F480648

General Info

Members Datasets Scaffolds Average Seq Length
783 238 783 133

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100091124|Ga0070670_1000911242
Length 152
Sequence MRRRLIVALGILALAACDDGAQQQTNQPTIKVRGTEQNQLHTLNAMNLSIALKHAIYDAGYTCKRITDAGFVAYYQNLDMWAAHCEYDKGASRDWAIFAGPDGSAQVRDCKDIVGTGVPACAITKRPKGSFGNPPSGAEAPSDGAKTDTNLG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.02
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1012998 3300001915 Bacteria 1419
2 JGI24741J21665_1018528 3300001915 Unclassified 1112
3 JGI24740J21852_10004688 3300001979 Bacteria 5857
4 JGI24740J21852_10008945 3300001979 Bacteria 3955
5 JGI24740J21852_10026117 3300001979 Bacteria 1960
6 JGI24739J22299_10004473 3300001989 Bacteria 5351
7 JGI24739J22299_10014393 3300001989 Bacteria 2878
8 JGI24737J22298_10000655 3300001990 Bacteria 12249
9 JGI24737J22298_10000987 3300001990 Bacteria 10119
10 JGI24737J22298_10056357 3300001990 Bacteria 1187
11 JGI24743J22301_10048885 3300001991 Bacteria 859
12 JGI24735J21928_10057368 3300002067 Unclassified 1121
13 JGI24735J21928_10058798 3300002067 Bacteria 1106
14 JGI24738J21930_10000812 3300002075 Bacteria 8970
15 JGI24738J21930_10070799 3300002075 Bacteria 722
16 Ga0065712_10211573 3300005290 Unclassified 1071
17 Ga0070658_10000269 3300005327 Bacteria 45712
18 Ga0070658_10007111 3300005327 Bacteria 9035
19 Ga0070658_10016356 3300005327 Bacteria 5937
20 Ga0070658_10020842 3300005327 Bacteria 5252
21 Ga0070658_10026585 3300005327 Bacteria 4643
22 Ga0070658_10706906 3300005327 Bacteria 875
23 Ga0070676_10008701 3300005328 Bacteria 5477
24 Ga0070676_10034995 3300005328 Bacteria 2886
25 Ga0070676_10077479 3300005328 Bacteria 2009
26 Ga0070676_10649335 3300005328 Bacteria 766
27 Ga0070683_100001138 3300005329 Bacteria 20116
28 Ga0070683_100007370 3300005329 Bacteria 9295
29 Ga0070683_100361267 3300005329 Bacteria 1383
30 Ga0070683_101090397 3300005329 Bacteria 767
31 Ga0070690_100060826 3300005330 Bacteria 2432
32 Ga0070690_100137193 3300005330 Bacteria 1657
33 Ga0070690_100657645 3300005330 Bacteria 801
34 Ga0070670_100028324 3300005331 Bacteria 4821
35 Ga0070670_100030482 3300005331 Bacteria 4645
36 Ga0070670_100073467 3300005331 Bacteria 2937
37 Ga0070670_100091124 3300005331 Bacteria 2620
38 Ga0070670_100159061 3300005331 Bacteria 1957
39 Ga0070670_100175633 3300005331 Bacteria 1859
40 Ga0070670_100325843 3300005331 Bacteria 1346
41 Ga0070670_100438894 3300005331 Bacteria 1156
42 Ga0070670_101516190 3300005331 Bacteria 616
43 Ga0070670_102008472 3300005331 Unclassified 533
44 Ga0070677_10592280 3300005333 Bacteria 613
45 Ga0068869_100318459 3300005334 Bacteria 1261
46 Ga0068869_100653340 3300005334 Bacteria 893
47 Ga0070666_10000330 3300005335 Bacteria 29917
48 Ga0070666_10007668 3300005335 Bacteria 6663
49 Ga0070666_10032086 3300005335 Bacteria 3469
50 Ga0070666_10193411 3300005335 Unclassified 1430
51 Ga0070666_10208281 3300005335 Bacteria 1376
52 Ga0070680_100007182 3300005336 Bacteria 8490
53 Ga0070680_100217441 3300005336 Bacteria 1612
54 Ga0070682_100230895 3300005337 Bacteria 1322
55 Ga0068868_100024884 3300005338 Bacteria 4546
56 Ga0068868_100147000 3300005338 Bacteria 1939
57 Ga0068868_100157935 3300005338 Bacteria 1871
58 Ga0068868_100207917 3300005338 Bacteria 1634
59 Ga0068868_100454913 3300005338 Bacteria 1114
60 Ga0070660_100000109 3300005339 Bacteria 50964
61 Ga0070660_100000339 3300005339 Bacteria 31090
62 Ga0070660_100003053 3300005339 Bacteria 11523
63 Ga0070660_100015001 3300005339 Bacteria 5588
64 Ga0070660_100107887 3300005339 Bacteria 2213
65 Ga0070660_100582750 3300005339 Bacteria 934
66 Ga0070660_101684040 3300005339 Bacteria 540
67 Ga0070687_100091225 3300005343 Bacteria 1686
68 Ga0070687_100190983 3300005343 Bacteria 1234
69 Ga0070661_100000070 3300005344 Bacteria 82818
70 Ga0070661_100011611 3300005344 Bacteria 6139
71 Ga0070661_100023710 3300005344 Bacteria 4400
72 Ga0070661_100034939 3300005344 Bacteria 3648
73 Ga0070661_100118743 3300005344 Bacteria 1979
74 Ga0070661_100325891 3300005344 Bacteria 1200
75 Ga0070692_10008029 3300005345 Bacteria 4685
76 Ga0070692_10011894 3300005345 Bacteria 4013
77 Ga0070668_100019581 3300005347 Bacteria 5094
78 Ga0070668_100058980 3300005347 Bacteria 2970
79 Ga0070668_100489744 3300005347 Bacteria 1063
80 Ga0070668_100544512 3300005347 Bacteria 1009
81 Ga0070668_101483319 3300005347 Unclassified 620
82 Ga0070669_100140030 3300005353 Bacteria 1864
83 Ga0070669_100185501 3300005353 Bacteria 1630
84 Ga0070669_100256674 3300005353 Bacteria 1393
85 Ga0070669_100269297 3300005353 Bacteria 1361
86 Ga0070669_101285535 3300005353 Bacteria 633
87 Ga0070675_100140457 3300005354 Bacteria 2064
88 Ga0070675_100355003 3300005354 Bacteria 1301
89 Ga0070675_100973275 3300005354 Unclassified 779
90 Ga0070671_100016707 3300005355 Bacteria 5934
91 Ga0070671_100026341 3300005355 Bacteria 4778
92 Ga0070671_100081281 3300005355 Bacteria 2710
93 Ga0070671_100151912 3300005355 Bacteria 1955
94 Ga0070671_100196846 3300005355 Bacteria 1708
95 Ga0070671_100599972 3300005355 Unclassified 951
96 Ga0070671_100717777 3300005355 Bacteria 868
97 Ga0070674_100044481 3300005356 Bacteria 3027
98 Ga0070674_100111426 3300005356 Bacteria 2010
99 Ga0070674_100269077 3300005356 Bacteria 1346
100 Ga0070673_100008589 3300005364 Bacteria 6801
101 Ga0070673_100029719 3300005364 Bacteria 4078
102 Ga0070673_100029963 3300005364 Bacteria 4065
103 Ga0070673_100068180 3300005364 Bacteria 2848
104 Ga0070673_100072882 3300005364 Bacteria 2763
105 Ga0070673_100125407 3300005364 Bacteria 2148
106 Ga0070673_100500918 3300005364 Bacteria 1098
107 Ga0070688_100239974 3300005365 Bacteria 1286
108 Ga0070659_100000312 3300005366 Bacteria 37872
109 Ga0070659_100005147 3300005366 Bacteria 9376
110 Ga0070659_100053970 3300005366 Bacteria 3165
111 Ga0070659_100238704 3300005366 Bacteria 1503
112 Ga0070659_100389646 3300005366 Bacteria 1175
113 Ga0070659_101000084 3300005366 Bacteria 734
114 Ga0070667_100003813 3300005367 Bacteria 12811
115 Ga0070667_100008539 3300005367 Bacteria 8491
116 Ga0070667_100031529 3300005367 Bacteria 4419
117 Ga0070667_100036196 3300005367 Bacteria 4137
118 Ga0070667_100042585 3300005367 Bacteria 3809
119 Ga0070667_100081281 3300005367 Bacteria 2773
120 Ga0070667_100243972 3300005367 Bacteria 1605
121 Ga0070667_100264287 3300005367 Bacteria 1541
122 Ga0070667_100462252 3300005367 Bacteria 1160
123 Ga0070667_100521863 3300005367 Bacteria 1090
124 Ga0070667_101026454 3300005367 Bacteria 770
125 Ga0070714_100304477 3300005435 Bacteria 1487
126 Ga0070694_100025638 3300005444 Bacteria 3814
127 Ga0070663_100006534 3300005455 Bacteria 7022
128 Ga0070663_100008493 3300005455 Bacteria 6320
129 Ga0070663_100222806 3300005455 Bacteria 1481
130 Ga0070663_100314442 3300005455 Bacteria 1257
131 Ga0070663_100388540 3300005455 Unclassified 1138
132 Ga0070663_100817736 3300005455 Bacteria 800
133 Ga0070678_100001567 3300005456 Bacteria 12248
134 Ga0070678_100008774 3300005456 Bacteria 6074
135 Ga0070678_100160172 3300005456 Bacteria 1822
136 Ga0070678_100271767 3300005456 Bacteria 1430
137 Ga0070678_101070560 3300005456 Bacteria 743
138 Ga0070678_101080991 3300005456 Bacteria 740
139 Ga0070662_100000037 3300005457 Bacteria 76596
140 Ga0070662_100009922 3300005457 Bacteria 6239
141 Ga0070662_100031671 3300005457 Bacteria 3713
142 Ga0070662_100318556 3300005457 Bacteria 1268
143 Ga0070662_100805208 3300005457 Unclassified 799
144 Ga0070681_10020408 3300005458 Bacteria 6641
145 Ga0070681_10063111 3300005458 Bacteria 3677
146 Ga0068867_100020121 3300005459 Bacteria 4756
147 Ga0068867_100093557 3300005459 Bacteria 2285
148 Ga0068867_100185971 3300005459 Bacteria 1654
149 Ga0068867_100830755 3300005459 Unclassified 826
150 Ga0070685_10057207 3300005466 Bacteria 2269
151 Ga0070679_100015769 3300005530 Bacteria 7269
152 Ga0070679_100211998 3300005530 Bacteria 1900
153 Ga0070679_101042618 3300005530 Bacteria 762
154 Ga0070684_100007613 3300005535 Bacteria 8441
155 Ga0068853_100000309 3300005539 Bacteria 34282
156 Ga0068853_100100007 3300005539 Bacteria 2563
157 Ga0068853_101073267 3300005539 Unclassified 776
158 Ga0068853_101579720 3300005539 Bacteria 635
159 Ga0070672_100009584 3300005543 Bacteria 6681
160 Ga0070672_100009843 3300005543 Bacteria 6608
161 Ga0070672_100169136 3300005543 Bacteria 1817
162 Ga0070672_100169185 3300005543 Bacteria 1816
163 Ga0070686_100063234 3300005544 Bacteria 2397
164 Ga0070686_100359814 3300005544 Bacteria 1096
165 Ga0070695_100520689 3300005545 Bacteria 923
166 Ga0070696_100137209 3300005546 Bacteria 1784
167 Ga0070696_100804678 3300005546 Bacteria 774
168 Ga0070693_100003397 3300005547 Bacteria 7412
169 Ga0070693_100120838 3300005547 Bacteria 1624
170 Ga0070665_100002925 3300005548 Bacteria 18444
171 Ga0070665_100049719 3300005548 Bacteria 4207
172 Ga0070665_100095470 3300005548 Bacteria 2978
173 Ga0070665_100105865 3300005548 Bacteria 2815
174 Ga0070665_100124803 3300005548 Bacteria 2576
175 Ga0070665_100159377 3300005548 Bacteria 2258
176 Ga0070704_101078266 3300005549 Unclassified 729
177 Ga0068855_100000247 3300005563 Bacteria 68071
178 Ga0068855_100024916 3300005563 Bacteria 7158
179 Ga0068855_100037585 3300005563 Bacteria 5757
180 Ga0068855_100070606 3300005563 Bacteria 4063
181 Ga0068855_100082525 3300005563 Bacteria 3725
182 Ga0068855_100764707 3300005563 Bacteria 1029
183 Ga0068855_101203595 3300005563 Bacteria 788
184 Ga0068855_101283533 3300005563 Unclassified 758
185 Ga0070664_100000077 3300005564 Bacteria 62053
186 Ga0070664_100003026 3300005564 Bacteria 13593
187 Ga0070664_100129822 3300005564 Bacteria 2213
188 Ga0070664_100158916 3300005564 Bacteria 1998
189 Ga0068857_100020826 3300005577 Bacteria 5769
190 Ga0068857_100022877 3300005577 Bacteria 5498
191 Ga0068857_100252035 3300005577 Bacteria 1619
192 Ga0068857_101034718 3300005577 Unclassified 791
193 Ga0068854_100111101 3300005578 Bacteria 2068
194 Ga0068854_100170997 3300005578 Bacteria 1691
195 Ga0068854_100503140 3300005578 Bacteria 1021
196 Ga0068856_100000444 3300005614 Bacteria 45674
197 Ga0068856_100014742 3300005614 Bacteria 7544
198 Ga0068856_100063582 3300005614 Bacteria 3646
199 Ga0068856_100153077 3300005614 Bacteria 2315
200 Ga0070702_100231833 3300005615 Bacteria 1241
201 Ga0068852_100000350 3300005616 Bacteria 31032
202 Ga0068852_100032451 3300005616 Bacteria 4324
203 Ga0068852_100282041 3300005616 Bacteria 1602
204 Ga0068852_100688902 3300005616 Bacteria 1031
205 Ga0068859_100002392 3300005617 Bacteria 19100
206 Ga0068859_100037850 3300005617 Bacteria 4841
207 Ga0068859_100157169 3300005617 Bacteria 2351
208 Ga0068859_100257758 3300005617 Bacteria 1835
209 Ga0068859_101533935 3300005617 Unclassified 735
210 Ga0068864_100001110 3300005618 Bacteria 22495
211 Ga0068864_100002819 3300005618 Bacteria 14343
212 Ga0068864_100022361 3300005618 Bacteria 5302
