F480648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 238 | 783 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100091124|Ga0070670_1000911242 |
| Length | 152 |
| Sequence | MRRRLIVALGILALAACDDGAQQQTNQPTIKVRGTEQNQLHTLNAMNLSIALKHAIYDAGYTCKRITDAGFVAYYQNLDMWAAHCEYDKGASRDWAIFAGPDGSAQVRDCKDIVGTGVPACAITKRPKGSFGNPPSGAEAPSDGAKTDTNLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 232 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 237 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 7.02 |
| Rhizosphere | 92.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1012998 | 3300001915 | Bacteria | 1419 |
| 2 | JGI24741J21665_1018528 | 3300001915 | Unclassified | 1112 |
| 3 | JGI24740J21852_10004688 | 3300001979 | Bacteria | 5857 |
| 4 | JGI24740J21852_10008945 | 3300001979 | Bacteria | 3955 |
| 5 | JGI24740J21852_10026117 | 3300001979 | Bacteria | 1960 |
| 6 | JGI24739J22299_10004473 | 3300001989 | Bacteria | 5351 |
| 7 | JGI24739J22299_10014393 | 3300001989 | Bacteria | 2878 |
| 8 | JGI24737J22298_10000655 | 3300001990 | Bacteria | 12249 |
| 9 | JGI24737J22298_10000987 | 3300001990 | Bacteria | 10119 |
| 10 | JGI24737J22298_10056357 | 3300001990 | Bacteria | 1187 |
| 11 | JGI24743J22301_10048885 | 3300001991 | Bacteria | 859 |
| 12 | JGI24735J21928_10057368 | 3300002067 | Unclassified | 1121 |
| 13 | JGI24735J21928_10058798 | 3300002067 | Bacteria | 1106 |
| 14 | JGI24738J21930_10000812 | 3300002075 | Bacteria | 8970 |
| 15 | JGI24738J21930_10070799 | 3300002075 | Bacteria | 722 |
| 16 | Ga0065712_10211573 | 3300005290 | Unclassified | 1071 |
| 17 | Ga0070658_10000269 | 3300005327 | Bacteria | 45712 |
| 18 | Ga0070658_10007111 | 3300005327 | Bacteria | 9035 |
| 19 | Ga0070658_10016356 | 3300005327 | Bacteria | 5937 |
| 20 | Ga0070658_10020842 | 3300005327 | Bacteria | 5252 |
| 21 | Ga0070658_10026585 | 3300005327 | Bacteria | 4643 |
| 22 | Ga0070658_10706906 | 3300005327 | Bacteria | 875 |
| 23 | Ga0070676_10008701 | 3300005328 | Bacteria | 5477 |
| 24 | Ga0070676_10034995 | 3300005328 | Bacteria | 2886 |
| 25 | Ga0070676_10077479 | 3300005328 | Bacteria | 2009 |
| 26 | Ga0070676_10649335 | 3300005328 | Bacteria | 766 |
| 27 | Ga0070683_100001138 | 3300005329 | Bacteria | 20116 |
| 28 | Ga0070683_100007370 | 3300005329 | Bacteria | 9295 |
| 29 | Ga0070683_100361267 | 3300005329 | Bacteria | 1383 |
| 30 | Ga0070683_101090397 | 3300005329 | Bacteria | 767 |
| 31 | Ga0070690_100060826 | 3300005330 | Bacteria | 2432 |
| 32 | Ga0070690_100137193 | 3300005330 | Bacteria | 1657 |
| 33 | Ga0070690_100657645 | 3300005330 | Bacteria | 801 |
| 34 | Ga0070670_100028324 | 3300005331 | Bacteria | 4821 |
| 35 | Ga0070670_100030482 | 3300005331 | Bacteria | 4645 |
| 36 | Ga0070670_100073467 | 3300005331 | Bacteria | 2937 |
| 37 | Ga0070670_100091124 | 3300005331 | Bacteria | 2620 |
| 38 | Ga0070670_100159061 | 3300005331 | Bacteria | 1957 |
| 39 | Ga0070670_100175633 | 3300005331 | Bacteria | 1859 |
| 40 | Ga0070670_100325843 | 3300005331 | Bacteria | 1346 |
| 41 | Ga0070670_100438894 | 3300005331 | Bacteria | 1156 |
| 42 | Ga0070670_101516190 | 3300005331 | Bacteria | 616 |
| 43 | Ga0070670_102008472 | 3300005331 | Unclassified | 533 |
| 44 | Ga0070677_10592280 | 3300005333 | Bacteria | 613 |
| 45 | Ga0068869_100318459 | 3300005334 | Bacteria | 1261 |
| 46 | Ga0068869_100653340 | 3300005334 | Bacteria | 893 |
| 47 | Ga0070666_10000330 | 3300005335 | Bacteria | 29917 |
| 48 | Ga0070666_10007668 | 3300005335 | Bacteria | 6663 |
| 49 | Ga0070666_10032086 | 3300005335 | Bacteria | 3469 |
| 50 | Ga0070666_10193411 | 3300005335 | Unclassified | 1430 |
| 51 | Ga0070666_10208281 | 3300005335 | Bacteria | 1376 |
| 52 | Ga0070680_100007182 | 3300005336 | Bacteria | 8490 |
| 53 | Ga0070680_100217441 | 3300005336 | Bacteria | 1612 |
| 54 | Ga0070682_100230895 | 3300005337 | Bacteria | 1322 |
| 55 | Ga0068868_100024884 | 3300005338 | Bacteria | 4546 |
| 56 | Ga0068868_100147000 | 3300005338 | Bacteria | 1939 |
| 57 | Ga0068868_100157935 | 3300005338 | Bacteria | 1871 |
| 58 | Ga0068868_100207917 | 3300005338 | Bacteria | 1634 |
| 59 | Ga0068868_100454913 | 3300005338 | Bacteria | 1114 |
| 60 | Ga0070660_100000109 | 3300005339 | Bacteria | 50964 |
| 61 | Ga0070660_100000339 | 3300005339 | Bacteria | 31090 |
| 62 | Ga0070660_100003053 | 3300005339 | Bacteria | 11523 |
| 63 | Ga0070660_100015001 | 3300005339 | Bacteria | 5588 |
| 64 | Ga0070660_100107887 | 3300005339 | Bacteria | 2213 |
| 65 | Ga0070660_100582750 | 3300005339 | Bacteria | 934 |
| 66 | Ga0070660_101684040 | 3300005339 | Bacteria | 540 |
| 67 | Ga0070687_100091225 | 3300005343 | Bacteria | 1686 |
| 68 | Ga0070687_100190983 | 3300005343 | Bacteria | 1234 |
| 69 | Ga0070661_100000070 | 3300005344 | Bacteria | 82818 |
| 70 | Ga0070661_100011611 | 3300005344 | Bacteria | 6139 |
| 71 | Ga0070661_100023710 | 3300005344 | Bacteria | 4400 |
| 72 | Ga0070661_100034939 | 3300005344 | Bacteria | 3648 |
| 73 | Ga0070661_100118743 | 3300005344 | Bacteria | 1979 |
| 74 | Ga0070661_100325891 | 3300005344 | Bacteria | 1200 |
| 75 | Ga0070692_10008029 | 3300005345 | Bacteria | 4685 |
| 76 | Ga0070692_10011894 | 3300005345 | Bacteria | 4013 |
| 77 | Ga0070668_100019581 | 3300005347 | Bacteria | 5094 |
| 78 | Ga0070668_100058980 | 3300005347 | Bacteria | 2970 |
| 79 | Ga0070668_100489744 | 3300005347 | Bacteria | 1063 |
| 80 | Ga0070668_100544512 | 3300005347 | Bacteria | 1009 |
| 81 | Ga0070668_101483319 | 3300005347 | Unclassified | 620 |
| 82 | Ga0070669_100140030 | 3300005353 | Bacteria | 1864 |
| 83 | Ga0070669_100185501 | 3300005353 | Bacteria | 1630 |
| 84 | Ga0070669_100256674 | 3300005353 | Bacteria | 1393 |
| 85 | Ga0070669_100269297 | 3300005353 | Bacteria | 1361 |
| 86 | Ga0070669_101285535 | 3300005353 | Bacteria | 633 |
| 87 | Ga0070675_100140457 | 3300005354 | Bacteria | 2064 |
| 88 | Ga0070675_100355003 | 3300005354 | Bacteria | 1301 |
| 89 | Ga0070675_100973275 | 3300005354 | Unclassified | 779 |
| 90 | Ga0070671_100016707 | 3300005355 | Bacteria | 5934 |
| 91 | Ga0070671_100026341 | 3300005355 | Bacteria | 4778 |
| 92 | Ga0070671_100081281 | 3300005355 | Bacteria | 2710 |
| 93 | Ga0070671_100151912 | 3300005355 | Bacteria | 1955 |
| 94 | Ga0070671_100196846 | 3300005355 | Bacteria | 1708 |
| 95 | Ga0070671_100599972 | 3300005355 | Unclassified | 951 |
| 96 | Ga0070671_100717777 | 3300005355 | Bacteria | 868 |
| 97 | Ga0070674_100044481 | 3300005356 | Bacteria | 3027 |
| 98 | Ga0070674_100111426 | 3300005356 | Bacteria | 2010 |
| 99 | Ga0070674_100269077 | 3300005356 | Bacteria | 1346 |
| 100 | Ga0070673_100008589 | 3300005364 | Bacteria | 6801 |
| 101 | Ga0070673_100029719 | 3300005364 | Bacteria | 4078 |
| 102 | Ga0070673_100029963 | 3300005364 | Bacteria | 4065 |
| 103 | Ga0070673_100068180 | 3300005364 | Bacteria | 2848 |
| 104 | Ga0070673_100072882 | 3300005364 | Bacteria | 2763 |
| 105 | Ga0070673_100125407 | 3300005364 | Bacteria | 2148 |
| 106 | Ga0070673_100500918 | 3300005364 | Bacteria | 1098 |
| 107 | Ga0070688_100239974 | 3300005365 | Bacteria | 1286 |
| 108 | Ga0070659_100000312 | 3300005366 | Bacteria | 37872 |
| 109 | Ga0070659_100005147 | 3300005366 | Bacteria | 9376 |
| 110 | Ga0070659_100053970 | 3300005366 | Bacteria | 3165 |
| 111 | Ga0070659_100238704 | 3300005366 | Bacteria | 1503 |
| 112 | Ga0070659_100389646 | 3300005366 | Bacteria | 1175 |
| 113 | Ga0070659_101000084 | 3300005366 | Bacteria | 734 |
| 114 | Ga0070667_100003813 | 3300005367 | Bacteria | 12811 |
| 115 | Ga0070667_100008539 | 3300005367 | Bacteria | 8491 |
| 116 | Ga0070667_100031529 | 3300005367 | Bacteria | 4419 |
| 117 | Ga0070667_100036196 | 3300005367 | Bacteria | 4137 |
| 118 | Ga0070667_100042585 | 3300005367 | Bacteria | 3809 |
| 119 | Ga0070667_100081281 | 3300005367 | Bacteria | 2773 |
| 120 | Ga0070667_100243972 | 3300005367 | Bacteria | 1605 |
| 121 | Ga0070667_100264287 | 3300005367 | Bacteria | 1541 |
| 122 | Ga0070667_100462252 | 3300005367 | Bacteria | 1160 |
| 123 | Ga0070667_100521863 | 3300005367 | Bacteria | 1090 |
| 124 | Ga0070667_101026454 | 3300005367 | Bacteria | 770 |
| 125 | Ga0070714_100304477 | 3300005435 | Bacteria | 1487 |
| 126 | Ga0070694_100025638 | 3300005444 | Bacteria | 3814 |
| 127 | Ga0070663_100006534 | 3300005455 | Bacteria | 7022 |
| 128 | Ga0070663_100008493 | 3300005455 | Bacteria | 6320 |
| 129 | Ga0070663_100222806 | 3300005455 | Bacteria | 1481 |
| 130 | Ga0070663_100314442 | 3300005455 | Bacteria | 1257 |
| 131 | Ga0070663_100388540 | 3300005455 | Unclassified | 1138 |
| 132 | Ga0070663_100817736 | 3300005455 | Bacteria | 800 |
| 133 | Ga0070678_100001567 | 3300005456 | Bacteria | 12248 |
| 134 | Ga0070678_100008774 | 3300005456 | Bacteria | 6074 |
| 135 | Ga0070678_100160172 | 3300005456 | Bacteria | 1822 |
| 136 | Ga0070678_100271767 | 3300005456 | Bacteria | 1430 |
| 137 | Ga0070678_101070560 | 3300005456 | Bacteria | 743 |
| 138 | Ga0070678_101080991 | 3300005456 | Bacteria | 740 |
| 139 | Ga0070662_100000037 | 3300005457 | Bacteria | 76596 |
| 140 | Ga0070662_100009922 | 3300005457 | Bacteria | 6239 |
| 141 | Ga0070662_100031671 | 3300005457 | Bacteria | 3713 |
| 142 | Ga0070662_100318556 | 3300005457 | Bacteria | 1268 |
| 143 | Ga0070662_100805208 | 3300005457 | Unclassified | 799 |
| 144 | Ga0070681_10020408 | 3300005458 | Bacteria | 6641 |
| 145 | Ga0070681_10063111 | 3300005458 | Bacteria | 3677 |
| 146 | Ga0068867_100020121 | 3300005459 | Bacteria | 4756 |
| 147 | Ga0068867_100093557 | 3300005459 | Bacteria | 2285 |
| 148 | Ga0068867_100185971 | 3300005459 | Bacteria | 1654 |
| 149 | Ga0068867_100830755 | 3300005459 | Unclassified | 826 |
| 150 | Ga0070685_10057207 | 3300005466 | Bacteria | 2269 |
| 151 | Ga0070679_100015769 | 3300005530 | Bacteria | 7269 |
| 152 | Ga0070679_100211998 | 3300005530 | Bacteria | 1900 |
| 153 | Ga0070679_101042618 | 3300005530 | Bacteria | 762 |
| 154 | Ga0070684_100007613 | 3300005535 | Bacteria | 8441 |
| 155 | Ga0068853_100000309 | 3300005539 | Bacteria | 34282 |
| 156 | Ga0068853_100100007 | 3300005539 | Bacteria | 2563 |
| 157 | Ga0068853_101073267 | 3300005539 | Unclassified | 776 |
| 158 | Ga0068853_101579720 | 3300005539 | Bacteria | 635 |
| 159 | Ga0070672_100009584 | 3300005543 | Bacteria | 6681 |
| 160 | Ga0070672_100009843 | 3300005543 | Bacteria | 6608 |
| 161 | Ga0070672_100169136 | 3300005543 | Bacteria | 1817 |
| 162 | Ga0070672_100169185 | 3300005543 | Bacteria | 1816 |
| 163 | Ga0070686_100063234 | 3300005544 | Bacteria | 2397 |
| 164 | Ga0070686_100359814 | 3300005544 | Bacteria | 1096 |
| 165 | Ga0070695_100520689 | 3300005545 | Bacteria | 923 |
| 166 | Ga0070696_100137209 | 3300005546 | Bacteria | 1784 |
| 167 | Ga0070696_100804678 | 3300005546 | Bacteria | 774 |
| 168 | Ga0070693_100003397 | 3300005547 | Bacteria | 7412 |
| 169 | Ga0070693_100120838 | 3300005547 | Bacteria | 1624 |
| 170 | Ga0070665_100002925 | 3300005548 | Bacteria | 18444 |
| 171 | Ga0070665_100049719 | 3300005548 | Bacteria | 4207 |
| 172 | Ga0070665_100095470 | 3300005548 | Bacteria | 2978 |
| 173 | Ga0070665_100105865 | 3300005548 | Bacteria | 2815 |
| 174 | Ga0070665_100124803 | 3300005548 | Bacteria | 2576 |
| 175 | Ga0070665_100159377 | 3300005548 | Bacteria | 2258 |
| 176 | Ga0070704_101078266 | 3300005549 | Unclassified | 729 |
| 177 | Ga0068855_100000247 | 3300005563 | Bacteria | 68071 |
| 178 | Ga0068855_100024916 | 3300005563 | Bacteria | 7158 |
| 179 | Ga0068855_100037585 | 3300005563 | Bacteria | 5757 |
| 180 | Ga0068855_100070606 | 3300005563 | Bacteria | 4063 |
| 181 | Ga0068855_100082525 | 3300005563 | Bacteria | 3725 |
| 182 | Ga0068855_100764707 | 3300005563 | Bacteria | 1029 |
| 183 | Ga0068855_101203595 | 3300005563 | Bacteria | 788 |
| 184 | Ga0068855_101283533 | 3300005563 | Unclassified | 758 |
| 185 | Ga0070664_100000077 | 3300005564 | Bacteria | 62053 |
| 186 | Ga0070664_100003026 | 3300005564 | Bacteria | 13593 |
| 187 | Ga0070664_100129822 | 3300005564 | Bacteria | 2213 |
| 188 | Ga0070664_100158916 | 3300005564 | Bacteria | 1998 |
| 189 | Ga0068857_100020826 | 3300005577 | Bacteria | 5769 |
| 190 | Ga0068857_100022877 | 3300005577 | Bacteria | 5498 |
| 191 | Ga0068857_100252035 | 3300005577 | Bacteria | 1619 |
| 192 | Ga0068857_101034718 | 3300005577 | Unclassified | 791 |
| 193 | Ga0068854_100111101 | 3300005578 | Bacteria | 2068 |
| 194 | Ga0068854_100170997 | 3300005578 | Bacteria | 1691 |
| 195 | Ga0068854_100503140 | 3300005578 | Bacteria | 1021 |
| 196 | Ga0068856_100000444 | 3300005614 | Bacteria | 45674 |
| 197 | Ga0068856_100014742 | 3300005614 | Bacteria | 7544 |
| 198 | Ga0068856_100063582 | 3300005614 | Bacteria | 3646 |
| 199 | Ga0068856_100153077 | 3300005614 | Bacteria | 2315 |
| 200 | Ga0070702_100231833 | 3300005615 | Bacteria | 1241 |
| 201 | Ga0068852_100000350 | 3300005616 | Bacteria | 31032 |
| 202 | Ga0068852_100032451 | 3300005616 | Bacteria | 4324 |
| 203 | Ga0068852_100282041 | 3300005616 | Bacteria | 1602 |
| 204 | Ga0068852_100688902 | 3300005616 | Bacteria | 1031 |
| 205 | Ga0068859_100002392 | 3300005617 | Bacteria | 19100 |
| 206 | Ga0068859_100037850 | 3300005617 | Bacteria | 4841 |
| 207 | Ga0068859_100157169 | 3300005617 | Bacteria | 2351 |
| 208 | Ga0068859_100257758 | 3300005617 | Bacteria | 1835 |
