F480553

General Info

Members Datasets Scaffolds Average Seq Length
781 324 1562 106

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100875243|Ga0070698_1008752432
Length 105
Sequence MYARNVSLHLKSNMLSDYTRIFEKDILPLLRKQNGFKDEITFCPGGMDVTAISLWDNKANAEAYNTNTYPEVLQTLARVIDGTPKVQTCEVVNSTFHKIAVGAGA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
120 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
191 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
192 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
193 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
219 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
220 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
223 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
256 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.46
Metatranscriptomes 17.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 96.16
Stem 0
Stem Tuber 0
Unclassified 47.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100875243 3300005471 Unclassified 844
2 JGI24739J22299_10241925 3300001989 Unclassified 528
3 JGI24737J22298_10044638 3300001990 Bacteria 1354
4 JGI24737J22298_10159255 3300001990 Bacteria 666
5 Ga0065712_10094390 3300005290 Unclassified 2257
6 Ga0065715_10023259 3300005293 Unclassified 1727
7 Ga0070676_10103108 3300005328 Unclassified 1766
8 Ga0070676_11204077 3300005328 Unclassified 576
9 Ga0070683_100856737 3300005329 Bacteria 871
10 Ga0070683_101765720 3300005329 Unclassified 595
11 Ga0070690_100157071 3300005330 Bacteria 1556
12 Ga0068869_100044433 3300005334 Bacteria 3195
13 Ga0068869_100049263 3300005334 Unclassified 3049
14 Ga0070666_11368821 3300005335 Unclassified 528
15 Ga0070680_100210604 3300005336 Bacteria 1640
16 Ga0070680_100514605 3300005336 Bacteria 1024
17 Ga0070682_100079870 3300005337 Unclassified 2113
18 Ga0070682_100867722 3300005337 Bacteria 739
19 Ga0068868_100018866 3300005338 Bacteria 5162
20 Ga0068868_100108978 3300005338 Unclassified 2248
21 Ga0068868_100252195 3300005338 Bacteria 1486
22 Ga0070660_100103726 3300005339 Bacteria 2255
23 Ga0070691_10033187 3300005341 Bacteria 2428
24 Ga0070687_100229812 3300005343 Bacteria 1141
25 Ga0070687_100712235 3300005343 Unclassified 702
26 Ga0070661_100201059 3300005344 Bacteria 1522
27 Ga0070661_100678001 3300005344 Unclassified 838
28 Ga0070692_10307377 3300005345 Unclassified 970
29 Ga0070668_100007429 3300005347 Bacteria 8132
30 Ga0070669_100117538 3300005353 Bacteria 2024
31 Ga0070675_100223604 3300005354 Bacteria 1640
32 Ga0070675_100912186 3300005354 Unclassified 805
33 Ga0070671_101002769 3300005355 Unclassified 732
34 Ga0070674_100239183 3300005356 Bacteria 1421
35 Ga0070688_100540590 3300005365 Unclassified 884
36 Ga0070659_100040585 3300005366 Bacteria 3637
37 Ga0070659_100694270 3300005366 Unclassified 880
38 Ga0070667_100122356 3300005367 Bacteria 2264
39 Ga0070667_100558117 3300005367 Unclassified 1053
40 Ga0070667_100812953 3300005367 Unclassified 868
41 Ga0070709_10104203 3300005434 Unclassified 1895
42 Ga0070709_10111578 3300005434 Bacteria 1839
43 Ga0070709_10348946 3300005434 Unclassified 1093
44 Ga0070709_10399734 3300005434 Unclassified 1025
45 Ga0070709_10605838 3300005434 Unclassified 844
46 Ga0070709_10645679 3300005434 Unclassified 819
47 Ga0070709_11661602 3300005434 Unclassified 521
48 Ga0070714_100009954 3300005435 Bacteria 7498
49 Ga0070714_100078852 3300005435 Unclassified 2863
50 Ga0070714_100868133 3300005435 Unclassified 875
51 Ga0070714_101243867 3300005435 Unclassified 726
52 Ga0070713_100021084 3300005436 Bacteria 5005
53 Ga0070713_100022245 3300005436 Bacteria 4896
54 Ga0070713_100069888 3300005436 Bacteria 2963
55 Ga0070713_100183247 3300005436 Unclassified 1883
56 Ga0070713_100223014 3300005436 Bacteria 1710
57 Ga0070713_100450277 3300005436 Unclassified 1209
58 Ga0070713_100798847 3300005436 Unclassified 904
59 Ga0070713_101506854 3300005436 Bacteria 653
60 Ga0070713_101770311 3300005436 Unclassified 600
61 Ga0070710_10116085 3300005437 Bacteria 1614
62 Ga0070710_10266286 3300005437 Bacteria 1107
63 Ga0070710_11168102 3300005437 Unclassified 568
64 Ga0070701_10422846 3300005438 Bacteria 849
65 Ga0070711_100136750 3300005439 Unclassified 1832
66 Ga0070711_100478201 3300005439 Bacteria 1023
67 Ga0070711_100573244 3300005439 Unclassified 939
68 Ga0070711_100938797 3300005439 Unclassified 740
69 Ga0070711_101112408 3300005439 Unclassified 681
70 Ga0070705_100229866 3300005440 Bacteria 1290
71 Ga0070705_101180284 3300005440 Unclassified 630
72 Ga0070694_100135732 3300005444 Unclassified 1783
73 Ga0070708_100008829 3300005445 Bacteria 8110
74 Ga0070708_100045192 3300005445 Bacteria 3878
75 Ga0070708_100247147 3300005445 Unclassified 1675
76 Ga0070663_100373538 3300005455 Bacteria 1159
77 Ga0070678_100042985 3300005456 Bacteria 3216
78 Ga0070678_100054401 3300005456 Bacteria 2916
79 Ga0070662_100012427 3300005457 Bacteria 5647
80 Ga0070662_100019078 3300005457 Unclassified 4651
81 Ga0070662_100725019 3300005457 Unclassified 842
82 Ga0070681_10008295 3300005458 Bacteria 10172
83 Ga0070681_10023083 3300005458 Bacteria 6256
84 Ga0070681_10231818 3300005458 Bacteria 1761
85 Ga0068867_100030361 3300005459 Unclassified 3899
86 Ga0068867_100483425 3300005459 Bacteria 1061
87 Ga0070685_10311392 3300005466 Bacteria 1064
88 Ga0070706_100026518 3300005467 Bacteria 5331
89 Ga0070706_100067539 3300005467 Bacteria 3307
90 Ga0070706_100494009 3300005467 Bacteria 1139
91 Ga0070706_100686683 3300005467 Bacteria 950
92 Ga0070707_100025402 3300005468 Bacteria 5619
93 Ga0070707_100676839 3300005468 Bacteria 994
94 Ga0070698_100053290 3300005471 Unclassified 4112
95 Ga0070699_100013838 3300005518 Bacteria 6940
96 Ga0070699_100510400 3300005518 Bacteria 1092
97 Ga0070699_101762886 3300005518 Unclassified 567
98 Ga0070679_100171407 3300005530 Bacteria 2143
99 Ga0070679_100179877 3300005530 Bacteria 2087
100 Ga0070679_101206571 3300005530 Unclassified 702
101 Ga0070684_100073073 3300005535 Bacteria 3021
102 Ga0070684_100203036 3300005535 Unclassified 1806
103 Ga0070684_100204820 3300005535 Unclassified 1797
104 Ga0070697_100006949 3300005536 Bacteria 8800
105 Ga0070697_100342332 3300005536 Bacteria 1290
106 Ga0070697_100553441 3300005536 Bacteria 1009
107 Ga0070697_100730423 3300005536 Unclassified 874
108 Ga0070697_101298282 3300005536 Unclassified 649
109 Ga0068853_100053613 3300005539 Bacteria 3472
110 Ga0068853_101928752 3300005539 Unclassified 573
111 Ga0070686_100043528 3300005544 Bacteria 2818
112 Ga0070686_100375366 3300005544 Unclassified 1075
113 Ga0070695_100695060 3300005545 Bacteria 807
114 Ga0070696_100560546 3300005546 Bacteria 916
115 Ga0070693_100037164 3300005547 Bacteria 2713
116 Ga0070665_100143216 3300005548 Unclassified 2393
117 Ga0070665_101154348 3300005548 Unclassified 786
118 Ga0068855_100044774 3300005563 Bacteria 5237
119 Ga0068855_100208491 3300005563 Bacteria 2197
120 Ga0068855_100362170 3300005563 Bacteria 1595
121 Ga0068855_100405937 3300005563 Unclassified 1492
122 Ga0068855_101903042 3300005563 Unclassified 602
123 Ga0068855_102568847 3300005563 Unclassified 506
124 Ga0070664_100012076 3300005564 Bacteria 7019
125 Ga0070664_100037583 3300005564 Bacteria 4071
126 Ga0070664_100797885 3300005564 Bacteria 883
127 Ga0070664_100942931 3300005564 Unclassified 810
128 Ga0068857_100006131 3300005577 Bacteria 10272
129 Ga0068857_100059980 3300005577 Unclassified 3380