213 Ga0068864_100040637 3300005618 Bacteria 3978
214 Ga0068864_100510382 3300005618 Bacteria 1158
215 Ga0068866_10005188 3300005718 Bacteria 5368
216 Ga0068866_10067216 3300005718 Bacteria 1881
217 Ga0068861_100397804 3300005719 Bacteria 1222
218 Ga0068851_10006475 3300005834 Bacteria 5347
219 Ga0068851_10018054 3300005834 Bacteria 3396
220 Ga0068870_10049839 3300005840 Bacteria 2210
221 Ga0068863_100001056 3300005841 Bacteria 27521
222 Ga0068863_100022022 3300005841 Bacteria 6083
223 Ga0068863_100064125 3300005841 Bacteria 3474
224 Ga0068863_100079639 3300005841 Bacteria 3102
225 Ga0068863_100588306 3300005841 Bacteria 1101
226 Ga0068858_100002753 3300005842 Bacteria 17665
227 Ga0068858_100003145 3300005842 Bacteria 16530
228 Ga0068858_100020528 3300005842 Bacteria 6174
229 Ga0068858_100055846 3300005842 Bacteria 3650
230 Ga0068858_100115005 3300005842 Bacteria 2514
231 Ga0068858_100864297 3300005842 Bacteria 884
232 Ga0068860_100002768 3300005843 Bacteria 18241
233 Ga0068860_100022372 3300005843 Bacteria 6116
234 Ga0068860_100160812 3300005843 Bacteria 2165
235 Ga0068860_100599134 3300005843 Bacteria 1107
236 Ga0068860_100739500 3300005843 Bacteria 995
237 Ga0068860_100850854 3300005843 Unclassified 927
238 Ga0068862_100016753 3300005844 Bacteria 6101
239 Ga0068862_100101524 3300005844 Bacteria 2517
240 Ga0068862_100186233 3300005844 Bacteria 1865
241 Ga0068862_100209588 3300005844 Bacteria 1760
242 Ga0068862_100333344 3300005844 Bacteria 1403
243 Ga0070717_10307576 3300006028 Bacteria 1410
244 Ga0075362_10040870 3300006177 Bacteria 2043
245 Ga0097621_100011209 3300006237 Bacteria 6600
246 Ga0097621_100013030 3300006237 Bacteria 6181
247 Ga0097621_100073298 3300006237 Bacteria 2834
248 Ga0097621_100079858 3300006237 Bacteria 2720
249 Ga0097621_100386946 3300006237 Bacteria 1250
250 Ga0097621_100769015 3300006237 Bacteria 891
251 Ga0068871_100005666 3300006358 Bacteria 8763
252 Ga0068871_100149842 3300006358 Bacteria 1988
253 Ga0068865_100001424 3300006881 Bacteria 13953
254 Ga0068865_100555539 3300006881 Bacteria 965
255 Ga0097620_100002392 3300006931 Bacteria 19100
256 Ga0097620_100037851 3300006931 Bacteria 4841
257 Ga0097620_100157174 3300006931 Bacteria 2351
258 Ga0097620_100257750 3300006931 Bacteria 1835
259 Ga0097620_101534009 3300006931 Unclassified 735
260 Ga0105250_10020270 3300009092 Bacteria 2689
261 Ga0105240_10122528 3300009093 Bacteria 3129
262 Ga0111539_10687239 3300009094 Bacteria 1191
263 Ga0105245_10019331 3300009098 Bacteria 5963
264 Ga0105247_10136598 3300009101 Bacteria 1602
265 Ga0105247_11578015 3300009101 Bacteria 538
266 Ga0105243_10425369 3300009148 Bacteria 1240
267 Ga0105243_10678028 3300009148 Bacteria 1002
268 Ga0105241_10035146 3300009174 Bacteria 3769
269 Ga0105241_12136009 3300009174 Unclassified 554
270 Ga0105242_10002410 3300009176 Bacteria 14697
271 Ga0105248_10000719 3300009177 Bacteria 37511
272 Ga0105248_10001320 3300009177 Bacteria 27621
273 Ga0105248_10034268 3300009177 Bacteria 5676
274 Ga0105248_10034516 3300009177 Bacteria 5657
275 Ga0105248_10044563 3300009177 Bacteria 4975
276 Ga0105248_10197736 3300009177 Bacteria 2265
277 Ga0105248_10444894 3300009177 Bacteria 1460
278 Ga0105248_10610712 3300009177 Bacteria 1230
279 Ga0105248_10760313 3300009177 Bacteria 1094
280 Ga0105237_10099852 3300009545 Bacteria 2893
281 Ga0105238_10105363 3300009551 Bacteria 2801
282 Ga0105238_10238785 3300009551 Bacteria 1795
283 Ga0105238_10284737 3300009551 Bacteria 1634
284 Ga0105238_10923203 3300009551 Bacteria 892
285 Ga0105249_10026474 3300009553 Bacteria 5226
286 Ga0105249_10026708 3300009553 Bacteria 5205
287 Ga0105249_10297614 3300009553 Bacteria 1617
288 Ga0105249_10763485 3300009553 Bacteria 1029
289 Ga0105239_10042112 3300010375 Bacteria 5004
290 Ga0105239_10497957 3300010375 Bacteria 1385
291 Ga0105246_10686742 3300011119 Unclassified 895
292 Ga0157373_10093973 3300013100 Bacteria 2111
293 Ga0157373_10104195 3300013100 Bacteria 1995
294 Ga0157373_10239812 3300013100 Bacteria 1281
295 Ga0157373_10699714 3300013100 Bacteria 743
296 Ga0157371_10000624 3300013102 Bacteria 42051
297 Ga0157371_10009369 3300013102 Bacteria 7713
298 Ga0157371_10060886 3300013102 Bacteria 2676
299 Ga0157371_10079776 3300013102 Bacteria 2318
300 Ga0157371_10195695 3300013102 Bacteria 1448
301 Ga0157371_10209660 3300013102 Bacteria 1398
302 Ga0157370_10015768 3300013104 Bacteria 7669
303 Ga0157370_10350312 3300013104 Bacteria 1361
304 Ga0157369_10004619 3300013105 Bacteria 16188
305 Ga0157369_10063577 3300013105 Bacteria 3975
306 Ga0157369_10083232 3300013105 Bacteria 3423
307 Ga0157369_10301563 3300013105 Bacteria 1666
308 Ga0157369_10743491 3300013105 Bacteria 1009
309 Ga0157374_10002253 3300013296 Bacteria 16246
310 Ga0157374_10034433 3300013296 Bacteria 4626
311 Ga0157374_10101337 3300013296 Bacteria 2761
312 Ga0157374_10116923 3300013296 Bacteria 2570
313 Ga0157374_10437965 3300013296 Bacteria 1307
314 Ga0157378_10182112 3300013297 Bacteria 1977
315 Ga0157378_11842491 3300013297 Bacteria 653
316 Ga0163162_10021265 3300013306 Bacteria 6386
317 Ga0163162_10088341 3300013306 Bacteria 3179
318 Ga0163162_10154261 3300013306 Bacteria 2416
319 Ga0163162_10460752 3300013306 Bacteria 1403
320 Ga0157372_10143435 3300013307 Bacteria 2754
321 Ga0157372_10506493 3300013307 Bacteria 1408
322 Ga0157372_10571284 3300013307 Bacteria 1318
323 Ga0157372_11304519 3300013307 Bacteria 838
324 Ga0157372_12392102 3300013307 Bacteria 607
325 Ga0157375_10004680 3300013308 Bacteria 11902
326 Ga0157375_10377954 3300013308 Bacteria 1583
327 Ga0157375_11198341 3300013308 Bacteria 891
328 Ga0163163_10000123 3300014325 Bacteria 82366
329 Ga0163163_10002706 3300014325 Bacteria 14968
330 Ga0163163_10006151 3300014325 Bacteria 10461
331 Ga0163163_10093474 3300014325 Bacteria 3024
332 Ga0157377_10156987 3300014745 Bacteria 1411
333 Ga0157377_10764551 3300014745 Unclassified 708
334 Ga0157379_10003612 3300014968 Bacteria 13127
335 Ga0157379_10013809 3300014968 Bacteria 7078
336 Ga0157379_10028415 3300014968 Bacteria 4974
337 Ga0157379_10148042 3300014968 Bacteria 2118
338 Ga0157379_10271188 3300014968 Bacteria 1543
339 Ga0157379_11834004 3300014968 Unclassified 596
340 Ga0157376_10003882 3300014969 Bacteria 10338
341 Ga0163161_10140702 3300017792 Bacteria 1827
342 Ga0206355_1223371 3300020076 Bacteria 1228
343 Ga0206353_10745816 3300020082 Bacteria 1192
344 Ga0213876_10807115 3300021384 Unclassified 500
345 Ga0207697_10020248 3300025315 Bacteria 2725
346 Ga0207656_10051647 3300025321 Bacteria 1778
347 Ga0207656_10088655 3300025321 Bacteria 1401
348 Ga0207696_1014589 3300025711 Bacteria 2689
349 Ga0207682_10222412 3300025893 Bacteria 873
350 Ga0207642_10103059 3300025899 Bacteria 1437
351 Ga0207642_10193347 3300025899 Unclassified 1118
352 Ga0207688_10011556 3300025901 Bacteria 4804
353 Ga0207688_10174628 3300025901 Bacteria 1279
354 Ga0207688_10197216 3300025901 Bacteria 1206
355 Ga0207680_10033482 3300025903 Bacteria 2931
356 Ga0207680_10249074 3300025903 Bacteria 1227
357 Ga0207680_10250498 3300025903 Bacteria 1223
358 Ga0207680_10434187 3300025903 Bacteria 931
359 Ga0207680_10471134 3300025903 Bacteria 893
360 Ga0207647_10007743 3300025904 Bacteria 7735
361 Ga0207647_10014655 3300025904 Bacteria 5401
362 Ga0207647_10021670 3300025904 Bacteria 4285
363 Ga0207647_10104745 3300025904 Bacteria 1676
364 Ga0207647_10162018 3300025904 Bacteria 1304
365 Ga0207647_10166710 3300025904 Bacteria 1284
366 Ga0207699_11048191 3300025906 Unclassified 603
367 Ga0207645_10008669 3300025907 Bacteria 7084
368 Ga0207645_10060475 3300025907 Bacteria 2419
369 Ga0207645_10187521 3300025907 Bacteria 1358
370 Ga0207645_10417150 3300025907 Bacteria 904
371 Ga0207643_10025687 3300025908 Bacteria 3257
372 Ga0207705_10000082 3300025909 Bacteria 118194
373 Ga0207705_10000086 3300025909 Bacteria 116132
374 Ga0207705_10000493 3300025909 Bacteria 33656
375 Ga0207705_10005027 3300025909 Bacteria 9920
376 Ga0207705_10026022 3300025909 Bacteria 4175
377 Ga0207705_10039003 3300025909 Bacteria 3403
378 Ga0207705_10052448 3300025909 Bacteria 2936
379 Ga0207705_10101837 3300025909 Bacteria 2113
380 Ga0207654_10031984 3300025911 Bacteria 2902
381 Ga0207654_10118589 3300025911 Bacteria 1658
382 Ga0207654_10875007 3300025911 Bacteria 651
383 Ga0207707_10025551 3300025912 Bacteria 5167
384 Ga0207707_10087292 3300025912 Bacteria 2726
385 Ga0207707_10343098 3300025912 Bacteria 1288
386 Ga0207695_10736975 3300025913 Bacteria 866
387 Ga0207693_10471338 3300025915 Bacteria 981
388 Ga0207693_10654058 3300025915 Unclassified 816
389 Ga0207660_10000770 3300025917 Bacteria 21320
390 Ga0207660_10019326 3300025917 Bacteria 4552
391 Ga0207662_10014872 3300025918 Bacteria 4372
392 Ga0207662_10866349 3300025918 Bacteria 639
393 Ga0207657_10000360 3300025919 Bacteria 48193
394 Ga0207657_10001020 3300025919 Bacteria 29724
395 Ga0207657_10001678 3300025919 Bacteria 23887
396 Ga0207657_10002261 3300025919 Bacteria 20877
397 Ga0207657_10011262 3300025919 Bacteria 8886
398 Ga0207657_10022343 3300025919 Bacteria 5922
399 Ga0207657_10023065 3300025919 Bacteria 5804
400 Ga0207657_10026681 3300025919 Bacteria 5302
401 Ga0207657_10140861 3300025919 Bacteria 1970
402 Ga0207657_10524623 3300025919 Unclassified 927
403 Ga0207649_10000420 3300025920 Bacteria 31171
404 Ga0207649_10018705 3300025920 Bacteria 3946
405 Ga0207649_10029155 3300025920 Bacteria 3257
406 Ga0207649_10128035 3300025920 Unclassified 1721
407 Ga0207649_10308980 3300025920 Bacteria 1158
408 Ga0207652_10000034 3300025921 Bacteria 138571
409 Ga0207652_10028676 3300025921 Bacteria 4647
410 Ga0207652_10268136 3300025921 Bacteria 1540
411 Ga0207681_10026545 3300025923 Bacteria 3736
412 Ga0207681_10032261 3300025923 Bacteria 3428
413 Ga0207681_11442421 3300025923 Bacteria 577
414 Ga0207694_10123657 3300025924 Bacteria 2068
415 Ga0207694_10174361 3300025924 Bacteria 1742
416 Ga0207694_10425874 3300025924 Bacteria 1106
417 Ga0207650_10017046 3300025925 Bacteria 5084
418 Ga0207650_10032900 3300025925 Bacteria 3753
419 Ga0207650_10093483 3300025925 Bacteria 2302
420 Ga0207650_10110147 3300025925 Bacteria 2130
421 Ga0207650_10112624 3300025925 Bacteria 2108
422 Ga0207650_10278944 3300025925 Bacteria 1360
423 Ga0207650_10457245 3300025925 Bacteria 1063
424 Ga0207650_10460092 3300025925 Unclassified 1060
425 Ga0207659_10083897 3300025926 Bacteria 2363
426 Ga0207659_10157715 3300025926 Bacteria 1779
427 Ga0207659_10434818 3300025926 Bacteria 1103
428 Ga0207687_10414331 3300025927 Bacteria 1111
429 Ga0207664_10854551 3300025929 Bacteria 818
430 Ga0207644_10006312 3300025931 Bacteria 7718
431 Ga0207644_10025723 3300025931 Bacteria 4048
432 Ga0207644_10031105 3300025931 Bacteria 3717
433 Ga0207644_10036457 3300025931 Bacteria 3453
434 Ga0207644_10043002 3300025931 Bacteria 3204
435 Ga0207644_10486112 3300025931 Bacteria 1017
436 Ga0207644_11198259 3300025931 Bacteria 638
