F480553
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 781 | 324 | 1562 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100875243|Ga0070698_1008752432 |
| Length | 105 |
| Sequence | MYARNVSLHLKSNMLSDYTRIFEKDILPLLRKQNGFKDEITFCPGGMDVTAISLWDNKANAEAYNTNTYPEVLQTLARVIDGTPKVQTCEVVNSTFHKIAVGAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 120 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 125 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 126 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 129 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 130 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 191 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 192 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 193 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 219 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 220 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 223 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 224 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 256 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.46 |
| Metatranscriptomes | 17.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 96.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 47.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070698_100875243 | 3300005471 | Unclassified | 844 |
| 2 | JGI24739J22299_10241925 | 3300001989 | Unclassified | 528 |
| 3 | JGI24737J22298_10044638 | 3300001990 | Bacteria | 1354 |
| 4 | JGI24737J22298_10159255 | 3300001990 | Bacteria | 666 |
| 5 | Ga0065712_10094390 | 3300005290 | Unclassified | 2257 |
| 6 | Ga0065715_10023259 | 3300005293 | Unclassified | 1727 |
| 7 | Ga0070676_10103108 | 3300005328 | Unclassified | 1766 |
| 8 | Ga0070676_11204077 | 3300005328 | Unclassified | 576 |
| 9 | Ga0070683_100856737 | 3300005329 | Bacteria | 871 |
| 10 | Ga0070683_101765720 | 3300005329 | Unclassified | 595 |
| 11 | Ga0070690_100157071 | 3300005330 | Bacteria | 1556 |
| 12 | Ga0068869_100044433 | 3300005334 | Bacteria | 3195 |
| 13 | Ga0068869_100049263 | 3300005334 | Unclassified | 3049 |
| 14 | Ga0070666_11368821 | 3300005335 | Unclassified | 528 |
| 15 | Ga0070680_100210604 | 3300005336 | Bacteria | 1640 |
| 16 | Ga0070680_100514605 | 3300005336 | Bacteria | 1024 |
| 17 | Ga0070682_100079870 | 3300005337 | Unclassified | 2113 |
| 18 | Ga0070682_100867722 | 3300005337 | Bacteria | 739 |
| 19 | Ga0068868_100018866 | 3300005338 | Bacteria | 5162 |
| 20 | Ga0068868_100108978 | 3300005338 | Unclassified | 2248 |
| 21 | Ga0068868_100252195 | 3300005338 | Bacteria | 1486 |
| 22 | Ga0070660_100103726 | 3300005339 | Bacteria | 2255 |
| 23 | Ga0070691_10033187 | 3300005341 | Bacteria | 2428 |
| 24 | Ga0070687_100229812 | 3300005343 | Bacteria | 1141 |
| 25 | Ga0070687_100712235 | 3300005343 | Unclassified | 702 |
| 26 | Ga0070661_100201059 | 3300005344 | Bacteria | 1522 |
| 27 | Ga0070661_100678001 | 3300005344 | Unclassified | 838 |
| 28 | Ga0070692_10307377 | 3300005345 | Unclassified | 970 |
| 29 | Ga0070668_100007429 | 3300005347 | Bacteria | 8132 |
| 30 | Ga0070669_100117538 | 3300005353 | Bacteria | 2024 |
| 31 | Ga0070675_100223604 | 3300005354 | Bacteria | 1640 |
| 32 | Ga0070675_100912186 | 3300005354 | Unclassified | 805 |
| 33 | Ga0070671_101002769 | 3300005355 | Unclassified | 732 |
| 34 | Ga0070674_100239183 | 3300005356 | Bacteria | 1421 |
| 35 | Ga0070688_100540590 | 3300005365 | Unclassified | 884 |
| 36 | Ga0070659_100040585 | 3300005366 | Bacteria | 3637 |
| 37 | Ga0070659_100694270 | 3300005366 | Unclassified | 880 |
| 38 | Ga0070667_100122356 | 3300005367 | Bacteria | 2264 |
| 39 | Ga0070667_100558117 | 3300005367 | Unclassified | 1053 |
| 40 | Ga0070667_100812953 | 3300005367 | Unclassified | 868 |
| 41 | Ga0070709_10104203 | 3300005434 | Unclassified | 1895 |
| 42 | Ga0070709_10111578 | 3300005434 | Bacteria | 1839 |
| 43 | Ga0070709_10348946 | 3300005434 | Unclassified | 1093 |
| 44 | Ga0070709_10399734 | 3300005434 | Unclassified | 1025 |
| 45 | Ga0070709_10605838 | 3300005434 | Unclassified | 844 |
| 46 | Ga0070709_10645679 | 3300005434 | Unclassified | 819 |
| 47 | Ga0070709_11661602 | 3300005434 | Unclassified | 521 |
| 48 | Ga0070714_100009954 | 3300005435 | Bacteria | 7498 |
| 49 | Ga0070714_100078852 | 3300005435 | Unclassified | 2863 |
| 50 | Ga0070714_100868133 | 3300005435 | Unclassified | 875 |
| 51 | Ga0070714_101243867 | 3300005435 | Unclassified | 726 |
| 52 | Ga0070713_100021084 | 3300005436 | Bacteria | 5005 |
| 53 | Ga0070713_100022245 | 3300005436 | Bacteria | 4896 |
| 54 | Ga0070713_100069888 | 3300005436 | Bacteria | 2963 |
| 55 | Ga0070713_100183247 | 3300005436 | Unclassified | 1883 |
| 56 | Ga0070713_100223014 | 3300005436 | Bacteria | 1710 |
| 57 | Ga0070713_100450277 | 3300005436 | Unclassified | 1209 |
| 58 | Ga0070713_100798847 | 3300005436 | Unclassified | 904 |
| 59 | Ga0070713_101506854 | 3300005436 | Bacteria | 653 |
| 60 | Ga0070713_101770311 | 3300005436 | Unclassified | 600 |
| 61 | Ga0070710_10116085 | 3300005437 | Bacteria | 1614 |
| 62 | Ga0070710_10266286 | 3300005437 | Bacteria | 1107 |
| 63 | Ga0070710_11168102 | 3300005437 | Unclassified | 568 |
| 64 | Ga0070701_10422846 | 3300005438 | Bacteria | 849 |
| 65 | Ga0070711_100136750 | 3300005439 | Unclassified | 1832 |
| 66 | Ga0070711_100478201 | 3300005439 | Bacteria | 1023 |
| 67 | Ga0070711_100573244 | 3300005439 | Unclassified | 939 |
| 68 | Ga0070711_100938797 | 3300005439 | Unclassified | 740 |
| 69 | Ga0070711_101112408 | 3300005439 | Unclassified | 681 |
| 70 | Ga0070705_100229866 | 3300005440 | Bacteria | 1290 |
| 71 | Ga0070705_101180284 | 3300005440 | Unclassified | 630 |
| 72 | Ga0070694_100135732 | 3300005444 | Unclassified | 1783 |
| 73 | Ga0070708_100008829 | 3300005445 | Bacteria | 8110 |
| 74 | Ga0070708_100045192 | 3300005445 | Bacteria | 3878 |
| 75 | Ga0070708_100247147 | 3300005445 | Unclassified | 1675 |
| 76 | Ga0070663_100373538 | 3300005455 | Bacteria | 1159 |
| 77 | Ga0070678_100042985 | 3300005456 | Bacteria | 3216 |
| 78 | Ga0070678_100054401 | 3300005456 | Bacteria | 2916 |
| 79 | Ga0070662_100012427 | 3300005457 | Bacteria | 5647 |
| 80 | Ga0070662_100019078 | 3300005457 | Unclassified | 4651 |
| 81 | Ga0070662_100725019 | 3300005457 | Unclassified | 842 |
| 82 | Ga0070681_10008295 | 3300005458 | Bacteria | 10172 |
| 83 | Ga0070681_10023083 | 3300005458 | Bacteria | 6256 |
| 84 | Ga0070681_10231818 | 3300005458 | Bacteria | 1761 |
| 85 | Ga0068867_100030361 | 3300005459 | Unclassified | 3899 |
| 86 | Ga0068867_100483425 | 3300005459 | Bacteria | 1061 |
| 87 | Ga0070685_10311392 | 3300005466 | Bacteria | 1064 |
| 88 | Ga0070706_100026518 | 3300005467 | Bacteria | 5331 |
| 89 | Ga0070706_100067539 | 3300005467 | Bacteria | 3307 |
| 90 | Ga0070706_100494009 | 3300005467 | Bacteria | 1139 |
| 91 | Ga0070706_100686683 | 3300005467 | Bacteria | 950 |
| 92 | Ga0070707_100025402 | 3300005468 | Bacteria | 5619 |
| 93 | Ga0070707_100676839 | 3300005468 | Bacteria | 994 |
| 94 | Ga0070698_100053290 | 3300005471 | Unclassified | 4112 |
| 95 | Ga0070699_100013838 | 3300005518 | Bacteria | 6940 |
| 96 | Ga0070699_100510400 | 3300005518 | Bacteria | 1092 |
| 97 | Ga0070699_101762886 | 3300005518 | Unclassified | 567 |
| 98 | Ga0070679_100171407 | 3300005530 | Bacteria | 2143 |
| 99 | Ga0070679_100179877 | 3300005530 | Bacteria | 2087 |
| 100 | Ga0070679_101206571 | 3300005530 | Unclassified | 702 |
| 101 | Ga0070684_100073073 | 3300005535 | Bacteria | 3021 |
| 102 | Ga0070684_100203036 | 3300005535 | Unclassified | 1806 |
| 103 | Ga0070684_100204820 | 3300005535 | Unclassified | 1797 |
| 104 | Ga0070697_100006949 | 3300005536 | Bacteria | 8800 |
| 105 | Ga0070697_100342332 | 3300005536 | Bacteria | 1290 |
| 106 | Ga0070697_100553441 | 3300005536 | Bacteria | 1009 |
| 107 | Ga0070697_100730423 | 3300005536 | Unclassified | 874 |
| 108 | Ga0070697_101298282 | 3300005536 | Unclassified | 649 |
| 109 | Ga0068853_100053613 | 3300005539 | Bacteria | 3472 |
| 110 | Ga0068853_101928752 | 3300005539 | Unclassified | 573 |
| 111 | Ga0070686_100043528 | 3300005544 | Bacteria | 2818 |
| 112 | Ga0070686_100375366 | 3300005544 | Unclassified | 1075 |
| 113 | Ga0070695_100695060 | 3300005545 | Bacteria | 807 |
| 114 | Ga0070696_100560546 | 3300005546 | Bacteria | 916 |
| 115 | Ga0070693_100037164 | 3300005547 | Bacteria | 2713 |
| 116 | Ga0070665_100143216 | 3300005548 | Unclassified | 2393 |
| 117 | Ga0070665_101154348 | 3300005548 | Unclassified | 786 |
| 118 | Ga0068855_100044774 | 3300005563 | Bacteria | 5237 |
| 119 | Ga0068855_100208491 | 3300005563 | Bacteria | 2197 |
| 120 | Ga0068855_100362170 | 3300005563 | Bacteria | 1595 |
| 121 | Ga0068855_100405937 | 3300005563 | Unclassified | 1492 |
| 122 | Ga0068855_101903042 | 3300005563 | Unclassified | 602 |
| 123 | Ga0068855_102568847 | 3300005563 | Unclassified | 506 |
| 124 | Ga0070664_100012076 | 3300005564 | Bacteria | 7019 |
| 125 | Ga0070664_100037583 | 3300005564 | Bacteria | 4071 |
| 126 | Ga0070664_100797885 | 3300005564 | Bacteria | 883 |
| 127 | Ga0070664_100942931 | 3300005564 | Unclassified | 810 |
| 128 | Ga0068857_100006131 | 3300005577 | Bacteria | 10272 |
| 129 | Ga0068857_100059980 | 3300005577 | Unclassified | 3380 |
| 130 | Ga0068857_100322118 | 3300005577 | Bacteria | 1428 |
| 131 | Ga0068854_100035894 | 3300005578 | Bacteria | 3473 |
| 132 | Ga0068854_100048389 | 3300005578 | Bacteria | 3033 |
| 133 | Ga0068854_100338567 | 3300005578 | Bacteria | 1228 |
| 134 | Ga0068856_100010194 | 3300005614 | Bacteria | 9136 |
| 135 | Ga0068856_100025793 | 3300005614 | Bacteria | 5731 |
