
476 3300026121 Ga0207683_10004440 Ga0207683_100044403 246
477 3300026142 Ga0207698_10013354 Ga0207698_100133543 246
478 3300026142 Ga0207698_10465249 Ga0207698_104652492 246
479 3300035170 Ga0373943_0049689 Ga0373943_0049689_756_1499 246
480 3300035171 Ga0373946_0012232 Ga0373946_0012232_2172_2915 246
481 3300035692 Ga0373935_0031869 Ga0373935_0031869_290_1033 246
482 3300036401 Ga0373937_0217503 Ga0373937_0217503_48_791 246
483 3300037312 Ga0395899_0003237 Ga0395899_0003237_8177_8920 246
484 3300037312 Ga0395899_0013471 Ga0395899_0013471_2489_3274 246
485 3300037312 Ga0395899_0039866 Ga0395899_0039866_2495_3238 246
486 3300037312 Ga0395899_0320840 Ga0395899_0320840_277_1020 246
487 3300037418 Ga0395900_0009108 Ga0395900_0009108_4604_5389 246
488 3300037418 Ga0395900_0015479 Ga0395900_0015479_4003_4746 246
489 3300037418 Ga0395900_0018490 Ga0395900_0018490_1947_2690 246
490 3300037418 Ga0395900_0164368 Ga0395900_0164368_963_1706 246
491 3300037418 Ga0395900_0291786 Ga0395900_0291786_292_1035 246
492 3300037418 Ga0395900_0540114 Ga0395900_0540114_153_896 246
493 3300037418 Ga0395900_0690755 Ga0395900_0690755_164_907 246
494 3300037418 Ga0395900_0745956 Ga0395900_0745956_48_791 246
495 3300037418 Ga0395900_0761635 Ga0395900_0761635_77_862 246
496 3300037466 Ga0395898_0011941 Ga0395898_0011941_557_1300 246
497 3300037466 Ga0395898_0035995 Ga0395898_0035995_3619_4404 246
498 3300037466 Ga0395898_0046303 Ga0395898_0046303_1434_2177 246
499 3300037466 Ga0395898_0121320 Ga0395898_0121320_1276_2019 246
500 3300037466 Ga0395898_0176084 Ga0395898_0176084_1073_1816 246
501 3300037466 Ga0395898_0630405 Ga0395898_0630405_25_768 246
502 3300037466 Ga0395898_0739059 Ga0395898_0739059_152_895 246
503 3300037471 Ga0395905_0032222 Ga0395905_0032222_3631_4374 246
504 3300037471 Ga0395905_0033690 Ga0395905_0033690_1959_2702 246
505 3300037471 Ga0395905_0033936 Ga0395905_0033936_1838_2581 246
506 3300037471 Ga0395905_0094763 Ga0395905_0094763_2010_2753 246
507 3300037471 Ga0395905_0138077 Ga0395905_0138077_838_1623 246
508 3300037471 Ga0395905_0216523 Ga0395905_0216523_226_969 246
509 3300037471 Ga0395905_0320545 Ga0395905_0320545_375_1118 246
510 3300038443 Ga0395901_0014797 Ga0395901_0014797_6628_7371 246
511 3300038443 Ga0395901_0043818 Ga0395901_0043818_449_1192 246
512 3300038443 Ga0395901_0050524 Ga0395901_0050524_585_1328 246
513 3300038443 Ga0395901_0085845 Ga0395901_0085845_2449_3192 246
514 3300038443 Ga0395901_0192157 Ga0395901_0192157_507_1250 246
515 3300038443 Ga0395901_0875719 Ga0395901_0875719_20_763 246
516 3300044656 Ga0466969_0006183 Ga0466969_0006183_4138_4929 246
517 3300044658 Ga0466972_0052315 Ga0466972_0052315_555_1298 246
518 3300044684 Ga0466966_0001899 Ga0466966_0001899_4335_5126 246
519 3300044694 Ga0466963_0005520 Ga0466963_0005520_5947_6690 246
520 3300044694 Ga0466963_0006155 Ga0466963_0006155_3150_3941 246
521 3300044694 Ga0466963_0224239 Ga0466963_0224239_25_810 246