437 Ga0207690_10000413 3300025932 Bacteria 27940
438 Ga0207690_10042985 3300025932 Bacteria 2972
439 Ga0207690_10053007 3300025932 Bacteria 2720
440 Ga0207690_10099389 3300025932 Bacteria 2074
441 Ga0207690_10120973 3300025932 Bacteria 1902
442 Ga0207690_10140316 3300025932 Bacteria 1780
443 Ga0207690_10471756 3300025932 Unclassified 1012
444 Ga0207690_10588261 3300025932 Bacteria 907
445 Ga0207690_10711457 3300025932 Bacteria 826
446 Ga0207706_10000192 3300025933 Bacteria 68319
447 Ga0207706_10006865 3300025933 Bacteria 10524
448 Ga0207706_10007819 3300025933 Bacteria 9867
449 Ga0207706_10016257 3300025933 Bacteria 6721
450 Ga0207706_10020249 3300025933 Bacteria 5979
451 Ga0207706_10132255 3300025933 Bacteria 2194
452 Ga0207706_10317391 3300025933 Bacteria 1356
453 Ga0207706_11214764 3300025933 Bacteria 626
454 Ga0207686_10228229 3300025934 Bacteria 1348
455 Ga0207709_10334038 3300025935 Bacteria 1138
456 Ga0207709_10373253 3300025935 Bacteria 1083
457 Ga0207709_10664277 3300025935 Bacteria 831
458 Ga0207669_10290219 3300025937 Bacteria 1238
459 Ga0207669_10954660 3300025937 Bacteria 719
460 Ga0207704_10342826 3300025938 Bacteria 1160
461 Ga0207691_10013134 3300025940 Bacteria 7928
462 Ga0207691_10014251 3300025940 Bacteria 7584
463 Ga0207691_10026469 3300025940 Bacteria 5441
464 Ga0207691_10062014 3300025940 Bacteria 3394
465 Ga0207691_10081216 3300025940 Bacteria 2914
466 Ga0207711_10000869 3300025941 Bacteria 29230
467 Ga0207711_10002038 3300025941 Bacteria 18270
468 Ga0207711_10006956 3300025941 Bacteria 9493
469 Ga0207711_10047302 3300025941 Bacteria 3677
470 Ga0207711_10080903 3300025941 Bacteria 2838
471 Ga0207711_10186107 3300025941 Bacteria 1890
472 Ga0207711_10647918 3300025941 Bacteria 985
473 Ga0207689_10024225 3300025942 Bacteria 5092
474 Ga0207689_10033527 3300025942 Bacteria 4267
475 Ga0207661_10002726 3300025944 Bacteria 12149
476 Ga0207661_10028875 3300025944 Bacteria 4252
477 Ga0207679_10000347 3300025945 Bacteria 33719
478 Ga0207679_10001488 3300025945 Bacteria 14672
479 Ga0207679_10025135 3300025945 Bacteria 4092
480 Ga0207679_10031355 3300025945 Bacteria 3720
481 Ga0207679_10051489 3300025945 Bacteria 3014
482 Ga0207679_10426486 3300025945 Bacteria 1171
483 Ga0207667_10000114 3300025949 Bacteria 128923
484 Ga0207667_10000850 3300025949 Bacteria 39399
485 Ga0207667_10069541 3300025949 Bacteria 3664
486 Ga0207667_10094516 3300025949 Bacteria 3086
487 Ga0207667_10095578 3300025949 Bacteria 3068
488 Ga0207667_10364114 3300025949 Bacteria 1474
489 Ga0207667_10475191 3300025949 Bacteria 1269
490 Ga0207651_10008035 3300025960 Bacteria 5661
491 Ga0207651_10009471 3300025960 Bacteria 5337
492 Ga0207651_10282048 3300025960 Bacteria 1373
493 Ga0207712_10003235 3300025961 Bacteria 10349
494 Ga0207712_10058889 3300025961 Bacteria 2716
495 Ga0207668_10000072 3300025972 Bacteria 77023
496 Ga0207668_10033122 3300025972 Bacteria 3421
497 Ga0207668_10160863 3300025972 Bacteria 1749
498 Ga0207668_10648170 3300025972 Bacteria 924
499 Ga0207640_10014591 3300025981 Bacteria 4527
500 Ga0207640_10141564 3300025981 Bacteria 1754
501 Ga0207640_10457633 3300025981 Bacteria 1053
502 Ga0207640_10553422 3300025981 Bacteria 967
503 Ga0207658_10009361 3300025986 Bacteria 6645
504 Ga0207658_10015372 3300025986 Bacteria 5251
505 Ga0207658_10021906 3300025986 Bacteria 4442
506 Ga0207658_10022216 3300025986 Bacteria 4415
507 Ga0207658_10026119 3300025986 Bacteria 4092
508 Ga0207658_10096138 3300025986 Bacteria 2309
509 Ga0207658_10107463 3300025986 Bacteria 2199
510 Ga0207658_10177607 3300025986 Bacteria 1759
511 Ga0207658_10188689 3300025986 Bacteria 1711
512 Ga0207658_10453870 3300025986 Bacteria 1135
513 Ga0207658_10785992 3300025986 Bacteria 863
514 Ga0207677_10066798 3300026023 Bacteria 2516
515 Ga0207677_10071281 3300026023 Bacteria 2452
516 Ga0207677_10277365 3300026023 Bacteria 1374
517 Ga0207677_10300752 3300026023 Bacteria 1325
518 Ga0207703_10004152 3300026035 Bacteria 11945
519 Ga0207703_10014313 3300026035 Bacteria 6188
520 Ga0207703_10027296 3300026035 Bacteria 4496
521 Ga0207703_10042738 3300026035 Bacteria 3636
522 Ga0207703_10142454 3300026035 Bacteria 2082
523 Ga0207703_11892354 3300026035 Bacteria 573
524 Ga0207639_10000524 3300026041 Bacteria 26513
525 Ga0207639_10029804 3300026041 Bacteria 3999
526 Ga0207639_10318103 3300026041 Bacteria 1381
527 Ga0207639_10334654 3300026041 Bacteria 1348
528 Ga0207639_10381418 3300026041 Bacteria 1266
529 Ga0207678_10004938 3300026067 Bacteria 11979
530 Ga0207678_10010668 3300026067 Bacteria 8071
531 Ga0207678_10011128 3300026067 Bacteria 7904
532 Ga0207678_10051977 3300026067 Bacteria 3536
533 Ga0207678_10876423 3300026067 Bacteria 793
534 Ga0207678_11207644 3300026067 Bacteria 670
535 Ga0207702_10001885 3300026078 Bacteria 20524
536 Ga0207702_10022362 3300026078 Bacteria 5242
537 Ga0207702_10054149 3300026078 Bacteria 3399
538 Ga0207702_10211184 3300026078 Bacteria 1804
539 Ga0207702_10368541 3300026078 Bacteria 1378
540 Ga0207641_10001513 3300026088 Bacteria 22775
541 Ga0207641_10064867 3300026088 Bacteria 3122
542 Ga0207641_10112062 3300026088 Bacteria 2420
543 Ga0207641_10540375 3300026088 Bacteria 1135
544 Ga0207648_10002300 3300026089 Bacteria 20648
545 Ga0207648_10020517 3300026089 Bacteria 5950
546 Ga0207648_10118017 3300026089 Bacteria 2331
547 Ga0207648_10303784 3300026089 Bacteria 1431
548 Ga0207648_10831389 3300026089 Unclassified 861
549 Ga0207676_10006150 3300026095 Bacteria 8475
550 Ga0207676_10006185 3300026095 Bacteria 8457
551 Ga0207676_10014327 3300026095 Bacteria 5703
552 Ga0207674_10008897 3300026116 Bacteria 11545
553 Ga0207674_10028194 3300026116 Bacteria 5930
554 Ga0207674_10040219 3300026116 Bacteria 4845
555 Ga0207674_10058545 3300026116 Bacteria 3902
556 Ga0207674_10194371 3300026116 Bacteria 1979
557 Ga0207674_10986198 3300026116 Bacteria 811
558 Ga0207674_11311970 3300026116 Bacteria 693
559 Ga0207675_100504457 3300026118 Bacteria 1205
560 Ga0207683_10001629 3300026121 Bacteria 20121
561 Ga0207683_10002763 3300026121 Bacteria 15335
562 Ga0207683_10004970 3300026121 Bacteria 11437
563 Ga0207683_10055134 3300026121 Bacteria 3486
564 Ga0207683_10195399 3300026121 Bacteria 1838
565 Ga0207698_10000542 3300026142 Bacteria 21912
566 Ga0207698_10006707 3300026142 Bacteria 7194
567 Ga0207698_10077733 3300026142 Bacteria 2662
568 Ga0207698_10123193 3300026142 Bacteria 2199
569 Ga0207698_10392822 3300026142 Bacteria 1323
570 Ga0207698_10692656 3300026142 Bacteria 1013
571 Ga0207698_11073888 3300026142 Bacteria 817
572 Ga0207698_11222284 3300026142 Bacteria 765
573 Ga0268266_10003812 3300028379 Bacteria 14751
574 Ga0268266_10010764 3300028379 Bacteria 7970
575 Ga0268266_10061473 3300028379 Bacteria 3240
576 Ga0268266_10137169 3300028379 Bacteria 2192
577 Ga0268266_10204869 3300028379 Bacteria 1807
578 Ga0268265_10002655 3300028380 Bacteria 13268
579 Ga0268265_10003724 3300028380 Bacteria 10841
580 Ga0268265_10064979 3300028380 Bacteria 2813
581 Ga0268265_10182703 3300028380 Bacteria 1803
582 Ga0268265_10228207 3300028380 Bacteria 1634
583 Ga0268265_10326296 3300028380 Bacteria 1392
584 Ga0268264_10005781 3300028381 Bacteria 10486
585 Ga0268264_10006884 3300028381 Bacteria 9541
586 Ga0268264_10148778 3300028381 Bacteria 2097
587 Ga0268264_10308887 3300028381 Bacteria 1491
588 Ga0268264_10429415 3300028381 Bacteria 1276
589 Ga0268264_10488669 3300028381 Bacteria 1199
590 Ga0268264_10537805 3300028381 Bacteria 1144
591 Ga0268264_10637035 3300028381 Bacteria 1054
592 Ga0268264_10747498 3300028381 Bacteria 974
593 Ga0268264_10812687 3300028381 Unclassified 934
594 Ga0307513_10504345 3300031456 Bacteria 927
595 Ga0307405_10082142 3300031731 Bacteria 2108
596 Ga0307405_10162711 3300031731 Bacteria 1583
597 Ga0307405_10370384 3300031731 Bacteria 1112
598 Ga0307413_10002467 3300031824 Bacteria 7526
599 Ga0307413_10010593 3300031824 Bacteria 4484
600 Ga0307410_10011969 3300031852 Bacteria 4989
601 Ga0307410_10227112 3300031852 Bacteria 1439
602 Ga0307410_10246541 3300031852 Bacteria 1387
603 Ga0307406_10181586 3300031901 Bacteria 1532
604 Ga0307406_10782456 3300031901 Unclassified 804
605 Ga0307407_10099736 3300031903 Bacteria 1800
606 Ga0307407_10109914 3300031903 Bacteria 1728
607 Ga0307407_10140567 3300031903 Bacteria 1557
608 Ga0307407_11464884 3300031903 Unclassified 539
609 Ga0307409_100021681 3300031995 Bacteria 4410
610 Ga0307409_100230612 3300031995 Bacteria 1678
611 Ga0307409_100568805 3300031995 Bacteria 1115
612 Ga0307416_100608895 3300032002 Bacteria 1173
613 Ga0307416_100631338 3300032002 Unclassified 1154
614 Ga0307416_100968210 3300032002 Unclassified 953
615 Ga0307416_101433404 3300032002 Bacteria 796
616 Ga0307414_10009564 3300032004 Bacteria 5578
617 Ga0307414_10792635 3300032004 Bacteria 864
618 Ga0307411_10000475 3300032005 Bacteria 13954
619 Ga0307411_10003128 3300032005 Bacteria 7586
620 Ga0307411_11363681 3300032005 Unclassified 648
621 Ga0307415_100129072 3300032126 Bacteria 1910
622 Ga0307415_100141369 3300032126 Bacteria 1839
623 Ga0307415_100575332 3300032126 Bacteria 998
624 Ga0307415_101534432 3300032126 Bacteria 638
625 Ga0373928_0014329 3300035084 Bacteria 1602
626 Ga0373949_0303835 3300035090 Unclassified 507
627 Ga0373952_0069710 3300035092 Bacteria 877
628 Ga0373932_0128468 3300035112 Bacteria 852
629 Ga0373939_0042642 3300035114 Bacteria 1373
630 Ga0373946_0563239 3300035171 Unclassified 589
631 Ga0373942_0095134 3300035207 Bacteria 903
632 Ga0373961_0055104 3300035241 Bacteria 1190
633 Ga0373931_0015417 3300035691 Bacteria 3748
634 Ga0373931_0087294 3300035691 Bacteria 1732
635 Ga0373935_0009711 3300035692 Bacteria 5761
636 Ga0395899_0026489 3300037312 Bacteria 4375
637 Ga0395899_0059381 3300037312 Bacteria 2819
638 Ga0395899_0078830 3300037312 Bacteria 2400
639 Ga0395899_0239317 3300037312 Bacteria 1250
640 Ga0395899_0395108 3300037312 Bacteria 916
641 Ga0395899_0996460 3300037312 Unclassified 505
642 Ga0395900_0003085 3300037418 Bacteria 18103
643 Ga0395900_0013504 3300037418 Bacteria 8346
644 Ga0395900_0015910 3300037418 Bacteria 7663
645 Ga0395900_0016429 3300037418 Bacteria 7547
646 Ga0395900_0028185 3300037418 Bacteria 5752
647 Ga0395900_0089079 3300037418 Bacteria 3172
648 Ga0395900_0097007 3300037418 Bacteria 3029
649 Ga0395900_0203772 3300037418 Bacteria 2000
650 Ga0395900_0479947 3300037418 Bacteria 1196
651 Ga0395900_0546808 3300037418 Bacteria 1103
652 Ga0395900_0609207 3300037418 Bacteria 1032
653 Ga0395898_0010465 3300037466 Bacteria 9695
654 Ga0395898_0064367 3300037466 Bacteria 3556
655 Ga0395898_0094728 3300037466 Bacteria 2869
656 Ga0395898_0108973 3300037466 Bacteria 2655
657 Ga0395898_0329791 3300037466 Bacteria 1455
658 Ga0395898_0352082 3300037466 Bacteria 1404
659 Ga0395898_0822954 3300037466 Bacteria 868
660 Ga0395905_0000104 3300037471 Bacteria 141965
661 Ga0395905_0001031 3300037471 Bacteria 35482