| 209 | Ga0068859_101533935 | 3300005617 | Unclassified | 735 |
| 210 | Ga0068864_100001110 | 3300005618 | Bacteria | 22495 |
| 211 | Ga0068864_100002819 | 3300005618 | Bacteria | 14343 |
| 212 | Ga0068864_100022361 | 3300005618 | Bacteria | 5302 |
| 213 | Ga0068864_100040637 | 3300005618 | Bacteria | 3978 |
| 214 | Ga0068864_100510382 | 3300005618 | Bacteria | 1158 |
| 215 | Ga0068866_10005188 | 3300005718 | Bacteria | 5368 |
| 216 | Ga0068866_10067216 | 3300005718 | Bacteria | 1881 |
| 217 | Ga0068861_100397804 | 3300005719 | Bacteria | 1222 |
| 218 | Ga0068851_10006475 | 3300005834 | Bacteria | 5347 |
| 219 | Ga0068851_10018054 | 3300005834 | Bacteria | 3396 |
| 220 | Ga0068870_10049839 | 3300005840 | Bacteria | 2210 |
| 221 | Ga0068863_100001056 | 3300005841 | Bacteria | 27521 |
| 222 | Ga0068863_100022022 | 3300005841 | Bacteria | 6083 |
| 223 | Ga0068863_100064125 | 3300005841 | Bacteria | 3474 |
| 224 | Ga0068863_100079639 | 3300005841 | Bacteria | 3102 |
| 225 | Ga0068863_100588306 | 3300005841 | Bacteria | 1101 |
| 226 | Ga0068858_100002753 | 3300005842 | Bacteria | 17665 |
| 227 | Ga0068858_100003145 | 3300005842 | Bacteria | 16530 |
| 228 | Ga0068858_100020528 | 3300005842 | Bacteria | 6174 |
| 229 | Ga0068858_100055846 | 3300005842 | Bacteria | 3650 |
| 230 | Ga0068858_100115005 | 3300005842 | Bacteria | 2514 |
| 231 | Ga0068858_100864297 | 3300005842 | Bacteria | 884 |
| 232 | Ga0068860_100002768 | 3300005843 | Bacteria | 18241 |
| 233 | Ga0068860_100022372 | 3300005843 | Bacteria | 6116 |
| 234 | Ga0068860_100160812 | 3300005843 | Bacteria | 2165 |
| 235 | Ga0068860_100599134 | 3300005843 | Bacteria | 1107 |
| 236 | Ga0068860_100739500 | 3300005843 | Bacteria | 995 |
| 237 | Ga0068860_100850854 | 3300005843 | Unclassified | 927 |
| 238 | Ga0068862_100016753 | 3300005844 | Bacteria | 6101 |
| 239 | Ga0068862_100101524 | 3300005844 | Bacteria | 2517 |
| 240 | Ga0068862_100186233 | 3300005844 | Bacteria | 1865 |
| 241 | Ga0068862_100209588 | 3300005844 | Bacteria | 1760 |
| 242 | Ga0068862_100333344 | 3300005844 | Bacteria | 1403 |
| 243 | Ga0070717_10307576 | 3300006028 | Bacteria | 1410 |
| 244 | Ga0075362_10040870 | 3300006177 | Bacteria | 2043 |
| 245 | Ga0097621_100011209 | 3300006237 | Bacteria | 6600 |
| 246 | Ga0097621_100013030 | 3300006237 | Bacteria | 6181 |
| 247 | Ga0097621_100073298 | 3300006237 | Bacteria | 2834 |
| 248 | Ga0097621_100079858 | 3300006237 | Bacteria | 2720 |
| 249 | Ga0097621_100386946 | 3300006237 | Bacteria | 1250 |
| 250 | Ga0097621_100769015 | 3300006237 | Bacteria | 891 |
| 251 | Ga0068871_100005666 | 3300006358 | Bacteria | 8763 |
| 252 | Ga0068871_100149842 | 3300006358 | Bacteria | 1988 |
| 253 | Ga0068865_100001424 | 3300006881 | Bacteria | 13953 |
| 254 | Ga0068865_100555539 | 3300006881 | Bacteria | 965 |
| 255 | Ga0097620_100002392 | 3300006931 | Bacteria | 19100 |
| 256 | Ga0097620_100037851 | 3300006931 | Bacteria | 4841 |
| 257 | Ga0097620_100157174 | 3300006931 | Bacteria | 2351 |
| 258 | Ga0097620_100257750 | 3300006931 | Bacteria | 1835 |
| 259 | Ga0097620_101534009 | 3300006931 | Unclassified | 735 |
| 260 | Ga0105250_10020270 | 3300009092 | Bacteria | 2689 |
| 261 | Ga0105240_10122528 | 3300009093 | Bacteria | 3129 |
| 262 | Ga0111539_10687239 | 3300009094 | Bacteria | 1191 |
| 263 | Ga0105245_10019331 | 3300009098 | Bacteria | 5963 |
| 264 | Ga0105247_10136598 | 3300009101 | Bacteria | 1602 |
| 265 | Ga0105247_11578015 | 3300009101 | Bacteria | 538 |
| 266 | Ga0105243_10425369 | 3300009148 | Bacteria | 1240 |
| 267 | Ga0105243_10678028 | 3300009148 | Bacteria | 1002 |
| 268 | Ga0105241_10035146 | 3300009174 | Bacteria | 3769 |
| 269 | Ga0105241_12136009 | 3300009174 | Unclassified | 554 |
| 270 | Ga0105242_10002410 | 3300009176 | Bacteria | 14697 |
| 271 | Ga0105248_10000719 | 3300009177 | Bacteria | 37511 |
| 272 | Ga0105248_10001320 | 3300009177 | Bacteria | 27621 |
| 273 | Ga0105248_10034268 | 3300009177 | Bacteria | 5676 |
| 274 | Ga0105248_10034516 | 3300009177 | Bacteria | 5657 |
| 275 | Ga0105248_10044563 | 3300009177 | Bacteria | 4975 |
| 276 | Ga0105248_10197736 | 3300009177 | Bacteria | 2265 |
| 277 | Ga0105248_10444894 | 3300009177 | Bacteria | 1460 |
| 278 | Ga0105248_10610712 | 3300009177 | Bacteria | 1230 |
| 279 | Ga0105248_10760313 | 3300009177 | Bacteria | 1094 |
| 280 | Ga0105237_10099852 | 3300009545 | Bacteria | 2893 |
| 281 | Ga0105238_10105363 | 3300009551 | Bacteria | 2801 |
| 282 | Ga0105238_10238785 | 3300009551 | Bacteria | 1795 |
| 283 | Ga0105238_10284737 | 3300009551 | Bacteria | 1634 |
| 284 | Ga0105238_10923203 | 3300009551 | Bacteria | 892 |
| 285 | Ga0105249_10026474 | 3300009553 | Bacteria | 5226 |
| 286 | Ga0105249_10026708 | 3300009553 | Bacteria | 5205 |
| 287 | Ga0105249_10297614 | 3300009553 | Bacteria | 1617 |
| 288 | Ga0105249_10763485 | 3300009553 | Bacteria | 1029 |
| 289 | Ga0105239_10042112 | 3300010375 | Bacteria | 5004 |
| 290 | Ga0105239_10497957 | 3300010375 | Bacteria | 1385 |
| 291 | Ga0105246_10686742 | 3300011119 | Unclassified | 895 |
| 292 | Ga0157373_10093973 | 3300013100 | Bacteria | 2111 |
| 293 | Ga0157373_10104195 | 3300013100 | Bacteria | 1995 |
| 294 | Ga0157373_10239812 | 3300013100 | Bacteria | 1281 |
| 295 | Ga0157373_10699714 | 3300013100 | Bacteria | 743 |
| 296 | Ga0157371_10000624 | 3300013102 | Bacteria | 42051 |
| 297 | Ga0157371_10009369 | 3300013102 | Bacteria | 7713 |
| 298 | Ga0157371_10060886 | 3300013102 | Bacteria | 2676 |
| 299 | Ga0157371_10079776 | 3300013102 | Bacteria | 2318 |
| 300 | Ga0157371_10195695 | 3300013102 | Bacteria | 1448 |
| 301 | Ga0157371_10209660 | 3300013102 | Bacteria | 1398 |
| 302 | Ga0157370_10015768 | 3300013104 | Bacteria | 7669 |
| 303 | Ga0157370_10350312 | 3300013104 | Bacteria | 1361 |
| 304 | Ga0157369_10004619 | 3300013105 | Bacteria | 16188 |
| 305 | Ga0157369_10063577 | 3300013105 | Bacteria | 3975 |
| 306 | Ga0157369_10083232 | 3300013105 | Bacteria | 3423 |
| 307 | Ga0157369_10301563 | 3300013105 | Bacteria | 1666 |
| 308 | Ga0157369_10743491 | 3300013105 | Bacteria | 1009 |
| 309 | Ga0157374_10002253 | 3300013296 | Bacteria | 16246 |
| 310 | Ga0157374_10034433 | 3300013296 | Bacteria | 4626 |
| 311 | Ga0157374_10101337 | 3300013296 | Bacteria | 2761 |
| 312 | Ga0157374_10116923 | 3300013296 | Bacteria | 2570 |
| 313 | Ga0157374_10437965 | 3300013296 | Bacteria | 1307 |
| 314 | Ga0157378_10182112 | 3300013297 | Bacteria | 1977 |
| 315 | Ga0157378_11842491 | 3300013297 | Bacteria | 653 |
| 316 | Ga0163162_10021265 | 3300013306 | Bacteria | 6386 |
| 317 | Ga0163162_10088341 | 3300013306 | Bacteria | 3179 |
| 318 | Ga0163162_10154261 | 3300013306 | Bacteria | 2416 |
| 319 | Ga0163162_10460752 | 3300013306 | Bacteria | 1403 |
| 320 | Ga0157372_10143435 | 3300013307 | Bacteria | 2754 |
| 321 | Ga0157372_10506493 | 3300013307 | Bacteria | 1408 |
| 322 | Ga0157372_10571284 | 3300013307 | Bacteria | 1318 |
| 323 | Ga0157372_11304519 | 3300013307 | Bacteria | 838 |
| 324 | Ga0157372_12392102 | 3300013307 | Bacteria | 607 |
| 325 | Ga0157375_10004680 | 3300013308 | Bacteria | 11902 |
| 326 | Ga0157375_10377954 | 3300013308 | Bacteria | 1583 |
| 327 | Ga0157375_11198341 | 3300013308 | Bacteria | 891 |
| 328 | Ga0163163_10000123 | 3300014325 | Bacteria | 82366 |
| 329 | Ga0163163_10002706 | 3300014325 | Bacteria | 14968 |
| 330 | Ga0163163_10006151 | 3300014325 | Bacteria | 10461 |
| 331 | Ga0163163_10093474 | 3300014325 | Bacteria | 3024 |
| 332 | Ga0157377_10156987 | 3300014745 | Bacteria | 1411 |
| 333 | Ga0157377_10764551 | 3300014745 | Unclassified | 708 |
| 334 | Ga0157379_10003612 | 3300014968 | Bacteria | 13127 |
| 335 | Ga0157379_10013809 | 3300014968 | Bacteria | 7078 |
| 336 | Ga0157379_10028415 | 3300014968 | Bacteria | 4974 |
| 337 | Ga0157379_10148042 | 3300014968 | Bacteria | 2118 |
| 338 | Ga0157379_10271188 | 3300014968 | Bacteria | 1543 |
| 339 | Ga0157379_11834004 | 3300014968 | Unclassified | 596 |
| 340 | Ga0157376_10003882 | 3300014969 | Bacteria | 10338 |
| 341 | Ga0163161_10140702 | 3300017792 | Bacteria | 1827 |
| 342 | Ga0206355_1223371 | 3300020076 | Bacteria | 1228 |
| 343 | Ga0206353_10745816 | 3300020082 | Bacteria | 1192 |
| 344 | Ga0213876_10807115 | 3300021384 | Unclassified | 500 |
| 345 | Ga0207697_10020248 | 3300025315 | Bacteria | 2725 |
| 346 | Ga0207656_10051647 | 3300025321 | Bacteria | 1778 |
| 347 | Ga0207656_10088655 | 3300025321 | Bacteria | 1401 |
| 348 | Ga0207696_1014589 | 3300025711 | Bacteria | 2689 |
| 349 | Ga0207682_10222412 | 3300025893 | Bacteria | 873 |
| 350 | Ga0207642_10103059 | 3300025899 | Bacteria | 1437 |
| 351 | Ga0207642_10193347 | 3300025899 | Unclassified | 1118 |
| 352 | Ga0207688_10011556 | 3300025901 | Bacteria | 4804 |
| 353 | Ga0207688_10174628 | 3300025901 | Bacteria | 1279 |
| 354 | Ga0207688_10197216 | 3300025901 | Bacteria | 1206 |
| 355 | Ga0207680_10033482 | 3300025903 | Bacteria | 2931 |
| 356 | Ga0207680_10249074 | 3300025903 | Bacteria | 1227 |
| 357 | Ga0207680_10250498 | 3300025903 | Bacteria | 1223 |
| 358 | Ga0207680_10434187 | 3300025903 | Bacteria | 931 |
| 359 | Ga0207680_10471134 | 3300025903 | Bacteria | 893 |
| 360 | Ga0207647_10007743 | 3300025904 | Bacteria | 7735 |
| 361 | Ga0207647_10014655 | 3300025904 | Bacteria | 5401 |
| 362 | Ga0207647_10021670 | 3300025904 | Bacteria | 4285 |
| 363 | Ga0207647_10104745 | 3300025904 | Bacteria | 1676 |
| 364 | Ga0207647_10162018 | 3300025904 | Bacteria | 1304 |
| 365 | Ga0207647_10166710 | 3300025904 | Bacteria | 1284 |
| 366 | Ga0207699_11048191 | 3300025906 | Unclassified | 603 |
| 367 | Ga0207645_10008669 | 3300025907 | Bacteria | 7084 |
| 368 | Ga0207645_10060475 | 3300025907 | Bacteria | 2419 |
| 369 | Ga0207645_10187521 | 3300025907 | Bacteria | 1358 |
| 370 | Ga0207645_10417150 | 3300025907 | Bacteria | 904 |
| 371 | Ga0207643_10025687 | 3300025908 | Bacteria | 3257 |
| 372 | Ga0207705_10000082 | 3300025909 | Bacteria | 118194 |
| 373 | Ga0207705_10000086 | 3300025909 | Bacteria | 116132 |
| 374 | Ga0207705_10000493 | 3300025909 | Bacteria | 33656 |
| 375 | Ga0207705_10005027 | 3300025909 | Bacteria | 9920 |
| 376 | Ga0207705_10026022 | 3300025909 | Bacteria | 4175 |
| 377 | Ga0207705_10039003 | 3300025909 | Bacteria | 3403 |
| 378 | Ga0207705_10052448 | 3300025909 | Bacteria | 2936 |
| 379 | Ga0207705_10101837 | 3300025909 | Bacteria | 2113 |
| 380 | Ga0207654_10031984 | 3300025911 | Bacteria | 2902 |
| 381 | Ga0207654_10118589 | 3300025911 | Bacteria | 1658 |
| 382 | Ga0207654_10875007 | 3300025911 | Bacteria | 651 |
| 383 | Ga0207707_10025551 | 3300025912 | Bacteria | 5167 |
| 384 | Ga0207707_10087292 | 3300025912 | Bacteria | 2726 |
| 385 | Ga0207707_10343098 | 3300025912 | Bacteria | 1288 |
| 386 | Ga0207695_10736975 | 3300025913 | Bacteria | 866 |
| 387 | Ga0207693_10471338 | 3300025915 | Bacteria | 981 |
| 388 | Ga0207693_10654058 | 3300025915 | Unclassified | 816 |
| 389 | Ga0207660_10000770 | 3300025917 | Bacteria | 21320 |
| 390 | Ga0207660_10019326 | 3300025917 | Bacteria | 4552 |
| 391 | Ga0207662_10014872 | 3300025918 | Bacteria | 4372 |
| 392 | Ga0207662_10866349 | 3300025918 | Bacteria | 639 |
| 393 | Ga0207657_10000360 | 3300025919 | Bacteria | 48193 |
| 394 | Ga0207657_10001020 | 3300025919 | Bacteria | 29724 |
| 395 | Ga0207657_10001678 | 3300025919 | Bacteria | 23887 |
| 396 | Ga0207657_10002261 | 3300025919 | Bacteria | 20877 |
| 397 | Ga0207657_10011262 | 3300025919 | Bacteria | 8886 |
| 398 | Ga0207657_10022343 | 3300025919 | Bacteria | 5922 |
| 399 | Ga0207657_10023065 | 3300025919 | Bacteria | 5804 |
| 400 | Ga0207657_10026681 | 3300025919 | Bacteria | 5302 |
| 401 | Ga0207657_10140861 | 3300025919 | Bacteria | 1970 |
| 402 | Ga0207657_10524623 | 3300025919 | Unclassified | 927 |
| 403 | Ga0207649_10000420 | 3300025920 | Bacteria | 31171 |
| 404 | Ga0207649_10018705 | 3300025920 | Bacteria | 3946 |
| 405 | Ga0207649_10029155 | 3300025920 | Bacteria | 3257 |
| 406 | Ga0207649_10128035 | 3300025920 | Unclassified | 1721 |
| 407 | Ga0207649_10308980 | 3300025920 | Bacteria | 1158 |
| 408 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 409 | Ga0207652_10028676 | 3300025921 | Bacteria | 4647 |
| 410 | Ga0207652_10268136 | 3300025921 | Bacteria | 1540 |
| 411 | Ga0207681_10026545 | 3300025923 | Bacteria | 3736 |
| 412 | Ga0207681_10032261 | 3300025923 | Bacteria | 3428 |
| 413 | Ga0207681_11442421 | 3300025923 | Bacteria | 577 |
| 414 | Ga0207694_10123657 | 3300025924 | Bacteria | 2068 |
| 415 | Ga0207694_10174361 | 3300025924 | Bacteria | 1742 |
| 416 | Ga0207694_10425874 | 3300025924 | Bacteria | 1106 |
| 417 | Ga0207650_10017046 | 3300025925 | Bacteria | 5084 |
| 418 | Ga0207650_10032900 | 3300025925 | Bacteria | 3753 |
| 419 | Ga0207650_10093483 | 3300025925 | Bacteria | 2302 |
| 420 | Ga0207650_10110147 | 3300025925 | Bacteria | 2130 |
| 421 | Ga0207650_10112624 | 3300025925 | Bacteria | 2108 |
| 422 | Ga0207650_10278944 | 3300025925 | Bacteria | 1360 |
| 423 | Ga0207650_10457245 | 3300025925 | Bacteria | 1063 |
| 424 | Ga0207650_10460092 | 3300025925 | Unclassified | 1060 |
| 425 | Ga0207659_10083897 | 3300025926 | Bacteria | 2363 |
| 426 | Ga0207659_10157715 | 3300025926 | Bacteria | 1779 |