522 3300044706 Ga0466964_0167061 Ga0466964_0167061_65_847 246
523 3300044719 Ga0466971_0001844 Ga0466971_0001844_5386_6177 246
524 3300044765 Ga0466970_0002797 Ga0466970_0002797_4591_5382 246
525 3300044842 Ga0466957_0008686 Ga0466957_0008686_4096_4839 246
526 3300044842 Ga0466957_0062046 Ga0466957_0062046_1012_1803 246
527 3300044901 Ga0466960_0061141 Ga0466960_0061141_862_1605 246
528 3300045049 Ga0466959_0095039 Ga0466959_0095039_820_1611 246
529 3300045836 Ga0466958_0002919 Ga0466958_0002919_5891_6634 246
530 3300045836 Ga0466958_0003408 Ga0466958_0003408_5801_6592 246
531 3300045976 Ga0466967_0004665 Ga0466967_0004665_2152_2895 246
532 3300045976 Ga0466967_0007036 Ga0466967_0007036_1423_2166 246
533 3300045976 Ga0466967_0226200 Ga0466967_0226200_486_1235 246
534 3300045976 Ga0466967_0276480 Ga0466967_0276480_763_1545 246
535 3300045976 Ga0466967_0386537 Ga0466967_0386537_542_1285 246
536 3300046459 Ga0495629_0224592 Ga0495629_0224592_72_815 246
537 3300046537 Ga0495598_0001742 Ga0495598_0001742_3082_3825 246
538 3300046539 Ga0495621_0000540 Ga0495621_0000540_4200_4943 246
539 3300046684 Ga0495669_0039189 Ga0495669_0039189_620_1363 246
540 3300046691 Ga0495670_0003431 Ga0495670_0003431_3365_4108 246
541 3300048903 Ga0496100_0044669 Ga0496100_0044669_1331_2074 246
542 3300048904 Ga0496101_0037134 Ga0496101_0037134_482_1225 246
543 3300048906 Ga0496103_0026300 Ga0496103_0026300_2740_3483 246
544 3300048907 Ga0496104_0313991 Ga0496104_0313991_412_1155 246
545 3300048909 Ga0496106_0024830 Ga0496106_0024830_2182_2925 246
546 3300048910 Ga0496107_0009837 Ga0496107_0009837_3380_4123 246
547 3300048910 Ga0496107_0021291 Ga0496107_0021291_1306_2049 246
548 3300048911 Ga0496108_0077986 Ga0496108_0077986_134_886 246
549 3300048911 Ga0496108_0614589 Ga0496108_0614589_135_878 246
550 3300048912 Ga0496109_0579218 Ga0496109_0579218_22_765 246
551 3300048913 Ga0496110_0010722 Ga0496110_0010722_2275_3018 246
552 3300048914 Ga0496111_0008768 Ga0496111_0008768_1869_2612 246
553 3300048915 Ga0496112_0022510 Ga0496112_0022510_4511_5254 246
554 3300048915 Ga0496112_0594331 Ga0496112_0594331_13_756 246
555 3300048916 Ga0496113_0012159 Ga0496113_0012159_4102_4845 246
556 3300048916 Ga0496113_0072787 Ga0496113_0072787_1155_1898 246
557 3300048917 Ga0496114_0000023 Ga0496114_0000023_4621_5364 246
558 3300061719 Ga0466962_0005633 Ga0466962_0005633_1488_2279 246
559 3300003320 rootH2_10090107 rootH2_100901072 247
560 3300005327 Ga0070658_10187855 Ga0070658_101878552 247
561 3300005327 Ga0070658_10292398 Ga0070658_102923982 247
562 3300005339 Ga0070660_100210217 Ga0070660_1002102172 247
563 3300005455 Ga0070663_100306295 Ga0070663_1003062952 247
564 3300005530 Ga0070679_100368923 Ga0070679_1003689231 247
565 3300005539 Ga0068853_100372928 Ga0068853_1003729282 247
566 3300005563 Ga0068855_100022028 Ga0068855_1000220287 247
567 3300005577 Ga0068857_100693776 Ga0068857_1006937761 247