662 Ga0395905_0028195 3300037471 Bacteria 5292
663 Ga0395905_0079844 3300037471 Bacteria 3066
664 Ga0395905_0139090 3300037471 Bacteria 2284
665 Ga0395905_0370642 3300037471 Bacteria 1325
666 Ga0395905_0380799 3300037471 Bacteria 1305
667 Ga0395905_0564245 3300037471 Bacteria 1040
668 Ga0395905_0738714 3300037471 Bacteria 886
669 Ga0395905_1037366 3300037471 Unclassified 723
670 Ga0395901_0001126 3300038443 Bacteria 28379
671 Ga0395901_0044992 3300038443 Bacteria 4579
672 Ga0395901_0165413 3300038443 Bacteria 2323
673 Ga0395901_0170171 3300038443 Bacteria 2286
674 Ga0395901_0247381 3300038443 Bacteria 1858
675 Ga0395901_0525600 3300038443 Bacteria 1201
676 Ga0395901_1974721 3300038443 Bacteria 530
677 Ga0439449_0095892 3300042007 Bacteria 1096
678 Ga0439458_0060151 3300042157 Bacteria 947
679 Ga0439464_0000350 3300042439 Bacteria 8930
680 Ga0466969_0084983 3300044656 Bacteria 1505
681 Ga0466969_0174412 3300044656 Bacteria 985
682 Ga0466966_0075412 3300044684 Bacteria 2107
683 Ga0466966_0151438 3300044684 Bacteria 1414
684 Ga0466961_0048228 3300044693 Bacteria 2722
685 Ga0466963_0023693 3300044694 Bacteria 3901
686 Ga0466963_0058368 3300044694 Bacteria 2573
687 Ga0466971_0025392 3300044719 Bacteria 2646
688 Ga0466957_0005582 3300044842 Bacteria 7066
689 Ga0466957_0009431 3300044842 Bacteria 5573
690 Ga0466960_0297462 3300044901 Unclassified 909
691 Ga0466959_0026160 3300045049 Bacteria 4326
692 Ga0466959_0176653 3300045049 Bacteria 1495
693 Ga0466958_0032434 3300045836 Bacteria 3108
694 Ga0466958_0104886 3300045836 Bacteria 1761
695 Ga0466958_0468886 3300045836 Bacteria 816
696 Ga0466967_0020997 3300045976 Bacteria 5290
697 Ga0466967_0027514 3300045976 Bacteria 4732
698 Ga0466967_0038382 3300045976 Bacteria 4107
699 Ga0466967_0047665 3300045976 Bacteria 3736
700 Ga0466967_0067578 3300045976 Bacteria 3188
701 Ga0466967_0071901 3300045976 Bacteria 3098
702 Ga0466967_0343418 3300045976 Bacteria 1444
703 Ga0466967_1456446 3300045976 Bacteria 682
704 Ga0495585_0120095 3300046492 Bacteria 1391
705 Ga0495616_0134238 3300046513 Bacteria 1132
706 Ga0495643_0393389 3300046522 Unclassified 613
707 Ga0495642_0376421 3300046528 Bacteria 625
708 Ga0495668_0050557 3300046616 Bacteria 2303
709 Ga0495668_0578034 3300046616 Bacteria 620
710 Ga0495669_0027869 3300046684 Bacteria 2471
711 Ga0495669_0101523 3300046684 Bacteria 1336
712 Ga0495669_0136343 3300046684 Bacteria 1157
713 Ga0495669_0313169 3300046684 Unclassified 757
714 Ga0495677_0047340 3300047445 Bacteria 1579
715 Ga0495677_0243229 3300047445 Bacteria 703
716 Ga0496100_0006995 3300048903 Bacteria 6188
717 Ga0496100_0165871 3300048903 Bacteria 1587
718 Ga0496100_0944117 3300048903 Bacteria 678
719 Ga0496101_0088049 3300048904 Bacteria 2306
720 Ga0496101_0118283 3300048904 Bacteria 2001
721 Ga0496101_0124376 3300048904 Bacteria 1953
722 Ga0496101_0189895 3300048904 Bacteria 1585
723 Ga0496101_1447997 3300048904 Bacteria 535
724 Ga0496102_0141200 3300048905 Bacteria 2258
725 Ga0496102_0144054 3300048905 Bacteria 2235
726 Ga0496103_0044232 3300048906 Bacteria 2743
727 Ga0496104_0215519 3300048907 Bacteria 1831
728 Ga0496104_0242889 3300048907 Bacteria 1713
729 Ga0496104_0391196 3300048907 Bacteria 1302
730 Ga0496105_0096247 3300048908 Bacteria 2445
731 Ga0496105_0233726 3300048908 Bacteria 1493
732 Ga0496105_0282734 3300048908 Bacteria 1337
733 Ga0496106_0033452 3300048909 Bacteria 3836
734 Ga0496106_0047950 3300048909 Bacteria 3216
735 Ga0496106_0111285 3300048909 Bacteria 2132
736 Ga0496107_0008263 3300048910 Bacteria 7203
737 Ga0496107_0025841 3300048910 Bacteria 4160
738 Ga0496107_0046907 3300048910 Bacteria 3110
739 Ga0496107_0144468 3300048910 Bacteria 1759
740 Ga0496107_0170668 3300048910 Bacteria 1614
741 Ga0496107_0510113 3300048910 Bacteria 892
742 Ga0496108_0009895 3300048911 Bacteria 7727
743 Ga0496108_0038691 3300048911 Bacteria 3974
744 Ga0496108_0040243 3300048911 Bacteria 3895
745 Ga0496108_0148879 3300048911 Bacteria 2019
746 Ga0496109_0119558 3300048912 Bacteria 2453
747 Ga0496109_0145862 3300048912 Bacteria 2214
748 Ga0496109_0202462 3300048912 Bacteria 1866
749 Ga0496109_0725456 3300048912 Bacteria 932
750 Ga0496110_0047002 3300048913 Bacteria 3777
751 Ga0496110_0091427 3300048913 Bacteria 2722
752 Ga0496110_0212783 3300048913 Bacteria 1757
753 Ga0496110_0315668 3300048913 Bacteria 1423
754 Ga0496110_1294800 3300048913 Bacteria 638
755 Ga0496111_0007276 3300048914 Bacteria 7244
756 Ga0496111_0140569 3300048914 Bacteria 1789
757 Ga0496111_0148522 3300048914 Bacteria 1738
758 Ga0496112_0057299 3300048915 Bacteria 3836
759 Ga0496112_0058934 3300048915 Bacteria 3782
760 Ga0496112_0109240 3300048915 Bacteria 2736
761 Ga0496112_0117027 3300048915 Bacteria 2635
762 Ga0496112_0172125 3300048915 Bacteria 2130
763 Ga0496112_1012585 3300048915 Bacteria 750
764 Ga0496113_0012024 3300048916 Bacteria 5804
765 Ga0496113_0073323 3300048916 Bacteria 2608
766 Ga0496113_0098386 3300048916 Bacteria 2264
767 Ga0496113_0184825 3300048916 Bacteria 1653
768 Ga0496113_1077842 3300048916 Archaea 631
769 Ga0496114_0030533 3300048917 Bacteria 4434
770 Ga0496115_0144384 3300048918 Bacteria 1964
771 Ga0501067_0035435 3300049583 Bacteria 2771
772 Ga0501069_0120442 3300049585 Bacteria 1499
773 Ga0501070_0067070 3300049586 Bacteria 2972
774 Ga0501070_0860643 3300049586 Bacteria 709
775 Ga0501071_0093261 3300049587 Bacteria 2214
776 Ga0501230_076047 3300049667 Unclassified 697
777 Ga0501268_026444 3300049765 Unclassified 1026
778 Ga0501270_009736 3300049767 Unclassified 1249
779 nmdc:mga08y16_533163_c1 3300050511 Bacteria 1189
780 nmdc:mga0n895_544974_c1 3300050512 Unclassified 1166
781 Ga0500658_0000036 3300053134 Bacteria 85304
782 Ga0587073_0086711 3300059492 Bacteria 788
783 Ga0587071_022250 3300060344 Bacteria 1169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0134238 Ga0495616_0134238_746_1117 119
2 3300009177 Ga0105248_10444894 Ga0105248_104448942 120
3 3300046616 Ga0495668_0578034 Ga0495668_0578034_182_589 122
4 3300046684 Ga0495669_0136343 Ga0495669_0136343_103_510 122
5 3300047445 Ga0495677_0243229 Ga0495677_0243229_251_658 122
6 3300037471 Ga0395905_0380799 Ga0395905_0380799_853_1239 123
7 3300001989 JGI24739J22299_10014393 JGI24739J22299_100143935 124
8 3300001990 JGI24737J22298_10056357 JGI24737J22298_100563571 124
9 3300005327 Ga0070658_10016356 Ga0070658_100163567 124
10 3300005328 Ga0070676_10008701 Ga0070676_100087015 124
11 3300005328 Ga0070676_10649335 Ga0070676_106493352 124
12 3300005330 Ga0070690_100137193 Ga0070690_1001371932 124
13 3300005331 Ga0070670_100175633 Ga0070670_1001756332 124
14 3300005335 Ga0070666_10032086 Ga0070666_100320864 124
15 3300005338 Ga0068868_100024884 Ga0068868_1000248847 124
16 3300005339 Ga0070660_100107887 Ga0070660_1001078872 124
17 3300005343 Ga0070687_100091225 Ga0070687_1000912252 124
18 3300005344 Ga0070661_100011611 Ga0070661_1000116112 124
19 3300005354 Ga0070675_100973275 Ga0070675_1009732752 124
20 3300005355 Ga0070671_100599972 Ga0070671_1005999722 124
21 3300005356 Ga0070674_100111426 Ga0070674_1001114263 124
22 3300005356 Ga0070674_100269077 Ga0070674_1002690772 124
23 3300005364 Ga0070673_100029963 Ga0070673_1000299633 124
24 3300005365 Ga0070688_100239974 Ga0070688_1002399741 124
25 3300005366 Ga0070659_100389646 Ga0070659_1003896462 124
26 3300005367 Ga0070667_100031529 Ga0070667_1000315297 124
27 3300005455 Ga0070663_100388540 Ga0070663_1003885402 124
28 3300005456 Ga0070678_100008774 Ga0070678_1000087742 124
29 3300005457 Ga0070662_100009922 Ga0070662_1000099223 124
30 3300005459 Ga0068867_100020121 Ga0068867_1000201217 124
31 3300005543 Ga0070672_100009584 Ga0070672_1000095846 124
32 3300005544 Ga0070686_100063234 Ga0070686_1000632342 124
33 3300005548 Ga0070665_100105865 Ga0070665_1001058653 124
34 3300005578 Ga0068854_100111101 Ga0068854_1001111013 124
35 3300005578 Ga0068854_100170997 Ga0068854_1001709973 124
36 3300005614 Ga0068856_100063582 Ga0068856_1000635821 124
37 3300005616 Ga0068852_100032451 Ga0068852_1000324517 124
38 3300005617 Ga0068859_100037850 Ga0068859_1000378507 124
39 3300005618 Ga0068864_100022361 Ga0068864_1000223612 124
40 3300005718 Ga0068866_10005188 Ga0068866_100051887 124
41 3300005834 Ga0068851_10018054 Ga0068851_100180545 124
42 3300005841 Ga0068863_100064125 Ga0068863_1000641254 124
43 3300005842 Ga0068858_100055846 Ga0068858_1000558462 124
44 3300005843 Ga0068860_100850854 Ga0068860_1008508542 124
45 3300006237 Ga0097621_100013030 Ga0097621_1000130304 124
46 3300006358 Ga0068871_100005666 Ga0068871_1000056667 124
47 3300006881 Ga0068865_100001424 Ga0068865_10000142413 124
48 3300006931 Ga0097620_100037851 Ga0097620_1000378517 124
49 3300009098 Ga0105245_10019331 Ga0105245_100193318 124
50 3300009148 Ga0105243_10425369 Ga0105243_104253693 124
51 3300009174 Ga0105241_12136009 Ga0105241_121360092 124
52 3300009176 Ga0105242_10002410 Ga0105242_1000241017 124
53 3300009177 Ga0105248_10197736 Ga0105248_101977362 124
54 3300009551 Ga0105238_10105363 Ga0105238_101053633 124
55 3300009553 Ga0105249_10763485 Ga0105249_107634852 124
56 3300010375 Ga0105239_10497957 Ga0105239_104979573 124
57 3300011119 Ga0105246_10686742 Ga0105246_106867422 124
58 3300013105 Ga0157369_10301563 Ga0157369_103015632 124
59 3300013296 Ga0157374_10116923 Ga0157374_101169234 124
60 3300013297 Ga0157378_10182112 Ga0157378_101821123 124
61 3300013306 Ga0163162_10088341 Ga0163162_100883415 124
62 3300013308 Ga0157375_10377954 Ga0157375_103779542 124
63 3300014325 Ga0163163_10093474 Ga0163163_100934743 124
64 3300014745 Ga0157377_10156987 Ga0157377_101569872 124
65 3300014968 Ga0157379_10148042 Ga0157379_101480424 124
66 3300014969 Ga0157376_10003882 Ga0157376_100038823 124
67 3300017792 Ga0163161_10140702 Ga0163161_101407023 124
68 3300025315 Ga0207697_10020248 Ga0207697_100202484 124
69 3300025899 Ga0207642_10193347 Ga0207642_101933472 124
70 3300025901 Ga0207688_10174628 Ga0207688_101746283 124
71 3300025904 Ga0207647_10162018 Ga0207647_101620182 124
72 3300025907 Ga0207645_10187521 Ga0207645_101875212 124
73 3300025909 Ga0207705_10101837 Ga0207705_101018374 124
74 3300025918 Ga0207662_10014872 Ga0207662_100148722 124
75 3300025919 Ga0207657_10026681 Ga0207657_100266813 124
76 3300025920 Ga0207649_10029155 Ga0207649_100291554 124
77 3300025924 Ga0207694_10174361 Ga0207694_101743612 124
78 3300025925 Ga0207650_10110147 Ga0207650_101101472 124
79 3300025926 Ga0207659_10434818 Ga0207659_104348182 124
80 3300025927 Ga0207687_10414331 Ga0207687_104143313 124
81 3300025931 Ga0207644_10043002 Ga0207644_100430024 124
82 3300025932 Ga0207690_10140316 Ga0207690_101403162 124
83 3300025932 Ga0207690_10471756 Ga0207690_104717562 124
84 3300025933 Ga0207706_10006865 Ga0207706_1000686513 124
85 3300025933 Ga0207706_10132255 Ga0207706_101322553 124
86 3300025934 Ga0207686_10228229 Ga0207686_102282293 124