| 427 | Ga0207659_10434818 | 3300025926 | Bacteria | 1103 |
| 428 | Ga0207687_10414331 | 3300025927 | Bacteria | 1111 |
| 429 | Ga0207664_10854551 | 3300025929 | Bacteria | 818 |
| 430 | Ga0207644_10006312 | 3300025931 | Bacteria | 7718 |
| 431 | Ga0207644_10025723 | 3300025931 | Bacteria | 4048 |
| 432 | Ga0207644_10031105 | 3300025931 | Bacteria | 3717 |
| 433 | Ga0207644_10036457 | 3300025931 | Bacteria | 3453 |
| 434 | Ga0207644_10043002 | 3300025931 | Bacteria | 3204 |
| 435 | Ga0207644_10486112 | 3300025931 | Bacteria | 1017 |
| 436 | Ga0207644_11198259 | 3300025931 | Bacteria | 638 |
| 437 | Ga0207690_10000413 | 3300025932 | Bacteria | 27940 |
| 438 | Ga0207690_10042985 | 3300025932 | Bacteria | 2972 |
| 439 | Ga0207690_10053007 | 3300025932 | Bacteria | 2720 |
| 440 | Ga0207690_10099389 | 3300025932 | Bacteria | 2074 |
| 441 | Ga0207690_10120973 | 3300025932 | Bacteria | 1902 |
| 442 | Ga0207690_10140316 | 3300025932 | Bacteria | 1780 |
| 443 | Ga0207690_10471756 | 3300025932 | Unclassified | 1012 |
| 444 | Ga0207690_10588261 | 3300025932 | Bacteria | 907 |
| 445 | Ga0207690_10711457 | 3300025932 | Bacteria | 826 |
| 446 | Ga0207706_10000192 | 3300025933 | Bacteria | 68319 |
| 447 | Ga0207706_10006865 | 3300025933 | Bacteria | 10524 |
| 448 | Ga0207706_10007819 | 3300025933 | Bacteria | 9867 |
| 449 | Ga0207706_10016257 | 3300025933 | Bacteria | 6721 |
| 450 | Ga0207706_10020249 | 3300025933 | Bacteria | 5979 |
| 451 | Ga0207706_10132255 | 3300025933 | Bacteria | 2194 |
| 452 | Ga0207706_10317391 | 3300025933 | Bacteria | 1356 |
| 453 | Ga0207706_11214764 | 3300025933 | Bacteria | 626 |
| 454 | Ga0207686_10228229 | 3300025934 | Bacteria | 1348 |
| 455 | Ga0207709_10334038 | 3300025935 | Bacteria | 1138 |
| 456 | Ga0207709_10373253 | 3300025935 | Bacteria | 1083 |
| 457 | Ga0207709_10664277 | 3300025935 | Bacteria | 831 |
| 458 | Ga0207669_10290219 | 3300025937 | Bacteria | 1238 |
| 459 | Ga0207669_10954660 | 3300025937 | Bacteria | 719 |
| 460 | Ga0207704_10342826 | 3300025938 | Bacteria | 1160 |
| 461 | Ga0207691_10013134 | 3300025940 | Bacteria | 7928 |
| 462 | Ga0207691_10014251 | 3300025940 | Bacteria | 7584 |
| 463 | Ga0207691_10026469 | 3300025940 | Bacteria | 5441 |
| 464 | Ga0207691_10062014 | 3300025940 | Bacteria | 3394 |
| 465 | Ga0207691_10081216 | 3300025940 | Bacteria | 2914 |
| 466 | Ga0207711_10000869 | 3300025941 | Bacteria | 29230 |
| 467 | Ga0207711_10002038 | 3300025941 | Bacteria | 18270 |
| 468 | Ga0207711_10006956 | 3300025941 | Bacteria | 9493 |
| 469 | Ga0207711_10047302 | 3300025941 | Bacteria | 3677 |
| 470 | Ga0207711_10080903 | 3300025941 | Bacteria | 2838 |
| 471 | Ga0207711_10186107 | 3300025941 | Bacteria | 1890 |
| 472 | Ga0207711_10647918 | 3300025941 | Bacteria | 985 |
| 473 | Ga0207689_10024225 | 3300025942 | Bacteria | 5092 |
| 474 | Ga0207689_10033527 | 3300025942 | Bacteria | 4267 |
| 475 | Ga0207661_10002726 | 3300025944 | Bacteria | 12149 |
| 476 | Ga0207661_10028875 | 3300025944 | Bacteria | 4252 |
| 477 | Ga0207679_10000347 | 3300025945 | Bacteria | 33719 |
| 478 | Ga0207679_10001488 | 3300025945 | Bacteria | 14672 |
| 479 | Ga0207679_10025135 | 3300025945 | Bacteria | 4092 |
| 480 | Ga0207679_10031355 | 3300025945 | Bacteria | 3720 |
| 481 | Ga0207679_10051489 | 3300025945 | Bacteria | 3014 |
| 482 | Ga0207679_10426486 | 3300025945 | Bacteria | 1171 |
| 483 | Ga0207667_10000114 | 3300025949 | Bacteria | 128923 |
| 484 | Ga0207667_10000850 | 3300025949 | Bacteria | 39399 |
| 485 | Ga0207667_10069541 | 3300025949 | Bacteria | 3664 |
| 486 | Ga0207667_10094516 | 3300025949 | Bacteria | 3086 |
| 487 | Ga0207667_10095578 | 3300025949 | Bacteria | 3068 |
| 488 | Ga0207667_10364114 | 3300025949 | Bacteria | 1474 |
| 489 | Ga0207667_10475191 | 3300025949 | Bacteria | 1269 |
| 490 | Ga0207651_10008035 | 3300025960 | Bacteria | 5661 |
| 491 | Ga0207651_10009471 | 3300025960 | Bacteria | 5337 |
| 492 | Ga0207651_10282048 | 3300025960 | Bacteria | 1373 |
| 493 | Ga0207712_10003235 | 3300025961 | Bacteria | 10349 |
| 494 | Ga0207712_10058889 | 3300025961 | Bacteria | 2716 |
| 495 | Ga0207668_10000072 | 3300025972 | Bacteria | 77023 |
| 496 | Ga0207668_10033122 | 3300025972 | Bacteria | 3421 |
| 497 | Ga0207668_10160863 | 3300025972 | Bacteria | 1749 |
| 498 | Ga0207668_10648170 | 3300025972 | Bacteria | 924 |
| 499 | Ga0207640_10014591 | 3300025981 | Bacteria | 4527 |
| 500 | Ga0207640_10141564 | 3300025981 | Bacteria | 1754 |
| 501 | Ga0207640_10457633 | 3300025981 | Bacteria | 1053 |
| 502 | Ga0207640_10553422 | 3300025981 | Bacteria | 967 |
| 503 | Ga0207658_10009361 | 3300025986 | Bacteria | 6645 |
| 504 | Ga0207658_10015372 | 3300025986 | Bacteria | 5251 |
| 505 | Ga0207658_10021906 | 3300025986 | Bacteria | 4442 |
| 506 | Ga0207658_10022216 | 3300025986 | Bacteria | 4415 |
| 507 | Ga0207658_10026119 | 3300025986 | Bacteria | 4092 |
| 508 | Ga0207658_10096138 | 3300025986 | Bacteria | 2309 |
| 509 | Ga0207658_10107463 | 3300025986 | Bacteria | 2199 |
| 510 | Ga0207658_10177607 | 3300025986 | Bacteria | 1759 |
| 511 | Ga0207658_10188689 | 3300025986 | Bacteria | 1711 |
| 512 | Ga0207658_10453870 | 3300025986 | Bacteria | 1135 |
| 513 | Ga0207658_10785992 | 3300025986 | Bacteria | 863 |
| 514 | Ga0207677_10066798 | 3300026023 | Bacteria | 2516 |
| 515 | Ga0207677_10071281 | 3300026023 | Bacteria | 2452 |
| 516 | Ga0207677_10277365 | 3300026023 | Bacteria | 1374 |
| 517 | Ga0207677_10300752 | 3300026023 | Bacteria | 1325 |
| 518 | Ga0207703_10004152 | 3300026035 | Bacteria | 11945 |
| 519 | Ga0207703_10014313 | 3300026035 | Bacteria | 6188 |
| 520 | Ga0207703_10027296 | 3300026035 | Bacteria | 4496 |
| 521 | Ga0207703_10042738 | 3300026035 | Bacteria | 3636 |
| 522 | Ga0207703_10142454 | 3300026035 | Bacteria | 2082 |
| 523 | Ga0207703_11892354 | 3300026035 | Bacteria | 573 |
| 524 | Ga0207639_10000524 | 3300026041 | Bacteria | 26513 |
| 525 | Ga0207639_10029804 | 3300026041 | Bacteria | 3999 |
| 526 | Ga0207639_10318103 | 3300026041 | Bacteria | 1381 |
| 527 | Ga0207639_10334654 | 3300026041 | Bacteria | 1348 |
| 528 | Ga0207639_10381418 | 3300026041 | Bacteria | 1266 |
| 529 | Ga0207678_10004938 | 3300026067 | Bacteria | 11979 |
| 530 | Ga0207678_10010668 | 3300026067 | Bacteria | 8071 |
| 531 | Ga0207678_10011128 | 3300026067 | Bacteria | 7904 |
| 532 | Ga0207678_10051977 | 3300026067 | Bacteria | 3536 |
| 533 | Ga0207678_10876423 | 3300026067 | Bacteria | 793 |
| 534 | Ga0207678_11207644 | 3300026067 | Bacteria | 670 |
| 535 | Ga0207702_10001885 | 3300026078 | Bacteria | 20524 |
| 536 | Ga0207702_10022362 | 3300026078 | Bacteria | 5242 |
| 537 | Ga0207702_10054149 | 3300026078 | Bacteria | 3399 |
| 538 | Ga0207702_10211184 | 3300026078 | Bacteria | 1804 |
| 539 | Ga0207702_10368541 | 3300026078 | Bacteria | 1378 |
| 540 | Ga0207641_10001513 | 3300026088 | Bacteria | 22775 |
| 541 | Ga0207641_10064867 | 3300026088 | Bacteria | 3122 |
| 542 | Ga0207641_10112062 | 3300026088 | Bacteria | 2420 |
| 543 | Ga0207641_10540375 | 3300026088 | Bacteria | 1135 |
| 544 | Ga0207648_10002300 | 3300026089 | Bacteria | 20648 |
| 545 | Ga0207648_10020517 | 3300026089 | Bacteria | 5950 |
| 546 | Ga0207648_10118017 | 3300026089 | Bacteria | 2331 |
| 547 | Ga0207648_10303784 | 3300026089 | Bacteria | 1431 |
| 548 | Ga0207648_10831389 | 3300026089 | Unclassified | 861 |
| 549 | Ga0207676_10006150 | 3300026095 | Bacteria | 8475 |
| 550 | Ga0207676_10006185 | 3300026095 | Bacteria | 8457 |
| 551 | Ga0207676_10014327 | 3300026095 | Bacteria | 5703 |
| 552 | Ga0207674_10008897 | 3300026116 | Bacteria | 11545 |
| 553 | Ga0207674_10028194 | 3300026116 | Bacteria | 5930 |
| 554 | Ga0207674_10040219 | 3300026116 | Bacteria | 4845 |
| 555 | Ga0207674_10058545 | 3300026116 | Bacteria | 3902 |
| 556 | Ga0207674_10194371 | 3300026116 | Bacteria | 1979 |
| 557 | Ga0207674_10986198 | 3300026116 | Bacteria | 811 |
| 558 | Ga0207674_11311970 | 3300026116 | Bacteria | 693 |
| 559 | Ga0207675_100504457 | 3300026118 | Bacteria | 1205 |
| 560 | Ga0207683_10001629 | 3300026121 | Bacteria | 20121 |
| 561 | Ga0207683_10002763 | 3300026121 | Bacteria | 15335 |
| 562 | Ga0207683_10004970 | 3300026121 | Bacteria | 11437 |
| 563 | Ga0207683_10055134 | 3300026121 | Bacteria | 3486 |
| 564 | Ga0207683_10195399 | 3300026121 | Bacteria | 1838 |
| 565 | Ga0207698_10000542 | 3300026142 | Bacteria | 21912 |
| 566 | Ga0207698_10006707 | 3300026142 | Bacteria | 7194 |
| 567 | Ga0207698_10077733 | 3300026142 | Bacteria | 2662 |
| 568 | Ga0207698_10123193 | 3300026142 | Bacteria | 2199 |
| 569 | Ga0207698_10392822 | 3300026142 | Bacteria | 1323 |
| 570 | Ga0207698_10692656 | 3300026142 | Bacteria | 1013 |
| 571 | Ga0207698_11073888 | 3300026142 | Bacteria | 817 |
| 572 | Ga0207698_11222284 | 3300026142 | Bacteria | 765 |
| 573 | Ga0268266_10003812 | 3300028379 | Bacteria | 14751 |
| 574 | Ga0268266_10010764 | 3300028379 | Bacteria | 7970 |
| 575 | Ga0268266_10061473 | 3300028379 | Bacteria | 3240 |
| 576 | Ga0268266_10137169 | 3300028379 | Bacteria | 2192 |
| 577 | Ga0268266_10204869 | 3300028379 | Bacteria | 1807 |
| 578 | Ga0268265_10002655 | 3300028380 | Bacteria | 13268 |
| 579 | Ga0268265_10003724 | 3300028380 | Bacteria | 10841 |
| 580 | Ga0268265_10064979 | 3300028380 | Bacteria | 2813 |
| 581 | Ga0268265_10182703 | 3300028380 | Bacteria | 1803 |
| 582 | Ga0268265_10228207 | 3300028380 | Bacteria | 1634 |
| 583 | Ga0268265_10326296 | 3300028380 | Bacteria | 1392 |
| 584 | Ga0268264_10005781 | 3300028381 | Bacteria | 10486 |
| 585 | Ga0268264_10006884 | 3300028381 | Bacteria | 9541 |
| 586 | Ga0268264_10148778 | 3300028381 | Bacteria | 2097 |
| 587 | Ga0268264_10308887 | 3300028381 | Bacteria | 1491 |
| 588 | Ga0268264_10429415 | 3300028381 | Bacteria | 1276 |
| 589 | Ga0268264_10488669 | 3300028381 | Bacteria | 1199 |
| 590 | Ga0268264_10537805 | 3300028381 | Bacteria | 1144 |
| 591 | Ga0268264_10637035 | 3300028381 | Bacteria | 1054 |
| 592 | Ga0268264_10747498 | 3300028381 | Bacteria | 974 |
| 593 | Ga0268264_10812687 | 3300028381 | Unclassified | 934 |
| 594 | Ga0307513_10504345 | 3300031456 | Bacteria | 927 |
| 595 | Ga0307405_10082142 | 3300031731 | Bacteria | 2108 |
| 596 | Ga0307405_10162711 | 3300031731 | Bacteria | 1583 |
| 597 | Ga0307405_10370384 | 3300031731 | Bacteria | 1112 |
| 598 | Ga0307413_10002467 | 3300031824 | Bacteria | 7526 |
| 599 | Ga0307413_10010593 | 3300031824 | Bacteria | 4484 |
| 600 | Ga0307410_10011969 | 3300031852 | Bacteria | 4989 |
| 601 | Ga0307410_10227112 | 3300031852 | Bacteria | 1439 |
| 602 | Ga0307410_10246541 | 3300031852 | Bacteria | 1387 |
| 603 | Ga0307406_10181586 | 3300031901 | Bacteria | 1532 |
| 604 | Ga0307406_10782456 | 3300031901 | Unclassified | 804 |
| 605 | Ga0307407_10099736 | 3300031903 | Bacteria | 1800 |
| 606 | Ga0307407_10109914 | 3300031903 | Bacteria | 1728 |
| 607 | Ga0307407_10140567 | 3300031903 | Bacteria | 1557 |
| 608 | Ga0307407_11464884 | 3300031903 | Unclassified | 539 |
| 609 | Ga0307409_100021681 | 3300031995 | Bacteria | 4410 |
| 610 | Ga0307409_100230612 | 3300031995 | Bacteria | 1678 |
| 611 | Ga0307409_100568805 | 3300031995 | Bacteria | 1115 |
| 612 | Ga0307416_100608895 | 3300032002 | Bacteria | 1173 |
| 613 | Ga0307416_100631338 | 3300032002 | Unclassified | 1154 |
| 614 | Ga0307416_100968210 | 3300032002 | Unclassified | 953 |
| 615 | Ga0307416_101433404 | 3300032002 | Bacteria | 796 |
| 616 | Ga0307414_10009564 | 3300032004 | Bacteria | 5578 |
| 617 | Ga0307414_10792635 | 3300032004 | Bacteria | 864 |
| 618 | Ga0307411_10000475 | 3300032005 | Bacteria | 13954 |
| 619 | Ga0307411_10003128 | 3300032005 | Bacteria | 7586 |
| 620 | Ga0307411_11363681 | 3300032005 | Unclassified | 648 |
| 621 | Ga0307415_100129072 | 3300032126 | Bacteria | 1910 |
| 622 | Ga0307415_100141369 | 3300032126 | Bacteria | 1839 |
| 623 | Ga0307415_100575332 | 3300032126 | Bacteria | 998 |
| 624 | Ga0307415_101534432 | 3300032126 | Bacteria | 638 |
| 625 | Ga0373928_0014329 | 3300035084 | Bacteria | 1602 |
| 626 | Ga0373949_0303835 | 3300035090 | Unclassified | 507 |
| 627 | Ga0373952_0069710 | 3300035092 | Bacteria | 877 |
| 628 | Ga0373932_0128468 | 3300035112 | Bacteria | 852 |
| 629 | Ga0373939_0042642 | 3300035114 | Bacteria | 1373 |
| 630 | Ga0373946_0563239 | 3300035171 | Unclassified | 589 |
| 631 | Ga0373942_0095134 | 3300035207 | Bacteria | 903 |
| 632 | Ga0373961_0055104 | 3300035241 | Bacteria | 1190 |
| 633 | Ga0373931_0015417 | 3300035691 | Bacteria | 3748 |
| 634 | Ga0373931_0087294 | 3300035691 | Bacteria | 1732 |
| 635 | Ga0373935_0009711 | 3300035692 | Bacteria | 5761 |
| 636 | Ga0395899_0026489 | 3300037312 | Bacteria | 4375 |
| 637 | Ga0395899_0059381 | 3300037312 | Bacteria | 2819 |
| 638 | Ga0395899_0078830 | 3300037312 | Bacteria | 2400 |
| 639 | Ga0395899_0239317 | 3300037312 | Bacteria | 1250 |
| 640 | Ga0395899_0395108 | 3300037312 | Bacteria | 916 |
| 641 | Ga0395899_0996460 | 3300037312 | Unclassified | 505 |
| 642 | Ga0395900_0003085 | 3300037418 | Bacteria | 18103 |
| 643 | Ga0395900_0013504 | 3300037418 | Bacteria | 8346 |
| 644 | Ga0395900_0015910 | 3300037418 | Bacteria | 7663 |
| 645 | Ga0395900_0016429 | 3300037418 | Bacteria | 7547 |
| 646 | Ga0395900_0028185 | 3300037418 | Bacteria | 5752 |