568 3300005614 Ga0068856_100018907 Ga0068856_1000189077 247
569 3300005614 Ga0068856_100185294 Ga0068856_1001852943 247
570 3300005616 Ga0068852_100008660 Ga0068852_1000086607 247
571 3300005616 Ga0068852_100157005 Ga0068852_1001570052 247
572 3300006237 Ga0097621_100221665 Ga0097621_1002216652 247
573 3300006358 Ga0068871_100183413 Ga0068871_1001834132 247
574 3300009093 Ga0105240_10026853 Ga0105240_100268534 247
575 3300009174 Ga0105241_10028305 Ga0105241_100283053 247
576 3300009545 Ga0105237_10651303 Ga0105237_106513032 247
577 3300009551 Ga0105238_10222718 Ga0105238_102227182 247
578 3300013100 Ga0157373_10115430 Ga0157373_101154302 247
579 3300013102 Ga0157371_10009508 Ga0157371_100095083 247
580 3300013102 Ga0157371_10182844 Ga0157371_101828442 247
581 3300013102 Ga0157371_10255308 Ga0157371_102553081 247
582 3300013104 Ga0157370_10205798 Ga0157370_102057982 247
583 3300013105 Ga0157369_10010903 Ga0157369_100109037 247
584 3300013105 Ga0157369_10019218 Ga0157369_100192183 247
585 3300013105 Ga0157369_10030814 Ga0157369_100308143 247
586 3300013307 Ga0157372_10249107 Ga0157372_102491072 247
587 3300025904 Ga0207647_10005869 Ga0207647_100058692 247
588 3300025909 Ga0207705_10180886 Ga0207705_101808862 247
589 3300025909 Ga0207705_10337715 Ga0207705_103377152 247
590 3300025913 Ga0207695_10079062 Ga0207695_100790622 247
591 3300025914 Ga0207671_10609395 Ga0207671_106093951 247
592 3300025920 Ga0207649_10150934 Ga0207649_101509342 247
593 3300025920 Ga0207649_10176498 Ga0207649_101764982 247
594 3300025920 Ga0207649_10180646 Ga0207649_101806462 247
595 3300025921 Ga0207652_10186638 Ga0207652_101866382 247
596 3300025929 Ga0207664_10327633 Ga0207664_103276332 247
597 3300025932 Ga0207690_10007360 Ga0207690_100073604 247
598 3300025944 Ga0207661_10164447 Ga0207661_101644472 247
599 3300025949 Ga0207667_10016106 Ga0207667_100161064 247
600 3300025949 Ga0207667_10023916 Ga0207667_100239165 247
601 3300026041 Ga0207639_10292306 Ga0207639_102923062 247
602 3300026067 Ga0207678_10015800 Ga0207678_100158002 247
603 3300026078 Ga0207702_10023767 Ga0207702_100237675 247
604 3300026078 Ga0207702_10050366 Ga0207702_100503663 247
605 3300026116 Ga0207674_10141143 Ga0207674_101411433 247
606 3300026142 Ga0207698_10002441 Ga0207698_100024412 247
607 3300026142 Ga0207698_10031198 Ga0207698_100311982 247
608 3300037312 Ga0395899_0000882 Ga0395899_0000882_4402_5148 247
609 3300037312 Ga0395899_0054528 Ga0395899_0054528_515_1261 247
610 3300037418 Ga0395900_0005773 Ga0395900_0005773_5251_5997 247
611 3300037418 Ga0395900_0039974 Ga0395900_0039974_3484_4230 247
612 3300037418 Ga0395900_0050304 Ga0395900_0050304_259_1005 247
613 3300037418 Ga0395900_0063446 Ga0395900_0063446_2509_3255 247
614 3300037418 Ga0395900_0309720 Ga0395900_0309720_516_1262 247
615 3300037418 Ga0395900_0337528 Ga0395900_0337528_307_1053 247
616 3300037466 Ga0395898_0033555 Ga0395898_0033555_933_1679 247