130 Ga0068857_100322118 3300005577 Bacteria 1428
131 Ga0068854_100035894 3300005578 Bacteria 3473
132 Ga0068854_100048389 3300005578 Bacteria 3033
133 Ga0068854_100338567 3300005578 Bacteria 1228
134 Ga0068856_100010194 3300005614 Bacteria 9136
135 Ga0068856_100025793 3300005614 Bacteria 5731
136 Ga0068856_100040619 3300005614 Unclassified 4570
137 Ga0068856_100061438 3300005614 Bacteria 3712
138 Ga0068856_100275342 3300005614 Unclassified 1699
139 Ga0068856_101080334 3300005614 Unclassified 820
140 Ga0068856_101998919 3300005614 Unclassified 590
141 Ga0068856_102120744 3300005614 Unclassified 572
142 Ga0070702_100314775 3300005615 Bacteria 1088
143 Ga0068852_100931996 3300005616 Unclassified 886
144 Ga0068859_100221156 3300005617 Unclassified 1981
145 Ga0068859_100739758 3300005617 Bacteria 1073
146 Ga0068864_100025145 3300005618 Bacteria 5013
147 Ga0068864_100691586 3300005618 Unclassified 996
148 Ga0068864_101939140 3300005618 Unclassified 595
149 Ga0068866_10019917 3300005718 Bacteria 3064
150 Ga0068866_10364898 3300005718 Bacteria 922
151 Ga0068861_100086140 3300005719 Bacteria 2469
152 Ga0068861_101182417 3300005719 Unclassified 739
153 Ga0068851_10758323 3300005834 Unclassified 601
154 Ga0068870_10055117 3300005840 Bacteria 2117
155 Ga0068863_100470919 3300005841 Unclassified 1234
156 Ga0068863_100663634 3300005841 Bacteria 1035
157 Ga0068858_100372537 3300005842 Bacteria 1370
158 Ga0068858_100707448 3300005842 Bacteria 980
159 Ga0068858_101137360 3300005842 Unclassified 767
160 Ga0068860_100037643 3300005843 Bacteria 4631
161 Ga0068860_100097549 3300005843 Bacteria 2802
162 Ga0068862_100241054 3300005844 Bacteria 1644
163 Ga0070717_10003494 3300006028 Bacteria 11251
164 Ga0070717_10011899 3300006028 Bacteria 6621
165 Ga0070717_10027952 3300006028 Bacteria 4510
166 Ga0070717_10028362 3300006028 Unclassified 4480
167 Ga0070717_10044255 3300006028 Unclassified 3635
168 Ga0070717_10105215 3300006028 Unclassified 2402
169 Ga0070717_10131726 3300006028 Bacteria 2151
170 Ga0070717_10371945 3300006028 Bacteria 1280
171 Ga0070717_10465231 3300006028 Bacteria 1141
172 Ga0070717_10832469 3300006028 Unclassified 840
173 Ga0070717_10840000 3300006028 Unclassified 836
174 Ga0070717_11205342 3300006028 Unclassified 689
175 Ga0070715_10089860 3300006163 Bacteria 1411
176 Ga0070715_10484665 3300006163 Unclassified 705
177 Ga0070715_10720251 3300006163 Unclassified 598
178 Ga0070716_100011035 3300006173 Unclassified 4544
179 Ga0070716_100141716 3300006173 Bacteria 1534
180 Ga0070716_100163598 3300006173 Unclassified 1445
181 Ga0070716_100189339 3300006173 Bacteria 1358
182 Ga0070716_100411333 3300006173 Unclassified 975
183 Ga0070716_100912291 3300006173 Unclassified 689
184 Ga0070716_101248507 3300006173 Unclassified 599
185 Ga0070716_101583790 3300006173 Bacteria 538
186 Ga0070712_100042156 3300006175 Unclassified 3138
187 Ga0070712_100047230 3300006175 Bacteria 2979
188 Ga0070712_100119636 3300006175 Bacteria 1980
189 Ga0070712_100177483 3300006175 Unclassified 1657
190 Ga0070712_100316539 3300006175 Unclassified 1268
191 Ga0070712_100401666 3300006175 Bacteria 1132
192 Ga0070712_100449450 3300006175 Unclassified 1073
193 Ga0070712_101802648 3300006175 Unclassified 536
194 Ga0097621_100009199 3300006237 Bacteria 7164
195 Ga0097621_100031690 3300006237 Bacteria 4196
196 Ga0097621_100032650 3300006237 Unclassified 4140
197 Ga0097621_100101641 3300006237 Unclassified 2419
198 Ga0097621_100420355 3300006237 Unclassified 1200
199 Ga0097621_100854250 3300006237 Bacteria 846
200 Ga0068871_100012980 3300006358 Bacteria 6169
201 Ga0068871_100025836 3300006358 Unclassified 4575
202 Ga0068871_100145336 3300006358 Unclassified 2018
203 Ga0068871_100533053 3300006358 Bacteria 1062
204 Ga0075434_100095958 3300006871 Bacteria 2970
205 Ga0075434_100343290 3300006871 Unclassified 1514
206 Ga0075434_101571895 3300006871 Unclassified 666
207 Ga0068865_100499771 3300006881 Bacteria 1014
208 Ga0068865_100671469 3300006881 Unclassified 883
209 Ga0075436_100002999 3300006914 Bacteria 11561
210 Ga0075436_100105214 3300006914 Bacteria 1968
211 Ga0075436_100520205 3300006914 Unclassified 872
212 Ga0097620_100221145 3300006931 Unclassified 1981
213 Ga0097620_100739813 3300006931 Bacteria 1073
214 Ga0075435_100055519 3300007076 Bacteria 3199
215 Ga0075435_100938523 3300007076 Unclassified 755
216 Ga0099794_10365507 3300007265 Bacteria 751
217 Ga0105250_10040532 3300009092 Unclassified 1868
218 Ga0105240_10086660 3300009093 Bacteria 3835
219 Ga0105240_10169681 3300009093 Bacteria 2585
220 Ga0105240_10268071 3300009093 Bacteria 1967
221 Ga0105240_10821260 3300009093 Unclassified 1006
222 Ga0105245_10078510 3300009098 Bacteria 3012
223 Ga0105245_10094488 3300009098 Bacteria 2756
224 Ga0105247_10011131 3300009101 Bacteria 5424
225 Ga0105247_10254627 3300009101 Bacteria 1201
226 Ga0105243_10352107 3300009148 Bacteria 1353
227 Ga0105241_10006864 3300009174 Bacteria 8373
228 Ga0105241_10050529 3300009174 Bacteria 3169
229 Ga0105241_10724185 3300009174 Bacteria 910
230 Ga0105241_12616200 3300009174 Unclassified 507
231 Ga0105242_10618463 3300009176 Bacteria 1049
232 Ga0105248_10054895 3300009177 Bacteria 4469
233 Ga0105248_10204053 3300009177 Bacteria 2227
234 Ga0105248_10324671 3300009177 Unclassified 1734
235 Ga0105248_10963904 3300009177 Bacteria 963
236 Ga0105248_12657598 3300009177 Unclassified 571
237 Ga0105237_10131570 3300009545 Bacteria 2496
238 Ga0105237_10405166 3300009545 Bacteria 1369
239 Ga0105237_10668192 3300009545 Unclassified 1046
240 Ga0105237_10741377 3300009545 Bacteria 989
241 Ga0105238_10076815 3300009551 Bacteria 3332
242 Ga0105238_10172498 3300009551 Unclassified 2139
243 Ga0105238_10216871 3300009551 Bacteria 1890
244 Ga0105238_10679853 3300009551 Bacteria 1041
245 Ga0105249_10075147 3300009553 Bacteria 3129
246 Ga0105249_10132946 3300009553 Bacteria 2377
247 Ga0105249_10768278 3300009553 Unclassified 1026
248 Ga0105239_12033777 3300010375 Unclassified 667
249 Ga0105239_12048916 3300010375 Bacteria 665
250 Ga0105246_10115057 3300011119 Unclassified 1983
251 Ga0105246_10250395 3300011119 Bacteria 1405
252 Ga0105246_10727833 3300011119 Bacteria 872
253 Ga0157373_10047535 3300013100 Bacteria 3060
254 Ga0157373_10280310 3300013100 Unclassified 1181
255 Ga0157373_10333525 3300013100 Bacteria 1080
256 Ga0157371_10020279 3300013102 Bacteria 4893
257 Ga0157371_10217621 3300013102 Bacteria 1371
258 Ga0157371_10319135 3300013102 Bacteria 1127
259 Ga0157370_10145392 3300013104 Bacteria 2208
260 Ga0157370_10170585 3300013104 Bacteria 2022
261 Ga0157370_10898765 3300013104 Unclassified 804
262 Ga0157369_10018318 3300013105 Bacteria 7852
263 Ga0157369_10052728 3300013105 Bacteria 4399
264 Ga0157369_10213452 3300013105 Unclassified 2022
265 Ga0157369_10232498 3300013105 Bacteria 1927
266 Ga0157369_12432064 3300013105 Unclassified 530
267 Ga0157374_10000220 3300013296 Bacteria 52590
268 Ga0157374_10000651 3300013296 Bacteria 30638
269 Ga0157374_10185695 3300013296 Bacteria 2032
270 Ga0157374_10225301 3300013296 Unclassified 1841
271 Ga0157374_10268997 3300013296 Bacteria 1680
272 Ga0157374_11130311 3300013296 Unclassified 804
273 Ga0157374_11716836 3300013296 Unclassified 653
274 Ga0157378_10005113 3300013297 Bacteria 11517
275 Ga0157378_10117296 3300013297 Bacteria 2449
276 Ga0157378_10334189 3300013297 Bacteria 1475