| 647 | Ga0395900_0089079 | 3300037418 | Bacteria | 3172 |
| 648 | Ga0395900_0097007 | 3300037418 | Bacteria | 3029 |
| 649 | Ga0395900_0203772 | 3300037418 | Bacteria | 2000 |
| 650 | Ga0395900_0479947 | 3300037418 | Bacteria | 1196 |
| 651 | Ga0395900_0546808 | 3300037418 | Bacteria | 1103 |
| 652 | Ga0395900_0609207 | 3300037418 | Bacteria | 1032 |
| 653 | Ga0395898_0010465 | 3300037466 | Bacteria | 9695 |
| 654 | Ga0395898_0064367 | 3300037466 | Bacteria | 3556 |
| 655 | Ga0395898_0094728 | 3300037466 | Bacteria | 2869 |
| 656 | Ga0395898_0108973 | 3300037466 | Bacteria | 2655 |
| 657 | Ga0395898_0329791 | 3300037466 | Bacteria | 1455 |
| 658 | Ga0395898_0352082 | 3300037466 | Bacteria | 1404 |
| 659 | Ga0395898_0822954 | 3300037466 | Bacteria | 868 |
| 660 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 661 | Ga0395905_0001031 | 3300037471 | Bacteria | 35482 |
| 662 | Ga0395905_0028195 | 3300037471 | Bacteria | 5292 |
| 663 | Ga0395905_0079844 | 3300037471 | Bacteria | 3066 |
| 664 | Ga0395905_0139090 | 3300037471 | Bacteria | 2284 |
| 665 | Ga0395905_0370642 | 3300037471 | Bacteria | 1325 |
| 666 | Ga0395905_0380799 | 3300037471 | Bacteria | 1305 |
| 667 | Ga0395905_0564245 | 3300037471 | Bacteria | 1040 |
| 668 | Ga0395905_0738714 | 3300037471 | Bacteria | 886 |
| 669 | Ga0395905_1037366 | 3300037471 | Unclassified | 723 |
| 670 | Ga0395901_0001126 | 3300038443 | Bacteria | 28379 |
| 671 | Ga0395901_0044992 | 3300038443 | Bacteria | 4579 |
| 672 | Ga0395901_0165413 | 3300038443 | Bacteria | 2323 |
| 673 | Ga0395901_0170171 | 3300038443 | Bacteria | 2286 |
| 674 | Ga0395901_0247381 | 3300038443 | Bacteria | 1858 |
| 675 | Ga0395901_0525600 | 3300038443 | Bacteria | 1201 |
| 676 | Ga0395901_1974721 | 3300038443 | Bacteria | 530 |
| 677 | Ga0439449_0095892 | 3300042007 | Bacteria | 1096 |
| 678 | Ga0439458_0060151 | 3300042157 | Bacteria | 947 |
| 679 | Ga0439464_0000350 | 3300042439 | Bacteria | 8930 |
| 680 | Ga0466969_0084983 | 3300044656 | Bacteria | 1505 |
| 681 | Ga0466969_0174412 | 3300044656 | Bacteria | 985 |
| 682 | Ga0466966_0075412 | 3300044684 | Bacteria | 2107 |
| 683 | Ga0466966_0151438 | 3300044684 | Bacteria | 1414 |
| 684 | Ga0466961_0048228 | 3300044693 | Bacteria | 2722 |
| 685 | Ga0466963_0023693 | 3300044694 | Bacteria | 3901 |
| 686 | Ga0466963_0058368 | 3300044694 | Bacteria | 2573 |
| 687 | Ga0466971_0025392 | 3300044719 | Bacteria | 2646 |
| 688 | Ga0466957_0005582 | 3300044842 | Bacteria | 7066 |
| 689 | Ga0466957_0009431 | 3300044842 | Bacteria | 5573 |
| 690 | Ga0466960_0297462 | 3300044901 | Unclassified | 909 |
| 691 | Ga0466959_0026160 | 3300045049 | Bacteria | 4326 |
| 692 | Ga0466959_0176653 | 3300045049 | Bacteria | 1495 |
| 693 | Ga0466958_0032434 | 3300045836 | Bacteria | 3108 |
| 694 | Ga0466958_0104886 | 3300045836 | Bacteria | 1761 |
| 695 | Ga0466958_0468886 | 3300045836 | Bacteria | 816 |
| 696 | Ga0466967_0020997 | 3300045976 | Bacteria | 5290 |
| 697 | Ga0466967_0027514 | 3300045976 | Bacteria | 4732 |
| 698 | Ga0466967_0038382 | 3300045976 | Bacteria | 4107 |
| 699 | Ga0466967_0047665 | 3300045976 | Bacteria | 3736 |
| 700 | Ga0466967_0067578 | 3300045976 | Bacteria | 3188 |
| 701 | Ga0466967_0071901 | 3300045976 | Bacteria | 3098 |
| 702 | Ga0466967_0343418 | 3300045976 | Bacteria | 1444 |
| 703 | Ga0466967_1456446 | 3300045976 | Bacteria | 682 |
| 704 | Ga0495585_0120095 | 3300046492 | Bacteria | 1391 |
| 705 | Ga0495616_0134238 | 3300046513 | Bacteria | 1132 |
| 706 | Ga0495643_0393389 | 3300046522 | Unclassified | 613 |
| 707 | Ga0495642_0376421 | 3300046528 | Bacteria | 625 |
| 708 | Ga0495668_0050557 | 3300046616 | Bacteria | 2303 |
| 709 | Ga0495668_0578034 | 3300046616 | Bacteria | 620 |
| 710 | Ga0495669_0027869 | 3300046684 | Bacteria | 2471 |
| 711 | Ga0495669_0101523 | 3300046684 | Bacteria | 1336 |
| 712 | Ga0495669_0136343 | 3300046684 | Bacteria | 1157 |
| 713 | Ga0495669_0313169 | 3300046684 | Unclassified | 757 |
| 714 | Ga0495677_0047340 | 3300047445 | Bacteria | 1579 |
| 715 | Ga0495677_0243229 | 3300047445 | Bacteria | 703 |
| 716 | Ga0496100_0006995 | 3300048903 | Bacteria | 6188 |
| 717 | Ga0496100_0165871 | 3300048903 | Bacteria | 1587 |
| 718 | Ga0496100_0944117 | 3300048903 | Bacteria | 678 |
| 719 | Ga0496101_0088049 | 3300048904 | Bacteria | 2306 |
| 720 | Ga0496101_0118283 | 3300048904 | Bacteria | 2001 |
| 721 | Ga0496101_0124376 | 3300048904 | Bacteria | 1953 |
| 722 | Ga0496101_0189895 | 3300048904 | Bacteria | 1585 |
| 723 | Ga0496101_1447997 | 3300048904 | Bacteria | 535 |
| 724 | Ga0496102_0141200 | 3300048905 | Bacteria | 2258 |
| 725 | Ga0496102_0144054 | 3300048905 | Bacteria | 2235 |
| 726 | Ga0496103_0044232 | 3300048906 | Bacteria | 2743 |
| 727 | Ga0496104_0215519 | 3300048907 | Bacteria | 1831 |
| 728 | Ga0496104_0242889 | 3300048907 | Bacteria | 1713 |
| 729 | Ga0496104_0391196 | 3300048907 | Bacteria | 1302 |
| 730 | Ga0496105_0096247 | 3300048908 | Bacteria | 2445 |
| 731 | Ga0496105_0233726 | 3300048908 | Bacteria | 1493 |
| 732 | Ga0496105_0282734 | 3300048908 | Bacteria | 1337 |
| 733 | Ga0496106_0033452 | 3300048909 | Bacteria | 3836 |
| 734 | Ga0496106_0047950 | 3300048909 | Bacteria | 3216 |
| 735 | Ga0496106_0111285 | 3300048909 | Bacteria | 2132 |
| 736 | Ga0496107_0008263 | 3300048910 | Bacteria | 7203 |
| 737 | Ga0496107_0025841 | 3300048910 | Bacteria | 4160 |
| 738 | Ga0496107_0046907 | 3300048910 | Bacteria | 3110 |
| 739 | Ga0496107_0144468 | 3300048910 | Bacteria | 1759 |
| 740 | Ga0496107_0170668 | 3300048910 | Bacteria | 1614 |
| 741 | Ga0496107_0510113 | 3300048910 | Bacteria | 892 |
| 742 | Ga0496108_0009895 | 3300048911 | Bacteria | 7727 |
| 743 | Ga0496108_0038691 | 3300048911 | Bacteria | 3974 |
| 744 | Ga0496108_0040243 | 3300048911 | Bacteria | 3895 |
| 745 | Ga0496108_0148879 | 3300048911 | Bacteria | 2019 |
| 746 | Ga0496109_0119558 | 3300048912 | Bacteria | 2453 |
| 747 | Ga0496109_0145862 | 3300048912 | Bacteria | 2214 |
| 748 | Ga0496109_0202462 | 3300048912 | Bacteria | 1866 |
| 749 | Ga0496109_0725456 | 3300048912 | Bacteria | 932 |
| 750 | Ga0496110_0047002 | 3300048913 | Bacteria | 3777 |
| 751 | Ga0496110_0091427 | 3300048913 | Bacteria | 2722 |
| 752 | Ga0496110_0212783 | 3300048913 | Bacteria | 1757 |
| 753 | Ga0496110_0315668 | 3300048913 | Bacteria | 1423 |
| 754 | Ga0496110_1294800 | 3300048913 | Bacteria | 638 |
| 755 | Ga0496111_0007276 | 3300048914 | Bacteria | 7244 |
| 756 | Ga0496111_0140569 | 3300048914 | Bacteria | 1789 |
| 757 | Ga0496111_0148522 | 3300048914 | Bacteria | 1738 |
| 758 | Ga0496112_0057299 | 3300048915 | Bacteria | 3836 |
| 759 | Ga0496112_0058934 | 3300048915 | Bacteria | 3782 |
| 760 | Ga0496112_0109240 | 3300048915 | Bacteria | 2736 |
| 761 | Ga0496112_0117027 | 3300048915 | Bacteria | 2635 |
| 762 | Ga0496112_0172125 | 3300048915 | Bacteria | 2130 |
| 763 | Ga0496112_1012585 | 3300048915 | Bacteria | 750 |
| 764 | Ga0496113_0012024 | 3300048916 | Bacteria | 5804 |
| 765 | Ga0496113_0073323 | 3300048916 | Bacteria | 2608 |
| 766 | Ga0496113_0098386 | 3300048916 | Bacteria | 2264 |
| 767 | Ga0496113_0184825 | 3300048916 | Bacteria | 1653 |
| 768 | Ga0496113_1077842 | 3300048916 | Archaea | 631 |
| 769 | Ga0496114_0030533 | 3300048917 | Bacteria | 4434 |
| 770 | Ga0496115_0144384 | 3300048918 | Bacteria | 1964 |
| 771 | Ga0501067_0035435 | 3300049583 | Bacteria | 2771 |
| 772 | Ga0501069_0120442 | 3300049585 | Bacteria | 1499 |
| 773 | Ga0501070_0067070 | 3300049586 | Bacteria | 2972 |
| 774 | Ga0501070_0860643 | 3300049586 | Bacteria | 709 |
| 775 | Ga0501071_0093261 | 3300049587 | Bacteria | 2214 |
| 776 | Ga0501230_076047 | 3300049667 | Unclassified | 697 |
| 777 | Ga0501268_026444 | 3300049765 | Unclassified | 1026 |
| 778 | Ga0501270_009736 | 3300049767 | Unclassified | 1249 |
| 779 | nmdc:mga08y16_533163_c1 | 3300050511 | Bacteria | 1189 |
| 780 | nmdc:mga0n895_544974_c1 | 3300050512 | Unclassified | 1166 |
| 781 | Ga0500658_0000036 | 3300053134 | Bacteria | 85304 |
| 782 | Ga0587073_0086711 | 3300059492 | Bacteria | 788 |
| 783 | Ga0587071_022250 | 3300060344 | Bacteria | 1169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046513 | Ga0495616_0134238 | Ga0495616_0134238_746_1117 | 119 |
| 2 | 3300009177 | Ga0105248_10444894 | Ga0105248_104448942 | 120 |
| 3 | 3300046616 | Ga0495668_0578034 | Ga0495668_0578034_182_589 | 122 |
| 4 | 3300046684 | Ga0495669_0136343 | Ga0495669_0136343_103_510 | 122 |
| 5 | 3300047445 | Ga0495677_0243229 | Ga0495677_0243229_251_658 | 122 |
| 6 | 3300037471 | Ga0395905_0380799 | Ga0395905_0380799_853_1239 | 123 |
| 7 | 3300001989 | JGI24739J22299_10014393 | JGI24739J22299_100143935 | 124 |
| 8 | 3300001990 | JGI24737J22298_10056357 | JGI24737J22298_100563571 | 124 |
| 9 | 3300005327 | Ga0070658_10016356 | Ga0070658_100163567 | 124 |
| 10 | 3300005328 | Ga0070676_10008701 | Ga0070676_100087015 | 124 |
| 11 | 3300005328 | Ga0070676_10649335 | Ga0070676_106493352 | 124 |
| 12 | 3300005330 | Ga0070690_100137193 | Ga0070690_1001371932 | 124 |
| 13 | 3300005331 | Ga0070670_100175633 | Ga0070670_1001756332 | 124 |
| 14 | 3300005335 | Ga0070666_10032086 | Ga0070666_100320864 | 124 |
| 15 | 3300005338 | Ga0068868_100024884 | Ga0068868_1000248847 | 124 |
| 16 | 3300005339 | Ga0070660_100107887 | Ga0070660_1001078872 | 124 |
| 17 | 3300005343 | Ga0070687_100091225 | Ga0070687_1000912252 | 124 |
| 18 | 3300005344 | Ga0070661_100011611 | Ga0070661_1000116112 | 124 |
| 19 | 3300005354 | Ga0070675_100973275 | Ga0070675_1009732752 | 124 |
| 20 | 3300005355 | Ga0070671_100599972 | Ga0070671_1005999722 | 124 |
| 21 | 3300005356 | Ga0070674_100111426 | Ga0070674_1001114263 | 124 |
| 22 | 3300005356 | Ga0070674_100269077 | Ga0070674_1002690772 | 124 |
| 23 | 3300005364 | Ga0070673_100029963 | Ga0070673_1000299633 | 124 |
| 24 | 3300005365 | Ga0070688_100239974 | Ga0070688_1002399741 | 124 |
| 25 | 3300005366 | Ga0070659_100389646 | Ga0070659_1003896462 | 124 |
| 26 | 3300005367 | Ga0070667_100031529 | Ga0070667_1000315297 | 124 |
| 27 | 3300005455 | Ga0070663_100388540 | Ga0070663_1003885402 | 124 |
| 28 | 3300005456 | Ga0070678_100008774 | Ga0070678_1000087742 | 124 |
| 29 | 3300005457 | Ga0070662_100009922 | Ga0070662_1000099223 | 124 |
| 30 | 3300005459 | Ga0068867_100020121 | Ga0068867_1000201217 | 124 |
| 31 | 3300005543 | Ga0070672_100009584 | Ga0070672_1000095846 | 124 |
| 32 | 3300005544 | Ga0070686_100063234 | Ga0070686_1000632342 | 124 |
| 33 | 3300005548 | Ga0070665_100105865 | Ga0070665_1001058653 | 124 |
| 34 | 3300005578 | Ga0068854_100111101 | Ga0068854_1001111013 | 124 |
| 35 | 3300005578 | Ga0068854_100170997 | Ga0068854_1001709973 | 124 |
| 36 | 3300005614 | Ga0068856_100063582 | Ga0068856_1000635821 | 124 |
| 37 | 3300005616 | Ga0068852_100032451 | Ga0068852_1000324517 | 124 |
| 38 | 3300005617 | Ga0068859_100037850 | Ga0068859_1000378507 | 124 |
| 39 | 3300005618 | Ga0068864_100022361 | Ga0068864_1000223612 | 124 |
| 40 | 3300005718 | Ga0068866_10005188 | Ga0068866_100051887 | 124 |
| 41 | 3300005834 | Ga0068851_10018054 | Ga0068851_100180545 | 124 |
| 42 | 3300005841 | Ga0068863_100064125 | Ga0068863_1000641254 | 124 |
| 43 | 3300005842 | Ga0068858_100055846 | Ga0068858_1000558462 | 124 |
| 44 | 3300005843 | Ga0068860_100850854 | Ga0068860_1008508542 | 124 |
| 45 | 3300006237 | Ga0097621_100013030 | Ga0097621_1000130304 | 124 |
| 46 | 3300006358 | Ga0068871_100005666 | Ga0068871_1000056667 | 124 |
| 47 | 3300006881 | Ga0068865_100001424 | Ga0068865_10000142413 | 124 |
| 48 | 3300006931 | Ga0097620_100037851 | Ga0097620_1000378517 | 124 |
| 49 | 3300009098 | Ga0105245_10019331 | Ga0105245_100193318 | 124 |
| 50 | 3300009148 | Ga0105243_10425369 | Ga0105243_104253693 | 124 |
| 51 | 3300009174 | Ga0105241_12136009 | Ga0105241_121360092 | 124 |
| 52 | 3300009176 | Ga0105242_10002410 | Ga0105242_1000241017 | 124 |
| 53 | 3300009177 | Ga0105248_10197736 | Ga0105248_101977362 | 124 |
| 54 | 3300009551 | Ga0105238_10105363 | Ga0105238_101053633 | 124 |
| 55 | 3300009553 | Ga0105249_10763485 | Ga0105249_107634852 | 124 |
| 56 | 3300010375 | Ga0105239_10497957 | Ga0105239_104979573 | 124 |
| 57 | 3300011119 | Ga0105246_10686742 | Ga0105246_106867422 | 124 |
| 58 | 3300013105 | Ga0157369_10301563 | Ga0157369_103015632 | 124 |
| 59 | 3300013296 | Ga0157374_10116923 | Ga0157374_101169234 | 124 |
| 60 | 3300013297 | Ga0157378_10182112 | Ga0157378_101821123 | 124 |
| 61 | 3300013306 | Ga0163162_10088341 | Ga0163162_100883415 | 124 |
| 62 | 3300013308 | Ga0157375_10377954 | Ga0157375_103779542 | 124 |
| 63 | 3300014325 | Ga0163163_10093474 | Ga0163163_100934743 | 124 |
| 64 | 3300014745 | Ga0157377_10156987 | Ga0157377_101569872 | 124 |
| 65 | 3300014968 | Ga0157379_10148042 | Ga0157379_101480424 | 124 |
| 66 | 3300014969 | Ga0157376_10003882 | Ga0157376_100038823 | 124 |
| 67 | 3300017792 | Ga0163161_10140702 | Ga0163161_101407023 | 124 |
| 68 | 3300025315 | Ga0207697_10020248 | Ga0207697_100202484 | 124 |
| 69 | 3300025899 | Ga0207642_10193347 | Ga0207642_101933472 | 124 |
| 70 | 3300025901 | Ga0207688_10174628 | Ga0207688_101746283 | 124 |
| 71 | 3300025904 | Ga0207647_10162018 | Ga0207647_101620182 | 124 |
| 72 | 3300025907 | Ga0207645_10187521 | Ga0207645_101875212 | 124 |