617 3300037466 Ga0395898_0112804 Ga0395898_0112804_516_1262 247
618 3300037466 Ga0395898_0343629 Ga0395898_0343629_103_849 247
619 3300037471 Ga0395905_0001939 Ga0395905_0001939_7812_8558 247
620 3300037471 Ga0395905_0075369 Ga0395905_0075369_858_1604 247
621 3300037471 Ga0395905_0130282 Ga0395905_0130282_1219_1965 247
622 3300038443 Ga0395901_0032252 Ga0395901_0032252_382_1128 247
623 3300038443 Ga0395901_0470586 Ga0395901_0470586_70_816 247
624 3300044684 Ga0466966_0000004 Ga0466966_0000004_105300_106088 247
625 3300044694 Ga0466963_0030580 Ga0466963_0030580_2183_2929 247
626 3300044694 Ga0466963_0109802 Ga0466963_0109802_1090_1836 247
627 3300044842 Ga0466957_0013181 Ga0466957_0013181_1134_1880 247
628 3300045836 Ga0466958_0009788 Ga0466958_0009788_4158_4904 247
629 3300045976 Ga0466967_0057230 Ga0466967_0057230_2252_2998 247
630 3300045976 Ga0466967_0078038 Ga0466967_0078038_1240_1986 247
631 3300045976 Ga0466967_0183938 Ga0466967_0183938_1192_1938 247
632 3300061719 Ga0466962_0009471 Ga0466962_0009471_2646_3392 247
633 3300003323 rootH1_10130588 rootH1_101305883 248
634 3300005327 Ga0070658_10062801 Ga0070658_100628012 248
635 3300005327 Ga0070658_10225842 Ga0070658_102258422 248
636 3300005329 Ga0070683_100056411 Ga0070683_1000564112 248
637 3300005329 Ga0070683_100623650 Ga0070683_1006236501 248
638 3300005331 Ga0070670_100000213 Ga0070670_10000021313 248
639 3300005337 Ga0070682_100023811 Ga0070682_1000238113 248
640 3300005339 Ga0070660_100001805 Ga0070660_1000018052 248
641 3300005339 Ga0070660_100358027 Ga0070660_1003580271 248
642 3300005344 Ga0070661_100025335 Ga0070661_1000253355 248
643 3300005345 Ga0070692_10059321 Ga0070692_100593212 248
644 3300005347 Ga0070668_100000049 Ga0070668_10000004936 248
645 3300005355 Ga0070671_100000805 Ga0070671_10000080512 248
646 3300005355 Ga0070671_100005071 Ga0070671_1000050713 248
647 3300005366 Ga0070659_100419726 Ga0070659_1004197261 248
648 3300005367 Ga0070667_100000009 Ga0070667_10000000940 248
649 3300005455 Ga0070663_100023044 Ga0070663_1000230441 248
650 3300005455 Ga0070663_100094545 Ga0070663_1000945452 248
651 3300005455 Ga0070663_100151640 Ga0070663_1001516402 248
652 3300005457 Ga0070662_100052452 Ga0070662_1000524523 248
653 3300005530 Ga0070679_100369671 Ga0070679_1003696712 248
654 3300005530 Ga0070679_100765498 Ga0070679_1007654981 248
655 3300005535 Ga0070684_100016175 Ga0070684_1000161752 248
656 3300005539 Ga0068853_100098468 Ga0068853_1000984682 248
657 3300005543 Ga0070672_100058682 Ga0070672_1000586822 248
658 3300005548 Ga0070665_100430137 Ga0070665_1004301372 248
659 3300005563 Ga0068855_100234167 Ga0068855_1002341672 248
660 3300005564 Ga0070664_100009887 Ga0070664_1000098872 248
661 3300005564 Ga0070664_100556028 Ga0070664_1005560282 248
662 3300005577 Ga0068857_100003142 Ga0068857_10000314212 248
663 3300005577 Ga0068857_100010041 Ga0068857_1000100419 248
664 3300005616 Ga0068852_100266529 Ga0068852_1002665292 248