277 Ga0157378_11243198 3300013297 Bacteria 785
278 Ga0157378_11486821 3300013297 Unclassified 722
279 Ga0163162_10024768 3300013306 Bacteria 5927
280 Ga0157372_10003153 3300013307 Bacteria 17780
281 Ga0157372_10007172 3300013307 Bacteria 11863
282 Ga0157372_10017970 3300013307 Bacteria 7599
283 Ga0157372_10037832 3300013307 Bacteria 5323
284 Ga0157372_10040835 3300013307 Bacteria 5127
285 Ga0157372_10111398 3300013307 Bacteria 3136
286 Ga0157372_10124578 3300013307 Unclassified 2962
287 Ga0157372_10223798 3300013307 Bacteria 2181
288 Ga0157375_10260151 3300013308 Unclassified 1897
289 Ga0157375_13203796 3300013308 Unclassified 546
290 Ga0163163_10106153 3300014325 Bacteria 2834
291 Ga0163163_10372763 3300014325 Bacteria 1485
292 Ga0163163_11157554 3300014325 Unclassified 836
293 Ga0157377_10634422 3300014745 Unclassified 767
294 Ga0157379_10035997 3300014968 Bacteria 4414
295 Ga0157379_10132288 3300014968 Bacteria 2246
296 Ga0157379_11311158 3300014968 Unclassified 699
297 Ga0157376_10096447 3300014969 Bacteria 2573
298 Ga0157376_10466655 3300014969 Bacteria 1234
299 Ga0157376_11136441 3300014969 Bacteria 808
300 Ga0157376_11364676 3300014969 Unclassified 740
301 Ga0182005_1271212 3300015265 Unclassified 530
302 Ga0163161_10454079 3300017792 Unclassified 1036
303 Ga0184602_100374 3300019161 Unclassified 626
304 Ga0184602_108799 3300019161 Unclassified 610
305 Ga0184602_109278 3300019161 Unclassified 584
306 Ga0184602_116921 3300019161 Unclassified 664
307 Ga0184602_126363 3300019161 Unclassified 542
308 Ga0184602_132365 3300019161 Bacteria 1110
309 Ga0184597_100518 3300019162 Bacteria 736
310 Ga0184597_121182 3300019162 Unclassified 508
311 Ga0184597_123989 3300019162 Bacteria 1053
312 Ga0184597_128478 3300019162 Unclassified 537
313 Ga0184595_109345 3300019166 Unclassified 627
314 Ga0184595_110125 3300019166 Bacteria 500
315 Ga0184595_125523 3300019166 Unclassified 641
316 Ga0184595_126827 3300019166 Bacteria 877
317 Ga0184598_101394 3300019182 Unclassified 530
318 Ga0184598_119654 3300019182 Unclassified 635
319 Ga0184598_126073 3300019182 Unclassified 875
320 Ga0184598_130657 3300019182 Unclassified 618
321 Ga0184598_137139 3300019182 Unclassified 534
322 Ga0184598_139079 3300019182 Unclassified 530
323 Ga0184601_101282 3300019183 Bacteria 1025
324 Ga0184601_108513 3300019183 Bacteria 998
325 Ga0184601_108906 3300019183 Unclassified 580
326 Ga0184601_110771 3300019183 Unclassified 504
327 Ga0184601_122462 3300019183 Bacteria 1430
328 Ga0184601_133084 3300019183 Unclassified 507
329 Ga0184599_106580 3300019188 Unclassified 507
330 Ga0184599_110872 3300019188 Bacteria 720
331 Ga0184599_113574 3300019188 Unclassified 565
332 Ga0184599_123342 3300019188 Unclassified 606
333 Ga0184599_126591 3300019188 Unclassified 581
334 Ga0184599_151074 3300019188 Unclassified 888
335 Ga0184599_152807 3300019188 Unclassified 503
336 Ga0184600_110547 3300019190 Bacteria 1377
337 Ga0184600_133038 3300019190 Unclassified 558
338 Ga0184600_136576 3300019190 Bacteria 1631
339 Ga0184600_146854 3300019190 Unclassified 544
340 Ga0184603_102317 3300019192 Bacteria 1076
341 Ga0184603_103961 3300019192 Unclassified 784
342 Ga0184603_110016 3300019192 Unclassified 548
343 Ga0184603_118243 3300019192 Bacteria 685
344 Ga0184603_120553 3300019192 Unclassified 505
345 Ga0184603_120588 3300019192 Bacteria 810
346 Ga0184603_121057 3300019192 Bacteria 522
347 Ga0184603_142816 3300019192 Bacteria 570
348 Ga0184603_144489 3300019192 Unclassified 548
349 Ga0184603_150214 3300019192 Unclassified 759
350 Ga0224569_110195 3300022732 Bacteria 664
351 Ga0247552_101551 3300023536 Bacteria 693
352 Ga0247552_101942 3300023536 Unclassified 643
353 Ga0247552_102588 3300023536 Unclassified 591
354 Ga0247552_104144 3300023536 Unclassified 511
355 Ga0247555_101795 3300023539 Unclassified 685
356 Ga0247555_103058 3300023539 Unclassified 579
357 Ga0247555_104449 3300023539 Unclassified 512
358 Ga0247555_104770 3300023539 Unclassified 501
359 Ga0247554_101396 3300023547 Unclassified 828
360 Ga0247554_103171 3300023547 Bacteria 638
361 Ga0247554_104024 3300023547 Unclassified 589
362 Ga0247554_104735 3300023547 Unclassified 564
363 Ga0247554_106513 3300023547 Bacteria 507
364 Ga0247551_100239 3300023552 Bacteria 1390
365 Ga0247521_115859 3300023557 Unclassified 580
366 Ga0247518_113452 3300023561 Unclassified 782
367 Ga0247550_102062 3300023660 Unclassified 672
368 Ga0247550_104570 3300023660 Bacteria 529
369 Ga0247553_100978 3300023672 Bacteria 1154
370 Ga0247553_102120 3300023672 Unclassified 901
371 Ga0247553_104896 3300023672 Unclassified 688
372 Ga0247553_105340 3300023672 Unclassified 666
373 Ga0247553_105758 3300023672 Bacteria 649
374 Ga0247553_109254 3300023672 Unclassified 556
375 Ga0247553_110308 3300023672 Unclassified 537
376 Ga0247553_110626 3300023672 Unclassified 531
377 Ga0247553_111073 3300023672 Unclassified 524
378 Ga0247522_117633 3300023688 Bacteria 550
379 Ga0224572_1056960 3300024225 Bacteria 725
380 Ga0228598_1006492 3300024227 Bacteria 2418
381 Ga0228598_1009719 3300024227 Unclassified 1923
382 Ga0228598_1010436 3300024227 Bacteria 1850
383 Ga0228598_1035664 3300024227 Unclassified 980
384 Ga0228598_1099922 3300024227 Unclassified 585
385 Ga0207656_10696329 3300025321 Unclassified 520
386 Ga0207692_10068918 3300025898 Bacteria 1857
387 Ga0207692_10324751 3300025898 Bacteria 943
388 Ga0207692_10325487 3300025898 Unclassified 942
389 Ga0207692_10371862 3300025898 Unclassified 885
390 Ga0207642_10003203 3300025899 Bacteria 5132
391 Ga0207642_10030408 3300025899 Bacteria 2249
392 Ga0207642_10272744 3300025899 Bacteria 969
393 Ga0207710_10078561 3300025900 Bacteria 1527
394 Ga0207710_10270089 3300025900 Unclassified 854
395 Ga0207688_10548027 3300025901 Bacteria 727
396 Ga0207688_10811397 3300025901 Unclassified 593
397 Ga0207680_10773694 3300025903 Unclassified 688
398 Ga0207647_10015305 3300025904 Bacteria 5262
399 Ga0207647_10066997 3300025904 Unclassified 2177
400 Ga0207647_10127224 3300025904 Bacteria 1499
401 Ga0207699_10042831 3300025906 Bacteria 2626
402 Ga0207699_10093294 3300025906 Bacteria 1894
403 Ga0207699_10171735 3300025906 Unclassified 1451
404 Ga0207699_10383332 3300025906 Unclassified 998
405 Ga0207699_10551710 3300025906 Unclassified 836
406 Ga0207699_10692764 3300025906 Unclassified 746
407 Ga0207645_10721898 3300025907 Unclassified 677
408 Ga0207643_10153211 3300025908 Bacteria 1383
409 Ga0207684_10034078 3300025910 Bacteria 4328
410 Ga0207684_10083180 3300025910 Bacteria 2726
411 Ga0207684_10117663 3300025910 Bacteria 2277
412 Ga0207654_10004095 3300025911 Bacteria 7345
413 Ga0207654_10005110 3300025911 Bacteria 6621
414 Ga0207654_10030496 3300025911 Bacteria 2960
415 Ga0207654_10042405 3300025911 Bacteria 2575
416 Ga0207654_10288527 3300025911 Bacteria 1112
417 Ga0207707_10049910 3300025912 Bacteria 3646
418 Ga0207707_10205514 3300025912 Bacteria 1716
419 Ga0207707_10341380 3300025912 Unclassified 1291
420 Ga0207707_11224118 3300025912 Unclassified 607
421 Ga0207695_10124252 3300025913 Bacteria 2545
422 Ga0207695_10204406 3300025913 Bacteria 1888
423 Ga0207695_10376133 3300025913 Bacteria 1306
424 Ga0207695_10971980 3300025913 Unclassified 729
425 Ga0207671_10019302 3300025914 Bacteria 5214
426 Ga0207671_10073107 3300025914 Bacteria 2560
427 Ga0207693_10063354 3300025915 Bacteria 2896
428 Ga0207693_10150425 3300025915 Bacteria 1831
429 Ga0207693_10342662 3300025915 Bacteria 1170