| 136 | Ga0068856_100040619 | 3300005614 | Unclassified | 4570 |
| 137 | Ga0068856_100061438 | 3300005614 | Bacteria | 3712 |
| 138 | Ga0068856_100275342 | 3300005614 | Unclassified | 1699 |
| 139 | Ga0068856_101080334 | 3300005614 | Unclassified | 820 |
| 140 | Ga0068856_101998919 | 3300005614 | Unclassified | 590 |
| 141 | Ga0068856_102120744 | 3300005614 | Unclassified | 572 |
| 142 | Ga0070702_100314775 | 3300005615 | Bacteria | 1088 |
| 143 | Ga0068852_100931996 | 3300005616 | Unclassified | 886 |
| 144 | Ga0068859_100221156 | 3300005617 | Unclassified | 1981 |
| 145 | Ga0068859_100739758 | 3300005617 | Bacteria | 1073 |
| 146 | Ga0068864_100025145 | 3300005618 | Bacteria | 5013 |
| 147 | Ga0068864_100691586 | 3300005618 | Unclassified | 996 |
| 148 | Ga0068864_101939140 | 3300005618 | Unclassified | 595 |
| 149 | Ga0068866_10019917 | 3300005718 | Bacteria | 3064 |
| 150 | Ga0068866_10364898 | 3300005718 | Bacteria | 922 |
| 151 | Ga0068861_100086140 | 3300005719 | Bacteria | 2469 |
| 152 | Ga0068861_101182417 | 3300005719 | Unclassified | 739 |
| 153 | Ga0068851_10758323 | 3300005834 | Unclassified | 601 |
| 154 | Ga0068870_10055117 | 3300005840 | Bacteria | 2117 |
| 155 | Ga0068863_100470919 | 3300005841 | Unclassified | 1234 |
| 156 | Ga0068863_100663634 | 3300005841 | Bacteria | 1035 |
| 157 | Ga0068858_100372537 | 3300005842 | Bacteria | 1370 |
| 158 | Ga0068858_100707448 | 3300005842 | Bacteria | 980 |
| 159 | Ga0068858_101137360 | 3300005842 | Unclassified | 767 |
| 160 | Ga0068860_100037643 | 3300005843 | Bacteria | 4631 |
| 161 | Ga0068860_100097549 | 3300005843 | Bacteria | 2802 |
| 162 | Ga0068862_100241054 | 3300005844 | Bacteria | 1644 |
| 163 | Ga0070717_10003494 | 3300006028 | Bacteria | 11251 |
| 164 | Ga0070717_10011899 | 3300006028 | Bacteria | 6621 |
| 165 | Ga0070717_10027952 | 3300006028 | Bacteria | 4510 |
| 166 | Ga0070717_10028362 | 3300006028 | Unclassified | 4480 |
| 167 | Ga0070717_10044255 | 3300006028 | Unclassified | 3635 |
| 168 | Ga0070717_10105215 | 3300006028 | Unclassified | 2402 |
| 169 | Ga0070717_10131726 | 3300006028 | Bacteria | 2151 |
| 170 | Ga0070717_10371945 | 3300006028 | Bacteria | 1280 |
| 171 | Ga0070717_10465231 | 3300006028 | Bacteria | 1141 |
| 172 | Ga0070717_10832469 | 3300006028 | Unclassified | 840 |
| 173 | Ga0070717_10840000 | 3300006028 | Unclassified | 836 |
| 174 | Ga0070717_11205342 | 3300006028 | Unclassified | 689 |
| 175 | Ga0070715_10089860 | 3300006163 | Bacteria | 1411 |
| 176 | Ga0070715_10484665 | 3300006163 | Unclassified | 705 |
| 177 | Ga0070715_10720251 | 3300006163 | Unclassified | 598 |
| 178 | Ga0070716_100011035 | 3300006173 | Unclassified | 4544 |
| 179 | Ga0070716_100141716 | 3300006173 | Bacteria | 1534 |
| 180 | Ga0070716_100163598 | 3300006173 | Unclassified | 1445 |
| 181 | Ga0070716_100189339 | 3300006173 | Bacteria | 1358 |
| 182 | Ga0070716_100411333 | 3300006173 | Unclassified | 975 |
| 183 | Ga0070716_100912291 | 3300006173 | Unclassified | 689 |
| 184 | Ga0070716_101248507 | 3300006173 | Unclassified | 599 |
| 185 | Ga0070716_101583790 | 3300006173 | Bacteria | 538 |
| 186 | Ga0070712_100042156 | 3300006175 | Unclassified | 3138 |
| 187 | Ga0070712_100047230 | 3300006175 | Bacteria | 2979 |
| 188 | Ga0070712_100119636 | 3300006175 | Bacteria | 1980 |
| 189 | Ga0070712_100177483 | 3300006175 | Unclassified | 1657 |
| 190 | Ga0070712_100316539 | 3300006175 | Unclassified | 1268 |
| 191 | Ga0070712_100401666 | 3300006175 | Bacteria | 1132 |
| 192 | Ga0070712_100449450 | 3300006175 | Unclassified | 1073 |
| 193 | Ga0070712_101802648 | 3300006175 | Unclassified | 536 |
| 194 | Ga0097621_100009199 | 3300006237 | Bacteria | 7164 |
| 195 | Ga0097621_100031690 | 3300006237 | Bacteria | 4196 |
| 196 | Ga0097621_100032650 | 3300006237 | Unclassified | 4140 |
| 197 | Ga0097621_100101641 | 3300006237 | Unclassified | 2419 |
| 198 | Ga0097621_100420355 | 3300006237 | Unclassified | 1200 |
| 199 | Ga0097621_100854250 | 3300006237 | Bacteria | 846 |
| 200 | Ga0068871_100012980 | 3300006358 | Bacteria | 6169 |
| 201 | Ga0068871_100025836 | 3300006358 | Unclassified | 4575 |
| 202 | Ga0068871_100145336 | 3300006358 | Unclassified | 2018 |
| 203 | Ga0068871_100533053 | 3300006358 | Bacteria | 1062 |
| 204 | Ga0075434_100095958 | 3300006871 | Bacteria | 2970 |
| 205 | Ga0075434_100343290 | 3300006871 | Unclassified | 1514 |
| 206 | Ga0075434_101571895 | 3300006871 | Unclassified | 666 |
| 207 | Ga0068865_100499771 | 3300006881 | Bacteria | 1014 |
| 208 | Ga0068865_100671469 | 3300006881 | Unclassified | 883 |
| 209 | Ga0075436_100002999 | 3300006914 | Bacteria | 11561 |
| 210 | Ga0075436_100105214 | 3300006914 | Bacteria | 1968 |
| 211 | Ga0075436_100520205 | 3300006914 | Unclassified | 872 |
| 212 | Ga0097620_100221145 | 3300006931 | Unclassified | 1981 |
| 213 | Ga0097620_100739813 | 3300006931 | Bacteria | 1073 |
| 214 | Ga0075435_100055519 | 3300007076 | Bacteria | 3199 |
| 215 | Ga0075435_100938523 | 3300007076 | Unclassified | 755 |
| 216 | Ga0099794_10365507 | 3300007265 | Bacteria | 751 |
| 217 | Ga0105250_10040532 | 3300009092 | Unclassified | 1868 |
| 218 | Ga0105240_10086660 | 3300009093 | Bacteria | 3835 |
| 219 | Ga0105240_10169681 | 3300009093 | Bacteria | 2585 |
| 220 | Ga0105240_10268071 | 3300009093 | Bacteria | 1967 |
| 221 | Ga0105240_10821260 | 3300009093 | Unclassified | 1006 |
| 222 | Ga0105245_10078510 | 3300009098 | Bacteria | 3012 |
| 223 | Ga0105245_10094488 | 3300009098 | Bacteria | 2756 |
| 224 | Ga0105247_10011131 | 3300009101 | Bacteria | 5424 |
| 225 | Ga0105247_10254627 | 3300009101 | Bacteria | 1201 |
| 226 | Ga0105243_10352107 | 3300009148 | Bacteria | 1353 |
| 227 | Ga0105241_10006864 | 3300009174 | Bacteria | 8373 |
| 228 | Ga0105241_10050529 | 3300009174 | Bacteria | 3169 |
| 229 | Ga0105241_10724185 | 3300009174 | Bacteria | 910 |
| 230 | Ga0105241_12616200 | 3300009174 | Unclassified | 507 |
| 231 | Ga0105242_10618463 | 3300009176 | Bacteria | 1049 |
| 232 | Ga0105248_10054895 | 3300009177 | Bacteria | 4469 |
| 233 | Ga0105248_10204053 | 3300009177 | Bacteria | 2227 |
| 234 | Ga0105248_10324671 | 3300009177 | Unclassified | 1734 |
| 235 | Ga0105248_10963904 | 3300009177 | Bacteria | 963 |
| 236 | Ga0105248_12657598 | 3300009177 | Unclassified | 571 |
| 237 | Ga0105237_10131570 | 3300009545 | Bacteria | 2496 |
| 238 | Ga0105237_10405166 | 3300009545 | Bacteria | 1369 |
| 239 | Ga0105237_10668192 | 3300009545 | Unclassified | 1046 |
| 240 | Ga0105237_10741377 | 3300009545 | Bacteria | 989 |
| 241 | Ga0105238_10076815 | 3300009551 | Bacteria | 3332 |
| 242 | Ga0105238_10172498 | 3300009551 | Unclassified | 2139 |
| 243 | Ga0105238_10216871 | 3300009551 | Bacteria | 1890 |
| 244 | Ga0105238_10679853 | 3300009551 | Bacteria | 1041 |
| 245 | Ga0105249_10075147 | 3300009553 | Bacteria | 3129 |
| 246 | Ga0105249_10132946 | 3300009553 | Bacteria | 2377 |
| 247 | Ga0105249_10768278 | 3300009553 | Unclassified | 1026 |
| 248 | Ga0105239_12033777 | 3300010375 | Unclassified | 667 |
| 249 | Ga0105239_12048916 | 3300010375 | Bacteria | 665 |
| 250 | Ga0105246_10115057 | 3300011119 | Unclassified | 1983 |
| 251 | Ga0105246_10250395 | 3300011119 | Bacteria | 1405 |
| 252 | Ga0105246_10727833 | 3300011119 | Bacteria | 872 |
| 253 | Ga0157373_10047535 | 3300013100 | Bacteria | 3060 |
| 254 | Ga0157373_10280310 | 3300013100 | Unclassified | 1181 |
| 255 | Ga0157373_10333525 | 3300013100 | Bacteria | 1080 |
| 256 | Ga0157371_10020279 | 3300013102 | Bacteria | 4893 |
| 257 | Ga0157371_10217621 | 3300013102 | Bacteria | 1371 |
| 258 | Ga0157371_10319135 | 3300013102 | Bacteria | 1127 |
| 259 | Ga0157370_10145392 | 3300013104 | Bacteria | 2208 |
| 260 | Ga0157370_10170585 | 3300013104 | Bacteria | 2022 |
| 261 | Ga0157370_10898765 | 3300013104 | Unclassified | 804 |
| 262 | Ga0157369_10018318 | 3300013105 | Bacteria | 7852 |
| 263 | Ga0157369_10052728 | 3300013105 | Bacteria | 4399 |
| 264 | Ga0157369_10213452 | 3300013105 | Unclassified | 2022 |
| 265 | Ga0157369_10232498 | 3300013105 | Bacteria | 1927 |
| 266 | Ga0157369_12432064 | 3300013105 | Unclassified | 530 |
| 267 | Ga0157374_10000220 | 3300013296 | Bacteria | 52590 |
| 268 | Ga0157374_10000651 | 3300013296 | Bacteria | 30638 |
| 269 | Ga0157374_10185695 | 3300013296 | Bacteria | 2032 |
| 270 | Ga0157374_10225301 | 3300013296 | Unclassified | 1841 |
| 271 | Ga0157374_10268997 | 3300013296 | Bacteria | 1680 |
| 272 | Ga0157374_11130311 | 3300013296 | Unclassified | 804 |
| 273 | Ga0157374_11716836 | 3300013296 | Unclassified | 653 |
| 274 | Ga0157378_10005113 | 3300013297 | Bacteria | 11517 |
| 275 | Ga0157378_10117296 | 3300013297 | Bacteria | 2449 |
| 276 | Ga0157378_10334189 | 3300013297 | Bacteria | 1475 |
| 277 | Ga0157378_11243198 | 3300013297 | Bacteria | 785 |
| 278 | Ga0157378_11486821 | 3300013297 | Unclassified | 722 |
| 279 | Ga0163162_10024768 | 3300013306 | Bacteria | 5927 |
| 280 | Ga0157372_10003153 | 3300013307 | Bacteria | 17780 |
| 281 | Ga0157372_10007172 | 3300013307 | Bacteria | 11863 |
| 282 | Ga0157372_10017970 | 3300013307 | Bacteria | 7599 |
| 283 | Ga0157372_10037832 | 3300013307 | Bacteria | 5323 |
| 284 | Ga0157372_10040835 | 3300013307 | Bacteria | 5127 |
| 285 | Ga0157372_10111398 | 3300013307 | Bacteria | 3136 |
| 286 | Ga0157372_10124578 | 3300013307 | Unclassified | 2962 |
| 287 | Ga0157372_10223798 | 3300013307 | Bacteria | 2181 |
| 288 | Ga0157375_10260151 | 3300013308 | Unclassified | 1897 |
| 289 | Ga0157375_13203796 | 3300013308 | Unclassified | 546 |
| 290 | Ga0163163_10106153 | 3300014325 | Bacteria | 2834 |
| 291 | Ga0163163_10372763 | 3300014325 | Bacteria | 1485 |
| 292 | Ga0163163_11157554 | 3300014325 | Unclassified | 836 |
| 293 | Ga0157377_10634422 | 3300014745 | Unclassified | 767 |
| 294 | Ga0157379_10035997 | 3300014968 | Bacteria | 4414 |
| 295 | Ga0157379_10132288 | 3300014968 | Bacteria | 2246 |
| 296 | Ga0157379_11311158 | 3300014968 | Unclassified | 699 |
| 297 | Ga0157376_10096447 | 3300014969 | Bacteria | 2573 |
| 298 | Ga0157376_10466655 | 3300014969 | Bacteria | 1234 |
| 299 | Ga0157376_11136441 | 3300014969 | Bacteria | 808 |
| 300 | Ga0157376_11364676 | 3300014969 | Unclassified | 740 |
| 301 | Ga0182005_1271212 | 3300015265 | Unclassified | 530 |
| 302 | Ga0163161_10454079 | 3300017792 | Unclassified | 1036 |
| 303 | Ga0184602_100374 | 3300019161 | Unclassified | 626 |
| 304 | Ga0184602_108799 | 3300019161 | Unclassified | 610 |
| 305 | Ga0184602_109278 | 3300019161 | Unclassified | 584 |
| 306 | Ga0184602_116921 | 3300019161 | Unclassified | 664 |
| 307 | Ga0184602_126363 | 3300019161 | Unclassified | 542 |
| 308 | Ga0184602_132365 | 3300019161 | Bacteria | 1110 |
| 309 | Ga0184597_100518 | 3300019162 | Bacteria | 736 |
| 310 | Ga0184597_121182 | 3300019162 | Unclassified | 508 |
| 311 | Ga0184597_123989 | 3300019162 | Bacteria | 1053 |
| 312 | Ga0184597_128478 | 3300019162 | Unclassified | 537 |
| 313 | Ga0184595_109345 | 3300019166 | Unclassified | 627 |
| 314 | Ga0184595_110125 | 3300019166 | Bacteria | 500 |
| 315 | Ga0184595_125523 | 3300019166 | Unclassified | 641 |
| 316 | Ga0184595_126827 | 3300019166 | Bacteria | 877 |
| 317 | Ga0184598_101394 | 3300019182 | Unclassified | 530 |
| 318 | Ga0184598_119654 | 3300019182 | Unclassified | 635 |
| 319 | Ga0184598_126073 | 3300019182 | Unclassified | 875 |
| 320 | Ga0184598_130657 | 3300019182 | Unclassified | 618 |
| 321 | Ga0184598_137139 | 3300019182 | Unclassified | 534 |
| 322 | Ga0184598_139079 | 3300019182 | Unclassified | 530 |
| 323 | Ga0184601_101282 | 3300019183 | Bacteria | 1025 |
| 324 | Ga0184601_108513 | 3300019183 | Bacteria | 998 |
| 325 | Ga0184601_108906 | 3300019183 | Unclassified | 580 |
| 326 | Ga0184601_110771 | 3300019183 | Unclassified | 504 |
| 327 | Ga0184601_122462 | 3300019183 | Bacteria | 1430 |
| 328 | Ga0184601_133084 | 3300019183 | Unclassified | 507 |
| 329 | Ga0184599_106580 | 3300019188 | Unclassified | 507 |
| 330 | Ga0184599_110872 | 3300019188 | Bacteria | 720 |
| 331 | Ga0184599_113574 | 3300019188 | Unclassified | 565 |
| 332 | Ga0184599_123342 | 3300019188 | Unclassified | 606 |
| 333 | Ga0184599_126591 | 3300019188 | Unclassified | 581 |
| 334 | Ga0184599_151074 | 3300019188 | Unclassified | 888 |
| 335 | Ga0184599_152807 | 3300019188 | Unclassified | 503 |
| 336 | Ga0184600_110547 | 3300019190 | Bacteria | 1377 |
| 337 | Ga0184600_133038 | 3300019190 | Unclassified | 558 |
| 338 | Ga0184600_136576 | 3300019190 | Bacteria | 1631 |
| 339 | Ga0184600_146854 | 3300019190 | Unclassified | 544 |
| 340 | Ga0184603_102317 | 3300019192 | Bacteria | 1076 |
| 341 | Ga0184603_103961 | 3300019192 | Unclassified | 784 |
| 342 | Ga0184603_110016 | 3300019192 | Unclassified | 548 |
| 343 | Ga0184603_118243 | 3300019192 | Bacteria | 685 |
| 344 | Ga0184603_120553 | 3300019192 | Unclassified | 505 |
| 345 | Ga0184603_120588 | 3300019192 | Bacteria | 810 |
| 346 | Ga0184603_121057 | 3300019192 | Bacteria | 522 |
| 347 | Ga0184603_142816 | 3300019192 | Bacteria | 570 |
| 348 | Ga0184603_144489 | 3300019192 | Unclassified | 548 |
| 349 | Ga0184603_150214 | 3300019192 | Unclassified | 759 |
| 350 | Ga0224569_110195 | 3300022732 | Bacteria | 664 |
| 351 | Ga0247552_101551 | 3300023536 | Bacteria | 693 |
| 352 | Ga0247552_101942 | 3300023536 | Unclassified | 643 |
| 353 | Ga0247552_102588 | 3300023536 | Unclassified | 591 |
| 354 | Ga0247552_104144 | 3300023536 | Unclassified | 511 |
| 355 | Ga0247555_101795 | 3300023539 | Unclassified | 685 |
| 356 | Ga0247555_103058 | 3300023539 | Unclassified | 579 |
| 357 | Ga0247555_104449 | 3300023539 | Unclassified | 512 |
| 358 | Ga0247555_104770 | 3300023539 | Unclassified | 501 |
| 359 | Ga0247554_101396 | 3300023547 | Unclassified | 828 |
| 360 | Ga0247554_103171 | 3300023547 | Bacteria | 638 |
| 361 | Ga0247554_104024 | 3300023547 | Unclassified | 589 |
| 362 | Ga0247554_104735 | 3300023547 | Unclassified | 564 |
| 363 | Ga0247554_106513 | 3300023547 | Bacteria | 507 |
| 364 | Ga0247551_100239 | 3300023552 | Bacteria | 1390 |
| 365 | Ga0247521_115859 | 3300023557 | Unclassified | 580 |
| 366 | Ga0247518_113452 | 3300023561 | Unclassified | 782 |
| 367 | Ga0247550_102062 | 3300023660 | Unclassified | 672 |
| 368 | Ga0247550_104570 | 3300023660 | Bacteria | 529 |
| 369 | Ga0247553_100978 | 3300023672 | Bacteria | 1154 |
| 370 | Ga0247553_102120 | 3300023672 | Unclassified | 901 |
| 371 | Ga0247553_104896 | 3300023672 | Unclassified | 688 |
| 372 | Ga0247553_105340 | 3300023672 | Unclassified | 666 |
| 373 | Ga0247553_105758 | 3300023672 | Bacteria | 649 |
| 374 | Ga0247553_109254 | 3300023672 | Unclassified | 556 |
| 375 | Ga0247553_110308 | 3300023672 | Unclassified | 537 |
| 376 | Ga0247553_110626 | 3300023672 | Unclassified | 531 |
| 377 | Ga0247553_111073 | 3300023672 | Unclassified | 524 |
| 378 | Ga0247522_117633 | 3300023688 | Bacteria | 550 |
| 379 | Ga0224572_1056960 | 3300024225 | Bacteria | 725 |
| 380 | Ga0228598_1006492 | 3300024227 | Bacteria | 2418 |
| 381 | Ga0228598_1009719 | 3300024227 | Unclassified | 1923 |
| 382 | Ga0228598_1010436 | 3300024227 | Bacteria | 1850 |
| 383 | Ga0228598_1035664 | 3300024227 | Unclassified | 980 |
| 384 | Ga0228598_1099922 | 3300024227 | Unclassified | 585 |
| 385 | Ga0207656_10696329 | 3300025321 | Unclassified | 520 |
| 386 | Ga0207692_10068918 | 3300025898 | Bacteria | 1857 |
| 387 | Ga0207692_10324751 | 3300025898 | Bacteria | 943 |
| 388 | Ga0207692_10325487 | 3300025898 | Unclassified | 942 |
| 389 | Ga0207692_10371862 | 3300025898 | Unclassified | 885 |
| 390 | Ga0207642_10003203 | 3300025899 | Bacteria | 5132 |
| 391 | Ga0207642_10030408 | 3300025899 | Bacteria | 2249 |
| 392 | Ga0207642_10272744 | 3300025899 | Bacteria | 969 |
| 393 | Ga0207710_10078561 | 3300025900 | Bacteria | 1527 |
| 394 | Ga0207710_10270089 | 3300025900 | Unclassified | 854 |
| 395 | Ga0207688_10548027 | 3300025901 | Bacteria | 727 |
| 396 | Ga0207688_10811397 | 3300025901 | Unclassified | 593 |
| 397 | Ga0207680_10773694 | 3300025903 | Unclassified | 688 |
| 398 | Ga0207647_10015305 | 3300025904 | Bacteria | 5262 |
| 399 | Ga0207647_10066997 | 3300025904 | Unclassified | 2177 |
| 400 | Ga0207647_10127224 | 3300025904 | Bacteria | 1499 |
| 401 | Ga0207699_10042831 | 3300025906 | Bacteria | 2626 |
| 402 | Ga0207699_10093294 | 3300025906 | Bacteria | 1894 |
| 403 | Ga0207699_10171735 | 3300025906 | Unclassified | 1451 |
| 404 | Ga0207699_10383332 | 3300025906 | Unclassified | 998 |
| 405 | Ga0207699_10551710 | 3300025906 | Unclassified | 836 |
| 406 | Ga0207699_10692764 | 3300025906 | Unclassified | 746 |
| 407 | Ga0207645_10721898 | 3300025907 | Unclassified | 677 |
| 408 | Ga0207643_10153211 | 3300025908 | Bacteria | 1383 |
| 409 | Ga0207684_10034078 | 3300025910 | Bacteria | 4328 |
| 410 | Ga0207684_10083180 | 3300025910 | Bacteria | 2726 |
| 411 | Ga0207684_10117663 | 3300025910 | Bacteria | 2277 |
| 412 | Ga0207654_10004095 | 3300025911 | Bacteria | 7345 |
| 413 | Ga0207654_10005110 | 3300025911 | Bacteria | 6621 |
| 414 | Ga0207654_10030496 | 3300025911 | Bacteria | 2960 |
| 415 | Ga0207654_10042405 | 3300025911 | Bacteria | 2575 |
| 416 | Ga0207654_10288527 | 3300025911 | Bacteria | 1112 |
| 417 | Ga0207707_10049910 | 3300025912 | Bacteria | 3646 |
| 418 | Ga0207707_10205514 | 3300025912 | Bacteria | 1716 |
| 419 | Ga0207707_10341380 | 3300025912 | Unclassified | 1291 |
| 420 | Ga0207707_11224118 | 3300025912 | Unclassified | 607 |
| 421 | Ga0207695_10124252 | 3300025913 | Bacteria | 2545 |
| 422 | Ga0207695_10204406 | 3300025913 | Bacteria | 1888 |
| 423 | Ga0207695_10376133 | 3300025913 | Bacteria | 1306 |
| 424 | Ga0207695_10971980 | 3300025913 | Unclassified | 729 |
| 425 | Ga0207671_10019302 | 3300025914 | Bacteria | 5214 |
| 426 | Ga0207671_10073107 | 3300025914 | Bacteria | 2560 |
| 427 | Ga0207693_10063354 | 3300025915 | Bacteria | 2896 |
| 428 | Ga0207693_10150425 | 3300025915 | Bacteria | 1831 |
| 429 | Ga0207693_10342662 | 3300025915 | Bacteria | 1170 |
| 430 | Ga0207693_10422591 | 3300025915 | Bacteria | 1042 |
| 431 | Ga0207693_10566944 | 3300025915 | Bacteria | 885 |
| 432 | Ga0207663_10167412 | 3300025916 | Bacteria | 1558 |
| 433 | Ga0207663_10312147 | 3300025916 | Unclassified | 1179 |
| 434 | Ga0207663_11182698 | 3300025916 | Unclassified | 615 |
| 435 | Ga0207663_11270594 | 3300025916 | Unclassified | 593 |
| 436 | Ga0207663_11425644 | 3300025916 | Unclassified | 558 |
| 437 | Ga0207660_10999454 | 3300025917 | Unclassified | 682 |
| 438 | Ga0207662_10273103 | 3300025918 | Bacteria | 1116 |
| 439 | Ga0207662_10701322 | 3300025918 | Bacteria | 709 |
| 440 | Ga0207657_10050639 | 3300025919 | Unclassified | 3614 |
| 441 | Ga0207649_10121620 | 3300025920 | Bacteria | 1761 |
| 442 | Ga0207652_10331131 | 3300025921 | Bacteria | 1375 |
| 443 | Ga0207652_10570512 | 3300025921 | Bacteria | 1016 |
| 444 | Ga0207652_11195957 | 3300025921 | Unclassified | 662 |
| 445 | Ga0207646_10407109 | 3300025922 | Bacteria | 1228 |
| 446 | Ga0207646_10770003 | 3300025922 | Bacteria | 858 |
| 447 | Ga0207681_10190870 | 3300025923 | Unclassified | 1567 |
| 448 | Ga0207694_10091140 | 3300025924 | Bacteria | 2406 |
| 449 | Ga0207694_10348131 | 3300025924 | Unclassified | 1226 |