87 3300025935 Ga0207709_10664277 Ga0207709_106642772 124
88 3300025937 Ga0207669_10290219 Ga0207669_102902192 124
89 3300025937 Ga0207669_10954660 Ga0207669_109546602 124
90 3300025938 Ga0207704_10342826 Ga0207704_103428263 124
91 3300025940 Ga0207691_10014251 Ga0207691_100142517 124
92 3300025941 Ga0207711_10080903 Ga0207711_100809032 124
93 3300025960 Ga0207651_10008035 Ga0207651_100080357 124
94 3300025981 Ga0207640_10141564 Ga0207640_101415643 124
95 3300025981 Ga0207640_10457633 Ga0207640_104576331 124
96 3300025986 Ga0207658_10188689 Ga0207658_101886892 124
97 3300026023 Ga0207677_10066798 Ga0207677_100667982 124
98 3300026035 Ga0207703_10027296 Ga0207703_100272967 124
99 3300026078 Ga0207702_10368541 Ga0207702_103685411 124
100 3300026088 Ga0207641_10540375 Ga0207641_105403752 124
101 3300026089 Ga0207648_10020517 Ga0207648_100205179 124
102 3300026089 Ga0207648_10303784 Ga0207648_103037843 124
103 3300026121 Ga0207683_10002763 Ga0207683_1000276313 124
104 3300026142 Ga0207698_10006707 Ga0207698_100067078 124
105 3300028379 Ga0268266_10204869 Ga0268266_102048692 124
106 3300028381 Ga0268264_10812687 Ga0268264_108126872 124
107 3300035084 Ga0373928_0014329 Ga0373928_0014329_62_466 124
108 3300035090 Ga0373949_0303835 Ga0373949_0303835_41_445 124
109 3300035092 Ga0373952_0069710 Ga0373952_0069710_421_825 124
110 3300035207 Ga0373942_0095134 Ga0373942_0095134_449_853 124
111 3300035691 Ga0373931_0087294 Ga0373931_0087294_675_1079 124
112 3300037312 Ga0395899_0078830 Ga0395899_0078830_796_1203 124
113 3300037418 Ga0395900_0028185 Ga0395900_0028185_1868_2275 124
114 3300037466 Ga0395898_0108973 Ga0395898_0108973_1623_2030 124
115 3300037471 Ga0395905_0079844 Ga0395905_0079844_1165_1572 124
116 3300038443 Ga0395901_0247381 Ga0395901_0247381_167_574 124
117 3300048903 Ga0496100_0006995 Ga0496100_0006995_1316_1720 124
118 3300048904 Ga0496101_0088049 Ga0496101_0088049_245_649 124
119 3300048905 Ga0496102_0144054 Ga0496102_0144054_682_1086 124
120 3300048907 Ga0496104_0391196 Ga0496104_0391196_159_563 124
121 3300048908 Ga0496105_0233726 Ga0496105_0233726_557_961 124
122 3300048909 Ga0496106_0111285 Ga0496106_0111285_673_1077 124
123 3300048910 Ga0496107_0008263 Ga0496107_0008263_5141_5545 124
124 3300048911 Ga0496108_0148879 Ga0496108_0148879_668_1072 124
125 3300048912 Ga0496109_0202462 Ga0496109_0202462_255_659 124
126 3300048913 Ga0496110_0212783 Ga0496110_0212783_1137_1541 124
127 3300048915 Ga0496112_0117027 Ga0496112_0117027_1320_1724 124
128 3300048916 Ga0496113_0098386 Ga0496113_0098386_888_1292 124
129 3300035171 Ga0373946_0563239 Ga0373946_0563239_140_544 125
130 3300035692 Ga0373935_0009711 Ga0373935_0009711_5113_5517 125
131 3300045976 Ga0466967_0027514 Ga0466967_0027514_1378_1788 125
132 3300046522 Ga0495643_0393389 Ga0495643_0393389_38_436 125
133 3300005327 Ga0070658_10007111 Ga0070658_100071119 126
134 3300005338 Ga0068868_100454913 Ga0068868_1004549132 126
135 3300005339 Ga0070660_100000339 Ga0070660_1000003395 126
136 3300005354 Ga0070675_100355003 Ga0070675_1003550032 126
137 3300005364 Ga0070673_100029719 Ga0070673_1000297193 126
138 3300005366 Ga0070659_101000084 Ga0070659_1010000841 126
139 3300005367 Ga0070667_100521863 Ga0070667_1005218632 126
140 3300005456 Ga0070678_100160172 Ga0070678_1001601722 126
141 3300005543 Ga0070672_100009843 Ga0070672_1000098434 126
142 3300005548 Ga0070665_100159377 Ga0070665_1001593772 126
143 3300005563 Ga0068855_100000247 Ga0068855_10000024726 126
144 3300005564 Ga0070664_100158916 Ga0070664_1001589162 126
145 3300005842 Ga0068858_100115005 Ga0068858_1001150053 126
146 3300009177 Ga0105248_10610712 Ga0105248_106107122 126
147 3300013102 Ga0157371_10000624 Ga0157371_1000062417 126
148 3300013104 Ga0157370_10350312 Ga0157370_103503122 126
149 3300013296 Ga0157374_10034433 Ga0157374_100344337 126
150 3300025904 Ga0207647_10014655 Ga0207647_100146552 126
151 3300025909 Ga0207705_10000082 Ga0207705_1000008233 126
152 3300025918 Ga0207662_10866349 Ga0207662_108663491 126
153 3300025919 Ga0207657_10000360 Ga0207657_1000036033 126
154 3300025926 Ga0207659_10083897 Ga0207659_100838973 126
155 3300025932 Ga0207690_10588261 Ga0207690_105882611 126
156 3300025940 Ga0207691_10013134 Ga0207691_100131344 126
157 3300025945 Ga0207679_10051489 Ga0207679_100514894 126
158 3300025949 Ga0207667_10000114 Ga0207667_10000114123 126
159 3300025986 Ga0207658_10453870 Ga0207658_104538702 126
160 3300026023 Ga0207677_10300752 Ga0207677_103007522 126
161 3300026035 Ga0207703_10042738 Ga0207703_100427384 126
162 3300026121 Ga0207683_10001629 Ga0207683_100016297 126
163 3300037418 Ga0395900_0609207 Ga0395900_0609207_544_924 126
164 3300037471 Ga0395905_0564245 Ga0395905_0564245_36_416 126
165 3300005327 Ga0070658_10706906 Ga0070658_107069062 127
166 3300005328 Ga0070676_10034995 Ga0070676_100349954 127
167 3300005331 Ga0070670_100438894 Ga0070670_1004388943 127
168 3300005334 Ga0068869_100318459 Ga0068869_1003184593 127
169 3300005335 Ga0070666_10193411 Ga0070666_101934112 127
170 3300005338 Ga0068868_100207917 Ga0068868_1002079172 127
171 3300005339 Ga0070660_101684040 Ga0070660_1016840401 127
172 3300005347 Ga0070668_100019581 Ga0070668_1000195814 127
173 3300005347 Ga0070668_101483319 Ga0070668_1014833191 127
174 3300005353 Ga0070669_100256674 Ga0070669_1002566742 127
175 3300005353 Ga0070669_100269297 Ga0070669_1002692973 127
176 3300005354 Ga0070675_100140457 Ga0070675_1001404572 127
177 3300005355 Ga0070671_100717777 Ga0070671_1007177772 127
178 3300005356 Ga0070674_100044481 Ga0070674_1000444816 127
179 3300005364 Ga0070673_100008589 Ga0070673_1000085894 127
180 3300005364 Ga0070673_100500918 Ga0070673_1005009182 127
181 3300005367 Ga0070667_100036196 Ga0070667_1000361964 127
182 3300005455 Ga0070663_100314442 Ga0070663_1003144422 127
183 3300005456 Ga0070678_101070560 Ga0070678_1010705601 127
184 3300005457 Ga0070662_100805208 Ga0070662_1008052082 127
185 3300005459 Ga0068867_100185971 Ga0068867_1001859712 127
186 3300005543 Ga0070672_100169136 Ga0070672_1001691364 127
187 3300005544 Ga0070686_100359814 Ga0070686_1003598142 127
188 3300005548 Ga0070665_100095470 Ga0070665_1000954704 127
189 3300005617 Ga0068859_100157169 Ga0068859_1001571696 127
190 3300005719 Ga0068861_100397804 Ga0068861_1003978042 127
191 3300005840 Ga0068870_10049839 Ga0068870_100498392 127
192 3300005843 Ga0068860_100022372 Ga0068860_1000223722 127
193 3300005844 Ga0068862_100333344 Ga0068862_1003333442 127
194 3300006237 Ga0097621_100073298 Ga0097621_1000732986 127
195 3300006237 Ga0097621_100769015 Ga0097621_1007690151 127
196 3300006358 Ga0068871_100149842 Ga0068871_1001498422 127
197 3300006881 Ga0068865_100555539 Ga0068865_1005555392 127
198 3300006931 Ga0097620_100157174 Ga0097620_1001571746 127
199 3300025893 Ga0207682_10222412 Ga0207682_102224122 127
200 3300025901 Ga0207688_10011556 Ga0207688_100115562 127
201 3300025903 Ga0207680_10249074 Ga0207680_102490742 127
202 3300025907 Ga0207645_10060475 Ga0207645_100604753 127
203 3300025908 Ga0207643_10025687 Ga0207643_100256875 127
204 3300025923 Ga0207681_10026545 Ga0207681_100265454 127
205 3300025925 Ga0207650_10112624 Ga0207650_101126243 127
206 3300025926 Ga0207659_10157715 Ga0207659_101577152 127
207 3300025931 Ga0207644_11198259 Ga0207644_111982591 127
208 3300025940 Ga0207691_10081216 Ga0207691_100812162 127
209 3300025941 Ga0207711_10647918 Ga0207711_106479182 127
210 3300025942 Ga0207689_10024225 Ga0207689_100242254 127
211 3300025960 Ga0207651_10282048 Ga0207651_102820482 127
212 3300025972 Ga0207668_10000072 Ga0207668_1000007254 127
213 3300025972 Ga0207668_10648170 Ga0207668_106481702 127
214 3300025986 Ga0207658_10021906 Ga0207658_100219067 127
215 3300025986 Ga0207658_10022216 Ga0207658_100222162 127
216 3300026023 Ga0207677_10071281 Ga0207677_100712812 127
217 3300026067 Ga0207678_10876423 Ga0207678_108764231 127
218 3300026089 Ga0207648_10002300 Ga0207648_1000230014 127
219 3300026118 Ga0207675_100504457 Ga0207675_1005044573 127
220 3300026121 Ga0207683_10055134 Ga0207683_100551343 127
221 3300028379 Ga0268266_10010764 Ga0268266_1001076410 127
222 3300028380 Ga0268265_10002655 Ga0268265_1000265514 127
223 3300028380 Ga0268265_10228207 Ga0268265_102282072 127
224 3300028381 Ga0268264_10006884 Ga0268264_1000688414 127
225 3300031852 Ga0307410_10227112 Ga0307410_102271122 127
226 3300031903 Ga0307407_11464884 Ga0307407_114648841 127
227 3300032005 Ga0307411_11363681 Ga0307411_113636811 127
228 3300032126 Ga0307415_101534432 Ga0307415_1015344322 127
229 3300001990 JGI24737J22298_10000655 JGI24737J22298_1000065513 128
230 3300005339 Ga0070660_100015001 Ga0070660_1000150015 128
231 3300005345 Ga0070692_10008029 Ga0070692_100080295 128
232 3300005347 Ga0070668_100544512 Ga0070668_1005445122 128
233 3300005353 Ga0070669_100140030 Ga0070669_1001400302 128
234 3300005366 Ga0070659_100005147 Ga0070659_10000514713 128
235 3300005444 Ga0070694_100025638 Ga0070694_1000256381 128
236 3300005457 Ga0070662_100031671 Ga0070662_1000316713 128
237 3300005539 Ga0068853_100100007 Ga0068853_1001000074 128
238 3300005543 Ga0070672_100169185 Ga0070672_1001691852 128
239 3300005545 Ga0070695_100520689 Ga0070695_1005206891 128
240 3300005548 Ga0070665_100049719 Ga0070665_1000497195 128
241 3300005549 Ga0070704_101078266 Ga0070704_1010782661 128
242 3300005563 Ga0068855_100024916 Ga0068855_1000249165 128
243 3300005577 Ga0068857_100252035 Ga0068857_1002520352 128
244 3300005617 Ga0068859_101533935 Ga0068859_1015339352 128
245 3300005843 Ga0068860_100160812 Ga0068860_1001608122 128
246 3300005844 Ga0068862_100186233 Ga0068862_1001862332 128
247 3300006931 Ga0097620_101534009 Ga0097620_1015340092 128
248 3300013308 Ga0157375_11198341 Ga0157375_111983412 128
249 3300014745 Ga0157377_10764551 Ga0157377_107645512 128
250 3300025904 Ga0207647_10007743 Ga0207647_100077433 128
251 3300025913 Ga0207695_10736975 Ga0207695_107369752 128
252 3300025919 Ga0207657_10022343 Ga0207657_100223437 128
253 3300025923 Ga0207681_11442421 Ga0207681_114424212 128
254 3300025932 Ga0207690_10042985 Ga0207690_100429852 128
255 3300025933 Ga0207706_10016257 Ga0207706_100162579 128
256 3300025935 Ga0207709_10334038 Ga0207709_103340382 128
257 3300025940 Ga0207691_10062014 Ga0207691_100620145 128
258 3300025949 Ga0207667_10094516 Ga0207667_100945162 128
259 3300025961 Ga0207712_10003235 Ga0207712_100032357 128
260 3300025972 Ga0207668_10160863 Ga0207668_101608632 128
261 3300026035 Ga0207703_11892354 Ga0207703_118923541 128
262 3300026041 Ga0207639_10029804 Ga0207639_100298044 128
263 3300026116 Ga0207674_10040219 Ga0207674_100402195 128
264 3300028379 Ga0268266_10061473 Ga0268266_100614734 128
265 3300028380 Ga0268265_10064979 Ga0268265_100649792 128
266 3300028381 Ga0268264_10148778 Ga0268264_101487782 128
267 3300031731 Ga0307405_10162711 Ga0307405_101627112 128
268 3300031852 Ga0307410_10246541 Ga0307410_102465412 128