430 Ga0207693_10422591 3300025915 Bacteria 1042
431 Ga0207693_10566944 3300025915 Bacteria 885
432 Ga0207663_10167412 3300025916 Bacteria 1558
433 Ga0207663_10312147 3300025916 Unclassified 1179
434 Ga0207663_11182698 3300025916 Unclassified 615
435 Ga0207663_11270594 3300025916 Unclassified 593
436 Ga0207663_11425644 3300025916 Unclassified 558
437 Ga0207660_10999454 3300025917 Unclassified 682
438 Ga0207662_10273103 3300025918 Bacteria 1116
439 Ga0207662_10701322 3300025918 Bacteria 709
440 Ga0207657_10050639 3300025919 Unclassified 3614
441 Ga0207649_10121620 3300025920 Bacteria 1761
442 Ga0207652_10331131 3300025921 Bacteria 1375
443 Ga0207652_10570512 3300025921 Bacteria 1016
444 Ga0207652_11195957 3300025921 Unclassified 662
445 Ga0207646_10407109 3300025922 Bacteria 1228
446 Ga0207646_10770003 3300025922 Bacteria 858
447 Ga0207681_10190870 3300025923 Unclassified 1567
448 Ga0207694_10091140 3300025924 Bacteria 2406
449 Ga0207694_10348131 3300025924 Unclassified 1226
450 Ga0207650_10018008 3300025925 Bacteria 4951
451 Ga0207650_10018028 3300025925 Bacteria 4948
452 Ga0207687_10027523 3300025927 Bacteria 3815
453 Ga0207687_10149308 3300025927 Bacteria 1781
454 Ga0207700_10052379 3300025928 Bacteria 3051
455 Ga0207700_10096532 3300025928 Bacteria 2347
456 Ga0207700_10783784 3300025928 Unclassified 852
457 Ga0207664_10011365 3300025929 Bacteria 6324
458 Ga0207664_10036879 3300025929 Unclassified 3780
459 Ga0207664_10083055 3300025929 Bacteria 2610
460 Ga0207664_10287741 3300025929 Bacteria 1443
461 Ga0207664_10501418 3300025929 Unclassified 1087
462 Ga0207664_10917807 3300025929 Unclassified 786
463 Ga0207664_10983754 3300025929 Bacteria 756
464 Ga0207644_10832027 3300025931 Unclassified 773
465 Ga0207690_10185830 3300025932 Bacteria 1568
466 Ga0207706_10000938 3300025933 Bacteria 29806
467 Ga0207706_10041125 3300025933 Unclassified 4099
468 Ga0207706_11155806 3300025933 Unclassified 645
469 Ga0207686_10102472 3300025934 Bacteria 1914
470 Ga0207709_10845494 3300025935 Bacteria 741
471 Ga0207669_10671314 3300025937 Bacteria 849
472 Ga0207704_10219972 3300025938 Bacteria 1404
473 Ga0207704_11920812 3300025938 Unclassified 509
474 Ga0207665_10002589 3300025939 Bacteria 12159
475 Ga0207665_10060373 3300025939 Unclassified 2568
476 Ga0207665_10167419 3300025939 Bacteria 1585
477 Ga0207665_10184404 3300025939 Bacteria 1513
478 Ga0207665_10228926 3300025939 Bacteria 1365
479 Ga0207665_10279457 3300025939 Bacteria 1242
480 Ga0207665_10681859 3300025939 Unclassified 807
481 Ga0207665_10844978 3300025939 Bacteria 725
482 Ga0207665_11029975 3300025939 Unclassified 655
483 Ga0207691_11392628 3300025940 Unclassified 576
484 Ga0207711_10023112 3300025941 Bacteria 5206
485 Ga0207711_10268750 3300025941 Bacteria 1568
486 Ga0207711_11237026 3300025941 Unclassified 688
487 Ga0207711_11317925 3300025941 Unclassified 664
488 Ga0207689_10083777 3300025942 Bacteria 2621
489 Ga0207689_10105283 3300025942 Bacteria 2318
490 Ga0207689_11048010 3300025942 Bacteria 688
491 Ga0207661_10268400 3300025944 Bacteria 1522
492 Ga0207661_11891372 3300025944 Unclassified 542
493 Ga0207679_10020124 3300025945 Bacteria 4499
494 Ga0207679_10461433 3300025945 Bacteria 1128
495 Ga0207679_10654565 3300025945 Bacteria 950
496 Ga0207667_10035572 3300025949 Bacteria 5342
497 Ga0207667_10064682 3300025949 Bacteria 3817
498 Ga0207667_10453745 3300025949 Unclassified 1302
499 Ga0207667_12252808 3300025949 Unclassified 501
500 Ga0207712_10524590 3300025961 Bacteria 1015
501 Ga0207668_10039426 3300025972 Bacteria 3179
502 Ga0207640_10008577 3300025981 Bacteria 5677
503 Ga0207640_11175890 3300025981 Unclassified 681
504 Ga0207640_11580815 3300025981 Unclassified 590
505 Ga0207658_10793513 3300025986 Unclassified 859
506 Ga0207677_10051768 3300026023 Bacteria 2786
507 Ga0207677_10110735 3300026023 Bacteria 2044
508 Ga0207677_10267010 3300026023 Bacteria 1398
509 Ga0207677_10846893 3300026023 Unclassified 821
510 Ga0207703_10075459 3300026035 Bacteria 2794
511 Ga0207703_10648843 3300026035 Bacteria 1001
512 Ga0207703_10981428 3300026035 Bacteria 810
513 Ga0207639_10215395 3300026041 Bacteria 1656
514 Ga0207639_10506981 3300026041 Bacteria 1103
515 Ga0207678_10001163 3300026067 Bacteria 24104
516 Ga0207702_10008794 3300026078 Bacteria 8512
517 Ga0207702_10038005 3300026078 Bacteria 4032
518 Ga0207702_10038861 3300026078 Bacteria 3986
519 Ga0207702_10141070 3300026078 Bacteria 2180
520 Ga0207702_10150679 3300026078 Bacteria 2115
521 Ga0207702_11111564 3300026078 Unclassified 784
522 Ga0207641_10359114 3300026088 Unclassified 1390
523 Ga0207641_10411037 3300026088 Bacteria 1301
524 Ga0207648_10043729 3300026089 Unclassified 3932
525 Ga0207648_10134557 3300026089 Bacteria 2177
526 Ga0207648_10171854 3300026089 Bacteria 1916
527 Ga0207648_10375318 3300026089 Unclassified 1285
528 Ga0207676_10015126 3300026095 Bacteria 5565
529 Ga0207676_10144866 3300026095 Unclassified 2039
530 Ga0207676_10232636 3300026095 Bacteria 1648
531 Ga0207676_11849964 3300026095 Unclassified 602
532 Ga0207674_10005128 3300026116 Bacteria 15632
533 Ga0207674_10008169 3300026116 Bacteria 12137
534 Ga0207674_10649249 3300026116 Bacteria 1019
535 Ga0207675_100238944 3300026118 Bacteria 1755
536 Ga0207675_100239976 3300026118 Unclassified 1751
537 Ga0207683_10064946 3300026121 Bacteria 3217
538 Ga0207683_11857335 3300026121 Unclassified 551
539 Ga0207698_10057352 3300026142 Bacteria 3013
540 Ga0207698_11522824 3300026142 Unclassified 684
541 Ga0265358_100623 3300028010 Unclassified 920
542 Ga0265354_1013449 3300028016 Bacteria 776
543 Ga0265357_1003484 3300028023 Unclassified 1366
544 Ga0265357_1024382 3300028023 Unclassified 674
545 Ga0265355_1010589 3300028036 Unclassified 752
546 Ga0268266_11558908 3300028379 Unclassified 636
547 Ga0268265_10050090 3300028380 Unclassified 3145
548 Ga0268265_10150018 3300028380 Bacteria 1965
549 Ga0268264_10029448 3300028381 Bacteria 4497
550 Ga0268264_10155256 3300028381 Unclassified 2056
551 Ga0265336_10086578 3300028666 Bacteria 934
552 Ga0265336_10110129 3300028666 Unclassified 820
553 Ga0265338_10000548 3300028800 Bacteria 65821
554 Ga0265338_10151773 3300028800 Bacteria 1799
555 Ga0265338_10699631 3300028800 Unclassified 699
556 Ga0265762_1005353 3300030760 Bacteria 2299
557 Ga0265762_1138310 3300030760 Unclassified 570
558 Ga0265775_107506 3300030762 Unclassified 655
559 Ga0265775_112300 3300030762 Unclassified 553
560 Ga0265763_1017738 3300030763 Unclassified 724
561 Ga0265763_1020358 3300030763 Unclassified 693
562 Ga0265763_1024361 3300030763 Unclassified 655
563 Ga0265763_1055503 3300030763 Unclassified 507
564 Ga0265777_101768 3300030877 Unclassified 1195
565 Ga0265777_114530 3300030877 Unclassified 608
566 Ga0265770_1001245 3300030878 Bacteria 3527
567 Ga0265765_1000221 3300030879 Bacteria 3990
568 Ga0265765_1040034 3300030879 Bacteria 620
569 Ga0265776_107123 3300030880 Unclassified 614
570 Ga0265776_112111 3300030880 Unclassified 525
571 Ga0265764_110310 3300030882 Unclassified 587
572 Ga0265764_111805 3300030882 Unclassified 568
573 Ga0265764_115465 3300030882 Unclassified 523
574 Ga0265769_119810 3300030888 Unclassified 528
575 Ga0265761_104315 3300030889 Unclassified 720
576 Ga0265761_110294 3300030889 Bacteria 542
577 Ga0265761_111343 3300030889 Unclassified 524
578 Ga0265771_1014385 3300031010 Unclassified 625