| 450 | Ga0207650_10018008 | 3300025925 | Bacteria | 4951 |
| 451 | Ga0207650_10018028 | 3300025925 | Bacteria | 4948 |
| 452 | Ga0207687_10027523 | 3300025927 | Bacteria | 3815 |
| 453 | Ga0207687_10149308 | 3300025927 | Bacteria | 1781 |
| 454 | Ga0207700_10052379 | 3300025928 | Bacteria | 3051 |
| 455 | Ga0207700_10096532 | 3300025928 | Bacteria | 2347 |
| 456 | Ga0207700_10783784 | 3300025928 | Unclassified | 852 |
| 457 | Ga0207664_10011365 | 3300025929 | Bacteria | 6324 |
| 458 | Ga0207664_10036879 | 3300025929 | Unclassified | 3780 |
| 459 | Ga0207664_10083055 | 3300025929 | Bacteria | 2610 |
| 460 | Ga0207664_10287741 | 3300025929 | Bacteria | 1443 |
| 461 | Ga0207664_10501418 | 3300025929 | Unclassified | 1087 |
| 462 | Ga0207664_10917807 | 3300025929 | Unclassified | 786 |
| 463 | Ga0207664_10983754 | 3300025929 | Bacteria | 756 |
| 464 | Ga0207644_10832027 | 3300025931 | Unclassified | 773 |
| 465 | Ga0207690_10185830 | 3300025932 | Bacteria | 1568 |
| 466 | Ga0207706_10000938 | 3300025933 | Bacteria | 29806 |
| 467 | Ga0207706_10041125 | 3300025933 | Unclassified | 4099 |
| 468 | Ga0207706_11155806 | 3300025933 | Unclassified | 645 |
| 469 | Ga0207686_10102472 | 3300025934 | Bacteria | 1914 |
| 470 | Ga0207709_10845494 | 3300025935 | Bacteria | 741 |
| 471 | Ga0207669_10671314 | 3300025937 | Bacteria | 849 |
| 472 | Ga0207704_10219972 | 3300025938 | Bacteria | 1404 |
| 473 | Ga0207704_11920812 | 3300025938 | Unclassified | 509 |
| 474 | Ga0207665_10002589 | 3300025939 | Bacteria | 12159 |
| 475 | Ga0207665_10060373 | 3300025939 | Unclassified | 2568 |
| 476 | Ga0207665_10167419 | 3300025939 | Bacteria | 1585 |
| 477 | Ga0207665_10184404 | 3300025939 | Bacteria | 1513 |
| 478 | Ga0207665_10228926 | 3300025939 | Bacteria | 1365 |
| 479 | Ga0207665_10279457 | 3300025939 | Bacteria | 1242 |
| 480 | Ga0207665_10681859 | 3300025939 | Unclassified | 807 |
| 481 | Ga0207665_10844978 | 3300025939 | Bacteria | 725 |
| 482 | Ga0207665_11029975 | 3300025939 | Unclassified | 655 |
| 483 | Ga0207691_11392628 | 3300025940 | Unclassified | 576 |
| 484 | Ga0207711_10023112 | 3300025941 | Bacteria | 5206 |
| 485 | Ga0207711_10268750 | 3300025941 | Bacteria | 1568 |
| 486 | Ga0207711_11237026 | 3300025941 | Unclassified | 688 |
| 487 | Ga0207711_11317925 | 3300025941 | Unclassified | 664 |
| 488 | Ga0207689_10083777 | 3300025942 | Bacteria | 2621 |
| 489 | Ga0207689_10105283 | 3300025942 | Bacteria | 2318 |
| 490 | Ga0207689_11048010 | 3300025942 | Bacteria | 688 |
| 491 | Ga0207661_10268400 | 3300025944 | Bacteria | 1522 |
| 492 | Ga0207661_11891372 | 3300025944 | Unclassified | 542 |
| 493 | Ga0207679_10020124 | 3300025945 | Bacteria | 4499 |
| 494 | Ga0207679_10461433 | 3300025945 | Bacteria | 1128 |
| 495 | Ga0207679_10654565 | 3300025945 | Bacteria | 950 |
| 496 | Ga0207667_10035572 | 3300025949 | Bacteria | 5342 |
| 497 | Ga0207667_10064682 | 3300025949 | Bacteria | 3817 |
| 498 | Ga0207667_10453745 | 3300025949 | Unclassified | 1302 |
| 499 | Ga0207667_12252808 | 3300025949 | Unclassified | 501 |
| 500 | Ga0207712_10524590 | 3300025961 | Bacteria | 1015 |
| 501 | Ga0207668_10039426 | 3300025972 | Bacteria | 3179 |
| 502 | Ga0207640_10008577 | 3300025981 | Bacteria | 5677 |
| 503 | Ga0207640_11175890 | 3300025981 | Unclassified | 681 |
| 504 | Ga0207640_11580815 | 3300025981 | Unclassified | 590 |
| 505 | Ga0207658_10793513 | 3300025986 | Unclassified | 859 |
| 506 | Ga0207677_10051768 | 3300026023 | Bacteria | 2786 |
| 507 | Ga0207677_10110735 | 3300026023 | Bacteria | 2044 |
| 508 | Ga0207677_10267010 | 3300026023 | Bacteria | 1398 |
| 509 | Ga0207677_10846893 | 3300026023 | Unclassified | 821 |
| 510 | Ga0207703_10075459 | 3300026035 | Bacteria | 2794 |
| 511 | Ga0207703_10648843 | 3300026035 | Bacteria | 1001 |
| 512 | Ga0207703_10981428 | 3300026035 | Bacteria | 810 |
| 513 | Ga0207639_10215395 | 3300026041 | Bacteria | 1656 |
| 514 | Ga0207639_10506981 | 3300026041 | Bacteria | 1103 |
| 515 | Ga0207678_10001163 | 3300026067 | Bacteria | 24104 |
| 516 | Ga0207702_10008794 | 3300026078 | Bacteria | 8512 |
| 517 | Ga0207702_10038005 | 3300026078 | Bacteria | 4032 |
| 518 | Ga0207702_10038861 | 3300026078 | Bacteria | 3986 |
| 519 | Ga0207702_10141070 | 3300026078 | Bacteria | 2180 |
| 520 | Ga0207702_10150679 | 3300026078 | Bacteria | 2115 |
| 521 | Ga0207702_11111564 | 3300026078 | Unclassified | 784 |
| 522 | Ga0207641_10359114 | 3300026088 | Unclassified | 1390 |
| 523 | Ga0207641_10411037 | 3300026088 | Bacteria | 1301 |
| 524 | Ga0207648_10043729 | 3300026089 | Unclassified | 3932 |
| 525 | Ga0207648_10134557 | 3300026089 | Bacteria | 2177 |
| 526 | Ga0207648_10171854 | 3300026089 | Bacteria | 1916 |
| 527 | Ga0207648_10375318 | 3300026089 | Unclassified | 1285 |
| 528 | Ga0207676_10015126 | 3300026095 | Bacteria | 5565 |
| 529 | Ga0207676_10144866 | 3300026095 | Unclassified | 2039 |
| 530 | Ga0207676_10232636 | 3300026095 | Bacteria | 1648 |
| 531 | Ga0207676_11849964 | 3300026095 | Unclassified | 602 |
| 532 | Ga0207674_10005128 | 3300026116 | Bacteria | 15632 |
| 533 | Ga0207674_10008169 | 3300026116 | Bacteria | 12137 |
| 534 | Ga0207674_10649249 | 3300026116 | Bacteria | 1019 |
| 535 | Ga0207675_100238944 | 3300026118 | Bacteria | 1755 |
| 536 | Ga0207675_100239976 | 3300026118 | Unclassified | 1751 |
| 537 | Ga0207683_10064946 | 3300026121 | Bacteria | 3217 |
| 538 | Ga0207683_11857335 | 3300026121 | Unclassified | 551 |
| 539 | Ga0207698_10057352 | 3300026142 | Bacteria | 3013 |
| 540 | Ga0207698_11522824 | 3300026142 | Unclassified | 684 |
| 541 | Ga0265358_100623 | 3300028010 | Unclassified | 920 |
| 542 | Ga0265354_1013449 | 3300028016 | Bacteria | 776 |
| 543 | Ga0265357_1003484 | 3300028023 | Unclassified | 1366 |
| 544 | Ga0265357_1024382 | 3300028023 | Unclassified | 674 |
| 545 | Ga0265355_1010589 | 3300028036 | Unclassified | 752 |
| 546 | Ga0268266_11558908 | 3300028379 | Unclassified | 636 |
| 547 | Ga0268265_10050090 | 3300028380 | Unclassified | 3145 |
| 548 | Ga0268265_10150018 | 3300028380 | Bacteria | 1965 |
| 549 | Ga0268264_10029448 | 3300028381 | Bacteria | 4497 |
| 550 | Ga0268264_10155256 | 3300028381 | Unclassified | 2056 |
| 551 | Ga0265336_10086578 | 3300028666 | Bacteria | 934 |
| 552 | Ga0265336_10110129 | 3300028666 | Unclassified | 820 |
| 553 | Ga0265338_10000548 | 3300028800 | Bacteria | 65821 |
| 554 | Ga0265338_10151773 | 3300028800 | Bacteria | 1799 |
| 555 | Ga0265338_10699631 | 3300028800 | Unclassified | 699 |
| 556 | Ga0265762_1005353 | 3300030760 | Bacteria | 2299 |
| 557 | Ga0265762_1138310 | 3300030760 | Unclassified | 570 |
| 558 | Ga0265775_107506 | 3300030762 | Unclassified | 655 |
| 559 | Ga0265775_112300 | 3300030762 | Unclassified | 553 |
| 560 | Ga0265763_1017738 | 3300030763 | Unclassified | 724 |
| 561 | Ga0265763_1020358 | 3300030763 | Unclassified | 693 |
| 562 | Ga0265763_1024361 | 3300030763 | Unclassified | 655 |
| 563 | Ga0265763_1055503 | 3300030763 | Unclassified | 507 |
| 564 | Ga0265777_101768 | 3300030877 | Unclassified | 1195 |
| 565 | Ga0265777_114530 | 3300030877 | Unclassified | 608 |
| 566 | Ga0265770_1001245 | 3300030878 | Bacteria | 3527 |
| 567 | Ga0265765_1000221 | 3300030879 | Bacteria | 3990 |
| 568 | Ga0265765_1040034 | 3300030879 | Bacteria | 620 |
| 569 | Ga0265776_107123 | 3300030880 | Unclassified | 614 |
| 570 | Ga0265776_112111 | 3300030880 | Unclassified | 525 |
| 571 | Ga0265764_110310 | 3300030882 | Unclassified | 587 |
| 572 | Ga0265764_111805 | 3300030882 | Unclassified | 568 |
| 573 | Ga0265764_115465 | 3300030882 | Unclassified | 523 |
| 574 | Ga0265769_119810 | 3300030888 | Unclassified | 528 |
| 575 | Ga0265761_104315 | 3300030889 | Unclassified | 720 |
| 576 | Ga0265761_110294 | 3300030889 | Bacteria | 542 |
| 577 | Ga0265761_111343 | 3300030889 | Unclassified | 524 |
| 578 | Ga0265771_1014385 | 3300031010 | Unclassified | 625 |
| 579 | Ga0265773_1031893 | 3300031018 | Unclassified | 570 |
| 580 | Ga0265779_114368 | 3300031043 | Unclassified | 514 |
| 581 | Ga0265760_10079574 | 3300031090 | Unclassified | 1014 |
| 582 | Ga0265760_10100841 | 3300031090 | Unclassified | 912 |
| 583 | Ga0265760_10102408 | 3300031090 | Bacteria | 906 |
| 584 | Ga0265760_10137668 | 3300031090 | Unclassified | 793 |
| 585 | Ga0265760_10157182 | 3300031090 | Unclassified | 748 |
| 586 | Ga0265760_10202121 | 3300031090 | Bacteria | 671 |
| 587 | Ga0265760_10240723 | 3300031090 | Unclassified | 623 |
| 588 | Ga0265760_10337487 | 3300031090 | Unclassified | 538 |
| 589 | Ga0265760_10392212 | 3300031090 | Unclassified | 500 |
| 590 | Ga0265330_10235770 | 3300031235 | Bacteria | 772 |
| 591 | Ga0265325_10310990 | 3300031241 | Unclassified | 702 |
| 592 | Ga0265340_10174941 | 3300031247 | Unclassified | 972 |
| 593 | Ga0265340_10425123 | 3300031247 | Unclassified | 586 |
| 594 | Ga0265339_10055600 | 3300031249 | Bacteria | 2146 |
| 595 | Ga0265339_10097496 | 3300031249 | Bacteria | 1534 |
| 596 | Ga0265339_10220499 | 3300031249 | Unclassified | 928 |
| 597 | Ga0265339_10245596 | 3300031249 | Unclassified | 868 |
| 598 | Ga0265339_10361938 | 3300031249 | Unclassified | 682 |
| 599 | Ga0265316_10023942 | 3300031344 | Bacteria | 5128 |
| 600 | Ga0265316_10080086 | 3300031344 | Bacteria | 2505 |
| 601 | Ga0265316_10095823 | 3300031344 | Bacteria | 2260 |
| 602 | Ga0265316_10639825 | 3300031344 | Bacteria | 752 |
| 603 | Ga0265316_11200831 | 3300031344 | Unclassified | 525 |
| 604 | Ga0310117_127002 | 3300031592 | Unclassified | 561 |
| 605 | Ga0310103_132860 | 3300031614 | Unclassified | 618 |
| 606 | Ga0310119_131841 | 3300031686 | Unclassified | 543 |