| 73 | 3300025909 | Ga0207705_10101837 | Ga0207705_101018374 | 124 |
| 74 | 3300025918 | Ga0207662_10014872 | Ga0207662_100148722 | 124 |
| 75 | 3300025919 | Ga0207657_10026681 | Ga0207657_100266813 | 124 |
| 76 | 3300025920 | Ga0207649_10029155 | Ga0207649_100291554 | 124 |
| 77 | 3300025924 | Ga0207694_10174361 | Ga0207694_101743612 | 124 |
| 78 | 3300025925 | Ga0207650_10110147 | Ga0207650_101101472 | 124 |
| 79 | 3300025926 | Ga0207659_10434818 | Ga0207659_104348182 | 124 |
| 80 | 3300025927 | Ga0207687_10414331 | Ga0207687_104143313 | 124 |
| 81 | 3300025931 | Ga0207644_10043002 | Ga0207644_100430024 | 124 |
| 82 | 3300025932 | Ga0207690_10140316 | Ga0207690_101403162 | 124 |
| 83 | 3300025932 | Ga0207690_10471756 | Ga0207690_104717562 | 124 |
| 84 | 3300025933 | Ga0207706_10006865 | Ga0207706_1000686513 | 124 |
| 85 | 3300025933 | Ga0207706_10132255 | Ga0207706_101322553 | 124 |
| 86 | 3300025934 | Ga0207686_10228229 | Ga0207686_102282293 | 124 |
| 87 | 3300025935 | Ga0207709_10664277 | Ga0207709_106642772 | 124 |
| 88 | 3300025937 | Ga0207669_10290219 | Ga0207669_102902192 | 124 |
| 89 | 3300025937 | Ga0207669_10954660 | Ga0207669_109546602 | 124 |
| 90 | 3300025938 | Ga0207704_10342826 | Ga0207704_103428263 | 124 |
| 91 | 3300025940 | Ga0207691_10014251 | Ga0207691_100142517 | 124 |
| 92 | 3300025941 | Ga0207711_10080903 | Ga0207711_100809032 | 124 |
| 93 | 3300025960 | Ga0207651_10008035 | Ga0207651_100080357 | 124 |
| 94 | 3300025981 | Ga0207640_10141564 | Ga0207640_101415643 | 124 |
| 95 | 3300025981 | Ga0207640_10457633 | Ga0207640_104576331 | 124 |
| 96 | 3300025986 | Ga0207658_10188689 | Ga0207658_101886892 | 124 |
| 97 | 3300026023 | Ga0207677_10066798 | Ga0207677_100667982 | 124 |
| 98 | 3300026035 | Ga0207703_10027296 | Ga0207703_100272967 | 124 |
| 99 | 3300026078 | Ga0207702_10368541 | Ga0207702_103685411 | 124 |
| 100 | 3300026088 | Ga0207641_10540375 | Ga0207641_105403752 | 124 |
| 101 | 3300026089 | Ga0207648_10020517 | Ga0207648_100205179 | 124 |
| 102 | 3300026089 | Ga0207648_10303784 | Ga0207648_103037843 | 124 |
| 103 | 3300026121 | Ga0207683_10002763 | Ga0207683_1000276313 | 124 |
| 104 | 3300026142 | Ga0207698_10006707 | Ga0207698_100067078 | 124 |
| 105 | 3300028379 | Ga0268266_10204869 | Ga0268266_102048692 | 124 |
| 106 | 3300028381 | Ga0268264_10812687 | Ga0268264_108126872 | 124 |
| 107 | 3300035084 | Ga0373928_0014329 | Ga0373928_0014329_62_466 | 124 |
| 108 | 3300035090 | Ga0373949_0303835 | Ga0373949_0303835_41_445 | 124 |
| 109 | 3300035092 | Ga0373952_0069710 | Ga0373952_0069710_421_825 | 124 |
| 110 | 3300035207 | Ga0373942_0095134 | Ga0373942_0095134_449_853 | 124 |
| 111 | 3300035691 | Ga0373931_0087294 | Ga0373931_0087294_675_1079 | 124 |
| 112 | 3300037312 | Ga0395899_0078830 | Ga0395899_0078830_796_1203 | 124 |
| 113 | 3300037418 | Ga0395900_0028185 | Ga0395900_0028185_1868_2275 | 124 |
| 114 | 3300037466 | Ga0395898_0108973 | Ga0395898_0108973_1623_2030 | 124 |
| 115 | 3300037471 | Ga0395905_0079844 | Ga0395905_0079844_1165_1572 | 124 |
| 116 | 3300038443 | Ga0395901_0247381 | Ga0395901_0247381_167_574 | 124 |
| 117 | 3300048903 | Ga0496100_0006995 | Ga0496100_0006995_1316_1720 | 124 |
| 118 | 3300048904 | Ga0496101_0088049 | Ga0496101_0088049_245_649 | 124 |
| 119 | 3300048905 | Ga0496102_0144054 | Ga0496102_0144054_682_1086 | 124 |
| 120 | 3300048907 | Ga0496104_0391196 | Ga0496104_0391196_159_563 | 124 |
| 121 | 3300048908 | Ga0496105_0233726 | Ga0496105_0233726_557_961 | 124 |
| 122 | 3300048909 | Ga0496106_0111285 | Ga0496106_0111285_673_1077 | 124 |
| 123 | 3300048910 | Ga0496107_0008263 | Ga0496107_0008263_5141_5545 | 124 |
| 124 | 3300048911 | Ga0496108_0148879 | Ga0496108_0148879_668_1072 | 124 |
| 125 | 3300048912 | Ga0496109_0202462 | Ga0496109_0202462_255_659 | 124 |
| 126 | 3300048913 | Ga0496110_0212783 | Ga0496110_0212783_1137_1541 | 124 |
| 127 | 3300048915 | Ga0496112_0117027 | Ga0496112_0117027_1320_1724 | 124 |
| 128 | 3300048916 | Ga0496113_0098386 | Ga0496113_0098386_888_1292 | 124 |
| 129 | 3300035171 | Ga0373946_0563239 | Ga0373946_0563239_140_544 | 125 |
| 130 | 3300035692 | Ga0373935_0009711 | Ga0373935_0009711_5113_5517 | 125 |
| 131 | 3300045976 | Ga0466967_0027514 | Ga0466967_0027514_1378_1788 | 125 |
| 132 | 3300046522 | Ga0495643_0393389 | Ga0495643_0393389_38_436 | 125 |
| 133 | 3300005327 | Ga0070658_10007111 | Ga0070658_100071119 | 126 |
| 134 | 3300005338 | Ga0068868_100454913 | Ga0068868_1004549132 | 126 |
| 135 | 3300005339 | Ga0070660_100000339 | Ga0070660_1000003395 | 126 |
| 136 | 3300005354 | Ga0070675_100355003 | Ga0070675_1003550032 | 126 |
| 137 | 3300005364 | Ga0070673_100029719 | Ga0070673_1000297193 | 126 |
| 138 | 3300005366 | Ga0070659_101000084 | Ga0070659_1010000841 | 126 |
| 139 | 3300005367 | Ga0070667_100521863 | Ga0070667_1005218632 | 126 |
| 140 | 3300005456 | Ga0070678_100160172 | Ga0070678_1001601722 | 126 |
| 141 | 3300005543 | Ga0070672_100009843 | Ga0070672_1000098434 | 126 |
| 142 | 3300005548 | Ga0070665_100159377 | Ga0070665_1001593772 | 126 |
| 143 | 3300005563 | Ga0068855_100000247 | Ga0068855_10000024726 | 126 |
| 144 | 3300005564 | Ga0070664_100158916 | Ga0070664_1001589162 | 126 |
| 145 | 3300005842 | Ga0068858_100115005 | Ga0068858_1001150053 | 126 |
| 146 | 3300009177 | Ga0105248_10610712 | Ga0105248_106107122 | 126 |
| 147 | 3300013102 | Ga0157371_10000624 | Ga0157371_1000062417 | 126 |
| 148 | 3300013104 | Ga0157370_10350312 | Ga0157370_103503122 | 126 |
| 149 | 3300013296 | Ga0157374_10034433 | Ga0157374_100344337 | 126 |
| 150 | 3300025904 | Ga0207647_10014655 | Ga0207647_100146552 | 126 |
| 151 | 3300025909 | Ga0207705_10000082 | Ga0207705_1000008233 | 126 |
| 152 | 3300025918 | Ga0207662_10866349 | Ga0207662_108663491 | 126 |
| 153 | 3300025919 | Ga0207657_10000360 | Ga0207657_1000036033 | 126 |
| 154 | 3300025926 | Ga0207659_10083897 | Ga0207659_100838973 | 126 |
| 155 | 3300025932 | Ga0207690_10588261 | Ga0207690_105882611 | 126 |
| 156 | 3300025940 | Ga0207691_10013134 | Ga0207691_100131344 | 126 |
| 157 | 3300025945 | Ga0207679_10051489 | Ga0207679_100514894 | 126 |
| 158 | 3300025949 | Ga0207667_10000114 | Ga0207667_10000114123 | 126 |
| 159 | 3300025986 | Ga0207658_10453870 | Ga0207658_104538702 | 126 |
| 160 | 3300026023 | Ga0207677_10300752 | Ga0207677_103007522 | 126 |
| 161 | 3300026035 | Ga0207703_10042738 | Ga0207703_100427384 | 126 |
| 162 | 3300026121 | Ga0207683_10001629 | Ga0207683_100016297 | 126 |
| 163 | 3300037418 | Ga0395900_0609207 | Ga0395900_0609207_544_924 | 126 |
| 164 | 3300037471 | Ga0395905_0564245 | Ga0395905_0564245_36_416 | 126 |
| 165 | 3300005327 | Ga0070658_10706906 | Ga0070658_107069062 | 127 |
| 166 | 3300005328 | Ga0070676_10034995 | Ga0070676_100349954 | 127 |
| 167 | 3300005331 | Ga0070670_100438894 | Ga0070670_1004388943 | 127 |
| 168 | 3300005334 | Ga0068869_100318459 | Ga0068869_1003184593 | 127 |
| 169 | 3300005335 | Ga0070666_10193411 | Ga0070666_101934112 | 127 |
| 170 | 3300005338 | Ga0068868_100207917 | Ga0068868_1002079172 | 127 |
| 171 | 3300005339 | Ga0070660_101684040 | Ga0070660_1016840401 | 127 |
| 172 | 3300005347 | Ga0070668_100019581 | Ga0070668_1000195814 | 127 |
| 173 | 3300005347 | Ga0070668_101483319 | Ga0070668_1014833191 | 127 |
| 174 | 3300005353 | Ga0070669_100256674 | Ga0070669_1002566742 | 127 |
| 175 | 3300005353 | Ga0070669_100269297 | Ga0070669_1002692973 | 127 |
| 176 | 3300005354 | Ga0070675_100140457 | Ga0070675_1001404572 | 127 |
| 177 | 3300005355 | Ga0070671_100717777 | Ga0070671_1007177772 | 127 |
| 178 | 3300005356 | Ga0070674_100044481 | Ga0070674_1000444816 | 127 |
| 179 | 3300005364 | Ga0070673_100008589 | Ga0070673_1000085894 | 127 |
| 180 | 3300005364 | Ga0070673_100500918 | Ga0070673_1005009182 | 127 |
| 181 | 3300005367 | Ga0070667_100036196 | Ga0070667_1000361964 | 127 |
| 182 | 3300005455 | Ga0070663_100314442 | Ga0070663_1003144422 | 127 |
| 183 | 3300005456 | Ga0070678_101070560 | Ga0070678_1010705601 | 127 |
| 184 | 3300005457 | Ga0070662_100805208 | Ga0070662_1008052082 | 127 |
| 185 | 3300005459 | Ga0068867_100185971 | Ga0068867_1001859712 | 127 |
| 186 | 3300005543 | Ga0070672_100169136 | Ga0070672_1001691364 | 127 |
| 187 | 3300005544 | Ga0070686_100359814 | Ga0070686_1003598142 | 127 |
| 188 | 3300005548 | Ga0070665_100095470 | Ga0070665_1000954704 | 127 |
| 189 | 3300005617 | Ga0068859_100157169 | Ga0068859_1001571696 | 127 |
| 190 | 3300005719 | Ga0068861_100397804 | Ga0068861_1003978042 | 127 |
| 191 | 3300005840 | Ga0068870_10049839 | Ga0068870_100498392 | 127 |
| 192 | 3300005843 | Ga0068860_100022372 | Ga0068860_1000223722 | 127 |
| 193 | 3300005844 | Ga0068862_100333344 | Ga0068862_1003333442 | 127 |
| 194 | 3300006237 | Ga0097621_100073298 | Ga0097621_1000732986 | 127 |
| 195 | 3300006237 | Ga0097621_100769015 | Ga0097621_1007690151 | 127 |
| 196 | 3300006358 | Ga0068871_100149842 | Ga0068871_1001498422 | 127 |
| 197 | 3300006881 | Ga0068865_100555539 | Ga0068865_1005555392 | 127 |
| 198 | 3300006931 | Ga0097620_100157174 | Ga0097620_1001571746 | 127 |
| 199 | 3300025893 | Ga0207682_10222412 | Ga0207682_102224122 | 127 |
| 200 | 3300025901 | Ga0207688_10011556 | Ga0207688_100115562 | 127 |
| 201 | 3300025903 | Ga0207680_10249074 | Ga0207680_102490742 | 127 |
| 202 | 3300025907 | Ga0207645_10060475 | Ga0207645_100604753 | 127 |
| 203 | 3300025908 | Ga0207643_10025687 | Ga0207643_100256875 | 127 |
| 204 | 3300025923 | Ga0207681_10026545 | Ga0207681_100265454 | 127 |
| 205 | 3300025925 | Ga0207650_10112624 | Ga0207650_101126243 | 127 |
| 206 | 3300025926 | Ga0207659_10157715 | Ga0207659_101577152 | 127 |
| 207 | 3300025931 | Ga0207644_11198259 | Ga0207644_111982591 | 127 |
| 208 | 3300025940 | Ga0207691_10081216 | Ga0207691_100812162 | 127 |
| 209 | 3300025941 | Ga0207711_10647918 | Ga0207711_106479182 | 127 |
| 210 | 3300025942 | Ga0207689_10024225 | Ga0207689_100242254 | 127 |
| 211 | 3300025960 | Ga0207651_10282048 | Ga0207651_102820482 | 127 |
| 212 | 3300025972 | Ga0207668_10000072 | Ga0207668_1000007254 | 127 |
| 213 | 3300025972 | Ga0207668_10648170 | Ga0207668_106481702 | 127 |
| 214 | 3300025986 | Ga0207658_10021906 | Ga0207658_100219067 | 127 |
| 215 | 3300025986 | Ga0207658_10022216 | Ga0207658_100222162 | 127 |
| 216 | 3300026023 | Ga0207677_10071281 | Ga0207677_100712812 | 127 |
| 217 | 3300026067 | Ga0207678_10876423 | Ga0207678_108764231 | 127 |
| 218 | 3300026089 | Ga0207648_10002300 | Ga0207648_1000230014 | 127 |
| 219 | 3300026118 | Ga0207675_100504457 | Ga0207675_1005044573 | 127 |
| 220 | 3300026121 | Ga0207683_10055134 | Ga0207683_100551343 | 127 |
| 221 | 3300028379 | Ga0268266_10010764 | Ga0268266_1001076410 | 127 |
| 222 | 3300028380 | Ga0268265_10002655 | Ga0268265_1000265514 | 127 |
| 223 | 3300028380 | Ga0268265_10228207 | Ga0268265_102282072 | 127 |
| 224 | 3300028381 | Ga0268264_10006884 | Ga0268264_1000688414 | 127 |
| 225 | 3300031852 | Ga0307410_10227112 | Ga0307410_102271122 | 127 |
| 226 | 3300031903 | Ga0307407_11464884 | Ga0307407_114648841 | 127 |
| 227 | 3300032005 | Ga0307411_11363681 | Ga0307411_113636811 | 127 |
| 228 | 3300032126 | Ga0307415_101534432 | Ga0307415_1015344322 | 127 |
| 229 | 3300001990 | JGI24737J22298_10000655 | JGI24737J22298_1000065513 | 128 |
| 230 | 3300005339 | Ga0070660_100015001 | Ga0070660_1000150015 | 128 |
| 231 | 3300005345 | Ga0070692_10008029 | Ga0070692_100080295 | 128 |
| 232 | 3300005347 | Ga0070668_100544512 | Ga0070668_1005445122 | 128 |
| 233 | 3300005353 | Ga0070669_100140030 | Ga0070669_1001400302 | 128 |
| 234 | 3300005366 | Ga0070659_100005147 | Ga0070659_10000514713 | 128 |
| 235 | 3300005444 | Ga0070694_100025638 | Ga0070694_1000256381 | 128 |
| 236 | 3300005457 | Ga0070662_100031671 | Ga0070662_1000316713 | 128 |
| 237 | 3300005539 | Ga0068853_100100007 | Ga0068853_1001000074 | 128 |
| 238 | 3300005543 | Ga0070672_100169185 | Ga0070672_1001691852 | 128 |
| 239 | 3300005545 | Ga0070695_100520689 | Ga0070695_1005206891 | 128 |
| 240 | 3300005548 | Ga0070665_100049719 | Ga0070665_1000497195 | 128 |
| 241 | 3300005549 | Ga0070704_101078266 | Ga0070704_1010782661 | 128 |
| 242 | 3300005563 | Ga0068855_100024916 | Ga0068855_1000249165 | 128 |
| 243 | 3300005577 | Ga0068857_100252035 | Ga0068857_1002520352 | 128 |
| 244 | 3300005617 | Ga0068859_101533935 | Ga0068859_1015339352 | 128 |
| 245 | 3300005843 | Ga0068860_100160812 | Ga0068860_1001608122 | 128 |
| 246 | 3300005844 | Ga0068862_100186233 | Ga0068862_1001862332 | 128 |
| 247 | 3300006931 | Ga0097620_101534009 | Ga0097620_1015340092 | 128 |
| 248 | 3300013308 | Ga0157375_11198341 | Ga0157375_111983412 | 128 |
| 249 | 3300014745 | Ga0157377_10764551 | Ga0157377_107645512 | 128 |
| 250 | 3300025904 | Ga0207647_10007743 | Ga0207647_100077433 | 128 |
| 251 | 3300025913 | Ga0207695_10736975 | Ga0207695_107369752 | 128 |
| 252 | 3300025919 | Ga0207657_10022343 | Ga0207657_100223437 | 128 |
| 253 | 3300025923 | Ga0207681_11442421 | Ga0207681_114424212 | 128 |
| 254 | 3300025932 | Ga0207690_10042985 | Ga0207690_100429852 | 128 |
| 255 | 3300025933 | Ga0207706_10016257 | Ga0207706_100162579 | 128 |
| 256 | 3300025935 | Ga0207709_10334038 | Ga0207709_103340382 | 128 |