579 Ga0265773_1031893 3300031018 Unclassified 570
580 Ga0265779_114368 3300031043 Unclassified 514
581 Ga0265760_10079574 3300031090 Unclassified 1014
582 Ga0265760_10100841 3300031090 Unclassified 912
583 Ga0265760_10102408 3300031090 Bacteria 906
584 Ga0265760_10137668 3300031090 Unclassified 793
585 Ga0265760_10157182 3300031090 Unclassified 748
586 Ga0265760_10202121 3300031090 Bacteria 671
587 Ga0265760_10240723 3300031090 Unclassified 623
588 Ga0265760_10337487 3300031090 Unclassified 538
589 Ga0265760_10392212 3300031090 Unclassified 500
590 Ga0265330_10235770 3300031235 Bacteria 772
591 Ga0265325_10310990 3300031241 Unclassified 702
592 Ga0265340_10174941 3300031247 Unclassified 972
593 Ga0265340_10425123 3300031247 Unclassified 586
594 Ga0265339_10055600 3300031249 Bacteria 2146
595 Ga0265339_10097496 3300031249 Bacteria 1534
596 Ga0265339_10220499 3300031249 Unclassified 928
597 Ga0265339_10245596 3300031249 Unclassified 868
598 Ga0265339_10361938 3300031249 Unclassified 682
599 Ga0265316_10023942 3300031344 Bacteria 5128
600 Ga0265316_10080086 3300031344 Bacteria 2505
601 Ga0265316_10095823 3300031344 Bacteria 2260
602 Ga0265316_10639825 3300031344 Bacteria 752
603 Ga0265316_11200831 3300031344 Unclassified 525
604 Ga0310117_127002 3300031592 Unclassified 561
605 Ga0310103_132860 3300031614 Unclassified 618
606 Ga0310119_131841 3300031686 Unclassified 543
607 Ga0265314_10065555 3300031711 Bacteria 2453
608 Ga0265314_10116705 3300031711 Bacteria 1687
609 Ga0265314_10257183 3300031711 Bacteria 999
610 Ga0265314_10334652 3300031711 Unclassified 838
611 Ga0316044_131221 3300031810 Unclassified 510
612 Ga0316053_102785 3300032120 Bacteria 1007
613 Ga0316053_104542 3300032120 Bacteria 858
614 Ga0316053_106766 3300032120 Unclassified 752
615 Ga0316053_109680 3300032120 Unclassified 664
616 Ga0316053_110154 3300032120 Unclassified 653
617 Ga0316053_111644 3300032120 Unclassified 623
618 Ga0316053_115686 3300032120 Unclassified 565
619 Ga0316053_118810 3300032120 Unclassified 531
620 Ga0316053_120060 3300032120 Unclassified 520
621 Ga0316215_1023045 3300033544 Bacteria 637
622 Ga0373930_0124914 3300034816 Unclassified 629
623 Ga0373948_0009021 3300034817 Bacteria 1712
624 Ga0373959_0078847 3300034820 Unclassified 756
625 Ga0373926_0009017 3300035083 Bacteria 3327
626 Ga0373926_0066188 3300035083 Unclassified 1323
627 Ga0373934_0166657 3300035086 Bacteria 904
628 Ga0373940_0085567 3300035088 Unclassified 938
629 Ga0373923_0068918 3300035111 Bacteria 1516
630 Ga0373923_0299702 3300035111 Unclassified 760
631 Ga0373923_0521451 3300035111 Unclassified 581
632 Ga0373932_0133840 3300035112 Bacteria 838
633 Ga0373932_0156212 3300035112 Bacteria 786
634 Ga0373936_0041664 3300035113 Bacteria 1842
635 Ga0373936_0157955 3300035113 Unclassified 986
636 Ga0373936_0309565 3300035113 Unclassified 714
637 Ga0373941_0328507 3300035115 Unclassified 617
638 Ga0373945_0381252 3300035116 Unclassified 616
639 Ga0373953_0511381 3300035117 Bacteria 533
640 Ga0373954_0422356 3300035118 Bacteria 660
641 Ga0373954_0602092 3300035118 Unclassified 545
642 Ga0373956_0083149 3300035119 Bacteria 1471
643 Ga0373943_0126193 3300035170 Bacteria 1365
644 Ga0373943_0226707 3300035170 Unclassified 1043
645 Ga0373943_0283323 3300035170 Bacteria 937
646 Ga0373946_0077075 3300035171 Bacteria 1452
647 Ga0373946_0317909 3300035171 Unclassified 773
648 Ga0373942_0133106 3300035207 Unclassified 786
649 Ga0373942_0351832 3300035207 Unclassified 521
650 Ga0373961_0077805 3300035241 Bacteria 1038
651 Ga0373962_0195980 3300035242 Unclassified 682
652 Ga0373924_0065874 3300035410 Bacteria 1522
653 Ga0373924_0259534 3300035410 Unclassified 770
654 Ga0373924_0325713 3300035410 Unclassified 684
655 Ga0373931_0103539 3300035691 Bacteria 1605
656 Ga0373931_0413088 3300035691 Bacteria 856
657 Ga0373931_1034571 3300035691 Unclassified 557
658 Ga0373935_0008382 3300035692 Bacteria 6186
659 Ga0373935_0045842 3300035692 Unclassified 2760
660 Ga0373935_0049468 3300035692 Bacteria 2664
661 Ga0373935_0071396 3300035692 Bacteria 2240
662 Ga0373927_0199335 3300035695 Archaea 1314
663 Ga0373927_0213330 3300035695 Bacteria 1268
664 Ga0373927_0266331 3300035695 Bacteria 1127
665 Ga0373927_0381120 3300035695 Unclassified 930
666 Ga0373933_0103988 3300035724 Bacteria 1765
667 Ga0373947_0079988 3300035725 Bacteria 2021
668 Ga0373947_0150430 3300035725 Bacteria 1499
669 Ga0373947_0286789 3300035725 Unclassified 1095
670 Ga0373947_0673889 3300035725 Unclassified 705
671 Ga0373947_0743332 3300035725 Unclassified 669
672 Ga0373937_0241478 3300036401 Bacteria 1702
673 Ga0265778_004395 3300036457 Unclassified 1457
674 Ga0265778_011184 3300036457 Bacteria 1031
675 Ga0265778_018949 3300036457 Bacteria 839
676 Ga0265778_019562 3300036457 Bacteria 828
677 Ga0265778_035222 3300036457 Unclassified 657
678 Ga0265778_038692 3300036457 Unclassified 632
679 Ga0265778_043768 3300036457 Unclassified 601
680 Ga0265778_062363 3300036457 Unclassified 522
681 Ga0373925_0039806 3300037068 Bacteria 3478
682 Ga0373925_0066203 3300037068 Bacteria 2723
683 Ga0373925_0150565 3300037068 Bacteria 1827
684 Ga0373925_0403947 3300037068 Bacteria 1114
685 Ga0395898_1167745 3300037466 Bacteria 702
686 Ga0395905_1672641 3300037471 Bacteria 542
687 Ga0242420_009180 3300038996 Bacteria 1619
688 Ga0451839_0187844 3300041496 Unclassified 794
689 Ga0453684_1586424 3300044712 Unclassified 672
690 Ga0451576_2477926 3300045051 Unclassified 530
691 Ga0495629_0016777 3300046459 Bacteria 5256
692 Ga0495580_0013176 3300046472 Bacteria 6326
693 Ga0495580_0023716 3300046472 Bacteria 4500
694 Ga0495580_0035807 3300046472 Bacteria 3568
695 Ga0495580_0057307 3300046472 Bacteria 2742
696 Ga0495580_0101015 3300046472 Unclassified 2006
697 Ga0495580_0202840 3300046472 Unclassified 1366
698 Ga0495580_0850932 3300046472 Unclassified 589
699 Ga0495582_0008490 3300046473 Bacteria 5667
700 Ga0495582_0381389 3300046473 Unclassified 812
701 Ga0495605_0063534 3300046474 Unclassified 1761
702 Ga0495662_0197028 3300046476 Unclassified 993
703 Ga0495664_0053805 3300046477 Unclassified 2393
704 Ga0495585_0015098 3300046492 Unclassified 4489
705 Ga0495594_0057430 3300046499 Bacteria 2149
706 Ga0495594_0292839 3300046499 Bacteria 927
707 Ga0495596_0018336 3300046500 Unclassified 2885
708 Ga0495607_0111954 3300046501 Unclassified 1446
709 Ga0495583_0179398 3300046506 Unclassified 867
710 Ga0495628_0841461 3300046516 Unclassified 640
711 Ga0495630_0102518 3300046517 Bacteria 2165
712 Ga0495630_1510750 3300046517 Bacteria 504
713 Ga0495631_0069664 3300046518 Unclassified 1521
714 Ga0495644_0000061 3300046523 Bacteria 52435
715 Ga0495665_0016298 3300046531 Unclassified 4004
716 Ga0495665_0403704 3300046531 Bacteria 693
717 Ga0495640_0811536 3300046533 Bacteria 557
718 Ga0495586_0490391 3300046535 Unclassified 709
719 Ga0495609_0031684 3300046538 Bacteria 2402
720 Ga0495622_0072311 3300046557 Bacteria 1591
721 Ga0495633_0254641 3300046558 Bacteria 801
722 Ga0495625_0031434 3300046660 Unclassified 3949
723 Ga0495659_0015011 3300046664 Bacteria 2543
724 Ga0495599_0240464 3300046678 Unclassified 1104
725 Ga0495623_0039903 3300046679 Bacteria 2998
726 Ga0495669_0052566 3300046684 Bacteria 1831
727 Ga0495669_0313139 3300046684 Unclassified 757
728 Ga0495613_0001990 3300046689 Bacteria 15512
729 Ga0495624_0195028 3300046690 Bacteria 1231
730 Ga0495624_0246217 3300046690 Archaea 1081
731 Ga0495624_0518755 3300046690 Unclassified 712
732 Ga0495670_0080969 3300046691 Unclassified 1654
733 Ga0495600_0164823 3300046809 Bacteria 1432
734 Ga0495581_0037561 3300047315 Bacteria 2803
735 Ga0495636_0140118 3300047318 Bacteria 1080
736 Ga0495636_0155120 3300047318 Unclassified 1029
737 Ga0495674_0935412 3300047319 Unclassified 667
738 Ga0495676_0108981 3300047321 Unclassified 2036
739 Ga0495680_0960794 3300047322 Unclassified 548
740 Ga0495677_0013494 3300047445 Unclassified 2975
741 Ga0495685_054807 3300047447 Unclassified 1349
742 Ga0495593_0305384 3300047673 Bacteria 796
743 Ga0495602_1014416 3300048088 Bacteria 547
744 Ga0495614_0001727 3300048089 Bacteria 9544
745 Ga0495615_0056789 3300048090 Unclassified 1023
746 Ga0496100_1149124 3300048903 Bacteria 612
747 Ga0496101_1079986 3300048904 Unclassified 630
748 Ga0496102_0134676 3300048905 Bacteria 2314
749 Ga0496103_0061903 3300048906 Bacteria 2329
750 Ga0496104_0391266 3300048907 Bacteria 1302
751 Ga0496106_0227032 3300048909 Bacteria 1490
752 Ga0496107_1107228 3300048910 Unclassified 572
753 Ga0496108_0715482 3300048911 Unclassified 868
754 Ga0496108_0918386 3300048911 Unclassified 751
755 Ga0496109_0111254 3300048912 Bacteria 2547
756 Ga0496111_0986128 3300048914 Bacteria 604
757 Ga0496112_0128262 3300048915 Bacteria 2507
758 Ga0496112_0131889 3300048915 Bacteria 2470
759 Ga0496112_0291574 3300048915 Unclassified 1578
760 Ga0496112_0473985 3300048915 Unclassified 1189
761 Ga0496112_1010782 3300048915 Unclassified 751
762 Ga0496112_1237321 3300048915 Unclassified 663
763 Ga0496112_1448838 3300048915 Unclassified 601
764 Ga0496113_0558053 3300048916 Unclassified 918
765 Ga0496114_0292286 3300048917 Bacteria 1438
766 Ga0496115_0083064 3300048918 Bacteria 2611
767 nmdc:mga0n895_145741_c1 3300050512 Unclassified 2397
768 nmdc:mga0n895_309813_c1 3300050512 Bacteria 1600
769 nmdc:mga0n895_56125_c1 3300050512 Bacteria 3879
770 nmdc:mga0rr50_1490518_c1 3300050513 Unclassified 572
771 nmdc:mga0rr50_41020_c2 3300050513 Bacteria 2871
772 nmdc:mga08x19_1071639_c1 3300050514 Unclassified 572
773 nmdc:mga08x19_1846_c1 3300050514 Bacteria 12979
774 Ga0495601_0150382 3300053077 Bacteria 1520
775 Ga0587093_090739 3300059478 Unclassified 540
776 Ga0587088_173574 3300059508 Unclassified 536
777 Ga0587091_199471 3300059511 Unclassified 536
778 Ga0587125_066665 3300059607 Unclassified 536
779 Ga0587117_043574 3300059627 Unclassified 723
780 Ga0587122_027423 3300059628 Unclassified 654
781 Ga0587114_136486 3300059655 Unclassified 509
782 Ga0070698_100875243
783 JGI24739J22299_10241925
784 JGI24737J22298_10044638
785 JGI24737J22298_10159255
786 Ga0065712_10094390
787 Ga0065715_10023259
788 Ga0070676_10103108
789 Ga0070676_11204077
790 Ga0070683_100856737
791 Ga0070683_101765720
792 Ga0070690_100157071
793 Ga0068869_100044433
794 Ga0068869_100049263
795 Ga0070666_11368821
796 Ga0070680_100210604
797 Ga0070680_100514605
798 Ga0070682_100079870
799 Ga0070682_100867722
800 Ga0068868_100018866
801 Ga0068868_100108978
802 Ga0068868_100252195
803 Ga0070660_100103726
804 Ga0070691_10033187
805 Ga0070687_100229812
806 Ga0070687_100712235
807 Ga0070661_100201059
808 Ga0070661_100678001
809 Ga0070692_10307377
810 Ga0070668_100007429
811 Ga0070669_100117538
812 Ga0070675_100223604
813 Ga0070675_100912186
814 Ga0070671_101002769
815 Ga0070674_100239183
816 Ga0070688_100540590
817 Ga0070659_100040585
818 Ga0070659_100694270
819 Ga0070667_100122356
820 Ga0070667_100558117
821 Ga0070667_100812953
822 Ga0070709_10104203
823 Ga0070709_10111578
824 Ga0070709_10348946
825 Ga0070709_10399734
826 Ga0070709_10605838
827 Ga0070709_10645679
828 Ga0070709_11661602
829 Ga0070714_100009954
830 Ga0070714_100078852
831 Ga0070714_100868133
832 Ga0070714_101243867
833 Ga0070713_100021084
834 Ga0070713_100022245
835 Ga0070713_100069888
836 Ga0070713_100183247
837 Ga0070713_100223014
838 Ga0070713_100450277
839 Ga0070713_100798847
840 Ga0070713_101506854
841 Ga0070713_101770311
842 Ga0070710_10116085
843 Ga0070710_10266286
844 Ga0070710_11168102
845 Ga0070701_10422846
846 Ga0070711_100136750
847 Ga0070711_100478201
848 Ga0070711_100573244
849 Ga0070711_100938797
850 Ga0070711_101112408
851 Ga0070705_100229866
852 Ga0070705_101180284
853 Ga0070694_100135732
854 Ga0070708_100008829
855 Ga0070708_100045192
856 Ga0070708_100247147
857 Ga0070663_100373538
858 Ga0070678_100042985
859 Ga0070678_100054401
860 Ga0070662_100012427
861 Ga0070662_100019078
862 Ga0070662_100725019
863 Ga0070681_10008295
864 Ga0070681_10023083
865 Ga0070681_10231818
866 Ga0068867_100030361
867 Ga0068867_100483425
868 Ga0070685_10311392
869 Ga0070706_100026518
870 Ga0070706_100067539
871 Ga0070706_100494009
872 Ga0070706_100686683
873 Ga0070707_100025402
874 Ga0070707_100676839
875 Ga0070698_100053290
876 Ga0070699_100013838
877 Ga0070699_100510400
878 Ga0070699_101762886
879 Ga0070679_100171407
880 Ga0070679_100179877
881 Ga0070679_101206571
882 Ga0070684_100073073
883 Ga0070684_100203036
884 Ga0070684_100204820
885 Ga0070697_100006949
886 Ga0070697_100342332
887 Ga0070697_100553441
888 Ga0070697_100730423
889 Ga0070697_101298282
890 Ga0068853_100053613
891 Ga0068853_101928752
892 Ga0070686_100043528
893 Ga0070686_100375366
894 Ga0070695_100695060
895 Ga0070696_100560546
896 Ga0070693_100037164
897 Ga0070665_100143216
898 Ga0070665_101154348
899 Ga0068855_100044774
900 Ga0068855_100208491
901 Ga0068855_100362170
902 Ga0068855_100405937
903 Ga0068855_101903042
904 Ga0068855_102568847
905 Ga0070664_100012076
906 Ga0070664_100037583
907 Ga0070664_100797885
908 Ga0070664_100942931
909 Ga0068857_100006131
910 Ga0068857_100059980
911 Ga0068857_100322118
912 Ga0068854_100035894
913 Ga0068854_100048389
914 Ga0068854_100338567
915 Ga0068856_100010194
916 Ga0068856_100025793
917 Ga0068856_100040619
918 Ga0068856_100061438
919 Ga0068856_100275342
920 Ga0068856_101080334
921 Ga0068856_101998919
922 Ga0068856_102120744
923 Ga0070702_100314775
924 Ga0068852_100931996
925 Ga0068859_100221156
926 Ga0068859_100739758
927 Ga0068864_100025145
928 Ga0068864_100691586
929 Ga0068864_101939140
930 Ga0068866_10019917
931 Ga0068866_10364898
932 Ga0068861_100086140
933 Ga0068861_101182417
934 Ga0068851_10758323
935 Ga0068870_10055117
936 Ga0068863_100470919
937 Ga0068863_100663634
938 Ga0068858_100372537
939 Ga0068858_100707448
940 Ga0068858_101137360
941 Ga0068860_100037643
942 Ga0068860_100097549
943 Ga0068862_100241054
944 Ga0070717_10003494
945 Ga0070717_10011899
946 Ga0070717_10027952
947 Ga0070717_10028362
948 Ga0070717_10044255
949 Ga0070717_10105215
950 Ga0070717_10131726
951 Ga0070717_10371945
952 Ga0070717_10465231
953 Ga0070717_10832469
954 Ga0070717_10840000
955 Ga0070717_11205342
956 Ga0070715_10089860
957 Ga0070715_10484665
958 Ga0070715_10720251
959 Ga0070716_100011035
960 Ga0070716_100141716
961 Ga0070716_100163598
962 Ga0070716_100189339
963 Ga0070716_100411333
964 Ga0070716_100912291
965 Ga0070716_101248507
966 Ga0070716_101583790
967 Ga0070712_100042156
968 Ga0070712_100047230
969 Ga0070712_100119636
970 Ga0070712_100177483
971 Ga0070712_100316539
972 Ga0070712_100401666
973 Ga0070712_100449450
974 Ga0070712_101802648
975 Ga0097621_100009199
976 Ga0097621_100031690
977 Ga0097621_100032650
978 Ga0097621_100101641
979 Ga0097621_100420355
980 Ga0097621_100854250
981 Ga0068871_100012980
982 Ga0068871_100025836
983 Ga0068871_100145336
984 Ga0068871_100533053
985 Ga0075434_100095958
986 Ga0075434_100343290
987 Ga0075434_101571895
988 Ga0068865_100499771
989 Ga0068865_100671469
990 Ga0075436_100002999
991 Ga0075436_100105214
992 Ga0075436_100520205
993 Ga0097620_100221145
994 Ga0097620_100739813
995 Ga0075435_100055519
996 Ga0075435_100938523
997 Ga0099794_10365507
998 Ga0105250_10040532
999 Ga0105240_10086660
1000 Ga0105240_10169681
1001 Ga0105240_10268071
1002 Ga0105240_10821260
1003 Ga0105245_10078510
1004 Ga0105245_10094488
1005 Ga0105247_10011131
1006 Ga0105247_10254627
1007 Ga0105243_10352107
1008 Ga0105241_10006864
1009 Ga0105241_10050529
1010 Ga0105241_10724185
1011 Ga0105241_12616200
1012 Ga0105242_10618463
1013 Ga0105248_10054895
1014 Ga0105248_10204053
1015 Ga0105248_10324671
1016 Ga0105248_10963904
1017 Ga0105248_12657598
1018 Ga0105237_10131570
1019 Ga0105237_10405166
1020 Ga0105237_10668192
1021 Ga0105237_10741377
1022 Ga0105238_10076815
1023 Ga0105238_10172498
1024 Ga0105238_10216871
1025 Ga0105238_10679853
1026 Ga0105249_10075147
1027 Ga0105249_10132946
1028 Ga0105249_10768278
1029 Ga0105239_12033777
1030 Ga0105239_12048916
1031 Ga0105246_10115057
1032 Ga0105246_10250395
1033 Ga0105246_10727833
1034 Ga0157373_10047535
1035 Ga0157373_10280310
1036 Ga0157373_10333525
1037 Ga0157371_10020279
1038 Ga0157371_10217621
1039 Ga0157371_10319135
1040 Ga0157370_10145392
1041 Ga0157370_10170585
1042 Ga0157370_10898765
1043 Ga0157369_10018318
1044 Ga0157369_10052728
1045 Ga0157369_10213452
1046 Ga0157369_10232498
1047 Ga0157369_12432064
1048 Ga0157374_10000220
1049 Ga0157374_10000651
1050 Ga0157374_10185695
1051 Ga0157374_10225301
1052 Ga0157374_10268997
1053 Ga0157374_11130311
1054 Ga0157374_11716836
1055 Ga0157378_10005113
1056 Ga0157378_10117296
1057 Ga0157378_10334189
1058 Ga0157378_11243198
1059 Ga0157378_11486821
1060 Ga0163162_10024768
1061 Ga0157372_10003153
1062 Ga0157372_10007172
1063 Ga0157372_10017970
1064 Ga0157372_10037832
1065 Ga0157372_10040835
1066 Ga0157372_10111398
1067 Ga0157372_10124578
1068 Ga0157372_10223798
1069 Ga0157375_10260151
1070 Ga0157375_13203796
1071 Ga0163163_10106153
1072 Ga0163163_10372763
1073 Ga0163163_11157554
1074 Ga0157377_10634422
1075 Ga0157379_10035997
1076 Ga0157379_10132288
1077 Ga0157379_11311158
1078 Ga0157376_10096447
1079 Ga0157376_10466655
1080 Ga0157376_11136441
1081 Ga0157376_11364676
1082 Ga0182005_1271212
1083 Ga0163161_10454079
1084 Ga0184602_100374
1085 Ga0184602_108799
1086 Ga0184602_109278
1087 Ga0184602_116921
1088 Ga0184602_126363
1089 Ga0184602_132365
1090 Ga0184597_100518
1091 Ga0184597_121182
1092 Ga0184597_123989
1093 Ga0184597_128478
1094 Ga0184595_109345
1095 Ga0184595_110125
1096 Ga0184595_125523
1097 Ga0184595_126827
1098 Ga0184598_101394
1099 Ga0184598_119654
1100 Ga0184598_126073
1101 Ga0184598_130657
1102 Ga0184598_137139
1103 Ga0184598_139079
1104 Ga0184601_101282
1105 Ga0184601_108513
1106 Ga0184601_108906
1107 Ga0184601_110771
1108 Ga0184601_122462
1109 Ga0184601_133084
1110 Ga0184599_106580
1111 Ga0184599_110872
1112 Ga0184599_113574
1113 Ga0184599_123342
1114 Ga0184599_126591
1115 Ga0184599_151074
1116 Ga0184599_152807
1117 Ga0184600_110547
1118 Ga0184600_133038
1119 Ga0184600_136576
1120 Ga0184600_146854
1121 Ga0184603_102317
1122 Ga0184603_103961
1123 Ga0184603_110016
1124 Ga0184603_118243
1125 Ga0184603_120553
1126 Ga0184603_120588
1127 Ga0184603_121057
1128 Ga0184603_142816
1129 Ga0184603_144489
1130 Ga0184603_150214
1131 Ga0224569_110195
1132 Ga0247552_101551
1133 Ga0247552_101942
1134 Ga0247552_102588
1135 Ga0247552_104144
1136 Ga0247555_101795
1137 Ga0247555_103058
1138 Ga0247555_104449
1139 Ga0247555_104770
1140 Ga0247554_101396
1141 Ga0247554_103171
1142 Ga0247554_104024
1143 Ga0247554_104735
1144 Ga0247554_106513
1145 Ga0247551_100239
1146 Ga0247521_115859
1147 Ga0247518_113452
1148 Ga0247550_102062
1149 Ga0247550_104570
1150 Ga0247553_100978
1151 Ga0247553_102120
1152 Ga0247553_104896
1153 Ga0247553_105340
1154 Ga0247553_105758
1155 Ga0247553_109254
1156 Ga0247553_110308
1157 Ga0247553_110626
1158 Ga0247553_111073
1159 Ga0247522_117633
1160 Ga0224572_1056960
1161 Ga0228598_1006492
1162 Ga0228598_1009719
1163 Ga0228598_1010436
1164 Ga0228598_1035664
1165 Ga0228598_1099922
1166 Ga0207656_10696329
1167 Ga0207692_10068918
1168 Ga0207692_10324751
1169 Ga0207692_10325487
1170 Ga0207692_10371862
1171 Ga0207642_10003203
1172 Ga0207642_10030408
1173 Ga0207642_10272744
1174 Ga0207710_10078561
1175 Ga0207710_10270089
1176 Ga0207688_10548027
1177 Ga0207688_10811397
1178 Ga0207680_10773694
1179 Ga0207647_10015305
1180 Ga0207647_10066997
1181 Ga0207647_10127224
1182 Ga0207699_10042831
1183 Ga0207699_10093294
1184 Ga0207699_10171735
1185 Ga0207699_10383332
1186 Ga0207699_10551710
1187 Ga0207699_10692764
1188 Ga0207645_10721898
1189 Ga0207643_10153211
1190 Ga0207684_10034078
1191 Ga0207684_10083180
1192 Ga0207684_10117663
1193 Ga0207654_10004095
1194 Ga0207654_10005110
1195 Ga0207654_10030496
1196 Ga0207654_10042405
1197 Ga0207654_10288527
1198 Ga0207707_10049910
1199 Ga0207707_10205514
1200 Ga0207707_10341380
1201 Ga0207707_11224118
1202 Ga0207695_10124252
1203 Ga0207695_10204406
1204 Ga0207695_10376133
1205 Ga0207695_10971980
1206 Ga0207671_10019302
1207 Ga0207671_10073107
1208 Ga0207693_10063354
1209 Ga0207693_10150425
1210 Ga0207693_10342662
1211 Ga0207693_10422591
1212 Ga0207693_10566944
1213 Ga0207663_10167412
1214 Ga0207663_10312147
1215 Ga0207663_11182698
1216 Ga0207663_11270594
1217 Ga0207663_11425644
1218 Ga0207660_10999454
1219 Ga0207662_10273103
1220 Ga0207662_10701322
1221 Ga0207657_10050639
1222 Ga0207649_10121620
1223 Ga0207652_10331131
1224 Ga0207652_10570512
1225 Ga0207652_11195957
1226 Ga0207646_10407109
1227 Ga0207646_10770003
1228 Ga0207681_10190870
1229 Ga0207694_10091140
1230 Ga0207694_10348131
1231 Ga0207650_10018008
1232 Ga0207650_10018028
1233 Ga0207687_10027523
1234 Ga0207687_10149308
1235 Ga0207700_10052379
1236 Ga0207700_10096532
1237 Ga0207700_10783784
1238 Ga0207664_10011365
1239 Ga0207664_10036879
1240 Ga0207664_10083055
1241 Ga0207664_10287741
1242 Ga0207664_10501418
1243 Ga0207664_10917807
1244 Ga0207664_10983754
1245 Ga0207644_10832027
1246 Ga0207690_10185830
1247 Ga0207706_10000938
1248 Ga0207706_10041125
1249 Ga0207706_11155806
1250 Ga0207686_10102472
1251 Ga0207709_10845494
1252 Ga0207669_10671314
1253 Ga0207704_10219972
1254 Ga0207704_11920812
1255 Ga0207665_10002589
1256 Ga0207665_10060373
1257 Ga0207665_10167419
1258 Ga0207665_10184404
1259 Ga0207665_10228926
1260 Ga0207665_10279457
1261 Ga0207665_10681859
1262 Ga0207665_10844978
1263 Ga0207665_11029975
1264 Ga0207691_11392628
1265 Ga0207711_10023112
1266 Ga0207711_10268750
1267 Ga0207711_11237026
1268 Ga0207711_11317925
1269 Ga0207689_10083777
1270 Ga0207689_10105283
1271 Ga0207689_11048010
1272 Ga0207661_10268400
1273 Ga0207661_11891372
1274 Ga0207679_10020124
1275 Ga0207679_10461433
1276 Ga0207679_10654565
1277 Ga0207667_10035572
1278 Ga0207667_10064682
1279 Ga0207667_10453745
1280 Ga0207667_12252808
1281 Ga0207712_10524590
1282 Ga0207668_10039426
1283 Ga0207640_10008577
1284 Ga0207640_11175890
1285 Ga0207640_11580815
1286 Ga0207658_10793513
1287 Ga0207677_10051768
1288 Ga0207677_10110735
1289 Ga0207677_10267010
1290 Ga0207677_10846893
1291 Ga0207703_10075459
1292 Ga0207703_10648843
1293 Ga0207703_10981428
1294 Ga0207639_10215395
1295 Ga0207639_10506981
1296 Ga0207678_10001163
1297 Ga0207702_10008794
1298 Ga0207702_10038005
1299 Ga0207702_10038861
1300 Ga0207702_10141070
1301 Ga0207702_10150679
1302 Ga0207702_11111564
1303 Ga0207641_10359114
1304 Ga0207641_10411037
1305 Ga0207648_10043729
1306 Ga0207648_10134557
1307 Ga0207648_10171854
1308 Ga0207648_10375318
1309 Ga0207676_10015126
1310 Ga0207676_10144866
1311 Ga0207676_10232636
1312 Ga0207676_11849964
1313 Ga0207674_10005128
1314 Ga0207674_10008169
1315 Ga0207674_10649249
1316 Ga0207675_100238944
1317 Ga0207675_100239976
1318 Ga0207683_10064946
1319 Ga0207683_11857335
1320 Ga0207698_10057352
1321 Ga0207698_11522824
1322 Ga0265358_100623
1323 Ga0265354_1013449
1324 Ga0265357_1003484
1325 Ga0265357_1024382
1326 Ga0265355_1010589
1327 Ga0268266_11558908
1328 Ga0268265_10050090
1329 Ga0268265_10150018
1330 Ga0268264_10029448
1331 Ga0268264_10155256
1332 Ga0265336_10086578
1333 Ga0265336_10110129
1334 Ga0265338_10000548
1335 Ga0265338_10151773
1336 Ga0265338_10699631
1337 Ga0265762_1005353
1338 Ga0265762_1138310
1339 Ga0265775_107506
1340 Ga0265775_112300
1341 Ga0265763_1017738
1342 Ga0265763_1020358
1343 Ga0265763_1024361
1344 Ga0265763_1055503
1345 Ga0265777_101768
1346 Ga0265777_114530
1347 Ga0265770_1001245
1348 Ga0265765_1000221
1349 Ga0265765_1040034
1350 Ga0265776_107123
1351 Ga0265776_112111
1352 Ga0265764_110310
1353 Ga0265764_111805
1354 Ga0265764_115465
1355 Ga0265769_119810
1356 Ga0265761_104315
1357 Ga0265761_110294
1358 Ga0265761_111343
1359 Ga0265771_1014385
1360 Ga0265773_1031893
1361 Ga0265779_114368
1362 Ga0265760_10079574
1363 Ga0265760_10100841
1364 Ga0265760_10102408
1365 Ga0265760_10137668
1366 Ga0265760_10157182
1367 Ga0265760_10202121
1368 Ga0265760_10240723
1369 Ga0265760_10337487
1370 Ga0265760_10392212
1371 Ga0265330_10235770
1372 Ga0265325_10310990
1373 Ga0265340_10174941
1374 Ga0265340_10425123
1375 Ga0265339_10055600
1376 Ga0265339_10097496
1377 Ga0265339_10220499
1378 Ga0265339_10245596
1379 Ga0265339_10361938
1380 Ga0265316_10023942
1381 Ga0265316_10080086
1382 Ga0265316_10095823
1383 Ga0265316_10639825
1384 Ga0265316_11200831
1385 Ga0310117_127002
1386 Ga0310103_132860
1387 Ga0310119_131841
1388 Ga0265314_10065555
1389 Ga0265314_10116705
1390 Ga0265314_10257183
1391 Ga0265314_10334652
1392 Ga0316044_131221
1393 Ga0316053_102785
1394 Ga0316053_104542
1395 Ga0316053_106766
1396 Ga0316053_109680
1397 Ga0316053_110154
1398 Ga0316053_111644
1399 Ga0316053_115686
1400 Ga0316053_118810
1401 Ga0316053_120060
1402 Ga0316215_1023045
1403 Ga0373930_0124914
1404 Ga0373948_0009021
1405 Ga0373959_0078847
1406 Ga0373926_0009017
1407 Ga0373926_0066188
1408 Ga0373934_0166657
1409 Ga0373940_0085567
1410 Ga0373923_0068918
1411 Ga0373923_0299702
1412 Ga0373923_0521451
1413 Ga0373932_0133840
1414 Ga0373932_0156212
1415 Ga0373936_0041664
1416 Ga0373936_0157955
1417 Ga0373936_0309565
1418 Ga0373941_0328507
1419 Ga0373945_0381252
1420 Ga0373953_0511381
1421 Ga0373954_0422356
1422 Ga0373954_0602092
1423 Ga0373956_0083149
1424 Ga0373943_0126193
1425 Ga0373943_0226707
1426 Ga0373943_0283323
1427 Ga0373946_0077075
1428 Ga0373946_0317909
1429 Ga0373942_0133106
1430 Ga0373942_0351832
1431 Ga0373961_0077805
1432 Ga0373962_0195980
1433 Ga0373924_0065874
1434 Ga0373924_0259534
1435 Ga0373924_0325713
1436 Ga0373931_0103539
1437 Ga0373931_0413088
1438 Ga0373931_1034571
1439 Ga0373935_0008382
1440 Ga0373935_0045842
1441 Ga0373935_0049468
1442 Ga0373935_0071396
1443 Ga0373927_0199335
1444 Ga0373927_0213330
1445 Ga0373927_0266331
1446 Ga0373927_0381120
1447 Ga0373933_0103988
1448 Ga0373947_0079988
1449 Ga0373947_0150430
1450 Ga0373947_0286789
1451 Ga0373947_0673889
1452 Ga0373947_0743332
1453 Ga0373937_0241478
1454 Ga0265778_004395
1455 Ga0265778_011184
1456 Ga0265778_018949
1457 Ga0265778_019562
1458 Ga0265778_035222
1459 Ga0265778_038692
1460 Ga0265778_043768
1461 Ga0265778_062363
1462 Ga0373925_0039806
1463 Ga0373925_0066203
1464 Ga0373925_0150565
1465 Ga0373925_0403947
1466 Ga0395898_1167745
1467 Ga0395905_1672641
1468 Ga0242420_009180
1469 Ga0451839_0187844
1470 Ga0453684_1586424
1471 Ga0451576_2477926
1472 Ga0495629_0016777
1473 Ga0495580_0013176
1474 Ga0495580_0023716
1475 Ga0495580_0035807
1476 Ga0495580_0057307
1477 Ga0495580_0101015
1478 Ga0495580_0202840
1479 Ga0495580_0850932
1480 Ga0495582_0008490
1481 Ga0495582_0381389
1482 Ga0495605_0063534
1483 Ga0495662_0197028
1484 Ga0495664_0053805
1485 Ga0495585_0015098
1486 Ga0495594_0057430
1487 Ga0495594_0292839
1488 Ga0495596_0018336
1489 Ga0495607_0111954
1490 Ga0495583_0179398
1491 Ga0495628_0841461
1492 Ga0495630_0102518
1493 Ga0495630_1510750
1494 Ga0495631_0069664
1495 Ga0495644_0000061
1496 Ga0495665_0016298
1497 Ga0495665_0403704
1498 Ga0495640_0811536
1499 Ga0495586_0490391
1500 Ga0495609_0031684
1501 Ga0495622_0072311
1502 Ga0495633_0254641
1503 Ga0495625_0031434
1504 Ga0495659_0015011
1505 Ga0495599_0240464
1506 Ga0495623_0039903
1507 Ga0495669_0052566
1508 Ga0495669_0313139
1509 Ga0495613_0001990
1510 Ga0495624_0195028
1511 Ga0495624_0246217
1512 Ga0495624_0518755
1513 Ga0495670_0080969
1514 Ga0495600_0164823
1515 Ga0495581_0037561
1516 Ga0495636_0140118
1517 Ga0495636_0155120
1518 Ga0495674_0935412
1519 Ga0495676_0108981
1520 Ga0495680_0960794
1521 Ga0495677_0013494
1522 Ga0495685_054807
1523 Ga0495593_0305384
1524 Ga0495602_1014416
1525 Ga0495614_0001727
1526 Ga0495615_0056789
1527 Ga0496100_1149124
1528 Ga0496101_1079986
1529 Ga0496102_0134676
1530 Ga0496103_0061903
1531 Ga0496104_0391266
1532 Ga0496106_0227032
1533 Ga0496107_1107228
1534 Ga0496108_0715482
1535 Ga0496108_0918386
1536 Ga0496109_0111254
1537 Ga0496111_0986128
1538 Ga0496112_0128262
1539 Ga0496112_0131889
1540 Ga0496112_0291574
1541 Ga0496112_0473985
1542 Ga0496112_1010782
1543 Ga0496112_1237321
1544 Ga0496112_1448838
1545 Ga0496113_0558053
1546 Ga0496114_0292286
1547 Ga0496115_0083064
1548 nmdc:mga0n895_145741_c1
1549 nmdc:mga0n895_309813_c1
1550 nmdc:mga0n895_56125_c1
1551 nmdc:mga0rr50_1490518_c1
1552 nmdc:mga0rr50_41020_c2
1553 nmdc:mga08x19_1071639_c1
1554 nmdc:mga08x19_1846_c1
1555 Ga0495601_0150382
1556 Ga0587093_090739
1557 Ga0587088_173574
1558 Ga0587091_199471
1559 Ga0587125_066665
1560 Ga0587117_043574
1561 Ga0587122_027423
1562 Ga0587114_136486

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5t-assembly1.cif.gz_B crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with the ligand oxidized acetyl dithranol 0.8388 2 95
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.8368 1 96
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.8365 2 94
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.8304 2 96
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.827 2 92
ID Description Score Start End Superfamily
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9148 5 69 3.10.450.240
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8942 2 89 3.30.70.100
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8773 5 69 3.10.450.240
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8675 3 79 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8507 2 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3N5J2N4-F1-model_v4 ABM domain-containing protein 0.9882 1 96
AF-A0A2V8Y4D7-F1-model_v4 ABM domain-containing protein 0.9881 1 86
AF-A0A524H098-F1-model_v4 ABM domain-containing protein 0.9773 2 96
AF-A0A534VNS4-F1-model_v4 ABM domain-containing protein 0.9771 2 98
AF-A0A2V9FIS3-F1-model_v4 ABM domain-containing protein 0.9758 1 96

Map