269 3300031901 Ga0307406_10782456 Ga0307406_107824561 128
270 3300032126 Ga0307415_100129072 Ga0307415_1001290722 128
271 3300046684 Ga0495669_0027869 Ga0495669_0027869_1844_2236 128
272 3300005347 Ga0070668_100489744 Ga0070668_1004897441 129
273 3300005353 Ga0070669_101285535 Ga0070669_1012855351 129
274 3300005844 Ga0068862_100016753 Ga0068862_1000167533 129
275 3300025907 Ga0207645_10417150 Ga0207645_104171501 129
276 3300025972 Ga0207668_10033122 Ga0207668_100331224 129
277 3300028380 Ga0268265_10003724 Ga0268265_1000372413 129
278 3300031824 Ga0307413_10002467 Ga0307413_1000246710 129
279 3300031824 Ga0307413_10010593 Ga0307413_100105933 129
280 3300031852 Ga0307410_10011969 Ga0307410_100119693 129
281 3300031903 Ga0307407_10099736 Ga0307407_100997363 129
282 3300031903 Ga0307407_10109914 Ga0307407_101099143 129
283 3300031995 Ga0307409_100021681 Ga0307409_1000216813 129
284 3300031995 Ga0307409_100230612 Ga0307409_1002306121 129
285 3300032002 Ga0307416_100968210 Ga0307416_1009682102 129
286 3300032002 Ga0307416_101433404 Ga0307416_1014334042 129
287 3300032004 Ga0307414_10009564 Ga0307414_100095643 129
288 3300032005 Ga0307411_10000475 Ga0307411_1000047511 129
289 3300032005 Ga0307411_10003128 Ga0307411_100031284 129
290 3300032126 Ga0307415_100141369 Ga0307415_1001413693 129
291 3300032126 Ga0307415_100575332 Ga0307415_1005753322 129
292 3300049585 Ga0501069_0120442 Ga0501069_0120442_502_924 129
293 3300005331 Ga0070670_101516190 Ga0070670_1015161901 130
294 3300005334 Ga0068869_100653340 Ga0068869_1006533402 130
295 3300005347 Ga0070668_100058980 Ga0070668_1000589806 130
296 3300005353 Ga0070669_100185501 Ga0070669_1001855013 130
297 3300005355 Ga0070671_100016707 Ga0070671_1000167073 130
298 3300005364 Ga0070673_100125407 Ga0070673_1001254071 130
299 3300005367 Ga0070667_100003813 Ga0070667_1000038133 130
300 3300005367 Ga0070667_100042585 Ga0070667_1000425856 130
301 3300005367 Ga0070667_101026454 Ga0070667_1010264541 130
302 3300005617 Ga0068859_100002392 Ga0068859_1000023928 130
303 3300005618 Ga0068864_100001110 Ga0068864_10000111018 130
304 3300005618 Ga0068864_100510382 Ga0068864_1005103821 130
305 3300005718 Ga0068866_10067216 Ga0068866_100672162 130
306 3300005841 Ga0068863_100001056 Ga0068863_1000010568 130
307 3300005842 Ga0068858_100003145 Ga0068858_10000314515 130
308 3300005843 Ga0068860_100002768 Ga0068860_1000027688 130
309 3300005843 Ga0068860_100739500 Ga0068860_1007395002 130
310 3300005844 Ga0068862_100209588 Ga0068862_1002095884 130
311 3300006931 Ga0097620_100002392 Ga0097620_1000023928 130
312 3300009093 Ga0105240_10122528 Ga0105240_101225282 130
313 3300009148 Ga0105243_10678028 Ga0105243_106780282 130
314 3300009553 Ga0105249_10026474 Ga0105249_100264746 130
315 3300010375 Ga0105239_10042112 Ga0105239_100421127 130
316 3300013100 Ga0157373_10699714 Ga0157373_106997142 130
317 3300013102 Ga0157371_10195695 Ga0157371_101956951 130
318 3300013306 Ga0163162_10154261 Ga0163162_101542612 130
319 3300013307 Ga0157372_12392102 Ga0157372_123921022 130
320 3300014968 Ga0157379_10028415 Ga0157379_100284152 130
321 3300014968 Ga0157379_10271188 Ga0157379_102711882 130
322 3300025711 Ga0207696_1014589 Ga0207696_10145892 130
323 3300025899 Ga0207642_10103059 Ga0207642_101030592 130
324 3300025923 Ga0207681_10032261 Ga0207681_100322616 130
325 3300025925 Ga0207650_10460092 Ga0207650_104600922 130
326 3300025931 Ga0207644_10036457 Ga0207644_100364575 130
327 3300025933 Ga0207706_10317391 Ga0207706_103173914 130
328 3300025941 Ga0207711_10000869 Ga0207711_1000086924 130
329 3300025942 Ga0207689_10033527 Ga0207689_100335276 130
330 3300025960 Ga0207651_10009471 Ga0207651_100094716 130
331 3300025961 Ga0207712_10058889 Ga0207712_100588892 130
332 3300025986 Ga0207658_10009361 Ga0207658_100093613 130
333 3300025986 Ga0207658_10015372 Ga0207658_100153728 130
334 3300025986 Ga0207658_10785992 Ga0207658_107859922 130
335 3300026035 Ga0207703_10004152 Ga0207703_1000415210 130
336 3300026088 Ga0207641_10001513 Ga0207641_100015138 130
337 3300026095 Ga0207676_10006150 Ga0207676_100061506 130
338 3300028380 Ga0268265_10182703 Ga0268265_101827034 130
339 3300028380 Ga0268265_10326296 Ga0268265_103262962 130
340 3300028381 Ga0268264_10005781 Ga0268264_100057818 130
341 3300028381 Ga0268264_10429415 Ga0268264_104294152 130
342 3300028381 Ga0268264_10637035 Ga0268264_106370352 130
343 3300032002 Ga0307416_100608895 Ga0307416_1006088952 130
344 3300038443 Ga0395901_1974721 Ga0395901_1974721_66_488 130
345 3300042439 Ga0439464_0000350 Ga0439464_0000350_1524_1922 130
346 3300005343 Ga0070687_100190983 Ga0070687_1001909832 131
347 3300005841 Ga0068863_100588306 Ga0068863_1005883062 131
348 3300005843 Ga0068860_100599134 Ga0068860_1005991342 131
349 3300009092 Ga0105250_10020270 Ga0105250_100202702 131
350 3300009101 Ga0105247_10136598 Ga0105247_101365982 131
351 3300009177 Ga0105248_10001320 Ga0105248_1000132027 131
352 3300009553 Ga0105249_10026708 Ga0105249_100267082 131
353 3300013306 Ga0163162_10460752 Ga0163162_104607524 131
354 3300014325 Ga0163163_10006151 Ga0163163_100061518 131
355 3300025935 Ga0207709_10373253 Ga0207709_103732531 131
356 3300028381 Ga0268264_10537805 Ga0268264_105378053 131
357 3300031731 Ga0307405_10082142 Ga0307405_100821422 131
358 3300037471 Ga0395905_0001031 Ga0395905_0001031_2433_2888 131
359 3300037471 Ga0395905_0370642 Ga0395905_0370642_130_528 131
360 3300046616 Ga0495668_0050557 Ga0495668_0050557_1114_1533 131
361 3300048915 Ga0496112_0057299 Ga0496112_0057299_2512_2937 131
362 3300048916 Ga0496113_1077842 Ga0496113_1077842_149_574 131
363 3300049583 Ga0501067_0035435 Ga0501067_0035435_2118_2540 131
364 3300049586 Ga0501070_0860643 Ga0501070_0860643_92_514 131
365 3300053134 Ga0500658_0000036 Ga0500658_0000036_46336_46755 131
366 3300005327 Ga0070658_10026585 Ga0070658_100265856 132
367 3300005458 Ga0070681_10063111 Ga0070681_100631112 132
368 3300005530 Ga0070679_101042618 Ga0070679_1010426181 132
369 3300005563 Ga0068855_101203595 Ga0068855_1012035952 132
370 3300005577 Ga0068857_100022877 Ga0068857_1000228772 132
371 3300005616 Ga0068852_100282041 Ga0068852_1002820412 132
372 3300005844 Ga0068862_100101524 Ga0068862_1001015243 132
373 3300006028 Ga0070717_10307576 Ga0070717_103075762 132
374 3300006177 Ga0075362_10040870 Ga0075362_100408703 132
375 3300009094 Ga0111539_10687239 Ga0111539_106872391 132
376 3300009551 Ga0105238_10284737 Ga0105238_102847372 132
377 3300013105 Ga0157369_10004619 Ga0157369_1000461910 132
378 3300013307 Ga0157372_10571284 Ga0157372_105712843 132
379 3300013307 Ga0157372_11304519 Ga0157372_113045192 132
380 3300025906 Ga0207699_11048191 Ga0207699_110481912 132
381 3300025909 Ga0207705_10026022 Ga0207705_100260227 132
382 3300025911 Ga0207654_10875007 Ga0207654_108750071 132
383 3300025912 Ga0207707_10087292 Ga0207707_100872923 132
384 3300025915 Ga0207693_10471338 Ga0207693_104713382 132
385 3300025915 Ga0207693_10654058 Ga0207693_106540582 132
386 3300025919 Ga0207657_10023065 Ga0207657_100230653 132
387 3300025920 Ga0207649_10308980 Ga0207649_103089802 132
388 3300025921 Ga0207652_10268136 Ga0207652_102681362 132
389 3300025924 Ga0207694_10425874 Ga0207694_104258742 132
390 3300025932 Ga0207690_10053007 Ga0207690_100530073 132
391 3300025933 Ga0207706_11214764 Ga0207706_112147641 132
392 3300025945 Ga0207679_10031355 Ga0207679_100313553 132
393 3300025949 Ga0207667_10475191 Ga0207667_104751913 132
394 3300025981 Ga0207640_10014591 Ga0207640_100145912 132
395 3300026078 Ga0207702_10054149 Ga0207702_100541493 132
396 3300026116 Ga0207674_10028194 Ga0207674_100281946 132
397 3300026142 Ga0207698_11222284 Ga0207698_112222842 132
398 3300031903 Ga0307407_10140567 Ga0307407_101405672 132
399 3300031995 Ga0307409_100568805 Ga0307409_1005688051 132
400 3300032002 Ga0307416_100631338 Ga0307416_1006313381 132
401 3300037418 Ga0395900_0546808 Ga0395900_0546808_345_755 132
402 3300037471 Ga0395905_1037366 Ga0395905_1037366_10_426 132
403 3300045976 Ga0466967_0038382 Ga0466967_0038382_763_1197 132
404 3300045976 Ga0466967_0047665 Ga0466967_0047665_2968_3378 132
405 3300048904 Ga0496101_1447997 Ga0496101_1447997_106_516 132
406 3300048910 Ga0496107_0170668 Ga0496107_0170668_611_1021 132
407 3300048913 Ga0496110_1294800 Ga0496110_1294800_183_593 132
408 3300048914 Ga0496111_0140569 Ga0496111_0140569_750_1160 132
409 3300048915 Ga0496112_0109240 Ga0496112_0109240_1629_2039 132
410 3300049667 Ga0501230_076047 Ga0501230_076047_272_682 132
411 3300049765 Ga0501268_026444 Ga0501268_026444_459_869 132
412 3300049767 Ga0501270_009736 Ga0501270_009736_797_1207 132
413 3300050511 nmdc:mga08y16_533163_c1 nmdc:mga08y16_533163_c1_18_467 132
414 3300059492 Ga0587073_0086711 Ga0587073_0086711_281_712 132
415 3300001915 JGI24741J21665_1018528 JGI24741J21665_10185283 133
416 3300001979 JGI24740J21852_10004688 JGI24740J21852_100046888 133
417 3300001979 JGI24740J21852_10026117 JGI24740J21852_100261172 133
418 3300001991 JGI24743J22301_10048885 JGI24743J22301_100488852 133
419 3300002067 JGI24735J21928_10057368 JGI24735J21928_100573682 133
420 3300002075 JGI24738J21930_10070799 JGI24738J21930_100707992 133
421 3300005327 Ga0070658_10020842 Ga0070658_100208423 133
422 3300005328 Ga0070676_10077479 Ga0070676_100774792 133
423 3300005329 Ga0070683_100007370 Ga0070683_1000073707 133
424 3300005330 Ga0070690_100060826 Ga0070690_1000608264 133
425 3300005331 Ga0070670_100030482 Ga0070670_1000304822 133
426 3300005331 Ga0070670_100091124 Ga0070670_1000911242 133
427 3300005331 Ga0070670_102008472 Ga0070670_1020084721 133
428 3300005333 Ga0070677_10592280 Ga0070677_105922801 133
429 3300005335 Ga0070666_10208281 Ga0070666_102082813 133
430 3300005336 Ga0070680_100007182 Ga0070680_1000071823 133
431 3300005336 Ga0070680_100217441 Ga0070680_1002174414 133
432 3300005337 Ga0070682_100230895 Ga0070682_1002308951 133
433 3300005338 Ga0068868_100147000 Ga0068868_1001470002 133
434 3300005339 Ga0070660_100003053 Ga0070660_1000030537 133
435 3300005344 Ga0070661_100034939 Ga0070661_1000349394 133
436 3300005344 Ga0070661_100118743 Ga0070661_1001187432 133
437 3300005344 Ga0070661_100325891 Ga0070661_1003258912 133
438 3300005345 Ga0070692_10011894 Ga0070692_100118943 133
439 3300005355 Ga0070671_100196846 Ga0070671_1001968462 133
440 3300005364 Ga0070673_100072882 Ga0070673_1000728823 133
441 3300005366 Ga0070659_100238704 Ga0070659_1002387041 133
442 3300005367 Ga0070667_100264287 Ga0070667_1002642871 133
443 3300005455 Ga0070663_100008493 Ga0070663_1000084937 133
444 3300005455 Ga0070663_100222806 Ga0070663_1002228063 133
445 3300005456 Ga0070678_100271767 Ga0070678_1002717672 133
446 3300005456 Ga0070678_101080991 Ga0070678_1010809911 133
447 3300005458 Ga0070681_10020408 Ga0070681_100204087 133
448 3300005459 Ga0068867_100093557 Ga0068867_1000935572 133