| 607 | Ga0265314_10065555 | 3300031711 | Bacteria | 2453 |
| 608 | Ga0265314_10116705 | 3300031711 | Bacteria | 1687 |
| 609 | Ga0265314_10257183 | 3300031711 | Bacteria | 999 |
| 610 | Ga0265314_10334652 | 3300031711 | Unclassified | 838 |
| 611 | Ga0316044_131221 | 3300031810 | Unclassified | 510 |
| 612 | Ga0316053_102785 | 3300032120 | Bacteria | 1007 |
| 613 | Ga0316053_104542 | 3300032120 | Bacteria | 858 |
| 614 | Ga0316053_106766 | 3300032120 | Unclassified | 752 |
| 615 | Ga0316053_109680 | 3300032120 | Unclassified | 664 |
| 616 | Ga0316053_110154 | 3300032120 | Unclassified | 653 |
| 617 | Ga0316053_111644 | 3300032120 | Unclassified | 623 |
| 618 | Ga0316053_115686 | 3300032120 | Unclassified | 565 |
| 619 | Ga0316053_118810 | 3300032120 | Unclassified | 531 |
| 620 | Ga0316053_120060 | 3300032120 | Unclassified | 520 |
| 621 | Ga0316215_1023045 | 3300033544 | Bacteria | 637 |
| 622 | Ga0373930_0124914 | 3300034816 | Unclassified | 629 |
| 623 | Ga0373948_0009021 | 3300034817 | Bacteria | 1712 |
| 624 | Ga0373959_0078847 | 3300034820 | Unclassified | 756 |
| 625 | Ga0373926_0009017 | 3300035083 | Bacteria | 3327 |
| 626 | Ga0373926_0066188 | 3300035083 | Unclassified | 1323 |
| 627 | Ga0373934_0166657 | 3300035086 | Bacteria | 904 |
| 628 | Ga0373940_0085567 | 3300035088 | Unclassified | 938 |
| 629 | Ga0373923_0068918 | 3300035111 | Bacteria | 1516 |
| 630 | Ga0373923_0299702 | 3300035111 | Unclassified | 760 |
| 631 | Ga0373923_0521451 | 3300035111 | Unclassified | 581 |
| 632 | Ga0373932_0133840 | 3300035112 | Bacteria | 838 |
| 633 | Ga0373932_0156212 | 3300035112 | Bacteria | 786 |
| 634 | Ga0373936_0041664 | 3300035113 | Bacteria | 1842 |
| 635 | Ga0373936_0157955 | 3300035113 | Unclassified | 986 |
| 636 | Ga0373936_0309565 | 3300035113 | Unclassified | 714 |
| 637 | Ga0373941_0328507 | 3300035115 | Unclassified | 617 |
| 638 | Ga0373945_0381252 | 3300035116 | Unclassified | 616 |
| 639 | Ga0373953_0511381 | 3300035117 | Bacteria | 533 |
| 640 | Ga0373954_0422356 | 3300035118 | Bacteria | 660 |
| 641 | Ga0373954_0602092 | 3300035118 | Unclassified | 545 |
| 642 | Ga0373956_0083149 | 3300035119 | Bacteria | 1471 |
| 643 | Ga0373943_0126193 | 3300035170 | Bacteria | 1365 |
| 644 | Ga0373943_0226707 | 3300035170 | Unclassified | 1043 |
| 645 | Ga0373943_0283323 | 3300035170 | Bacteria | 937 |
| 646 | Ga0373946_0077075 | 3300035171 | Bacteria | 1452 |
| 647 | Ga0373946_0317909 | 3300035171 | Unclassified | 773 |
| 648 | Ga0373942_0133106 | 3300035207 | Unclassified | 786 |
| 649 | Ga0373942_0351832 | 3300035207 | Unclassified | 521 |
| 650 | Ga0373961_0077805 | 3300035241 | Bacteria | 1038 |
| 651 | Ga0373962_0195980 | 3300035242 | Unclassified | 682 |
| 652 | Ga0373924_0065874 | 3300035410 | Bacteria | 1522 |
| 653 | Ga0373924_0259534 | 3300035410 | Unclassified | 770 |
| 654 | Ga0373924_0325713 | 3300035410 | Unclassified | 684 |
| 655 | Ga0373931_0103539 | 3300035691 | Bacteria | 1605 |
| 656 | Ga0373931_0413088 | 3300035691 | Bacteria | 856 |
| 657 | Ga0373931_1034571 | 3300035691 | Unclassified | 557 |
| 658 | Ga0373935_0008382 | 3300035692 | Bacteria | 6186 |
| 659 | Ga0373935_0045842 | 3300035692 | Unclassified | 2760 |
| 660 | Ga0373935_0049468 | 3300035692 | Bacteria | 2664 |
| 661 | Ga0373935_0071396 | 3300035692 | Bacteria | 2240 |
| 662 | Ga0373927_0199335 | 3300035695 | Archaea | 1314 |
| 663 | Ga0373927_0213330 | 3300035695 | Bacteria | 1268 |
| 664 | Ga0373927_0266331 | 3300035695 | Bacteria | 1127 |
| 665 | Ga0373927_0381120 | 3300035695 | Unclassified | 930 |
| 666 | Ga0373933_0103988 | 3300035724 | Bacteria | 1765 |
| 667 | Ga0373947_0079988 | 3300035725 | Bacteria | 2021 |
| 668 | Ga0373947_0150430 | 3300035725 | Bacteria | 1499 |
| 669 | Ga0373947_0286789 | 3300035725 | Unclassified | 1095 |
| 670 | Ga0373947_0673889 | 3300035725 | Unclassified | 705 |
| 671 | Ga0373947_0743332 | 3300035725 | Unclassified | 669 |
| 672 | Ga0373937_0241478 | 3300036401 | Bacteria | 1702 |
| 673 | Ga0265778_004395 | 3300036457 | Unclassified | 1457 |
| 674 | Ga0265778_011184 | 3300036457 | Bacteria | 1031 |
| 675 | Ga0265778_018949 | 3300036457 | Bacteria | 839 |
| 676 | Ga0265778_019562 | 3300036457 | Bacteria | 828 |
| 677 | Ga0265778_035222 | 3300036457 | Unclassified | 657 |
| 678 | Ga0265778_038692 | 3300036457 | Unclassified | 632 |
| 679 | Ga0265778_043768 | 3300036457 | Unclassified | 601 |
| 680 | Ga0265778_062363 | 3300036457 | Unclassified | 522 |
| 681 | Ga0373925_0039806 | 3300037068 | Bacteria | 3478 |
| 682 | Ga0373925_0066203 | 3300037068 | Bacteria | 2723 |
| 683 | Ga0373925_0150565 | 3300037068 | Bacteria | 1827 |
| 684 | Ga0373925_0403947 | 3300037068 | Bacteria | 1114 |
| 685 | Ga0395898_1167745 | 3300037466 | Bacteria | 702 |
| 686 | Ga0395905_1672641 | 3300037471 | Bacteria | 542 |
| 687 | Ga0242420_009180 | 3300038996 | Bacteria | 1619 |
| 688 | Ga0451839_0187844 | 3300041496 | Unclassified | 794 |
| 689 | Ga0453684_1586424 | 3300044712 | Unclassified | 672 |
| 690 | Ga0451576_2477926 | 3300045051 | Unclassified | 530 |
| 691 | Ga0495629_0016777 | 3300046459 | Bacteria | 5256 |
| 692 | Ga0495580_0013176 | 3300046472 | Bacteria | 6326 |
| 693 | Ga0495580_0023716 | 3300046472 | Bacteria | 4500 |
| 694 | Ga0495580_0035807 | 3300046472 | Bacteria | 3568 |
| 695 | Ga0495580_0057307 | 3300046472 | Bacteria | 2742 |
| 696 | Ga0495580_0101015 | 3300046472 | Unclassified | 2006 |
| 697 | Ga0495580_0202840 | 3300046472 | Unclassified | 1366 |
| 698 | Ga0495580_0850932 | 3300046472 | Unclassified | 589 |
| 699 | Ga0495582_0008490 | 3300046473 | Bacteria | 5667 |
| 700 | Ga0495582_0381389 | 3300046473 | Unclassified | 812 |
| 701 | Ga0495605_0063534 | 3300046474 | Unclassified | 1761 |
| 702 | Ga0495662_0197028 | 3300046476 | Unclassified | 993 |
| 703 | Ga0495664_0053805 | 3300046477 | Unclassified | 2393 |
| 704 | Ga0495585_0015098 | 3300046492 | Unclassified | 4489 |
| 705 | Ga0495594_0057430 | 3300046499 | Bacteria | 2149 |
| 706 | Ga0495594_0292839 | 3300046499 | Bacteria | 927 |
| 707 | Ga0495596_0018336 | 3300046500 | Unclassified | 2885 |
| 708 | Ga0495607_0111954 | 3300046501 | Unclassified | 1446 |
| 709 | Ga0495583_0179398 | 3300046506 | Unclassified | 867 |
| 710 | Ga0495628_0841461 | 3300046516 | Unclassified | 640 |
| 711 | Ga0495630_0102518 | 3300046517 | Bacteria | 2165 |
| 712 | Ga0495630_1510750 | 3300046517 | Bacteria | 504 |
| 713 | Ga0495631_0069664 | 3300046518 | Unclassified | 1521 |
| 714 | Ga0495644_0000061 | 3300046523 | Bacteria | 52435 |
| 715 | Ga0495665_0016298 | 3300046531 | Unclassified | 4004 |
| 716 | Ga0495665_0403704 | 3300046531 | Bacteria | 693 |
| 717 | Ga0495640_0811536 | 3300046533 | Bacteria | 557 |
| 718 | Ga0495586_0490391 | 3300046535 | Unclassified | 709 |
| 719 | Ga0495609_0031684 | 3300046538 | Bacteria | 2402 |
| 720 | Ga0495622_0072311 | 3300046557 | Bacteria | 1591 |
| 721 | Ga0495633_0254641 | 3300046558 | Bacteria | 801 |
| 722 | Ga0495625_0031434 | 3300046660 | Unclassified | 3949 |
| 723 | Ga0495659_0015011 | 3300046664 | Bacteria | 2543 |
| 724 | Ga0495599_0240464 | 3300046678 | Unclassified | 1104 |
| 725 | Ga0495623_0039903 | 3300046679 | Bacteria | 2998 |
| 726 | Ga0495669_0052566 | 3300046684 | Bacteria | 1831 |
| 727 | Ga0495669_0313139 | 3300046684 | Unclassified | 757 |
| 728 | Ga0495613_0001990 | 3300046689 | Bacteria | 15512 |
| 729 | Ga0495624_0195028 | 3300046690 | Bacteria | 1231 |
| 730 | Ga0495624_0246217 | 3300046690 | Archaea | 1081 |
| 731 | Ga0495624_0518755 | 3300046690 | Unclassified | 712 |
| 732 | Ga0495670_0080969 | 3300046691 | Unclassified | 1654 |
| 733 | Ga0495600_0164823 | 3300046809 | Bacteria | 1432 |
| 734 | Ga0495581_0037561 | 3300047315 | Bacteria | 2803 |
| 735 | Ga0495636_0140118 | 3300047318 | Bacteria | 1080 |
| 736 | Ga0495636_0155120 | 3300047318 | Unclassified | 1029 |
| 737 | Ga0495674_0935412 | 3300047319 | Unclassified | 667 |
| 738 | Ga0495676_0108981 | 3300047321 | Unclassified | 2036 |
| 739 | Ga0495680_0960794 | 3300047322 | Unclassified | 548 |
| 740 | Ga0495677_0013494 | 3300047445 | Unclassified | 2975 |
| 741 | Ga0495685_054807 | 3300047447 | Unclassified | 1349 |
| 742 | Ga0495593_0305384 | 3300047673 | Bacteria | 796 |
| 743 | Ga0495602_1014416 | 3300048088 | Bacteria | 547 |
| 744 | Ga0495614_0001727 | 3300048089 | Bacteria | 9544 |
| 745 | Ga0495615_0056789 | 3300048090 | Unclassified | 1023 |
| 746 | Ga0496100_1149124 | 3300048903 | Bacteria | 612 |
| 747 | Ga0496101_1079986 | 3300048904 | Unclassified | 630 |
| 748 | Ga0496102_0134676 | 3300048905 | Bacteria | 2314 |
| 749 | Ga0496103_0061903 | 3300048906 | Bacteria | 2329 |
| 750 | Ga0496104_0391266 | 3300048907 | Bacteria | 1302 |
| 751 | Ga0496106_0227032 | 3300048909 | Bacteria | 1490 |
| 752 | Ga0496107_1107228 | 3300048910 | Unclassified | 572 |
| 753 | Ga0496108_0715482 | 3300048911 | Unclassified | 868 |
| 754 | Ga0496108_0918386 | 3300048911 | Unclassified | 751 |
| 755 | Ga0496109_0111254 | 3300048912 | Bacteria | 2547 |
| 756 | Ga0496111_0986128 | 3300048914 | Bacteria | 604 |
| 757 | Ga0496112_0128262 | 3300048915 | Bacteria | 2507 |
| 758 | Ga0496112_0131889 | 3300048915 | Bacteria | 2470 |
| 759 | Ga0496112_0291574 | 3300048915 | Unclassified | 1578 |
| 760 | Ga0496112_0473985 | 3300048915 | Unclassified | 1189 |
| 761 | Ga0496112_1010782 | 3300048915 | Unclassified | 751 |
| 762 | Ga0496112_1237321 | 3300048915 | Unclassified | 663 |
| 763 | Ga0496112_1448838 | 3300048915 | Unclassified | 601 |
| 764 | Ga0496113_0558053 | 3300048916 | Unclassified | 918 |
| 765 | Ga0496114_0292286 | 3300048917 | Bacteria | 1438 |
| 766 | Ga0496115_0083064 | 3300048918 | Bacteria | 2611 |
| 767 | nmdc:mga0n895_145741_c1 | 3300050512 | Unclassified | 2397 |
| 768 | nmdc:mga0n895_309813_c1 | 3300050512 | Bacteria | 1600 |
| 769 | nmdc:mga0n895_56125_c1 | 3300050512 | Bacteria | 3879 |
| 770 | nmdc:mga0rr50_1490518_c1 | 3300050513 | Unclassified | 572 |
| 771 | nmdc:mga0rr50_41020_c2 | 3300050513 | Bacteria | 2871 |
| 772 | nmdc:mga08x19_1071639_c1 | 3300050514 | Unclassified | 572 |
| 773 | nmdc:mga08x19_1846_c1 | 3300050514 | Bacteria | 12979 |
| 774 | Ga0495601_0150382 | 3300053077 | Bacteria | 1520 |
| 775 | Ga0587093_090739 | 3300059478 | Unclassified | 540 |
| 776 | Ga0587088_173574 | 3300059508 | Unclassified | 536 |
| 777 | Ga0587091_199471 | 3300059511 | Unclassified | 536 |
| 778 | Ga0587125_066665 | 3300059607 | Unclassified | 536 |
| 779 | Ga0587117_043574 | 3300059627 | Unclassified | 723 |
| 780 | Ga0587122_027423 | 3300059628 | Unclassified | 654 |
| 781 | Ga0587114_136486 | 3300059655 | Unclassified | 509 |
| 782 | Ga0070698_100875243 | |||
| 783 | JGI24739J22299_10241925 | |||
| 784 | JGI24737J22298_10044638 | |||
| 785 | JGI24737J22298_10159255 | |||
| 786 | Ga0065712_10094390 | |||
| 787 | Ga0065715_10023259 | |||
| 788 | Ga0070676_10103108 | |||
| 789 | Ga0070676_11204077 | |||
| 790 | Ga0070683_100856737 | |||
| 791 | Ga0070683_101765720 | |||
| 792 | Ga0070690_100157071 | |||
| 793 | Ga0068869_100044433 | |||
| 794 | Ga0068869_100049263 | |||
| 795 | Ga0070666_11368821 | |||
| 796 | Ga0070680_100210604 | |||
| 797 | Ga0070680_100514605 | |||
| 798 | Ga0070682_100079870 | |||
| 799 | Ga0070682_100867722 | |||
| 800 | Ga0068868_100018866 | |||
| 801 | Ga0068868_100108978 | |||
| 802 | Ga0068868_100252195 | |||
| 803 | Ga0070660_100103726 | |||
| 804 | Ga0070691_10033187 | |||
| 805 | Ga0070687_100229812 | |||
| 806 | Ga0070687_100712235 | |||
| 807 | Ga0070661_100201059 | |||
| 808 | Ga0070661_100678001 | |||
| 809 | Ga0070692_10307377 | |||
| 810 | Ga0070668_100007429 | |||
| 811 | Ga0070669_100117538 | |||
| 812 | Ga0070675_100223604 | |||
| 813 | Ga0070675_100912186 | |||
| 814 | Ga0070671_101002769 | |||
| 815 | Ga0070674_100239183 | |||
| 816 | Ga0070688_100540590 | |||
| 817 | Ga0070659_100040585 | |||
| 818 | Ga0070659_100694270 | |||
| 819 | Ga0070667_100122356 | |||
| 820 | Ga0070667_100558117 | |||
| 821 | Ga0070667_100812953 | |||
| 822 | Ga0070709_10104203 | |||
| 823 | Ga0070709_10111578 | |||
| 824 | Ga0070709_10348946 | |||
| 825 | Ga0070709_10399734 | |||
| 826 | Ga0070709_10605838 | |||
| 827 | Ga0070709_10645679 | |||
| 828 | Ga0070709_11661602 | |||
| 829 | Ga0070714_100009954 | |||
| 830 | Ga0070714_100078852 | |||
| 831 | Ga0070714_100868133 | |||
| 832 | Ga0070714_101243867 | |||
| 833 | Ga0070713_100021084 | |||
| 834 | Ga0070713_100022245 | |||
| 835 | Ga0070713_100069888 | |||
| 836 | Ga0070713_100183247 | |||
| 837 | Ga0070713_100223014 | |||
| 838 | Ga0070713_100450277 | |||
| 839 | Ga0070713_100798847 | |||
| 840 | Ga0070713_101506854 | |||
| 841 | Ga0070713_101770311 | |||
| 842 | Ga0070710_10116085 | |||
| 843 | Ga0070710_10266286 | |||
| 844 | Ga0070710_11168102 | |||
| 845 | Ga0070701_10422846 | |||
| 846 | Ga0070711_100136750 | |||
| 847 | Ga0070711_100478201 | |||
| 848 | Ga0070711_100573244 | |||
| 849 | Ga0070711_100938797 | |||
| 850 | Ga0070711_101112408 | |||
| 851 | Ga0070705_100229866 | |||
| 852 | Ga0070705_101180284 | |||
| 853 | Ga0070694_100135732 | |||
| 854 | Ga0070708_100008829 | |||
| 855 | Ga0070708_100045192 | |||
| 856 | Ga0070708_100247147 | |||
| 857 | Ga0070663_100373538 | |||
| 858 | Ga0070678_100042985 | |||
| 859 | Ga0070678_100054401 | |||
| 860 | Ga0070662_100012427 | |||
| 861 | Ga0070662_100019078 | |||
| 862 | Ga0070662_100725019 | |||
| 863 | Ga0070681_10008295 | |||
| 864 | Ga0070681_10023083 | |||
| 865 | Ga0070681_10231818 | |||
| 866 | Ga0068867_100030361 | |||
| 867 | Ga0068867_100483425 | |||
| 868 | Ga0070685_10311392 | |||
| 869 | Ga0070706_100026518 | |||
| 870 | Ga0070706_100067539 | |||
| 871 | Ga0070706_100494009 | |||
| 872 | Ga0070706_100686683 | |||
| 873 | Ga0070707_100025402 | |||
| 874 | Ga0070707_100676839 | |||
| 875 | Ga0070698_100053290 | |||
| 876 | Ga0070699_100013838 | |||
| 877 | Ga0070699_100510400 | |||
| 878 | Ga0070699_101762886 | |||
| 879 | Ga0070679_100171407 | |||
| 880 | Ga0070679_100179877 | |||
| 881 | Ga0070679_101206571 | |||
| 882 | Ga0070684_100073073 | |||
| 883 | Ga0070684_100203036 | |||
| 884 | Ga0070684_100204820 | |||
| 885 | Ga0070697_100006949 | |||
| 886 | Ga0070697_100342332 | |||
| 887 | Ga0070697_100553441 | |||
| 888 | Ga0070697_100730423 | |||
| 889 | Ga0070697_101298282 | |||
| 890 | Ga0068853_100053613 | |||
| 891 | Ga0068853_101928752 | |||
| 892 | Ga0070686_100043528 | |||
| 893 | Ga0070686_100375366 | |||
| 894 | Ga0070695_100695060 | |||
| 895 | Ga0070696_100560546 | |||
| 896 | Ga0070693_100037164 | |||
| 897 | Ga0070665_100143216 | |||
| 898 | Ga0070665_101154348 | |||
| 899 | Ga0068855_100044774 | |||
| 900 | Ga0068855_100208491 | |||
| 901 | Ga0068855_100362170 | |||
| 902 | Ga0068855_100405937 | |||
| 903 | Ga0068855_101903042 | |||
| 904 | Ga0068855_102568847 | |||
| 905 | Ga0070664_100012076 | |||
| 906 | Ga0070664_100037583 | |||
| 907 | Ga0070664_100797885 | |||
| 908 | Ga0070664_100942931 | |||
| 909 | Ga0068857_100006131 | |||
| 910 | Ga0068857_100059980 | |||
| 911 | Ga0068857_100322118 | |||
| 912 | Ga0068854_100035894 | |||
| 913 | Ga0068854_100048389 | |||
| 914 | Ga0068854_100338567 | |||
| 915 | Ga0068856_100010194 | |||
| 916 | Ga0068856_100025793 | |||
| 917 | Ga0068856_100040619 | |||
| 918 | Ga0068856_100061438 | |||
| 919 | Ga0068856_100275342 | |||
| 920 | Ga0068856_101080334 | |||
| 921 | Ga0068856_101998919 | |||
| 922 | Ga0068856_102120744 | |||
| 923 | Ga0070702_100314775 | |||
| 924 | Ga0068852_100931996 | |||
| 925 | Ga0068859_100221156 | |||
| 926 | Ga0068859_100739758 | |||
| 927 | Ga0068864_100025145 | |||
| 928 | Ga0068864_100691586 | |||
| 929 | Ga0068864_101939140 | |||
| 930 | Ga0068866_10019917 | |||
| 931 | Ga0068866_10364898 | |||
| 932 | Ga0068861_100086140 | |||
| 933 | Ga0068861_101182417 | |||
| 934 | Ga0068851_10758323 | |||
| 935 | Ga0068870_10055117 | |||
| 936 | Ga0068863_100470919 | |||
| 937 | Ga0068863_100663634 | |||
| 938 | Ga0068858_100372537 | |||
| 939 | Ga0068858_100707448 | |||
| 940 | Ga0068858_101137360 | |||
| 941 | Ga0068860_100037643 | |||
| 942 | Ga0068860_100097549 | |||
| 943 | Ga0068862_100241054 | |||
| 944 | Ga0070717_10003494 | |||
| 945 | Ga0070717_10011899 | |||
| 946 | Ga0070717_10027952 | |||
| 947 | Ga0070717_10028362 | |||
| 948 | Ga0070717_10044255 | |||
| 949 | Ga0070717_10105215 | |||
| 950 | Ga0070717_10131726 | |||
| 951 | Ga0070717_10371945 | |||
| 952 | Ga0070717_10465231 | |||
| 953 | Ga0070717_10832469 | |||
| 954 | Ga0070717_10840000 | |||
| 955 | Ga0070717_11205342 | |||
| 956 | Ga0070715_10089860 | |||
| 957 | Ga0070715_10484665 | |||
| 958 | Ga0070715_10720251 | |||
| 959 | Ga0070716_100011035 | |||
| 960 | Ga0070716_100141716 | |||
| 961 | Ga0070716_100163598 | |||
| 962 | Ga0070716_100189339 | |||
| 963 | Ga0070716_100411333 | |||
| 964 | Ga0070716_100912291 | |||
| 965 | Ga0070716_101248507 | |||
| 966 | Ga0070716_101583790 | |||
| 967 | Ga0070712_100042156 | |||
| 968 | Ga0070712_100047230 | |||
| 969 | Ga0070712_100119636 | |||
| 970 | Ga0070712_100177483 | |||
| 971 | Ga0070712_100316539 | |||
| 972 | Ga0070712_100401666 | |||
| 973 | Ga0070712_100449450 | |||
| 974 | Ga0070712_101802648 | |||
| 975 | Ga0097621_100009199 | |||
| 976 | Ga0097621_100031690 | |||
| 977 | Ga0097621_100032650 | |||
| 978 | Ga0097621_100101641 | |||
| 979 | Ga0097621_100420355 | |||
| 980 | Ga0097621_100854250 | |||
| 981 | Ga0068871_100012980 | |||
| 982 | Ga0068871_100025836 | |||
| 983 | Ga0068871_100145336 | |||
| 984 | Ga0068871_100533053 | |||
| 985 | Ga0075434_100095958 | |||
| 986 | Ga0075434_100343290 | |||
| 987 | Ga0075434_101571895 | |||
| 988 | Ga0068865_100499771 | |||
| 989 | Ga0068865_100671469 | |||
| 990 | Ga0075436_100002999 | |||
| 991 | Ga0075436_100105214 | |||
| 992 | Ga0075436_100520205 | |||
| 993 | Ga0097620_100221145 | |||
| 994 | Ga0097620_100739813 | |||
| 995 | Ga0075435_100055519 | |||
| 996 | Ga0075435_100938523 | |||
| 997 | Ga0099794_10365507 | |||
| 998 | Ga0105250_10040532 | |||
| 999 | Ga0105240_10086660 | |||
| 1000 | Ga0105240_10169681 | |||
| 1001 | Ga0105240_10268071 | |||
| 1002 | Ga0105240_10821260 | |||
| 1003 | Ga0105245_10078510 | |||
| 1004 | Ga0105245_10094488 | |||
| 1005 | Ga0105247_10011131 | |||
| 1006 | Ga0105247_10254627 | |||
| 1007 | Ga0105243_10352107 | |||
| 1008 | Ga0105241_10006864 | |||
| 1009 | Ga0105241_10050529 | |||
| 1010 | Ga0105241_10724185 | |||
| 1011 | Ga0105241_12616200 | |||
| 1012 | Ga0105242_10618463 | |||
| 1013 | Ga0105248_10054895 | |||
| 1014 | Ga0105248_10204053 | |||
| 1015 | Ga0105248_10324671 | |||
| 1016 | Ga0105248_10963904 | |||
| 1017 | Ga0105248_12657598 | |||
| 1018 | Ga0105237_10131570 | |||
| 1019 | Ga0105237_10405166 | |||
| 1020 | Ga0105237_10668192 | |||
| 1021 | Ga0105237_10741377 | |||
| 1022 | Ga0105238_10076815 | |||
| 1023 | Ga0105238_10172498 | |||
| 1024 | Ga0105238_10216871 | |||
| 1025 | Ga0105238_10679853 | |||
| 1026 | Ga0105249_10075147 | |||
| 1027 | Ga0105249_10132946 | |||
| 1028 | Ga0105249_10768278 | |||
| 1029 | Ga0105239_12033777 | |||
| 1030 | Ga0105239_12048916 | |||
| 1031 | Ga0105246_10115057 | |||
| 1032 | Ga0105246_10250395 | |||
| 1033 | Ga0105246_10727833 | |||
| 1034 | Ga0157373_10047535 | |||
| 1035 | Ga0157373_10280310 | |||
| 1036 | Ga0157373_10333525 | |||
| 1037 | Ga0157371_10020279 | |||
| 1038 | Ga0157371_10217621 | |||
| 1039 | Ga0157371_10319135 | |||
| 1040 | Ga0157370_10145392 | |||
| 1041 | Ga0157370_10170585 | |||
| 1042 | Ga0157370_10898765 | |||
| 1043 | Ga0157369_10018318 | |||
| 1044 | Ga0157369_10052728 | |||
| 1045 | Ga0157369_10213452 | |||
| 1046 | Ga0157369_10232498 | |||
| 1047 | Ga0157369_12432064 | |||
| 1048 | Ga0157374_10000220 | |||
| 1049 | Ga0157374_10000651 | |||
| 1050 | Ga0157374_10185695 | |||
| 1051 | Ga0157374_10225301 | |||
| 1052 | Ga0157374_10268997 | |||
| 1053 | Ga0157374_11130311 | |||
| 1054 | Ga0157374_11716836 | |||
| 1055 | Ga0157378_10005113 | |||
| 1056 | Ga0157378_10117296 | |||
| 1057 | Ga0157378_10334189 | |||
| 1058 | Ga0157378_11243198 | |||
| 1059 | Ga0157378_11486821 | |||
| 1060 | Ga0163162_10024768 | |||
| 1061 | Ga0157372_10003153 | |||
| 1062 | Ga0157372_10007172 | |||
| 1063 | Ga0157372_10017970 | |||
| 1064 | Ga0157372_10037832 | |||
| 1065 | Ga0157372_10040835 | |||
| 1066 | Ga0157372_10111398 | |||
| 1067 | Ga0157372_10124578 | |||
| 1068 | Ga0157372_10223798 | |||
| 1069 | Ga0157375_10260151 | |||
| 1070 | Ga0157375_13203796 | |||
| 1071 | Ga0163163_10106153 | |||
| 1072 | Ga0163163_10372763 | |||
| 1073 | Ga0163163_11157554 | |||
| 1074 | Ga0157377_10634422 | |||
| 1075 | Ga0157379_10035997 | |||
| 1076 | Ga0157379_10132288 | |||
| 1077 | Ga0157379_11311158 | |||
| 1078 | Ga0157376_10096447 | |||
| 1079 | Ga0157376_10466655 | |||
| 1080 | Ga0157376_11136441 | |||
| 1081 | Ga0157376_11364676 | |||
| 1082 | Ga0182005_1271212 | |||
| 1083 | Ga0163161_10454079 | |||
| 1084 | Ga0184602_100374 | |||
| 1085 | Ga0184602_108799 | |||
| 1086 | Ga0184602_109278 | |||
| 1087 | Ga0184602_116921 | |||
| 1088 | Ga0184602_126363 | |||
| 1089 | Ga0184602_132365 | |||
| 1090 | Ga0184597_100518 | |||
| 1091 | Ga0184597_121182 | |||
| 1092 | Ga0184597_123989 | |||
| 1093 | Ga0184597_128478 | |||
| 1094 | Ga0184595_109345 | |||
| 1095 | Ga0184595_110125 | |||
| 1096 | Ga0184595_125523 | |||
| 1097 | Ga0184595_126827 | |||
| 1098 | Ga0184598_101394 | |||
| 1099 | Ga0184598_119654 | |||
| 1100 | Ga0184598_126073 | |||
| 1101 | Ga0184598_130657 | |||
| 1102 | Ga0184598_137139 | |||
| 1103 | Ga0184598_139079 | |||
| 1104 | Ga0184601_101282 | |||
| 1105 | Ga0184601_108513 | |||
| 1106 | Ga0184601_108906 | |||
| 1107 | Ga0184601_110771 | |||
| 1108 | Ga0184601_122462 | |||
| 1109 | Ga0184601_133084 | |||
| 1110 | Ga0184599_106580 | |||
| 1111 | Ga0184599_110872 | |||
| 1112 | Ga0184599_113574 | |||
| 1113 | Ga0184599_123342 | |||
| 1114 | Ga0184599_126591 | |||
| 1115 | Ga0184599_151074 | |||
| 1116 | Ga0184599_152807 | |||
| 1117 | Ga0184600_110547 | |||
| 1118 | Ga0184600_133038 | |||
| 1119 | Ga0184600_136576 | |||
| 1120 | Ga0184600_146854 | |||
| 1121 | Ga0184603_102317 | |||
| 1122 | Ga0184603_103961 | |||
| 1123 | Ga0184603_110016 | |||
| 1124 | Ga0184603_118243 | |||
| 1125 | Ga0184603_120553 | |||
| 1126 | Ga0184603_120588 | |||
| 1127 | Ga0184603_121057 | |||
| 1128 | Ga0184603_142816 | |||
| 1129 | Ga0184603_144489 | |||
| 1130 | Ga0184603_150214 | |||
| 1131 | Ga0224569_110195 | |||
| 1132 | Ga0247552_101551 | |||
| 1133 | Ga0247552_101942 | |||
| 1134 | Ga0247552_102588 | |||
| 1135 | Ga0247552_104144 | |||
| 1136 | Ga0247555_101795 | |||
| 1137 | Ga0247555_103058 | |||
| 1138 | Ga0247555_104449 | |||
| 1139 | Ga0247555_104770 | |||
| 1140 | Ga0247554_101396 | |||
| 1141 | Ga0247554_103171 | |||
| 1142 | Ga0247554_104024 | |||
| 1143 | Ga0247554_104735 | |||
| 1144 | Ga0247554_106513 | |||
| 1145 | Ga0247551_100239 | |||
| 1146 | Ga0247521_115859 | |||
| 1147 | Ga0247518_113452 | |||
| 1148 | Ga0247550_102062 | |||
| 1149 | Ga0247550_104570 | |||
| 1150 | Ga0247553_100978 | |||
| 1151 | Ga0247553_102120 | |||
| 1152 | Ga0247553_104896 | |||
| 1153 | Ga0247553_105340 | |||
| 1154 | Ga0247553_105758 | |||
| 1155 | Ga0247553_109254 | |||
| 1156 | Ga0247553_110308 | |||
| 1157 | Ga0247553_110626 | |||
| 1158 | Ga0247553_111073 | |||
| 1159 | Ga0247522_117633 | |||
| 1160 | Ga0224572_1056960 | |||
| 1161 | Ga0228598_1006492 | |||
| 1162 | Ga0228598_1009719 | |||
| 1163 | Ga0228598_1010436 | |||
| 1164 | Ga0228598_1035664 | |||
| 1165 | Ga0228598_1099922 | |||
| 1166 | Ga0207656_10696329 | |||
| 1167 | Ga0207692_10068918 | |||
| 1168 | Ga0207692_10324751 | |||
| 1169 | Ga0207692_10325487 | |||
| 1170 | Ga0207692_10371862 | |||
| 1171 | Ga0207642_10003203 | |||
| 1172 | Ga0207642_10030408 | |||
| 1173 | Ga0207642_10272744 | |||
| 1174 | Ga0207710_10078561 | |||
| 1175 | Ga0207710_10270089 | |||
| 1176 | Ga0207688_10548027 | |||
| 1177 | Ga0207688_10811397 | |||
| 1178 | Ga0207680_10773694 | |||
| 1179 | Ga0207647_10015305 | |||
| 1180 | Ga0207647_10066997 | |||
| 1181 | Ga0207647_10127224 | |||
| 1182 | Ga0207699_10042831 | |||
| 1183 | Ga0207699_10093294 | |||
| 1184 | Ga0207699_10171735 | |||
| 1185 | Ga0207699_10383332 | |||
| 1186 | Ga0207699_10551710 | |||
| 1187 | Ga0207699_10692764 | |||
| 1188 | Ga0207645_10721898 | |||
| 1189 | Ga0207643_10153211 | |||
| 1190 | Ga0207684_10034078 | |||
| 1191 | Ga0207684_10083180 | |||
| 1192 | Ga0207684_10117663 | |||
| 1193 | Ga0207654_10004095 | |||
| 1194 | Ga0207654_10005110 | |||
| 1195 | Ga0207654_10030496 | |||
| 1196 | Ga0207654_10042405 | |||
| 1197 | Ga0207654_10288527 | |||
| 1198 | Ga0207707_10049910 | |||
| 1199 | Ga0207707_10205514 | |||
| 1200 | Ga0207707_10341380 | |||
| 1201 | Ga0207707_11224118 | |||
| 1202 | Ga0207695_10124252 | |||
| 1203 | Ga0207695_10204406 | |||
| 1204 | Ga0207695_10376133 | |||
| 1205 | Ga0207695_10971980 | |||
| 1206 | Ga0207671_10019302 | |||
| 1207 | Ga0207671_10073107 | |||
| 1208 | Ga0207693_10063354 | |||
| 1209 | Ga0207693_10150425 | |||
| 1210 | Ga0207693_10342662 | |||
| 1211 | Ga0207693_10422591 | |||
| 1212 | Ga0207693_10566944 | |||
| 1213 | Ga0207663_10167412 | |||
| 1214 | Ga0207663_10312147 | |||
| 1215 | Ga0207663_11182698 | |||
| 1216 | Ga0207663_11270594 | |||
| 1217 | Ga0207663_11425644 | |||
| 1218 | Ga0207660_10999454 | |||
| 1219 | Ga0207662_10273103 | |||
| 1220 | Ga0207662_10701322 | |||
| 1221 | Ga0207657_10050639 | |||
| 1222 | Ga0207649_10121620 | |||
| 1223 | Ga0207652_10331131 | |||
| 1224 | Ga0207652_10570512 | |||
| 1225 | Ga0207652_11195957 | |||
| 1226 | Ga0207646_10407109 | |||
| 1227 | Ga0207646_10770003 | |||
| 1228 | Ga0207681_10190870 | |||
| 1229 | Ga0207694_10091140 | |||
| 1230 | Ga0207694_10348131 | |||
| 1231 | Ga0207650_10018008 | |||
| 1232 | Ga0207650_10018028 | |||
| 1233 | Ga0207687_10027523 | |||
| 1234 | Ga0207687_10149308 | |||
| 1235 | Ga0207700_10052379 | |||
| 1236 | Ga0207700_10096532 | |||
| 1237 | Ga0207700_10783784 | |||
| 1238 | Ga0207664_10011365 | |||
| 1239 | Ga0207664_10036879 | |||
| 1240 | Ga0207664_10083055 | |||
| 1241 | Ga0207664_10287741 | |||
| 1242 | Ga0207664_10501418 | |||
| 1243 | Ga0207664_10917807 | |||
| 1244 | Ga0207664_10983754 | |||
| 1245 | Ga0207644_10832027 | |||
| 1246 | Ga0207690_10185830 | |||
| 1247 | Ga0207706_10000938 | |||
| 1248 | Ga0207706_10041125 | |||
| 1249 | Ga0207706_11155806 | |||
| 1250 | Ga0207686_10102472 | |||
| 1251 | Ga0207709_10845494 | |||
| 1252 | Ga0207669_10671314 | |||
| 1253 | Ga0207704_10219972 | |||
| 1254 | Ga0207704_11920812 | |||
| 1255 | Ga0207665_10002589 | |||
| 1256 | Ga0207665_10060373 | |||
| 1257 | Ga0207665_10167419 | |||
| 1258 | Ga0207665_10184404 | |||
| 1259 | Ga0207665_10228926 | |||
| 1260 | Ga0207665_10279457 | |||
| 1261 | Ga0207665_10681859 | |||
| 1262 | Ga0207665_10844978 | |||
| 1263 | Ga0207665_11029975 | |||
| 1264 | Ga0207691_11392628 | |||
| 1265 | Ga0207711_10023112 | |||
| 1266 | Ga0207711_10268750 | |||
| 1267 | Ga0207711_11237026 | |||
| 1268 | Ga0207711_11317925 | |||
| 1269 | Ga0207689_10083777 | |||
| 1270 | Ga0207689_10105283 | |||
| 1271 | Ga0207689_11048010 | |||
| 1272 | Ga0207661_10268400 | |||
| 1273 | Ga0207661_11891372 | |||
| 1274 | Ga0207679_10020124 | |||
| 1275 | Ga0207679_10461433 | |||
| 1276 | Ga0207679_10654565 | |||
| 1277 | Ga0207667_10035572 | |||
| 1278 | Ga0207667_10064682 | |||
| 1279 | Ga0207667_10453745 | |||
| 1280 | Ga0207667_12252808 | |||
| 1281 | Ga0207712_10524590 | |||
| 1282 | Ga0207668_10039426 | |||
| 1283 | Ga0207640_10008577 | |||
| 1284 | Ga0207640_11175890 | |||
| 1285 | Ga0207640_11580815 | |||
| 1286 | Ga0207658_10793513 | |||
| 1287 | Ga0207677_10051768 | |||
| 1288 | Ga0207677_10110735 | |||
| 1289 | Ga0207677_10267010 | |||
| 1290 | Ga0207677_10846893 | |||
| 1291 | Ga0207703_10075459 | |||
| 1292 | Ga0207703_10648843 | |||
| 1293 | Ga0207703_10981428 | |||
| 1294 | Ga0207639_10215395 | |||
| 1295 | Ga0207639_10506981 | |||
| 1296 | Ga0207678_10001163 | |||
| 1297 | Ga0207702_10008794 | |||
| 1298 | Ga0207702_10038005 | |||
| 1299 | Ga0207702_10038861 | |||
| 1300 | Ga0207702_10141070 | |||
| 1301 | Ga0207702_10150679 | |||
| 1302 | Ga0207702_11111564 | |||
| 1303 | Ga0207641_10359114 | |||
| 1304 | Ga0207641_10411037 | |||
| 1305 | Ga0207648_10043729 | |||
| 1306 | Ga0207648_10134557 | |||
| 1307 | Ga0207648_10171854 | |||
| 1308 | Ga0207648_10375318 | |||
| 1309 | Ga0207676_10015126 | |||
| 1310 | Ga0207676_10144866 | |||
| 1311 | Ga0207676_10232636 | |||
| 1312 | Ga0207676_11849964 | |||
| 1313 | Ga0207674_10005128 | |||
| 1314 | Ga0207674_10008169 | |||
| 1315 | Ga0207674_10649249 | |||
| 1316 | Ga0207675_100238944 | |||
| 1317 | Ga0207675_100239976 | |||
| 1318 | Ga0207683_10064946 | |||
| 1319 | Ga0207683_11857335 | |||
| 1320 | Ga0207698_10057352 | |||
| 1321 | Ga0207698_11522824 | |||
| 1322 | Ga0265358_100623 | |||
| 1323 | Ga0265354_1013449 | |||
| 1324 | Ga0265357_1003484 | |||
| 1325 | Ga0265357_1024382 | |||
| 1326 | Ga0265355_1010589 | |||
| 1327 | Ga0268266_11558908 | |||
| 1328 | Ga0268265_10050090 | |||
| 1329 | Ga0268265_10150018 | |||
| 1330 | Ga0268264_10029448 | |||
| 1331 | Ga0268264_10155256 | |||
| 1332 | Ga0265336_10086578 | |||
| 1333 | Ga0265336_10110129 | |||
| 1334 | Ga0265338_10000548 | |||
| 1335 | Ga0265338_10151773 | |||
| 1336 | Ga0265338_10699631 | |||
| 1337 | Ga0265762_1005353 | |||
| 1338 | Ga0265762_1138310 | |||
| 1339 | Ga0265775_107506 | |||
| 1340 | Ga0265775_112300 | |||
| 1341 | Ga0265763_1017738 | |||
| 1342 | Ga0265763_1020358 | |||
| 1343 | Ga0265763_1024361 | |||
| 1344 | Ga0265763_1055503 | |||
| 1345 | Ga0265777_101768 | |||
| 1346 | Ga0265777_114530 | |||
| 1347 | Ga0265770_1001245 | |||
| 1348 | Ga0265765_1000221 | |||
| 1349 | Ga0265765_1040034 | |||
| 1350 | Ga0265776_107123 | |||
| 1351 | Ga0265776_112111 | |||
| 1352 | Ga0265764_110310 | |||
| 1353 | Ga0265764_111805 | |||
| 1354 | Ga0265764_115465 | |||
| 1355 | Ga0265769_119810 | |||
| 1356 | Ga0265761_104315 | |||
| 1357 | Ga0265761_110294 | |||
| 1358 | Ga0265761_111343 | |||
| 1359 | Ga0265771_1014385 | |||
| 1360 | Ga0265773_1031893 | |||
| 1361 | Ga0265779_114368 | |||
| 1362 | Ga0265760_10079574 | |||
| 1363 | Ga0265760_10100841 | |||
| 1364 | Ga0265760_10102408 | |||
| 1365 | Ga0265760_10137668 | |||
| 1366 | Ga0265760_10157182 | |||
| 1367 | Ga0265760_10202121 | |||
| 1368 | Ga0265760_10240723 | |||
| 1369 | Ga0265760_10337487 | |||
| 1370 | Ga0265760_10392212 | |||
| 1371 | Ga0265330_10235770 | |||
| 1372 | Ga0265325_10310990 | |||
| 1373 | Ga0265340_10174941 | |||
| 1374 | Ga0265340_10425123 | |||
| 1375 | Ga0265339_10055600 | |||
| 1376 | Ga0265339_10097496 | |||
| 1377 | Ga0265339_10220499 | |||
| 1378 | Ga0265339_10245596 | |||
| 1379 | Ga0265339_10361938 | |||
| 1380 | Ga0265316_10023942 | |||
| 1381 | Ga0265316_10080086 | |||
| 1382 | Ga0265316_10095823 | |||
| 1383 | Ga0265316_10639825 | |||
| 1384 | Ga0265316_11200831 | |||
| 1385 | Ga0310117_127002 | |||
| 1386 | Ga0310103_132860 | |||
| 1387 | Ga0310119_131841 | |||
| 1388 | Ga0265314_10065555 | |||
| 1389 | Ga0265314_10116705 | |||
| 1390 | Ga0265314_10257183 | |||
| 1391 | Ga0265314_10334652 | |||
| 1392 | Ga0316044_131221 | |||
| 1393 | Ga0316053_102785 | |||
| 1394 | Ga0316053_104542 | |||
| 1395 | Ga0316053_106766 | |||
| 1396 | Ga0316053_109680 | |||
| 1397 | Ga0316053_110154 | |||
| 1398 | Ga0316053_111644 | |||
| 1399 | Ga0316053_115686 | |||
| 1400 | Ga0316053_118810 | |||
| 1401 | Ga0316053_120060 | |||
| 1402 | Ga0316215_1023045 | |||
| 1403 | Ga0373930_0124914 | |||
| 1404 | Ga0373948_0009021 | |||
| 1405 | Ga0373959_0078847 | |||
| 1406 | Ga0373926_0009017 | |||
| 1407 | Ga0373926_0066188 | |||
| 1408 | Ga0373934_0166657 | |||
| 1409 | Ga0373940_0085567 | |||
| 1410 | Ga0373923_0068918 | |||
| 1411 | Ga0373923_0299702 | |||
| 1412 | Ga0373923_0521451 | |||
| 1413 | Ga0373932_0133840 | |||
| 1414 | Ga0373932_0156212 | |||
| 1415 | Ga0373936_0041664 | |||
| 1416 | Ga0373936_0157955 | |||
| 1417 | Ga0373936_0309565 | |||
| 1418 | Ga0373941_0328507 | |||
| 1419 | Ga0373945_0381252 | |||
| 1420 | Ga0373953_0511381 | |||
| 1421 | Ga0373954_0422356 | |||
| 1422 | Ga0373954_0602092 | |||
| 1423 | Ga0373956_0083149 | |||
| 1424 | Ga0373943_0126193 | |||
| 1425 | Ga0373943_0226707 | |||
| 1426 | Ga0373943_0283323 | |||
| 1427 | Ga0373946_0077075 | |||
| 1428 | Ga0373946_0317909 | |||
| 1429 | Ga0373942_0133106 | |||
| 1430 | Ga0373942_0351832 | |||
| 1431 | Ga0373961_0077805 | |||
| 1432 | Ga0373962_0195980 | |||
| 1433 | Ga0373924_0065874 | |||
| 1434 | Ga0373924_0259534 | |||
| 1435 | Ga0373924_0325713 | |||
| 1436 | Ga0373931_0103539 | |||
| 1437 | Ga0373931_0413088 | |||
| 1438 | Ga0373931_1034571 | |||
| 1439 | Ga0373935_0008382 | |||
| 1440 | Ga0373935_0045842 | |||
| 1441 | Ga0373935_0049468 | |||
| 1442 | Ga0373935_0071396 | |||
| 1443 | Ga0373927_0199335 | |||
| 1444 | Ga0373927_0213330 | |||
| 1445 | Ga0373927_0266331 | |||
| 1446 | Ga0373927_0381120 | |||
| 1447 | Ga0373933_0103988 | |||
| 1448 | Ga0373947_0079988 | |||
| 1449 | Ga0373947_0150430 | |||
| 1450 | Ga0373947_0286789 | |||
| 1451 | Ga0373947_0673889 | |||
| 1452 | Ga0373947_0743332 | |||
| 1453 | Ga0373937_0241478 | |||
| 1454 | Ga0265778_004395 | |||
| 1455 | Ga0265778_011184 | |||
| 1456 | Ga0265778_018949 | |||
| 1457 | Ga0265778_019562 | |||
| 1458 | Ga0265778_035222 | |||
| 1459 | Ga0265778_038692 | |||
| 1460 | Ga0265778_043768 | |||
| 1461 | Ga0265778_062363 | |||
| 1462 | Ga0373925_0039806 | |||
| 1463 | Ga0373925_0066203 | |||
| 1464 | Ga0373925_0150565 | |||
| 1465 | Ga0373925_0403947 | |||
| 1466 | Ga0395898_1167745 | |||
| 1467 | Ga0395905_1672641 | |||
| 1468 | Ga0242420_009180 | |||
| 1469 | Ga0451839_0187844 | |||
| 1470 | Ga0453684_1586424 | |||
| 1471 | Ga0451576_2477926 | |||
| 1472 | Ga0495629_0016777 | |||
| 1473 | Ga0495580_0013176 | |||
| 1474 | Ga0495580_0023716 | |||
| 1475 | Ga0495580_0035807 | |||
| 1476 | Ga0495580_0057307 | |||
| 1477 | Ga0495580_0101015 | |||
| 1478 | Ga0495580_0202840 | |||
| 1479 | Ga0495580_0850932 | |||
| 1480 | Ga0495582_0008490 | |||
| 1481 | Ga0495582_0381389 | |||
| 1482 | Ga0495605_0063534 | |||
| 1483 | Ga0495662_0197028 | |||
| 1484 | Ga0495664_0053805 | |||
| 1485 | Ga0495585_0015098 | |||
| 1486 | Ga0495594_0057430 | |||
| 1487 | Ga0495594_0292839 | |||
| 1488 | Ga0495596_0018336 | |||
| 1489 | Ga0495607_0111954 | |||
| 1490 | Ga0495583_0179398 | |||
| 1491 | Ga0495628_0841461 | |||
| 1492 | Ga0495630_0102518 | |||
| 1493 | Ga0495630_1510750 | |||
| 1494 | Ga0495631_0069664 | |||
| 1495 | Ga0495644_0000061 | |||
| 1496 | Ga0495665_0016298 | |||
| 1497 | Ga0495665_0403704 | |||
| 1498 | Ga0495640_0811536 | |||
| 1499 | Ga0495586_0490391 | |||
| 1500 | Ga0495609_0031684 | |||
| 1501 | Ga0495622_0072311 | |||
| 1502 | Ga0495633_0254641 | |||
| 1503 | Ga0495625_0031434 | |||
| 1504 | Ga0495659_0015011 | |||
| 1505 | Ga0495599_0240464 | |||
| 1506 | Ga0495623_0039903 | |||
| 1507 | Ga0495669_0052566 | |||
| 1508 | Ga0495669_0313139 | |||
| 1509 | Ga0495613_0001990 | |||
| 1510 | Ga0495624_0195028 | |||
| 1511 | Ga0495624_0246217 | |||
| 1512 | Ga0495624_0518755 | |||
| 1513 | Ga0495670_0080969 | |||
| 1514 | Ga0495600_0164823 | |||
| 1515 | Ga0495581_0037561 | |||
| 1516 | Ga0495636_0140118 | |||
| 1517 | Ga0495636_0155120 | |||
| 1518 | Ga0495674_0935412 | |||
| 1519 | Ga0495676_0108981 | |||
| 1520 | Ga0495680_0960794 | |||
| 1521 | Ga0495677_0013494 | |||
| 1522 | Ga0495685_054807 | |||
| 1523 | Ga0495593_0305384 | |||
| 1524 | Ga0495602_1014416 | |||
| 1525 | Ga0495614_0001727 | |||
| 1526 | Ga0495615_0056789 | |||
| 1527 | Ga0496100_1149124 | |||
| 1528 | Ga0496101_1079986 | |||
| 1529 | Ga0496102_0134676 | |||
| 1530 | Ga0496103_0061903 | |||
| 1531 | Ga0496104_0391266 | |||
| 1532 | Ga0496106_0227032 | |||
| 1533 | Ga0496107_1107228 | |||
| 1534 | Ga0496108_0715482 | |||
| 1535 | Ga0496108_0918386 | |||
| 1536 | Ga0496109_0111254 | |||
| 1537 | Ga0496111_0986128 | |||
| 1538 | Ga0496112_0128262 | |||
| 1539 | Ga0496112_0131889 | |||
| 1540 | Ga0496112_0291574 | |||
| 1541 | Ga0496112_0473985 | |||
| 1542 | Ga0496112_1010782 | |||
| 1543 | Ga0496112_1237321 | |||
| 1544 | Ga0496112_1448838 | |||
| 1545 | Ga0496113_0558053 | |||
| 1546 | Ga0496114_0292286 | |||
| 1547 | Ga0496115_0083064 | |||
| 1548 | nmdc:mga0n895_145741_c1 | |||
| 1549 | nmdc:mga0n895_309813_c1 | |||
| 1550 | nmdc:mga0n895_56125_c1 | |||
| 1551 | nmdc:mga0rr50_1490518_c1 | |||
| 1552 | nmdc:mga0rr50_41020_c2 | |||
| 1553 | nmdc:mga08x19_1071639_c1 | |||
| 1554 | nmdc:mga08x19_1846_c1 | |||
| 1555 | Ga0495601_0150382 | |||
| 1556 | Ga0587093_090739 | |||
| 1557 | Ga0587088_173574 | |||
| 1558 | Ga0587091_199471 | |||
| 1559 | Ga0587125_066665 | |||
| 1560 | Ga0587117_043574 | |||
| 1561 | Ga0587122_027423 | |||
| 1562 | Ga0587114_136486 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n5t-assembly1.cif.gz_B | crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with the ligand oxidized acetyl dithranol | 0.8388 | 2 | 95 |
| 1iuj-assembly1.cif.gz_B | the structure of tt1380 protein from thermus thermophilus | 0.8368 | 1 | 96 |
| 3gz7-assembly1.cif.gz_B | crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution | 0.8365 | 2 | 94 |
| 3kg1-assembly3.cif.gz_A-2 | crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a | 0.8304 | 2 | 96 |
| 3fgv-assembly1.cif.gz_B | crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution | 0.827 | 2 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLA3_32_98_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9148 | 5 | 69 | 3.10.450.240 |
| af_P9WLA3_28_227_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8942 | 2 | 89 | 3.30.70.100 |
| af_P9WLA3_32_98_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8773 | 5 | 69 | 3.10.450.240 |
| af_P9WLA3_114_212_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8675 | 3 | 79 | 3.30.70.100 |
| 3gz7B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8507 | 2 | 94 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5J2N4-F1-model_v4 | ABM domain-containing protein | 0.9882 | 1 | 96 |
|
| AF-A0A2V8Y4D7-F1-model_v4 | ABM domain-containing protein | 0.9881 | 1 | 86 |
|
| AF-A0A524H098-F1-model_v4 | ABM domain-containing protein | 0.9773 | 2 | 96 |
|
| AF-A0A534VNS4-F1-model_v4 | ABM domain-containing protein | 0.9771 | 2 | 98 |
|
| AF-A0A2V9FIS3-F1-model_v4 | ABM domain-containing protein | 0.9758 | 1 | 96 |
|