| 257 | 3300025940 | Ga0207691_10062014 | Ga0207691_100620145 | 128 |
| 258 | 3300025949 | Ga0207667_10094516 | Ga0207667_100945162 | 128 |
| 259 | 3300025961 | Ga0207712_10003235 | Ga0207712_100032357 | 128 |
| 260 | 3300025972 | Ga0207668_10160863 | Ga0207668_101608632 | 128 |
| 261 | 3300026035 | Ga0207703_11892354 | Ga0207703_118923541 | 128 |
| 262 | 3300026041 | Ga0207639_10029804 | Ga0207639_100298044 | 128 |
| 263 | 3300026116 | Ga0207674_10040219 | Ga0207674_100402195 | 128 |
| 264 | 3300028379 | Ga0268266_10061473 | Ga0268266_100614734 | 128 |
| 265 | 3300028380 | Ga0268265_10064979 | Ga0268265_100649792 | 128 |
| 266 | 3300028381 | Ga0268264_10148778 | Ga0268264_101487782 | 128 |
| 267 | 3300031731 | Ga0307405_10162711 | Ga0307405_101627112 | 128 |
| 268 | 3300031852 | Ga0307410_10246541 | Ga0307410_102465412 | 128 |
| 269 | 3300031901 | Ga0307406_10782456 | Ga0307406_107824561 | 128 |
| 270 | 3300032126 | Ga0307415_100129072 | Ga0307415_1001290722 | 128 |
| 271 | 3300046684 | Ga0495669_0027869 | Ga0495669_0027869_1844_2236 | 128 |
| 272 | 3300005347 | Ga0070668_100489744 | Ga0070668_1004897441 | 129 |
| 273 | 3300005353 | Ga0070669_101285535 | Ga0070669_1012855351 | 129 |
| 274 | 3300005844 | Ga0068862_100016753 | Ga0068862_1000167533 | 129 |
| 275 | 3300025907 | Ga0207645_10417150 | Ga0207645_104171501 | 129 |
| 276 | 3300025972 | Ga0207668_10033122 | Ga0207668_100331224 | 129 |
| 277 | 3300028380 | Ga0268265_10003724 | Ga0268265_1000372413 | 129 |
| 278 | 3300031824 | Ga0307413_10002467 | Ga0307413_1000246710 | 129 |
| 279 | 3300031824 | Ga0307413_10010593 | Ga0307413_100105933 | 129 |
| 280 | 3300031852 | Ga0307410_10011969 | Ga0307410_100119693 | 129 |
| 281 | 3300031903 | Ga0307407_10099736 | Ga0307407_100997363 | 129 |
| 282 | 3300031903 | Ga0307407_10109914 | Ga0307407_101099143 | 129 |
| 283 | 3300031995 | Ga0307409_100021681 | Ga0307409_1000216813 | 129 |
| 284 | 3300031995 | Ga0307409_100230612 | Ga0307409_1002306121 | 129 |
| 285 | 3300032002 | Ga0307416_100968210 | Ga0307416_1009682102 | 129 |
| 286 | 3300032002 | Ga0307416_101433404 | Ga0307416_1014334042 | 129 |
| 287 | 3300032004 | Ga0307414_10009564 | Ga0307414_100095643 | 129 |
| 288 | 3300032005 | Ga0307411_10000475 | Ga0307411_1000047511 | 129 |
| 289 | 3300032005 | Ga0307411_10003128 | Ga0307411_100031284 | 129 |
| 290 | 3300032126 | Ga0307415_100141369 | Ga0307415_1001413693 | 129 |
| 291 | 3300032126 | Ga0307415_100575332 | Ga0307415_1005753322 | 129 |
| 292 | 3300049585 | Ga0501069_0120442 | Ga0501069_0120442_502_924 | 129 |
| 293 | 3300005331 | Ga0070670_101516190 | Ga0070670_1015161901 | 130 |
| 294 | 3300005334 | Ga0068869_100653340 | Ga0068869_1006533402 | 130 |
| 295 | 3300005347 | Ga0070668_100058980 | Ga0070668_1000589806 | 130 |
| 296 | 3300005353 | Ga0070669_100185501 | Ga0070669_1001855013 | 130 |
| 297 | 3300005355 | Ga0070671_100016707 | Ga0070671_1000167073 | 130 |
| 298 | 3300005364 | Ga0070673_100125407 | Ga0070673_1001254071 | 130 |
| 299 | 3300005367 | Ga0070667_100003813 | Ga0070667_1000038133 | 130 |
| 300 | 3300005367 | Ga0070667_100042585 | Ga0070667_1000425856 | 130 |
| 301 | 3300005367 | Ga0070667_101026454 | Ga0070667_1010264541 | 130 |
| 302 | 3300005617 | Ga0068859_100002392 | Ga0068859_1000023928 | 130 |
| 303 | 3300005618 | Ga0068864_100001110 | Ga0068864_10000111018 | 130 |
| 304 | 3300005618 | Ga0068864_100510382 | Ga0068864_1005103821 | 130 |
| 305 | 3300005718 | Ga0068866_10067216 | Ga0068866_100672162 | 130 |
| 306 | 3300005841 | Ga0068863_100001056 | Ga0068863_1000010568 | 130 |
| 307 | 3300005842 | Ga0068858_100003145 | Ga0068858_10000314515 | 130 |
| 308 | 3300005843 | Ga0068860_100002768 | Ga0068860_1000027688 | 130 |
| 309 | 3300005843 | Ga0068860_100739500 | Ga0068860_1007395002 | 130 |
| 310 | 3300005844 | Ga0068862_100209588 | Ga0068862_1002095884 | 130 |
| 311 | 3300006931 | Ga0097620_100002392 | Ga0097620_1000023928 | 130 |
| 312 | 3300009093 | Ga0105240_10122528 | Ga0105240_101225282 | 130 |
| 313 | 3300009148 | Ga0105243_10678028 | Ga0105243_106780282 | 130 |
| 314 | 3300009553 | Ga0105249_10026474 | Ga0105249_100264746 | 130 |
| 315 | 3300010375 | Ga0105239_10042112 | Ga0105239_100421127 | 130 |
| 316 | 3300013100 | Ga0157373_10699714 | Ga0157373_106997142 | 130 |
| 317 | 3300013102 | Ga0157371_10195695 | Ga0157371_101956951 | 130 |
| 318 | 3300013306 | Ga0163162_10154261 | Ga0163162_101542612 | 130 |
| 319 | 3300013307 | Ga0157372_12392102 | Ga0157372_123921022 | 130 |
| 320 | 3300014968 | Ga0157379_10028415 | Ga0157379_100284152 | 130 |
| 321 | 3300014968 | Ga0157379_10271188 | Ga0157379_102711882 | 130 |
| 322 | 3300025711 | Ga0207696_1014589 | Ga0207696_10145892 | 130 |
| 323 | 3300025899 | Ga0207642_10103059 | Ga0207642_101030592 | 130 |
| 324 | 3300025923 | Ga0207681_10032261 | Ga0207681_100322616 | 130 |
| 325 | 3300025925 | Ga0207650_10460092 | Ga0207650_104600922 | 130 |
| 326 | 3300025931 | Ga0207644_10036457 | Ga0207644_100364575 | 130 |
| 327 | 3300025933 | Ga0207706_10317391 | Ga0207706_103173914 | 130 |
| 328 | 3300025941 | Ga0207711_10000869 | Ga0207711_1000086924 | 130 |
| 329 | 3300025942 | Ga0207689_10033527 | Ga0207689_100335276 | 130 |
| 330 | 3300025960 | Ga0207651_10009471 | Ga0207651_100094716 | 130 |
| 331 | 3300025961 | Ga0207712_10058889 | Ga0207712_100588892 | 130 |
| 332 | 3300025986 | Ga0207658_10009361 | Ga0207658_100093613 | 130 |
| 333 | 3300025986 | Ga0207658_10015372 | Ga0207658_100153728 | 130 |
| 334 | 3300025986 | Ga0207658_10785992 | Ga0207658_107859922 | 130 |
| 335 | 3300026035 | Ga0207703_10004152 | Ga0207703_1000415210 | 130 |
| 336 | 3300026088 | Ga0207641_10001513 | Ga0207641_100015138 | 130 |
| 337 | 3300026095 | Ga0207676_10006150 | Ga0207676_100061506 | 130 |
| 338 | 3300028380 | Ga0268265_10182703 | Ga0268265_101827034 | 130 |
| 339 | 3300028380 | Ga0268265_10326296 | Ga0268265_103262962 | 130 |
| 340 | 3300028381 | Ga0268264_10005781 | Ga0268264_100057818 | 130 |
| 341 | 3300028381 | Ga0268264_10429415 | Ga0268264_104294152 | 130 |
| 342 | 3300028381 | Ga0268264_10637035 | Ga0268264_106370352 | 130 |
| 343 | 3300032002 | Ga0307416_100608895 | Ga0307416_1006088952 | 130 |
| 344 | 3300038443 | Ga0395901_1974721 | Ga0395901_1974721_66_488 | 130 |
| 345 | 3300042439 | Ga0439464_0000350 | Ga0439464_0000350_1524_1922 | 130 |
| 346 | 3300005343 | Ga0070687_100190983 | Ga0070687_1001909832 | 131 |
| 347 | 3300005841 | Ga0068863_100588306 | Ga0068863_1005883062 | 131 |
| 348 | 3300005843 | Ga0068860_100599134 | Ga0068860_1005991342 | 131 |
| 349 | 3300009092 | Ga0105250_10020270 | Ga0105250_100202702 | 131 |
| 350 | 3300009101 | Ga0105247_10136598 | Ga0105247_101365982 | 131 |
| 351 | 3300009177 | Ga0105248_10001320 | Ga0105248_1000132027 | 131 |
| 352 | 3300009553 | Ga0105249_10026708 | Ga0105249_100267082 | 131 |
| 353 | 3300013306 | Ga0163162_10460752 | Ga0163162_104607524 | 131 |
| 354 | 3300014325 | Ga0163163_10006151 | Ga0163163_100061518 | 131 |
| 355 | 3300025935 | Ga0207709_10373253 | Ga0207709_103732531 | 131 |
| 356 | 3300028381 | Ga0268264_10537805 | Ga0268264_105378053 | 131 |
| 357 | 3300031731 | Ga0307405_10082142 | Ga0307405_100821422 | 131 |
| 358 | 3300037471 | Ga0395905_0001031 | Ga0395905_0001031_2433_2888 | 131 |
| 359 | 3300037471 | Ga0395905_0370642 | Ga0395905_0370642_130_528 | 131 |
| 360 | 3300046616 | Ga0495668_0050557 | Ga0495668_0050557_1114_1533 | 131 |
| 361 | 3300048915 | Ga0496112_0057299 | Ga0496112_0057299_2512_2937 | 131 |
| 362 | 3300048916 | Ga0496113_1077842 | Ga0496113_1077842_149_574 | 131 |
| 363 | 3300049583 | Ga0501067_0035435 | Ga0501067_0035435_2118_2540 | 131 |
| 364 | 3300049586 | Ga0501070_0860643 | Ga0501070_0860643_92_514 | 131 |
| 365 | 3300053134 | Ga0500658_0000036 | Ga0500658_0000036_46336_46755 | 131 |
| 366 | 3300005327 | Ga0070658_10026585 | Ga0070658_100265856 | 132 |
| 367 | 3300005458 | Ga0070681_10063111 | Ga0070681_100631112 | 132 |
| 368 | 3300005530 | Ga0070679_101042618 | Ga0070679_1010426181 | 132 |
| 369 | 3300005563 | Ga0068855_101203595 | Ga0068855_1012035952 | 132 |
| 370 | 3300005577 | Ga0068857_100022877 | Ga0068857_1000228772 | 132 |
| 371 | 3300005616 | Ga0068852_100282041 | Ga0068852_1002820412 | 132 |
| 372 | 3300005844 | Ga0068862_100101524 | Ga0068862_1001015243 | 132 |
| 373 | 3300006028 | Ga0070717_10307576 | Ga0070717_103075762 | 132 |
| 374 | 3300006177 | Ga0075362_10040870 | Ga0075362_100408703 | 132 |
| 375 | 3300009094 | Ga0111539_10687239 | Ga0111539_106872391 | 132 |
| 376 | 3300009551 | Ga0105238_10284737 | Ga0105238_102847372 | 132 |
| 377 | 3300013105 | Ga0157369_10004619 | Ga0157369_1000461910 | 132 |
| 378 | 3300013307 | Ga0157372_10571284 | Ga0157372_105712843 | 132 |
| 379 | 3300013307 | Ga0157372_11304519 | Ga0157372_113045192 | 132 |
| 380 | 3300025906 | Ga0207699_11048191 | Ga0207699_110481912 | 132 |
| 381 | 3300025909 | Ga0207705_10026022 | Ga0207705_100260227 | 132 |
| 382 | 3300025911 | Ga0207654_10875007 | Ga0207654_108750071 | 132 |
| 383 | 3300025912 | Ga0207707_10087292 | Ga0207707_100872923 | 132 |
| 384 | 3300025915 | Ga0207693_10471338 | Ga0207693_104713382 | 132 |
| 385 | 3300025915 | Ga0207693_10654058 | Ga0207693_106540582 | 132 |
| 386 | 3300025919 | Ga0207657_10023065 | Ga0207657_100230653 | 132 |
| 387 | 3300025920 | Ga0207649_10308980 | Ga0207649_103089802 | 132 |
| 388 | 3300025921 | Ga0207652_10268136 | Ga0207652_102681362 | 132 |
| 389 | 3300025924 | Ga0207694_10425874 | Ga0207694_104258742 | 132 |
| 390 | 3300025932 | Ga0207690_10053007 | Ga0207690_100530073 | 132 |
| 391 | 3300025933 | Ga0207706_11214764 | Ga0207706_112147641 | 132 |
| 392 | 3300025945 | Ga0207679_10031355 | Ga0207679_100313553 | 132 |
| 393 | 3300025949 | Ga0207667_10475191 | Ga0207667_104751913 | 132 |
| 394 | 3300025981 | Ga0207640_10014591 | Ga0207640_100145912 | 132 |
| 395 | 3300026078 | Ga0207702_10054149 | Ga0207702_100541493 | 132 |
| 396 | 3300026116 | Ga0207674_10028194 | Ga0207674_100281946 | 132 |
| 397 | 3300026142 | Ga0207698_11222284 | Ga0207698_112222842 | 132 |
| 398 | 3300031903 | Ga0307407_10140567 | Ga0307407_101405672 | 132 |
| 399 | 3300031995 | Ga0307409_100568805 | Ga0307409_1005688051 | 132 |
| 400 | 3300032002 | Ga0307416_100631338 | Ga0307416_1006313381 | 132 |
| 401 | 3300037418 | Ga0395900_0546808 | Ga0395900_0546808_345_755 | 132 |
| 402 | 3300037471 | Ga0395905_1037366 | Ga0395905_1037366_10_426 | 132 |
| 403 | 3300045976 | Ga0466967_0038382 | Ga0466967_0038382_763_1197 | 132 |
| 404 | 3300045976 | Ga0466967_0047665 | Ga0466967_0047665_2968_3378 | 132 |
| 405 | 3300048904 | Ga0496101_1447997 | Ga0496101_1447997_106_516 | 132 |
| 406 | 3300048910 | Ga0496107_0170668 | Ga0496107_0170668_611_1021 | 132 |
| 407 | 3300048913 | Ga0496110_1294800 | Ga0496110_1294800_183_593 | 132 |
| 408 | 3300048914 | Ga0496111_0140569 | Ga0496111_0140569_750_1160 | 132 |
| 409 | 3300048915 | Ga0496112_0109240 | Ga0496112_0109240_1629_2039 | 132 |
| 410 | 3300049667 | Ga0501230_076047 | Ga0501230_076047_272_682 | 132 |
| 411 | 3300049765 | Ga0501268_026444 | Ga0501268_026444_459_869 | 132 |
| 412 | 3300049767 | Ga0501270_009736 | Ga0501270_009736_797_1207 | 132 |
| 413 | 3300050511 | nmdc:mga08y16_533163_c1 | nmdc:mga08y16_533163_c1_18_467 | 132 |
| 414 | 3300059492 | Ga0587073_0086711 | Ga0587073_0086711_281_712 | 132 |
| 415 | 3300001915 | JGI24741J21665_1018528 | JGI24741J21665_10185283 | 133 |
| 416 | 3300001979 | JGI24740J21852_10004688 | JGI24740J21852_100046888 | 133 |
| 417 | 3300001979 | JGI24740J21852_10026117 | JGI24740J21852_100261172 | 133 |
| 418 | 3300001991 | JGI24743J22301_10048885 | JGI24743J22301_100488852 | 133 |
| 419 | 3300002067 | JGI24735J21928_10057368 | JGI24735J21928_100573682 | 133 |
| 420 | 3300002075 | JGI24738J21930_10070799 | JGI24738J21930_100707992 | 133 |
| 421 | 3300005327 | Ga0070658_10020842 | Ga0070658_100208423 | 133 |
| 422 | 3300005328 | Ga0070676_10077479 | Ga0070676_100774792 | 133 |
| 423 | 3300005329 | Ga0070683_100007370 | Ga0070683_1000073707 | 133 |
| 424 | 3300005330 | Ga0070690_100060826 | Ga0070690_1000608264 | 133 |
| 425 | 3300005331 | Ga0070670_100030482 | Ga0070670_1000304822 | 133 |
| 426 | 3300005331 | Ga0070670_100091124 | Ga0070670_1000911242 | 133 |
| 427 | 3300005331 | Ga0070670_102008472 | Ga0070670_1020084721 | 133 |
| 428 | 3300005333 | Ga0070677_10592280 | Ga0070677_105922801 | 133 |
| 429 | 3300005335 | Ga0070666_10208281 | Ga0070666_102082813 | 133 |
| 430 | 3300005336 | Ga0070680_100007182 | Ga0070680_1000071823 | 133 |
| 431 | 3300005336 | Ga0070680_100217441 | Ga0070680_1002174414 | 133 |
| 432 | 3300005337 | Ga0070682_100230895 | Ga0070682_1002308951 | 133 |
| 433 | 3300005338 | Ga0068868_100147000 | Ga0068868_1001470002 | 133 |
| 434 | 3300005339 | Ga0070660_100003053 | Ga0070660_1000030537 | 133 |
| 435 | 3300005344 | Ga0070661_100034939 | Ga0070661_1000349394 | 133 |
| 436 | 3300005344 | Ga0070661_100118743 | Ga0070661_1001187432 | 133 |
| 437 | 3300005344 | Ga0070661_100325891 | Ga0070661_1003258912 | 133 |
| 438 | 3300005345 | Ga0070692_10011894 | Ga0070692_100118943 | 133 |
| 439 | 3300005355 | Ga0070671_100196846 | Ga0070671_1001968462 | 133 |
| 440 | 3300005364 | Ga0070673_100072882 | Ga0070673_1000728823 | 133 |