449 3300005530 Ga0070679_100015769 Ga0070679_1000157695 133
450 3300005530 Ga0070679_100211998 Ga0070679_1002119982 133
451 3300005535 Ga0070684_100007613 Ga0070684_1000076136 133
452 3300005539 Ga0068853_101579720 Ga0068853_1015797201 133
453 3300005546 Ga0070696_100804678 Ga0070696_1008046782 133
454 3300005547 Ga0070693_100120838 Ga0070693_1001208382 133
455 3300005563 Ga0068855_100070606 Ga0068855_1000706063 133
456 3300005563 Ga0068855_100082525 Ga0068855_1000825254 133
457 3300005564 Ga0070664_100003026 Ga0070664_1000030267 133
458 3300005614 Ga0068856_100014742 Ga0068856_1000147425 133
459 3300005616 Ga0068852_100688902 Ga0068852_1006889022 133
460 3300009177 Ga0105248_10760313 Ga0105248_107603132 133
461 3300009545 Ga0105237_10099852 Ga0105237_100998525 133
462 3300009551 Ga0105238_10923203 Ga0105238_109232032 133
463 3300013100 Ga0157373_10093973 Ga0157373_100939733 133
464 3300013100 Ga0157373_10104195 Ga0157373_101041953 133
465 3300013102 Ga0157371_10079776 Ga0157371_100797762 133
466 3300013104 Ga0157370_10015768 Ga0157370_100157682 133
467 3300013105 Ga0157369_10063577 Ga0157369_100635775 133
468 3300013296 Ga0157374_10101337 Ga0157374_101013373 133
469 3300014968 Ga0157379_10003612 Ga0157379_100036125 133
470 3300020076 Ga0206355_1223371 Ga0206355_12233712 133
471 3300025321 Ga0207656_10088655 Ga0207656_100886551 133
472 3300025903 Ga0207680_10434187 Ga0207680_104341872 133
473 3300025904 Ga0207647_10104745 Ga0207647_101047453 133
474 3300025904 Ga0207647_10166710 Ga0207647_101667102 133
475 3300025907 Ga0207645_10008669 Ga0207645_100086692 133
476 3300025909 Ga0207705_10000493 Ga0207705_100004938 133
477 3300025909 Ga0207705_10005027 Ga0207705_100050272 133
478 3300025909 Ga0207705_10039003 Ga0207705_100390033 133
479 3300025911 Ga0207654_10118589 Ga0207654_101185894 133
480 3300025912 Ga0207707_10025551 Ga0207707_100255514 133
481 3300025912 Ga0207707_10343098 Ga0207707_103430982 133
482 3300025917 Ga0207660_10000770 Ga0207660_100007708 133
483 3300025917 Ga0207660_10019326 Ga0207660_100193266 133
484 3300025919 Ga0207657_10001678 Ga0207657_1000167816 133
485 3300025919 Ga0207657_10002261 Ga0207657_1000226110 133
486 3300025919 Ga0207657_10011262 Ga0207657_100112627 133
487 3300025919 Ga0207657_10140861 Ga0207657_101408614 133
488 3300025920 Ga0207649_10018705 Ga0207649_100187053 133
489 3300025920 Ga0207649_10128035 Ga0207649_101280352 133
490 3300025921 Ga0207652_10000034 Ga0207652_10000034120 133
491 3300025921 Ga0207652_10028676 Ga0207652_100286767 133
492 3300025925 Ga0207650_10093483 Ga0207650_100934832 133
493 3300025925 Ga0207650_10457245 Ga0207650_104572452 133
494 3300025931 Ga0207644_10486112 Ga0207644_104861122 133
495 3300025932 Ga0207690_10099389 Ga0207690_100993892 133
496 3300025932 Ga0207690_10120973 Ga0207690_101209735 133
497 3300025932 Ga0207690_10711457 Ga0207690_107114572 133
498 3300025933 Ga0207706_10020249 Ga0207706_100202496 133
499 3300025944 Ga0207661_10002726 Ga0207661_100027268 133
500 3300025945 Ga0207679_10001488 Ga0207679_1000148819 133
501 3300025945 Ga0207679_10426486 Ga0207679_104264861 133
502 3300025949 Ga0207667_10069541 Ga0207667_100695414 133
503 3300025949 Ga0207667_10095578 Ga0207667_100955782 133
504 3300025981 Ga0207640_10553422 Ga0207640_105534222 133
505 3300025986 Ga0207658_10026119 Ga0207658_100261194 133
506 3300026023 Ga0207677_10277365 Ga0207677_102773652 133
507 3300026041 Ga0207639_10318103 Ga0207639_103181032 133
508 3300026041 Ga0207639_10334654 Ga0207639_103346544 133
509 3300026067 Ga0207678_10004938 Ga0207678_100049382 133
510 3300026067 Ga0207678_10011128 Ga0207678_100111287 133
511 3300026067 Ga0207678_10051977 Ga0207678_100519776 133
512 3300026078 Ga0207702_10022362 Ga0207702_100223623 133
513 3300026089 Ga0207648_10118017 Ga0207648_101180172 133
514 3300026116 Ga0207674_10058545 Ga0207674_100585454 133
515 3300026116 Ga0207674_10194371 Ga0207674_101943713 133
516 3300026116 Ga0207674_11311970 Ga0207674_113119702 133
517 3300026121 Ga0207683_10195399 Ga0207683_101953993 133
518 3300026142 Ga0207698_10077733 Ga0207698_100777333 133
519 3300026142 Ga0207698_10392822 Ga0207698_103928223 133
520 3300026142 Ga0207698_11073888 Ga0207698_110738881 133
521 3300031731 Ga0307405_10370384 Ga0307405_103703842 133
522 3300031901 Ga0307406_10181586 Ga0307406_101815862 133
523 3300037312 Ga0395899_0026489 Ga0395899_0026489_1121_1540 133
524 3300037418 Ga0395900_0003085 Ga0395900_0003085_11183_11602 133
525 3300037418 Ga0395900_0013504 Ga0395900_0013504_5713_6120 133
526 3300037418 Ga0395900_0479947 Ga0395900_0479947_682_1089 133
527 3300037466 Ga0395898_0010465 Ga0395898_0010465_6502_6921 133
528 3300037466 Ga0395898_0352082 Ga0395898_0352082_640_1047 133
529 3300037466 Ga0395898_0822954 Ga0395898_0822954_271_678 133
530 3300037471 Ga0395905_0000104 Ga0395905_0000104_90422_90829 133
531 3300037471 Ga0395905_0028195 Ga0395905_0028195_1490_1909 133
532 3300038443 Ga0395901_0044992 Ga0395901_0044992_1439_1858 133
533 3300042007 Ga0439449_0095892 Ga0439449_0095892_626_1033 133
534 3300044656 Ga0466969_0174412 Ga0466969_0174412_11_418 133
535 3300044684 Ga0466966_0075412 Ga0466966_0075412_1653_2060 133
536 3300044693 Ga0466961_0048228 Ga0466961_0048228_2272_2679 133
537 3300044719 Ga0466971_0025392 Ga0466971_0025392_619_1053 133
538 3300045049 Ga0466959_0176653 Ga0466959_0176653_755_1162 133
539 3300045836 Ga0466958_0468886 Ga0466958_0468886_288_695 133
540 3300046492 Ga0495585_0120095 Ga0495585_0120095_769_1203 133
541 3300046684 Ga0495669_0101523 Ga0495669_0101523_634_1056 133
542 3300046684 Ga0495669_0313169 Ga0495669_0313169_187_594 133
543 3300048903 Ga0496100_0165871 Ga0496100_0165871_32_445 133
544 3300048904 Ga0496101_0124376 Ga0496101_0124376_1031_1444 133
545 3300048905 Ga0496102_0141200 Ga0496102_0141200_1529_1942 133
546 3300048906 Ga0496103_0044232 Ga0496103_0044232_1300_1713 133
547 3300048907 Ga0496104_0215519 Ga0496104_0215519_109_522 133
548 3300048908 Ga0496105_0096247 Ga0496105_0096247_580_993 133
549 3300048909 Ga0496106_0047950 Ga0496106_0047950_2050_2463 133
550 3300048910 Ga0496107_0025841 Ga0496107_0025841_1731_2144 133
551 3300048910 Ga0496107_0510113 Ga0496107_0510113_424_831 133
552 3300048911 Ga0496108_0009895 Ga0496108_0009895_1228_1641 133
553 3300048911 Ga0496108_0038691 Ga0496108_0038691_1373_1795 133
554 3300048912 Ga0496109_0119558 Ga0496109_0119558_1137_1550 133
555 3300048913 Ga0496110_0047002 Ga0496110_0047002_1848_2261 133
556 3300048914 Ga0496111_0007276 Ga0496111_0007276_95_508 133
557 3300048915 Ga0496112_0058934 Ga0496112_0058934_2814_3227 133
558 3300048916 Ga0496113_0012024 Ga0496113_0012024_2137_2550 133
559 3300060344 Ga0587071_022250 Ga0587071_022250_190_603 133
560 3300005290 Ga0065712_10211573 Ga0065712_102115731 134
561 3300005331 Ga0070670_100073467 Ga0070670_1000734672 134
562 3300005331 Ga0070670_100159061 Ga0070670_1001590612 134
563 3300005331 Ga0070670_100325843 Ga0070670_1003258434 134
564 3300005335 Ga0070666_10007668 Ga0070666_100076682 134
565 3300005338 Ga0068868_100157935 Ga0068868_1001579352 134
566 3300005344 Ga0070661_100023710 Ga0070661_1000237102 134
567 3300005355 Ga0070671_100081281 Ga0070671_1000812813 134
568 3300005355 Ga0070671_100151912 Ga0070671_1001519123 134
569 3300005364 Ga0070673_100068180 Ga0070673_1000681802 134
570 3300005367 Ga0070667_100008539 Ga0070667_1000085399 134
571 3300005367 Ga0070667_100462252 Ga0070667_1004622521 134
572 3300005455 Ga0070663_100817736 Ga0070663_1008177362 134
573 3300005456 Ga0070678_100001567 Ga0070678_10000156712 134
574 3300005457 Ga0070662_100318556 Ga0070662_1003185562 134
575 3300005459 Ga0068867_100830755 Ga0068867_1008307551 134
576 3300005466 Ga0070685_10057207 Ga0070685_100572072 134
577 3300005539 Ga0068853_101073267 Ga0068853_1010732671 134
578 3300005548 Ga0070665_100124803 Ga0070665_1001248033 134
579 3300005563 Ga0068855_100764707 Ga0068855_1007647072 134
580 3300005564 Ga0070664_100129822 Ga0070664_1001298223 134
581 3300005617 Ga0068859_100257758 Ga0068859_1002577583 134
582 3300005618 Ga0068864_100040637 Ga0068864_1000406372 134
583 3300005841 Ga0068863_100022022 Ga0068863_1000220223 134
584 3300005841 Ga0068863_100079639 Ga0068863_1000796392 134
585 3300005842 Ga0068858_100002753 Ga0068858_1000027532 134
586 3300005842 Ga0068858_100864297 Ga0068858_1008642972 134
587 3300006237 Ga0097621_100011209 Ga0097621_1000112099 134
588 3300006237 Ga0097621_100079858 Ga0097621_1000798583 134
589 3300006931 Ga0097620_100257750 Ga0097620_1002577503 134
590 3300009101 Ga0105247_11578015 Ga0105247_115780151 134
591 3300009177 Ga0105248_10034268 Ga0105248_100342683 134
592 3300009177 Ga0105248_10034516 Ga0105248_100345166 134
593 3300009177 Ga0105248_10044563 Ga0105248_100445631 134
594 3300009553 Ga0105249_10297614 Ga0105249_102976142 134
595 3300013102 Ga0157371_10060886 Ga0157371_100608862 134
596 3300013296 Ga0157374_10002253 Ga0157374_1000225318 134
597 3300013306 Ga0163162_10021265 Ga0163162_100212652 134
598 3300013308 Ga0157375_10004680 Ga0157375_100046808 134
599 3300014325 Ga0163163_10002706 Ga0163163_1000270616 134
600 3300014968 Ga0157379_11834004 Ga0157379_118340042 134
601 3300021384 Ga0213876_10807115 Ga0213876_108071151 134
602 3300025901 Ga0207688_10197216 Ga0207688_101972162 134
603 3300025903 Ga0207680_10250498 Ga0207680_102504982 134
604 3300025903 Ga0207680_10471134 Ga0207680_104711342 134
605 3300025925 Ga0207650_10017046 Ga0207650_100170465 134
606 3300025925 Ga0207650_10278944 Ga0207650_102789443 134
607 3300025931 Ga0207644_10025723 Ga0207644_100257233 134
608 3300025931 Ga0207644_10031105 Ga0207644_100311053 134
609 3300025933 Ga0207706_10007819 Ga0207706_1000781911 134
610 3300025940 Ga0207691_10026469 Ga0207691_100264697 134
611 3300025941 Ga0207711_10006956 Ga0207711_100069563 134
612 3300025941 Ga0207711_10047302 Ga0207711_100473023 134
613 3300025941 Ga0207711_10186107 Ga0207711_101861072 134
614 3300025945 Ga0207679_10025135 Ga0207679_100251354 134
615 3300025986 Ga0207658_10096138 Ga0207658_100961383 134
616 3300025986 Ga0207658_10177607 Ga0207658_101776073 134
617 3300026035 Ga0207703_10142454 Ga0207703_101424541 134
618 3300026041 Ga0207639_10381418 Ga0207639_103814182 134
619 3300026067 Ga0207678_11207644 Ga0207678_112076442 134
620 3300026088 Ga0207641_10112062 Ga0207641_101120623 134
621 3300026089 Ga0207648_10831389 Ga0207648_108313892 134
622 3300026095 Ga0207676_10014327 Ga0207676_100143273 134
623 3300026121 Ga0207683_10004970 Ga0207683_100049703 134
624 3300028379 Ga0268266_10137169 Ga0268266_101371693 134
625 3300028381 Ga0268264_10308887 Ga0268264_103088873 134
626 3300028381 Ga0268264_10747498 Ga0268264_107474982 134
627 3300031456 Ga0307513_10504345 Ga0307513_105043451 134
628 3300032004 Ga0307414_10792635 Ga0307414_107926352 134
629 3300037312 Ga0395899_0059381 Ga0395899_0059381_1765_2175 134