665 3300005618 Ga0068864_100001173 Ga0068864_1000011737 248
666 3300005719 Ga0068861_100298726 Ga0068861_1002987262 248
667 3300005841 Ga0068863_100008241 Ga0068863_1000082414 248
668 3300005841 Ga0068863_100166662 Ga0068863_1001666623 248
669 3300005842 Ga0068858_100001456 Ga0068858_10000145618 248
670 3300005843 Ga0068860_100000042 Ga0068860_100000042230 248
671 3300005844 Ga0068862_100000411 Ga0068862_1000004114 248
672 3300013102 Ga0157371_10056140 Ga0157371_100561401 248
673 3300013104 Ga0157370_10260897 Ga0157370_102608972 248
674 3300013105 Ga0157369_10105332 Ga0157369_101053323 248
675 3300013105 Ga0157369_10183847 Ga0157369_101838472 248
676 3300013306 Ga0163162_10367925 Ga0163162_103679253 248
677 3300013307 Ga0157372_10919588 Ga0157372_109195882 248
678 3300017792 Ga0163161_10044103 Ga0163161_100441034 248
679 3300020082 Ga0206353_10453333 Ga0206353_104533332 248
680 3300025904 Ga0207647_10056214 Ga0207647_100562142 248
681 3300025909 Ga0207705_10066087 Ga0207705_100660871 248
682 3300025917 Ga0207660_10009126 Ga0207660_100091264 248
683 3300025919 Ga0207657_10000919 Ga0207657_1000091930 248
684 3300025919 Ga0207657_10010417 Ga0207657_100104174 248
685 3300025920 Ga0207649_10056167 Ga0207649_100561672 248
686 3300025921 Ga0207652_10275526 Ga0207652_102755262 248
687 3300025925 Ga0207650_10000766 Ga0207650_1000076612 248
688 3300025931 Ga0207644_10000088 Ga0207644_1000008820 248
689 3300025932 Ga0207690_10221559 Ga0207690_102215592 248
690 3300025932 Ga0207690_10279827 Ga0207690_102798271 248
691 3300025933 Ga0207706_10006514 Ga0207706_100065147 248
692 3300025944 Ga0207661_10116791 Ga0207661_101167912 248
693 3300025945 Ga0207679_10197575 Ga0207679_101975752 248
694 3300025945 Ga0207679_10244565 Ga0207679_102445652 248
695 3300025972 Ga0207668_10000077 Ga0207668_1000007735 248
696 3300025981 Ga0207640_10133814 Ga0207640_101338142 248
697 3300025986 Ga0207658_10000009 Ga0207658_10000009227 248
698 3300026035 Ga0207703_10016173 Ga0207703_100161736 248
699 3300026067 Ga0207678_10020604 Ga0207678_100206042 248
700 3300026067 Ga0207678_10035640 Ga0207678_100356403 248
701 3300026067 Ga0207678_10044369 Ga0207678_100443693 248
702 3300026067 Ga0207678_10143419 Ga0207678_101434192 248
703 3300026088 Ga0207641_10006534 Ga0207641_100065343 248
704 3300026088 Ga0207641_10009145 Ga0207641_100091457 248
705 3300026089 Ga0207648_10153996 Ga0207648_101539962 248
706 3300026095 Ga0207676_10001713 Ga0207676_100017137 248
707 3300026116 Ga0207674_10005438 Ga0207674_1000543814 248
708 3300026118 Ga0207675_100236877 Ga0207675_1002368772 248
709 3300028379 Ga0268266_10404658 Ga0268266_104046582 248
710 3300028380 Ga0268265_10000580 Ga0268265_1000058011 248
711 3300028381 Ga0268264_10000001 Ga0268264_10000001304 248
712 3300037312 Ga0395899_0250156 Ga0395899_0250156_316_1071 248
713 3300037418 Ga0395900_0027226 Ga0395900_0027226_747_1496 248
714 3300037418 Ga0395900_0063453 Ga0395900_0063453_350_1099 248
715 3300037418 Ga0395900_0512470 Ga0395900_0512470_358_1113 248
716 3300037466 Ga0395898_0088371 Ga0395898_0088371_2156_2911 248
717 3300037466 Ga0395898_0210857 Ga0395898_0210857_326_1075 248
718 3300037466 Ga0395898_0543035 Ga0395898_0543035_248_1003 248
719 3300037471 Ga0395905_0002317 Ga0395905_0002317_1083_1832 248
720 3300037471 Ga0395905_0011151 Ga0395905_0011151_7887_8636 248
721 3300042876 Ga0451577_0008460 Ga0451577_0008460_585_1358 248
722 3300044684 Ga0466966_0054690 Ga0466966_0054690_1357_2112 248
723 3300044694 Ga0466963_0031349 Ga0466963_0031349_1216_1968 248
724 3300044706 Ga0466964_0016774 Ga0466964_0016774_1900_2649 248
725 3300044712 Ga0453684_0000633 Ga0453684_0000633_40459_41232 248
726 3300044842 Ga0466957_0018520 Ga0466957_0018520_2164_2913 248
727 3300045049 Ga0466959_0012407 Ga0466959_0012407_1283_2044 248
728 3300045049 Ga0466959_0014602 Ga0466959_0014602_2715_3470 248
729 3300045836 Ga0466958_0024679 Ga0466958_0024679_1687_2442 248
730 3300045976 Ga0466967_0090910 Ga0466967_0090910_1871_2620 248
731 3300045976 Ga0466967_0187537 Ga0466967_0187537_376_1125 248
732 3300048911 Ga0496108_0085594 Ga0496108_0085594_995_1801 248
733 3300048915 Ga0496112_0020028 Ga0496112_0020028_2439_3206 248
734 3300005617 Ga0068859_100091431 Ga0068859_1000914313 249
735 3300005841 Ga0068863_100300258 Ga0068863_1003002582 249
736 3300005844 Ga0068862_100003765 Ga0068862_1000037658 249
737 3300006931 Ga0097620_100091431 Ga0097620_1000914312 249
738 3300009177 Ga0105248_10134256 Ga0105248_101342562 249
739 3300026088 Ga0207641_10098972 Ga0207641_100989723 249
740 3300026142 Ga0207698_10085639 Ga0207698_100856393 249
741 3300028380 Ga0268265_10002838 Ga0268265_100028384 249
742 3300002459 JGI24751J29686_10000087 JGI24751J29686_1000008725 250
743 3300005331 Ga0070670_100000060 Ga0070670_10000006042 250
744 3300005347 Ga0070668_100064670 Ga0070668_1000646702 250
745 3300005353 Ga0070669_100000053 Ga0070669_10000005374 250
746 3300005367 Ga0070667_100012743 Ga0070667_1000127434 250
747 3300005577 Ga0068857_100348004 Ga0068857_1003480042 250
748 3300005617 Ga0068859_100033975 Ga0068859_1000339754 250
749 3300005618 Ga0068864_100000069 Ga0068864_10000006974 250
750 3300005719 Ga0068861_100250695 Ga0068861_1002506952 250
751 3300005844 Ga0068862_100000082 Ga0068862_10000008242 250
752 3300006931 Ga0097620_100033976 Ga0097620_1000339762 250
753 3300009177 Ga0105248_10000101 Ga0105248_1000010155 250
754 3300014325 Ga0163163_10040675 Ga0163163_100406752 250
755 3300014326 Ga0157380_10000964 Ga0157380_1000096420 250
756 3300017792 Ga0163161_10059933 Ga0163161_100599332 250
757 3300025923 Ga0207681_10000003 Ga0207681_10000003478 250
758 3300025925 Ga0207650_10000148 Ga0207650_1000014845 250
759 3300025972 Ga0207668_10028445 Ga0207668_100284452 250
760 3300025986 Ga0207658_10008532 Ga0207658_100085324 250
761 3300026095 Ga0207676_10000009 Ga0207676_10000009480 250
762 3300026116 Ga0207674_10350435 Ga0207674_103504352 250
763 3300026118 Ga0207675_100000162 Ga0207675_10000016256 250
764 3300028380 Ga0268265_10000030 Ga0268265_10000030130 250
765 2162886007 SwRhRL2b_contig_1843357 SwRhRL2b_0521.00005630 252
766 3300025298 Ga0209050_1000605 Ga0209050_100060523 252
767 3300046500 Ga0495596_0001388 Ga0495596_0001388_5933_6700 252
768 3300046507 Ga0495606_0017189 Ga0495606_0017189_3122_3889 252
769 3300046512 Ga0495610_0000795 Ga0495610_0000795_22937_23704 252
770 3300047472 Ga0495686_0000623 Ga0495686_0000623_33759_34556 252
771 3300048091 Ga0495626_0000477 Ga0495626_0000477_32787_33554 252
772 3300048919 Ga0496116_0000248 Ga0496116_0000248_45418_46176 252
773 3300048920 Ga0496117_0048754 Ga0496117_0048754_556_1314 252
774 3300048921 Ga0496118_0017871 Ga0496118_0017871_2199_2957 252
775 3300048922 Ga0496119_0044232 Ga0496119_0044232_112_909 252
776 3300048924 Ga0496121_0002179 Ga0496121_0002179_16113_17048 252
777 3300048925 Ga0496122_0002452 Ga0496122_0002452_4554_5312 252
778 3300048927 Ga0496124_0001327 Ga0496124_0001327_367_1302 252
779 3300048927 Ga0496124_0025896 Ga0496124_0025896_2084_2842 252
780 3300048928 Ga0496125_0005948 Ga0496125_0005948_738_1496 252
781 3300048929 Ga0496126_0000097 Ga0496126_0000097_65875_66633 252
782 3300049570 Ga0501033_0009198 Ga0501033_0009198_4869_5666 252
783 3300049579 Ga0501043_0011919 Ga0501043_0011919_3667_4464 252
784 3300049823 Ga0501044_0016660 Ga0501044_0016660_5788_6585 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10096

DUF2334

Uncharacterized protein conserved in bacteria (DUF2334)

22

189

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.7927 4 248
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.7924 4 248
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.7767 8 247
8hf9-assembly1.cif.gz_A the structure of chitin deacetylase pst_13661 from puccinia striiformis f. sp. tritici 0.7652 6 251
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.7646 4 248
ID Description Score Start End Superfamily
af_P71837_4_164_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8441 17 180 3.20.20.370
af_Q57928_23_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8056 8 237 3.20.20.370
af_P71837_4_164_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7662 17 180 3.20.20.370
2iw0A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7603 5 251 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7583 7 248 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A520DPP0-F1-model_v4 deleted 0.9795 8 235
AF-A0A7W0BRA9-F1-model_v4 deleted 0.9788 8 249
AF-A0A2A2K113-F1-model_v4 NodB homology domain-containing protein 0.9782 43 247 GO:0005975
AF-A0A1E4K613-F1-model_v4 DUF2334 domain-containing protein 0.9716 6 246 GO:0005975
AF-A0A520DPP0-F1-model_v4 deleted 0.9709 8 235

Feature Viewer

pLDDT pTM Quality
90.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map