| 441 | 3300005366 | Ga0070659_100238704 | Ga0070659_1002387041 | 133 |
| 442 | 3300005367 | Ga0070667_100264287 | Ga0070667_1002642871 | 133 |
| 443 | 3300005455 | Ga0070663_100008493 | Ga0070663_1000084937 | 133 |
| 444 | 3300005455 | Ga0070663_100222806 | Ga0070663_1002228063 | 133 |
| 445 | 3300005456 | Ga0070678_100271767 | Ga0070678_1002717672 | 133 |
| 446 | 3300005456 | Ga0070678_101080991 | Ga0070678_1010809911 | 133 |
| 447 | 3300005458 | Ga0070681_10020408 | Ga0070681_100204087 | 133 |
| 448 | 3300005459 | Ga0068867_100093557 | Ga0068867_1000935572 | 133 |
| 449 | 3300005530 | Ga0070679_100015769 | Ga0070679_1000157695 | 133 |
| 450 | 3300005530 | Ga0070679_100211998 | Ga0070679_1002119982 | 133 |
| 451 | 3300005535 | Ga0070684_100007613 | Ga0070684_1000076136 | 133 |
| 452 | 3300005539 | Ga0068853_101579720 | Ga0068853_1015797201 | 133 |
| 453 | 3300005546 | Ga0070696_100804678 | Ga0070696_1008046782 | 133 |
| 454 | 3300005547 | Ga0070693_100120838 | Ga0070693_1001208382 | 133 |
| 455 | 3300005563 | Ga0068855_100070606 | Ga0068855_1000706063 | 133 |
| 456 | 3300005563 | Ga0068855_100082525 | Ga0068855_1000825254 | 133 |
| 457 | 3300005564 | Ga0070664_100003026 | Ga0070664_1000030267 | 133 |
| 458 | 3300005614 | Ga0068856_100014742 | Ga0068856_1000147425 | 133 |
| 459 | 3300005616 | Ga0068852_100688902 | Ga0068852_1006889022 | 133 |
| 460 | 3300009177 | Ga0105248_10760313 | Ga0105248_107603132 | 133 |
| 461 | 3300009545 | Ga0105237_10099852 | Ga0105237_100998525 | 133 |
| 462 | 3300009551 | Ga0105238_10923203 | Ga0105238_109232032 | 133 |
| 463 | 3300013100 | Ga0157373_10093973 | Ga0157373_100939733 | 133 |
| 464 | 3300013100 | Ga0157373_10104195 | Ga0157373_101041953 | 133 |
| 465 | 3300013102 | Ga0157371_10079776 | Ga0157371_100797762 | 133 |
| 466 | 3300013104 | Ga0157370_10015768 | Ga0157370_100157682 | 133 |
| 467 | 3300013105 | Ga0157369_10063577 | Ga0157369_100635775 | 133 |
| 468 | 3300013296 | Ga0157374_10101337 | Ga0157374_101013373 | 133 |
| 469 | 3300014968 | Ga0157379_10003612 | Ga0157379_100036125 | 133 |
| 470 | 3300020076 | Ga0206355_1223371 | Ga0206355_12233712 | 133 |
| 471 | 3300025321 | Ga0207656_10088655 | Ga0207656_100886551 | 133 |
| 472 | 3300025903 | Ga0207680_10434187 | Ga0207680_104341872 | 133 |
| 473 | 3300025904 | Ga0207647_10104745 | Ga0207647_101047453 | 133 |
| 474 | 3300025904 | Ga0207647_10166710 | Ga0207647_101667102 | 133 |
| 475 | 3300025907 | Ga0207645_10008669 | Ga0207645_100086692 | 133 |
| 476 | 3300025909 | Ga0207705_10000493 | Ga0207705_100004938 | 133 |
| 477 | 3300025909 | Ga0207705_10005027 | Ga0207705_100050272 | 133 |
| 478 | 3300025909 | Ga0207705_10039003 | Ga0207705_100390033 | 133 |
| 479 | 3300025911 | Ga0207654_10118589 | Ga0207654_101185894 | 133 |
| 480 | 3300025912 | Ga0207707_10025551 | Ga0207707_100255514 | 133 |
| 481 | 3300025912 | Ga0207707_10343098 | Ga0207707_103430982 | 133 |
| 482 | 3300025917 | Ga0207660_10000770 | Ga0207660_100007708 | 133 |
| 483 | 3300025917 | Ga0207660_10019326 | Ga0207660_100193266 | 133 |
| 484 | 3300025919 | Ga0207657_10001678 | Ga0207657_1000167816 | 133 |
| 485 | 3300025919 | Ga0207657_10002261 | Ga0207657_1000226110 | 133 |
| 486 | 3300025919 | Ga0207657_10011262 | Ga0207657_100112627 | 133 |
| 487 | 3300025919 | Ga0207657_10140861 | Ga0207657_101408614 | 133 |
| 488 | 3300025920 | Ga0207649_10018705 | Ga0207649_100187053 | 133 |
| 489 | 3300025920 | Ga0207649_10128035 | Ga0207649_101280352 | 133 |
| 490 | 3300025921 | Ga0207652_10000034 | Ga0207652_10000034120 | 133 |
| 491 | 3300025921 | Ga0207652_10028676 | Ga0207652_100286767 | 133 |
| 492 | 3300025925 | Ga0207650_10093483 | Ga0207650_100934832 | 133 |
| 493 | 3300025925 | Ga0207650_10457245 | Ga0207650_104572452 | 133 |
| 494 | 3300025931 | Ga0207644_10486112 | Ga0207644_104861122 | 133 |
| 495 | 3300025932 | Ga0207690_10099389 | Ga0207690_100993892 | 133 |
| 496 | 3300025932 | Ga0207690_10120973 | Ga0207690_101209735 | 133 |
| 497 | 3300025932 | Ga0207690_10711457 | Ga0207690_107114572 | 133 |
| 498 | 3300025933 | Ga0207706_10020249 | Ga0207706_100202496 | 133 |
| 499 | 3300025944 | Ga0207661_10002726 | Ga0207661_100027268 | 133 |
| 500 | 3300025945 | Ga0207679_10001488 | Ga0207679_1000148819 | 133 |
| 501 | 3300025945 | Ga0207679_10426486 | Ga0207679_104264861 | 133 |
| 502 | 3300025949 | Ga0207667_10069541 | Ga0207667_100695414 | 133 |
| 503 | 3300025949 | Ga0207667_10095578 | Ga0207667_100955782 | 133 |
| 504 | 3300025981 | Ga0207640_10553422 | Ga0207640_105534222 | 133 |
| 505 | 3300025986 | Ga0207658_10026119 | Ga0207658_100261194 | 133 |
| 506 | 3300026023 | Ga0207677_10277365 | Ga0207677_102773652 | 133 |
| 507 | 3300026041 | Ga0207639_10318103 | Ga0207639_103181032 | 133 |
| 508 | 3300026041 | Ga0207639_10334654 | Ga0207639_103346544 | 133 |
| 509 | 3300026067 | Ga0207678_10004938 | Ga0207678_100049382 | 133 |
| 510 | 3300026067 | Ga0207678_10011128 | Ga0207678_100111287 | 133 |
| 511 | 3300026067 | Ga0207678_10051977 | Ga0207678_100519776 | 133 |
| 512 | 3300026078 | Ga0207702_10022362 | Ga0207702_100223623 | 133 |
| 513 | 3300026089 | Ga0207648_10118017 | Ga0207648_101180172 | 133 |
| 514 | 3300026116 | Ga0207674_10058545 | Ga0207674_100585454 | 133 |
| 515 | 3300026116 | Ga0207674_10194371 | Ga0207674_101943713 | 133 |
| 516 | 3300026116 | Ga0207674_11311970 | Ga0207674_113119702 | 133 |
| 517 | 3300026121 | Ga0207683_10195399 | Ga0207683_101953993 | 133 |
| 518 | 3300026142 | Ga0207698_10077733 | Ga0207698_100777333 | 133 |
| 519 | 3300026142 | Ga0207698_10392822 | Ga0207698_103928223 | 133 |
| 520 | 3300026142 | Ga0207698_11073888 | Ga0207698_110738881 | 133 |
| 521 | 3300031731 | Ga0307405_10370384 | Ga0307405_103703842 | 133 |
| 522 | 3300031901 | Ga0307406_10181586 | Ga0307406_101815862 | 133 |
| 523 | 3300037312 | Ga0395899_0026489 | Ga0395899_0026489_1121_1540 | 133 |
| 524 | 3300037418 | Ga0395900_0003085 | Ga0395900_0003085_11183_11602 | 133 |
| 525 | 3300037418 | Ga0395900_0013504 | Ga0395900_0013504_5713_6120 | 133 |
| 526 | 3300037418 | Ga0395900_0479947 | Ga0395900_0479947_682_1089 | 133 |
| 527 | 3300037466 | Ga0395898_0010465 | Ga0395898_0010465_6502_6921 | 133 |
| 528 | 3300037466 | Ga0395898_0352082 | Ga0395898_0352082_640_1047 | 133 |
| 529 | 3300037466 | Ga0395898_0822954 | Ga0395898_0822954_271_678 | 133 |
| 530 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_90422_90829 | 133 |
| 531 | 3300037471 | Ga0395905_0028195 | Ga0395905_0028195_1490_1909 | 133 |
| 532 | 3300038443 | Ga0395901_0044992 | Ga0395901_0044992_1439_1858 | 133 |
| 533 | 3300042007 | Ga0439449_0095892 | Ga0439449_0095892_626_1033 | 133 |
| 534 | 3300044656 | Ga0466969_0174412 | Ga0466969_0174412_11_418 | 133 |
| 535 | 3300044684 | Ga0466966_0075412 | Ga0466966_0075412_1653_2060 | 133 |
| 536 | 3300044693 | Ga0466961_0048228 | Ga0466961_0048228_2272_2679 | 133 |
| 537 | 3300044719 | Ga0466971_0025392 | Ga0466971_0025392_619_1053 | 133 |
| 538 | 3300045049 | Ga0466959_0176653 | Ga0466959_0176653_755_1162 | 133 |
| 539 | 3300045836 | Ga0466958_0468886 | Ga0466958_0468886_288_695 | 133 |
| 540 | 3300046492 | Ga0495585_0120095 | Ga0495585_0120095_769_1203 | 133 |
| 541 | 3300046684 | Ga0495669_0101523 | Ga0495669_0101523_634_1056 | 133 |
| 542 | 3300046684 | Ga0495669_0313169 | Ga0495669_0313169_187_594 | 133 |
| 543 | 3300048903 | Ga0496100_0165871 | Ga0496100_0165871_32_445 | 133 |
| 544 | 3300048904 | Ga0496101_0124376 | Ga0496101_0124376_1031_1444 | 133 |
| 545 | 3300048905 | Ga0496102_0141200 | Ga0496102_0141200_1529_1942 | 133 |
| 546 | 3300048906 | Ga0496103_0044232 | Ga0496103_0044232_1300_1713 | 133 |
| 547 | 3300048907 | Ga0496104_0215519 | Ga0496104_0215519_109_522 | 133 |
| 548 | 3300048908 | Ga0496105_0096247 | Ga0496105_0096247_580_993 | 133 |
| 549 | 3300048909 | Ga0496106_0047950 | Ga0496106_0047950_2050_2463 | 133 |
| 550 | 3300048910 | Ga0496107_0025841 | Ga0496107_0025841_1731_2144 | 133 |
| 551 | 3300048910 | Ga0496107_0510113 | Ga0496107_0510113_424_831 | 133 |
| 552 | 3300048911 | Ga0496108_0009895 | Ga0496108_0009895_1228_1641 | 133 |
| 553 | 3300048911 | Ga0496108_0038691 | Ga0496108_0038691_1373_1795 | 133 |
| 554 | 3300048912 | Ga0496109_0119558 | Ga0496109_0119558_1137_1550 | 133 |
| 555 | 3300048913 | Ga0496110_0047002 | Ga0496110_0047002_1848_2261 | 133 |
| 556 | 3300048914 | Ga0496111_0007276 | Ga0496111_0007276_95_508 | 133 |
| 557 | 3300048915 | Ga0496112_0058934 | Ga0496112_0058934_2814_3227 | 133 |
| 558 | 3300048916 | Ga0496113_0012024 | Ga0496113_0012024_2137_2550 | 133 |
| 559 | 3300060344 | Ga0587071_022250 | Ga0587071_022250_190_603 | 133 |
| 560 | 3300005290 | Ga0065712_10211573 | Ga0065712_102115731 | 134 |
| 561 | 3300005331 | Ga0070670_100073467 | Ga0070670_1000734672 | 134 |
| 562 | 3300005331 | Ga0070670_100159061 | Ga0070670_1001590612 | 134 |
| 563 | 3300005331 | Ga0070670_100325843 | Ga0070670_1003258434 | 134 |
| 564 | 3300005335 | Ga0070666_10007668 | Ga0070666_100076682 | 134 |
| 565 | 3300005338 | Ga0068868_100157935 | Ga0068868_1001579352 | 134 |
| 566 | 3300005344 | Ga0070661_100023710 | Ga0070661_1000237102 | 134 |
| 567 | 3300005355 | Ga0070671_100081281 | Ga0070671_1000812813 | 134 |
| 568 | 3300005355 | Ga0070671_100151912 | Ga0070671_1001519123 | 134 |
| 569 | 3300005364 | Ga0070673_100068180 | Ga0070673_1000681802 | 134 |
| 570 | 3300005367 | Ga0070667_100008539 | Ga0070667_1000085399 | 134 |
| 571 | 3300005367 | Ga0070667_100462252 | Ga0070667_1004622521 | 134 |
| 572 | 3300005455 | Ga0070663_100817736 | Ga0070663_1008177362 | 134 |
| 573 | 3300005456 | Ga0070678_100001567 | Ga0070678_10000156712 | 134 |
| 574 | 3300005457 | Ga0070662_100318556 | Ga0070662_1003185562 | 134 |
| 575 | 3300005459 | Ga0068867_100830755 | Ga0068867_1008307551 | 134 |
| 576 | 3300005466 | Ga0070685_10057207 | Ga0070685_100572072 | 134 |
| 577 | 3300005539 | Ga0068853_101073267 | Ga0068853_1010732671 | 134 |
| 578 | 3300005548 | Ga0070665_100124803 | Ga0070665_1001248033 | 134 |
| 579 | 3300005563 | Ga0068855_100764707 | Ga0068855_1007647072 | 134 |
| 580 | 3300005564 | Ga0070664_100129822 | Ga0070664_1001298223 | 134 |
| 581 | 3300005617 | Ga0068859_100257758 | Ga0068859_1002577583 | 134 |
| 582 | 3300005618 | Ga0068864_100040637 | Ga0068864_1000406372 | 134 |
| 583 | 3300005841 | Ga0068863_100022022 | Ga0068863_1000220223 | 134 |
| 584 | 3300005841 | Ga0068863_100079639 | Ga0068863_1000796392 | 134 |
| 585 | 3300005842 | Ga0068858_100002753 | Ga0068858_1000027532 | 134 |
| 586 | 3300005842 | Ga0068858_100864297 | Ga0068858_1008642972 | 134 |
| 587 | 3300006237 | Ga0097621_100011209 | Ga0097621_1000112099 | 134 |
| 588 | 3300006237 | Ga0097621_100079858 | Ga0097621_1000798583 | 134 |
| 589 | 3300006931 | Ga0097620_100257750 | Ga0097620_1002577503 | 134 |
| 590 | 3300009101 | Ga0105247_11578015 | Ga0105247_115780151 | 134 |
| 591 | 3300009177 | Ga0105248_10034268 | Ga0105248_100342683 | 134 |
| 592 | 3300009177 | Ga0105248_10034516 | Ga0105248_100345166 | 134 |
| 593 | 3300009177 | Ga0105248_10044563 | Ga0105248_100445631 | 134 |
| 594 | 3300009553 | Ga0105249_10297614 | Ga0105249_102976142 | 134 |
| 595 | 3300013102 | Ga0157371_10060886 | Ga0157371_100608862 | 134 |
| 596 | 3300013296 | Ga0157374_10002253 | Ga0157374_1000225318 | 134 |
| 597 | 3300013306 | Ga0163162_10021265 | Ga0163162_100212652 | 134 |
| 598 | 3300013308 | Ga0157375_10004680 | Ga0157375_100046808 | 134 |
| 599 | 3300014325 | Ga0163163_10002706 | Ga0163163_1000270616 | 134 |
| 600 | 3300014968 | Ga0157379_11834004 | Ga0157379_118340042 | 134 |
| 601 | 3300021384 | Ga0213876_10807115 | Ga0213876_108071151 | 134 |
| 602 | 3300025901 | Ga0207688_10197216 | Ga0207688_101972162 | 134 |
| 603 | 3300025903 | Ga0207680_10250498 | Ga0207680_102504982 | 134 |
| 604 | 3300025903 | Ga0207680_10471134 | Ga0207680_104711342 | 134 |
| 605 | 3300025925 | Ga0207650_10017046 | Ga0207650_100170465 | 134 |
| 606 | 3300025925 | Ga0207650_10278944 | Ga0207650_102789443 | 134 |
| 607 | 3300025931 | Ga0207644_10025723 | Ga0207644_100257233 | 134 |
| 608 | 3300025931 | Ga0207644_10031105 | Ga0207644_100311053 | 134 |
| 609 | 3300025933 | Ga0207706_10007819 | Ga0207706_1000781911 | 134 |
| 610 | 3300025940 | Ga0207691_10026469 | Ga0207691_100264697 | 134 |
| 611 | 3300025941 | Ga0207711_10006956 | Ga0207711_100069563 | 134 |
| 612 | 3300025941 | Ga0207711_10047302 | Ga0207711_100473023 | 134 |
| 613 | 3300025941 | Ga0207711_10186107 | Ga0207711_101861072 | 134 |
| 614 | 3300025945 | Ga0207679_10025135 | Ga0207679_100251354 | 134 |
| 615 | 3300025986 | Ga0207658_10096138 | Ga0207658_100961383 | 134 |
| 616 | 3300025986 | Ga0207658_10177607 | Ga0207658_101776073 | 134 |
| 617 | 3300026035 | Ga0207703_10142454 | Ga0207703_101424541 | 134 |
| 618 | 3300026041 | Ga0207639_10381418 | Ga0207639_103814182 | 134 |
| 619 | 3300026067 | Ga0207678_11207644 | Ga0207678_112076442 | 134 |
| 620 | 3300026088 | Ga0207641_10112062 | Ga0207641_101120623 | 134 |
| 621 | 3300026089 | Ga0207648_10831389 | Ga0207648_108313892 | 134 |
| 622 | 3300026095 | Ga0207676_10014327 | Ga0207676_100143273 | 134 |
| 623 | 3300026121 | Ga0207683_10004970 | Ga0207683_100049703 | 134 |
| 624 | 3300028379 | Ga0268266_10137169 | Ga0268266_101371693 | 134 |