630 3300037466 Ga0395898_0064367 Ga0395898_0064367_2584_2994 134
631 3300042157 Ga0439458_0060151 Ga0439458_0060151_475_885 134
632 3300046528 Ga0495642_0376421 Ga0495642_0376421_137_547 134
633 3300047445 Ga0495677_0047340 Ga0495677_0047340_917_1342 134
634 3300048904 Ga0496101_0118283 Ga0496101_0118283_93_503 134
635 3300048904 Ga0496101_0189895 Ga0496101_0189895_734_1144 134
636 3300048909 Ga0496106_0033452 Ga0496106_0033452_1437_1847 134
637 3300048910 Ga0496107_0046907 Ga0496107_0046907_2457_2867 134
638 3300048911 Ga0496108_0040243 Ga0496108_0040243_2060_2470 134
639 3300048912 Ga0496109_0145862 Ga0496109_0145862_1083_1493 134
640 3300048913 Ga0496110_0091427 Ga0496110_0091427_292_702 134
641 3300048914 Ga0496111_0148522 Ga0496111_0148522_588_998 134
642 3300048915 Ga0496112_0172125 Ga0496112_0172125_1305_1715 134
643 3300048916 Ga0496113_0073323 Ga0496113_0073323_849_1259 134
644 3300048917 Ga0496114_0030533 Ga0496114_0030533_638_1048 134
645 3300048918 Ga0496115_0144384 Ga0496115_0144384_620_1030 134
646 3300050512 nmdc:mga0n895_544974_c1 nmdc:mga0n895_544974_c1_285_695 134
647 3300005367 Ga0070667_100243972 Ga0070667_1002439723 135
648 3300013102 Ga0157371_10209660 Ga0157371_102096602 135
649 3300013297 Ga0157378_11842491 Ga0157378_118424912 135
650 3300025986 Ga0207658_10107463 Ga0207658_101074632 135
651 3300026088 Ga0207641_10064867 Ga0207641_100648673 135
652 3300037418 Ga0395900_0015910 Ga0395900_0015910_593_1015 135
653 3300037418 Ga0395900_0203772 Ga0395900_0203772_774_1187 135
654 3300037466 Ga0395898_0329791 Ga0395898_0329791_235_648 135
655 3300038443 Ga0395901_0001126 Ga0395901_0001126_20994_21416 135
656 3300044656 Ga0466969_0084983 Ga0466969_0084983_1059_1469 135
657 3300044684 Ga0466966_0151438 Ga0466966_0151438_194_604 135
658 3300044694 Ga0466963_0058368 Ga0466963_0058368_1893_2303 135
659 3300044901 Ga0466960_0297462 Ga0466960_0297462_124_543 135
660 3300045049 Ga0466959_0026160 Ga0466959_0026160_1208_1618 135
661 3300045836 Ga0466958_0032434 Ga0466958_0032434_2213_2623 135
662 3300045836 Ga0466958_0104886 Ga0466958_0104886_691_1101 135
663 3300048910 Ga0496107_0144468 Ga0496107_0144468_570_983 135
664 3300001915 JGI24741J21665_1012998 JGI24741J21665_10129982 136
665 3300001979 JGI24740J21852_10008945 JGI24740J21852_100089455 136
666 3300001989 JGI24739J22299_10004473 JGI24739J22299_100044734 136
667 3300001990 JGI24737J22298_10000987 JGI24737J22298_100009879 136
668 3300002067 JGI24735J21928_10058798 JGI24735J21928_100587982 136
669 3300002075 JGI24738J21930_10000812 JGI24738J21930_100008126 136
670 3300005327 Ga0070658_10000269 Ga0070658_1000026937 136
671 3300005329 Ga0070683_100001138 Ga0070683_10000113811 136
672 3300005329 Ga0070683_100361267 Ga0070683_1003612672 136
673 3300005329 Ga0070683_101090397 Ga0070683_1010903971 136
674 3300005330 Ga0070690_100657645 Ga0070690_1006576452 136
675 3300005331 Ga0070670_100028324 Ga0070670_1000283242 136
676 3300005335 Ga0070666_10000330 Ga0070666_1000033020 136
677 3300005339 Ga0070660_100000109 Ga0070660_10000010912 136
678 3300005339 Ga0070660_100582750 Ga0070660_1005827501 136
679 3300005344 Ga0070661_100000070 Ga0070661_10000007077 136
680 3300005355 Ga0070671_100026341 Ga0070671_1000263415 136
681 3300005366 Ga0070659_100000312 Ga0070659_10000031227 136
682 3300005366 Ga0070659_100053970 Ga0070659_1000539705 136
683 3300005367 Ga0070667_100081281 Ga0070667_1000812815 136
684 3300005435 Ga0070714_100304477 Ga0070714_1003044772 136
685 3300005455 Ga0070663_100006534 Ga0070663_1000065347 136
686 3300005457 Ga0070662_100000037 Ga0070662_10000003767 136
687 3300005539 Ga0068853_100000309 Ga0068853_10000030913 136
688 3300005546 Ga0070696_100137209 Ga0070696_1001372091 136
689 3300005547 Ga0070693_100003397 Ga0070693_1000033975 136
690 3300005548 Ga0070665_100002925 Ga0070665_10000292513 136
691 3300005563 Ga0068855_100037585 Ga0068855_1000375857 136
692 3300005563 Ga0068855_101283533 Ga0068855_1012835332 136
693 3300005564 Ga0070664_100000077 Ga0070664_10000007713 136
694 3300005577 Ga0068857_100020826 Ga0068857_1000208262 136
695 3300005577 Ga0068857_101034718 Ga0068857_1010347182 136
696 3300005578 Ga0068854_100503140 Ga0068854_1005031401 136
697 3300005614 Ga0068856_100000444 Ga0068856_10000044437 136
698 3300005614 Ga0068856_100153077 Ga0068856_1001530774 136
699 3300005615 Ga0070702_100231833 Ga0070702_1002318332 136
700 3300005616 Ga0068852_100000350 Ga0068852_1000003505 136
701 3300005618 Ga0068864_100002819 Ga0068864_1000028195 136
702 3300005834 Ga0068851_10006475 Ga0068851_100064755 136
703 3300005842 Ga0068858_100020528 Ga0068858_1000205287 136
704 3300006237 Ga0097621_100386946 Ga0097621_1003869462 136
705 3300009174 Ga0105241_10035146 Ga0105241_100351464 136
706 3300009177 Ga0105248_10000719 Ga0105248_1000071914 136
707 3300009551 Ga0105238_10238785 Ga0105238_102387852 136
708 3300013100 Ga0157373_10239812 Ga0157373_102398123 136
709 3300013102 Ga0157371_10009369 Ga0157371_100093692 136
710 3300013105 Ga0157369_10083232 Ga0157369_100832325 136
711 3300013105 Ga0157369_10743491 Ga0157369_107434913 136
712 3300013296 Ga0157374_10437965 Ga0157374_104379653 136
713 3300013307 Ga0157372_10143435 Ga0157372_101434355 136
714 3300013307 Ga0157372_10506493 Ga0157372_105064932 136
715 3300014325 Ga0163163_10000123 Ga0163163_1000012377 136
716 3300014968 Ga0157379_10013809 Ga0157379_100138092 136
717 3300020082 Ga0206353_10745816 Ga0206353_107458162 136
718 3300025321 Ga0207656_10051647 Ga0207656_100516472 136
719 3300025903 Ga0207680_10033482 Ga0207680_100334825 136
720 3300025904 Ga0207647_10021670 Ga0207647_100216705 136
721 3300025909 Ga0207705_10000086 Ga0207705_1000008614 136
722 3300025909 Ga0207705_10052448 Ga0207705_100524485 136
723 3300025911 Ga0207654_10031984 Ga0207654_100319843 136
724 3300025919 Ga0207657_10001020 Ga0207657_1000102019 136
725 3300025919 Ga0207657_10524623 Ga0207657_105246232 136
726 3300025920 Ga0207649_10000420 Ga0207649_1000042031 136
727 3300025924 Ga0207694_10123657 Ga0207694_101236572 136
728 3300025925 Ga0207650_10032900 Ga0207650_100329002 136
729 3300025929 Ga0207664_10854551 Ga0207664_108545512 136
730 3300025931 Ga0207644_10006312 Ga0207644_100063126 136
731 3300025932 Ga0207690_10000413 Ga0207690_1000041313 136
732 3300025933 Ga0207706_10000192 Ga0207706_1000019256 136
733 3300025941 Ga0207711_10002038 Ga0207711_1000203817 136
734 3300025944 Ga0207661_10028875 Ga0207661_100288754 136
735 3300025945 Ga0207679_10000347 Ga0207679_1000034721 136
736 3300025949 Ga0207667_10000850 Ga0207667_1000085032 136
737 3300025949 Ga0207667_10364114 Ga0207667_103641142 136
738 3300026035 Ga0207703_10014313 Ga0207703_100143135 136
739 3300026041 Ga0207639_10000524 Ga0207639_1000052412 136
740 3300026067 Ga0207678_10010668 Ga0207678_100106682 136
741 3300026078 Ga0207702_10001885 Ga0207702_100018858 136
742 3300026078 Ga0207702_10211184 Ga0207702_102111844 136
743 3300026095 Ga0207676_10006185 Ga0207676_100061858 136
744 3300026116 Ga0207674_10008897 Ga0207674_100088978 136
745 3300026116 Ga0207674_10986198 Ga0207674_109861981 136
746 3300026142 Ga0207698_10000542 Ga0207698_100005422 136
747 3300026142 Ga0207698_10123193 Ga0207698_101231934 136
748 3300026142 Ga0207698_10692656 Ga0207698_106926561 136
749 3300028379 Ga0268266_10003812 Ga0268266_100038127 136
750 3300028381 Ga0268264_10488669 Ga0268264_104886693 136
751 3300035112 Ga0373932_0128468 Ga0373932_0128468_307_717 136
752 3300035114 Ga0373939_0042642 Ga0373939_0042642_146_556 136
753 3300035241 Ga0373961_0055104 Ga0373961_0055104_728_1138 136
754 3300035691 Ga0373931_0015417 Ga0373931_0015417_1330_1740 136
755 3300037312 Ga0395899_0239317 Ga0395899_0239317_400_813 136
756 3300037312 Ga0395899_0395108 Ga0395899_0395108_425_844 136
757 3300037312 Ga0395899_0996460 Ga0395899_0996460_60_470 136
758 3300037418 Ga0395900_0016429 Ga0395900_0016429_1773_2192 136
759 3300037418 Ga0395900_0089079 Ga0395900_0089079_951_1361 136
760 3300037418 Ga0395900_0097007 Ga0395900_0097007_942_1355 136
761 3300037466 Ga0395898_0094728 Ga0395898_0094728_1085_1495 136
762 3300037471 Ga0395905_0139090 Ga0395905_0139090_1504_1917 136
763 3300037471 Ga0395905_0738714 Ga0395905_0738714_330_740 136
764 3300038443 Ga0395901_0165413 Ga0395901_0165413_1538_1957 136
765 3300038443 Ga0395901_0170171 Ga0395901_0170171_454_867 136
766 3300038443 Ga0395901_0525600 Ga0395901_0525600_713_1123 136
767 3300044694 Ga0466963_0023693 Ga0466963_0023693_2388_2822 136
768 3300044842 Ga0466957_0005582 Ga0466957_0005582_5743_6177 136
769 3300044842 Ga0466957_0009431 Ga0466957_0009431_1177_1599 136
770 3300045976 Ga0466967_0020997 Ga0466967_0020997_3922_4332 136
771 3300045976 Ga0466967_0067578 Ga0466967_0067578_2189_2623 136
772 3300045976 Ga0466967_0071901 Ga0466967_0071901_2296_2706 136
773 3300045976 Ga0466967_0343418 Ga0466967_0343418_146_556 136
774 3300045976 Ga0466967_1456446 Ga0466967_1456446_135_557 136
775 3300048903 Ga0496100_0944117 Ga0496100_0944117_150_560 136
776 3300048907 Ga0496104_0242889 Ga0496104_0242889_122_532 136
777 3300048908 Ga0496105_0282734 Ga0496105_0282734_451_861 136
778 3300048912 Ga0496109_0725456 Ga0496109_0725456_236_646 136
779 3300048913 Ga0496110_0315668 Ga0496110_0315668_281_691 136
780 3300048915 Ga0496112_1012585 Ga0496112_1012585_154_564 136
781 3300048916 Ga0496113_0184825 Ga0496113_0184825_1217_1627 136
782 3300049586 Ga0501070_0067070 Ga0501070_0067070_130_546 136
783 3300049587 Ga0501071_0093261 Ga0501071_0093261_1134_1550 136

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhz-assembly1.cif.gz_B crystal structure of adp compounds hydrolase 0.8626 67 99
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8312 67 100
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8283 67 100
5i8u-assembly2.cif.gz_A crystal structure of the rv1700 (mt adprase) e142q mutant 0.8204 67 101
1xjv-assembly1.cif.gz_A crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag) 0.796 67 101
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8303 67 100 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8072 67 101 3.90.79.10
af_Q0D7W8_61_281_2.120.10.60 Mainly Beta;6 Propeller;Neuraminidase;Tricorn protease N-terminal domain 0.8065 64 110 2.120.10.60
af_A0A0R0JA37_7_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7984 67 99 2.40.50.140
af_A0A0R0EKE2_8_109_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7926 67 99 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V0RK78-F1-model_v4 Uncharacterized protein 0.8865 67 109
AF-A0A2H6IWU2-F1-model_v4 Uncharacterized protein 0.8767 67 109
AF-A0A5A8CHI9-F1-model_v4 Uncharacterized protein 0.873 67 110 GO:0016567
AF-A0A2A5F1X9-F1-model_v4 Uncharacterized protein 0.8409 69 110
AF-A0A225E0T6-F1-model_v4 Uncharacterized protein 0.8321 70 116 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.9 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map