| 625 | 3300028381 | Ga0268264_10308887 | Ga0268264_103088873 | 134 |
| 626 | 3300028381 | Ga0268264_10747498 | Ga0268264_107474982 | 134 |
| 627 | 3300031456 | Ga0307513_10504345 | Ga0307513_105043451 | 134 |
| 628 | 3300032004 | Ga0307414_10792635 | Ga0307414_107926352 | 134 |
| 629 | 3300037312 | Ga0395899_0059381 | Ga0395899_0059381_1765_2175 | 134 |
| 630 | 3300037466 | Ga0395898_0064367 | Ga0395898_0064367_2584_2994 | 134 |
| 631 | 3300042157 | Ga0439458_0060151 | Ga0439458_0060151_475_885 | 134 |
| 632 | 3300046528 | Ga0495642_0376421 | Ga0495642_0376421_137_547 | 134 |
| 633 | 3300047445 | Ga0495677_0047340 | Ga0495677_0047340_917_1342 | 134 |
| 634 | 3300048904 | Ga0496101_0118283 | Ga0496101_0118283_93_503 | 134 |
| 635 | 3300048904 | Ga0496101_0189895 | Ga0496101_0189895_734_1144 | 134 |
| 636 | 3300048909 | Ga0496106_0033452 | Ga0496106_0033452_1437_1847 | 134 |
| 637 | 3300048910 | Ga0496107_0046907 | Ga0496107_0046907_2457_2867 | 134 |
| 638 | 3300048911 | Ga0496108_0040243 | Ga0496108_0040243_2060_2470 | 134 |
| 639 | 3300048912 | Ga0496109_0145862 | Ga0496109_0145862_1083_1493 | 134 |
| 640 | 3300048913 | Ga0496110_0091427 | Ga0496110_0091427_292_702 | 134 |
| 641 | 3300048914 | Ga0496111_0148522 | Ga0496111_0148522_588_998 | 134 |
| 642 | 3300048915 | Ga0496112_0172125 | Ga0496112_0172125_1305_1715 | 134 |
| 643 | 3300048916 | Ga0496113_0073323 | Ga0496113_0073323_849_1259 | 134 |
| 644 | 3300048917 | Ga0496114_0030533 | Ga0496114_0030533_638_1048 | 134 |
| 645 | 3300048918 | Ga0496115_0144384 | Ga0496115_0144384_620_1030 | 134 |
| 646 | 3300050512 | nmdc:mga0n895_544974_c1 | nmdc:mga0n895_544974_c1_285_695 | 134 |
| 647 | 3300005367 | Ga0070667_100243972 | Ga0070667_1002439723 | 135 |
| 648 | 3300013102 | Ga0157371_10209660 | Ga0157371_102096602 | 135 |
| 649 | 3300013297 | Ga0157378_11842491 | Ga0157378_118424912 | 135 |
| 650 | 3300025986 | Ga0207658_10107463 | Ga0207658_101074632 | 135 |
| 651 | 3300026088 | Ga0207641_10064867 | Ga0207641_100648673 | 135 |
| 652 | 3300037418 | Ga0395900_0015910 | Ga0395900_0015910_593_1015 | 135 |
| 653 | 3300037418 | Ga0395900_0203772 | Ga0395900_0203772_774_1187 | 135 |
| 654 | 3300037466 | Ga0395898_0329791 | Ga0395898_0329791_235_648 | 135 |
| 655 | 3300038443 | Ga0395901_0001126 | Ga0395901_0001126_20994_21416 | 135 |
| 656 | 3300044656 | Ga0466969_0084983 | Ga0466969_0084983_1059_1469 | 135 |
| 657 | 3300044684 | Ga0466966_0151438 | Ga0466966_0151438_194_604 | 135 |
| 658 | 3300044694 | Ga0466963_0058368 | Ga0466963_0058368_1893_2303 | 135 |
| 659 | 3300044901 | Ga0466960_0297462 | Ga0466960_0297462_124_543 | 135 |
| 660 | 3300045049 | Ga0466959_0026160 | Ga0466959_0026160_1208_1618 | 135 |
| 661 | 3300045836 | Ga0466958_0032434 | Ga0466958_0032434_2213_2623 | 135 |
| 662 | 3300045836 | Ga0466958_0104886 | Ga0466958_0104886_691_1101 | 135 |
| 663 | 3300048910 | Ga0496107_0144468 | Ga0496107_0144468_570_983 | 135 |
| 664 | 3300001915 | JGI24741J21665_1012998 | JGI24741J21665_10129982 | 136 |
| 665 | 3300001979 | JGI24740J21852_10008945 | JGI24740J21852_100089455 | 136 |
| 666 | 3300001989 | JGI24739J22299_10004473 | JGI24739J22299_100044734 | 136 |
| 667 | 3300001990 | JGI24737J22298_10000987 | JGI24737J22298_100009879 | 136 |
| 668 | 3300002067 | JGI24735J21928_10058798 | JGI24735J21928_100587982 | 136 |
| 669 | 3300002075 | JGI24738J21930_10000812 | JGI24738J21930_100008126 | 136 |
| 670 | 3300005327 | Ga0070658_10000269 | Ga0070658_1000026937 | 136 |
| 671 | 3300005329 | Ga0070683_100001138 | Ga0070683_10000113811 | 136 |
| 672 | 3300005329 | Ga0070683_100361267 | Ga0070683_1003612672 | 136 |
| 673 | 3300005329 | Ga0070683_101090397 | Ga0070683_1010903971 | 136 |
| 674 | 3300005330 | Ga0070690_100657645 | Ga0070690_1006576452 | 136 |
| 675 | 3300005331 | Ga0070670_100028324 | Ga0070670_1000283242 | 136 |
| 676 | 3300005335 | Ga0070666_10000330 | Ga0070666_1000033020 | 136 |
| 677 | 3300005339 | Ga0070660_100000109 | Ga0070660_10000010912 | 136 |
| 678 | 3300005339 | Ga0070660_100582750 | Ga0070660_1005827501 | 136 |
| 679 | 3300005344 | Ga0070661_100000070 | Ga0070661_10000007077 | 136 |
| 680 | 3300005355 | Ga0070671_100026341 | Ga0070671_1000263415 | 136 |
| 681 | 3300005366 | Ga0070659_100000312 | Ga0070659_10000031227 | 136 |
| 682 | 3300005366 | Ga0070659_100053970 | Ga0070659_1000539705 | 136 |
| 683 | 3300005367 | Ga0070667_100081281 | Ga0070667_1000812815 | 136 |
| 684 | 3300005435 | Ga0070714_100304477 | Ga0070714_1003044772 | 136 |
| 685 | 3300005455 | Ga0070663_100006534 | Ga0070663_1000065347 | 136 |
| 686 | 3300005457 | Ga0070662_100000037 | Ga0070662_10000003767 | 136 |
| 687 | 3300005539 | Ga0068853_100000309 | Ga0068853_10000030913 | 136 |
| 688 | 3300005546 | Ga0070696_100137209 | Ga0070696_1001372091 | 136 |
| 689 | 3300005547 | Ga0070693_100003397 | Ga0070693_1000033975 | 136 |
| 690 | 3300005548 | Ga0070665_100002925 | Ga0070665_10000292513 | 136 |
| 691 | 3300005563 | Ga0068855_100037585 | Ga0068855_1000375857 | 136 |
| 692 | 3300005563 | Ga0068855_101283533 | Ga0068855_1012835332 | 136 |
| 693 | 3300005564 | Ga0070664_100000077 | Ga0070664_10000007713 | 136 |
| 694 | 3300005577 | Ga0068857_100020826 | Ga0068857_1000208262 | 136 |
| 695 | 3300005577 | Ga0068857_101034718 | Ga0068857_1010347182 | 136 |
| 696 | 3300005578 | Ga0068854_100503140 | Ga0068854_1005031401 | 136 |
| 697 | 3300005614 | Ga0068856_100000444 | Ga0068856_10000044437 | 136 |
| 698 | 3300005614 | Ga0068856_100153077 | Ga0068856_1001530774 | 136 |
| 699 | 3300005615 | Ga0070702_100231833 | Ga0070702_1002318332 | 136 |
| 700 | 3300005616 | Ga0068852_100000350 | Ga0068852_1000003505 | 136 |
| 701 | 3300005618 | Ga0068864_100002819 | Ga0068864_1000028195 | 136 |
| 702 | 3300005834 | Ga0068851_10006475 | Ga0068851_100064755 | 136 |
| 703 | 3300005842 | Ga0068858_100020528 | Ga0068858_1000205287 | 136 |
| 704 | 3300006237 | Ga0097621_100386946 | Ga0097621_1003869462 | 136 |
| 705 | 3300009174 | Ga0105241_10035146 | Ga0105241_100351464 | 136 |
| 706 | 3300009177 | Ga0105248_10000719 | Ga0105248_1000071914 | 136 |
| 707 | 3300009551 | Ga0105238_10238785 | Ga0105238_102387852 | 136 |
| 708 | 3300013100 | Ga0157373_10239812 | Ga0157373_102398123 | 136 |
| 709 | 3300013102 | Ga0157371_10009369 | Ga0157371_100093692 | 136 |
| 710 | 3300013105 | Ga0157369_10083232 | Ga0157369_100832325 | 136 |
| 711 | 3300013105 | Ga0157369_10743491 | Ga0157369_107434913 | 136 |
| 712 | 3300013296 | Ga0157374_10437965 | Ga0157374_104379653 | 136 |
| 713 | 3300013307 | Ga0157372_10143435 | Ga0157372_101434355 | 136 |
| 714 | 3300013307 | Ga0157372_10506493 | Ga0157372_105064932 | 136 |
| 715 | 3300014325 | Ga0163163_10000123 | Ga0163163_1000012377 | 136 |
| 716 | 3300014968 | Ga0157379_10013809 | Ga0157379_100138092 | 136 |
| 717 | 3300020082 | Ga0206353_10745816 | Ga0206353_107458162 | 136 |
| 718 | 3300025321 | Ga0207656_10051647 | Ga0207656_100516472 | 136 |
| 719 | 3300025903 | Ga0207680_10033482 | Ga0207680_100334825 | 136 |
| 720 | 3300025904 | Ga0207647_10021670 | Ga0207647_100216705 | 136 |
| 721 | 3300025909 | Ga0207705_10000086 | Ga0207705_1000008614 | 136 |
| 722 | 3300025909 | Ga0207705_10052448 | Ga0207705_100524485 | 136 |
| 723 | 3300025911 | Ga0207654_10031984 | Ga0207654_100319843 | 136 |
| 724 | 3300025919 | Ga0207657_10001020 | Ga0207657_1000102019 | 136 |
| 725 | 3300025919 | Ga0207657_10524623 | Ga0207657_105246232 | 136 |
| 726 | 3300025920 | Ga0207649_10000420 | Ga0207649_1000042031 | 136 |
| 727 | 3300025924 | Ga0207694_10123657 | Ga0207694_101236572 | 136 |
| 728 | 3300025925 | Ga0207650_10032900 | Ga0207650_100329002 | 136 |
| 729 | 3300025929 | Ga0207664_10854551 | Ga0207664_108545512 | 136 |
| 730 | 3300025931 | Ga0207644_10006312 | Ga0207644_100063126 | 136 |
| 731 | 3300025932 | Ga0207690_10000413 | Ga0207690_1000041313 | 136 |
| 732 | 3300025933 | Ga0207706_10000192 | Ga0207706_1000019256 | 136 |
| 733 | 3300025941 | Ga0207711_10002038 | Ga0207711_1000203817 | 136 |
| 734 | 3300025944 | Ga0207661_10028875 | Ga0207661_100288754 | 136 |
| 735 | 3300025945 | Ga0207679_10000347 | Ga0207679_1000034721 | 136 |
| 736 | 3300025949 | Ga0207667_10000850 | Ga0207667_1000085032 | 136 |
| 737 | 3300025949 | Ga0207667_10364114 | Ga0207667_103641142 | 136 |
| 738 | 3300026035 | Ga0207703_10014313 | Ga0207703_100143135 | 136 |
| 739 | 3300026041 | Ga0207639_10000524 | Ga0207639_1000052412 | 136 |
| 740 | 3300026067 | Ga0207678_10010668 | Ga0207678_100106682 | 136 |
| 741 | 3300026078 | Ga0207702_10001885 | Ga0207702_100018858 | 136 |
| 742 | 3300026078 | Ga0207702_10211184 | Ga0207702_102111844 | 136 |
| 743 | 3300026095 | Ga0207676_10006185 | Ga0207676_100061858 | 136 |
| 744 | 3300026116 | Ga0207674_10008897 | Ga0207674_100088978 | 136 |
| 745 | 3300026116 | Ga0207674_10986198 | Ga0207674_109861981 | 136 |
| 746 | 3300026142 | Ga0207698_10000542 | Ga0207698_100005422 | 136 |
| 747 | 3300026142 | Ga0207698_10123193 | Ga0207698_101231934 | 136 |
| 748 | 3300026142 | Ga0207698_10692656 | Ga0207698_106926561 | 136 |
| 749 | 3300028379 | Ga0268266_10003812 | Ga0268266_100038127 | 136 |
| 750 | 3300028381 | Ga0268264_10488669 | Ga0268264_104886693 | 136 |
| 751 | 3300035112 | Ga0373932_0128468 | Ga0373932_0128468_307_717 | 136 |
| 752 | 3300035114 | Ga0373939_0042642 | Ga0373939_0042642_146_556 | 136 |
| 753 | 3300035241 | Ga0373961_0055104 | Ga0373961_0055104_728_1138 | 136 |
| 754 | 3300035691 | Ga0373931_0015417 | Ga0373931_0015417_1330_1740 | 136 |
| 755 | 3300037312 | Ga0395899_0239317 | Ga0395899_0239317_400_813 | 136 |
| 756 | 3300037312 | Ga0395899_0395108 | Ga0395899_0395108_425_844 | 136 |
| 757 | 3300037312 | Ga0395899_0996460 | Ga0395899_0996460_60_470 | 136 |
| 758 | 3300037418 | Ga0395900_0016429 | Ga0395900_0016429_1773_2192 | 136 |
| 759 | 3300037418 | Ga0395900_0089079 | Ga0395900_0089079_951_1361 | 136 |
| 760 | 3300037418 | Ga0395900_0097007 | Ga0395900_0097007_942_1355 | 136 |
| 761 | 3300037466 | Ga0395898_0094728 | Ga0395898_0094728_1085_1495 | 136 |
| 762 | 3300037471 | Ga0395905_0139090 | Ga0395905_0139090_1504_1917 | 136 |
| 763 | 3300037471 | Ga0395905_0738714 | Ga0395905_0738714_330_740 | 136 |
| 764 | 3300038443 | Ga0395901_0165413 | Ga0395901_0165413_1538_1957 | 136 |
| 765 | 3300038443 | Ga0395901_0170171 | Ga0395901_0170171_454_867 | 136 |
| 766 | 3300038443 | Ga0395901_0525600 | Ga0395901_0525600_713_1123 | 136 |
| 767 | 3300044694 | Ga0466963_0023693 | Ga0466963_0023693_2388_2822 | 136 |
| 768 | 3300044842 | Ga0466957_0005582 | Ga0466957_0005582_5743_6177 | 136 |
| 769 | 3300044842 | Ga0466957_0009431 | Ga0466957_0009431_1177_1599 | 136 |
| 770 | 3300045976 | Ga0466967_0020997 | Ga0466967_0020997_3922_4332 | 136 |
| 771 | 3300045976 | Ga0466967_0067578 | Ga0466967_0067578_2189_2623 | 136 |
| 772 | 3300045976 | Ga0466967_0071901 | Ga0466967_0071901_2296_2706 | 136 |
| 773 | 3300045976 | Ga0466967_0343418 | Ga0466967_0343418_146_556 | 136 |
| 774 | 3300045976 | Ga0466967_1456446 | Ga0466967_1456446_135_557 | 136 |
| 775 | 3300048903 | Ga0496100_0944117 | Ga0496100_0944117_150_560 | 136 |
| 776 | 3300048907 | Ga0496104_0242889 | Ga0496104_0242889_122_532 | 136 |
| 777 | 3300048908 | Ga0496105_0282734 | Ga0496105_0282734_451_861 | 136 |
| 778 | 3300048912 | Ga0496109_0725456 | Ga0496109_0725456_236_646 | 136 |
| 779 | 3300048913 | Ga0496110_0315668 | Ga0496110_0315668_281_691 | 136 |
| 780 | 3300048915 | Ga0496112_1012585 | Ga0496112_1012585_154_564 | 136 |
| 781 | 3300048916 | Ga0496113_0184825 | Ga0496113_0184825_1217_1627 | 136 |
| 782 | 3300049586 | Ga0501070_0067070 | Ga0501070_0067070_130_546 | 136 |
| 783 | 3300049587 | Ga0501071_0093261 | Ga0501071_0093261_1134_1550 | 136 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vhz-assembly1.cif.gz_B | crystal structure of adp compounds hydrolase | 0.8626 | 67 | 99 |
| 5c8l-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.8312 | 67 | 100 |
| 5c7q-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.8283 | 67 | 100 |
| 5i8u-assembly2.cif.gz_A | crystal structure of the rv1700 (mt adprase) e142q mutant | 0.8204 | 67 | 101 |
| 1xjv-assembly1.cif.gz_A | crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag) | 0.796 | 67 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5c8lB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8303 | 67 | 100 | 3.90.79.10 |
| 5i8uB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8072 | 67 | 101 | 3.90.79.10 |
| af_Q0D7W8_61_281_2.120.10.60 | Mainly Beta;6 Propeller;Neuraminidase;Tricorn protease N-terminal domain | 0.8065 | 64 | 110 | 2.120.10.60 |
| af_A0A0R0JA37_7_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7984 | 67 | 99 | 2.40.50.140 |
| af_A0A0R0EKE2_8_109_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7926 | 67 | 99 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0RK78-F1-model_v4 | Uncharacterized protein | 0.8865 | 67 | 109 |
|
| AF-A0A2H6IWU2-F1-model_v4 | Uncharacterized protein | 0.8767 | 67 | 109 |
|
| AF-A0A5A8CHI9-F1-model_v4 | Uncharacterized protein | 0.873 | 67 | 110 |
GO:0016567
|
| AF-A0A2A5F1X9-F1-model_v4 | Uncharacterized protein | 0.8409 | 69 | 110 |
|
| AF-A0A225E0T6-F1-model_v4 | Uncharacterized protein | 0.8321 | 70 | 116 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar