F480532

General Info

Members Datasets Scaffolds Average Seq Length
780 315 770 190

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0376354|Ga0466967_0376354_612_1280
Length 222
Sequence VANAQQKNKSRVHKRKNLKQFYFYNRFKKSILIMDRRDAISRVALLLGGTVIGAEAFLKGCKPETKYGQSLKFTPDDVAYLDEVAETILPRTSTPGAKDAKVGQFMTVIVNDCYEDKDQKTFLDGMQKLDDASKKKNGKSFMESTPQQRHDLLVDLDKEAKDYQSKKKEDDPNHYFTLMKQLTLWGFFTSEPGATKALRYVAVPGRYEGCIPYKKGDKAWAT

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
298 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
299 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0.9
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 0.51
Rhizosphere 85.77
Stem 0
Stem Tuber 0
Unclassified 5.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000909 3300001979 Bacteria 13118
2 JGI24740J21852_10017204 3300001979 Bacteria 2591
3 JGI24739J22299_10003098 3300001989 Bacteria 6347
4 JGI24737J22298_10000041 3300001990 Bacteria 37211
5 JGI24735J21928_10000001 3300002067 Bacteria 650042
6 JGI25154J39366_1000012 3300002738 Bacteria 287601
7 JGI25157J39369_1006716 3300002741 Bacteria 1724
8 JGI25406J46586_10032261 3300003203 Bacteria 1948
9 JGI25153J46596_10001521 3300003215 Bacteria 13807
10 JGI25153J46596_10016658 3300003215 Bacteria 2931
11 rootH1_10042093 3300003316 Bacteria 2072
12 rootH1_10111220 3300003316 Bacteria 3056
13 rootH1_10151956 3300003316 Unclassified 1841
14 rootH2_10008932 3300003320 Bacteria 37271
15 rootH2_10032886 3300003320 Bacteria 16021
16 rootH2_10133367 3300003320 Bacteria 3739
17 rootH2_10167396 3300003320 Bacteria 1267
18 rootL2_10149769 3300003322 Bacteria 1429
19 rootL2_10157062 3300003322 Bacteria 1521
20 rootL2_10227972 3300003322 Bacteria 2539
21 rootH1_10025877 3300003323 Unclassified 1855
22 rootH1_10254323 3300003323 Bacteria 2773
23 rootH1_10254552 3300003323 Bacteria 1709
24 rootH1_10268100 3300003323 Bacteria 1518
25 JGI25160J50197_1003572 3300003354 Bacteria 6911
26 JGI25160J50197_1004764 3300003354 Bacteria 5792
27 JGI25160J50197_1006581 3300003354 Bacteria 4681
28 Ga0055526_1000006 3300003771 Bacteria 330857
29 Ga0055526_1016576 3300003771 Bacteria 2871
30 Ga0055526_1027605 3300003771 Bacteria 1748
31 Ga0055537_1000003 3300003773 Bacteria 220933
32 Ga0055537_1000018 3300003773 Bacteria 123452
33 Ga0055524_1000009 3300003775 Bacteria 295254
34 Ga0055534_1000004 3300003784 Bacteria 295251
35 Ga0055528_1000003 3300003790 Bacteria 330875
36 Ga0055528_1001024 3300003790 Bacteria 18512
37 Ga0055530_10001218 3300003791 Bacteria 19831
38 Ga0055531_10037765 3300003794 Bacteria 1462
39 Ga0058863_10091895 3300004799 Bacteria 12700
40 Ga0058861_12039234 3300004800 Bacteria 6175
41 Ga0058860_11662651 3300004801 Unclassified 655
42 Ga0058862_10284522 3300004803 Bacteria 9201
43 Ga0065165_1000228 3300005262 Bacteria 98736
44 Ga0065714_10075158 3300005288 Bacteria 2938
45 Ga0065714_10172053 3300005288 Unclassified 1000
46 Ga0065704_10113950 3300005289 Bacteria 1902
47 Ga0065712_10237453 3300005290 Bacteria 994
48 Ga0070658_10005453 3300005327 Bacteria 10313
49 Ga0070658_10044669 3300005327 Bacteria 3581
50 Ga0070658_10083170 3300005327 Bacteria 2631
51 Ga0070658_10638602 3300005327 Bacteria 923
52 Ga0070676_10000375 3300005328 Bacteria 20682
53 Ga0070676_10027954 3300005328 Unclassified 3202
54 Ga0070676_10766442 3300005328 Unclassified 709
55 Ga0070683_100790402 3300005329 Bacteria 909
56 Ga0070690_100061206 3300005330 Unclassified 2425
57 Ga0070690_100144687 3300005330 Unclassified 1616
58 Ga0070670_100228528 3300005331 Bacteria 1619
59 Ga0070677_10074147 3300005333 Unclassified 1439
60 Ga0070677_10173510 3300005333 Bacteria 1021
61 Ga0068869_100127536 3300005334 Bacteria 1953
62 Ga0068869_101349297 3300005334 Unclassified 630
63 Ga0070666_10000132 3300005335 Bacteria 52718
64 Ga0070666_10000885 3300005335 Bacteria 18201
65 Ga0070666_10269935 3300005335 Bacteria 1207
66 Ga0070666_10270683 3300005335 Bacteria 1205
67 Ga0070680_100005853 3300005336 Bacteria 9329
68 Ga0070680_100041989 3300005336 Bacteria 3710
69 Ga0070682_100015574 3300005337 Bacteria 4409
70 Ga0070682_100030591 3300005337 Bacteria 3251
71 Ga0070682_100621294 3300005337 Bacteria 856
72 Ga0068868_100000075 3300005338 Bacteria 58452
73 Ga0068868_100023545 3300005338 Bacteria 4661
74 Ga0068868_100191322 3300005338 Bacteria 1702
75 Ga0068868_100222536 3300005338 Unclassified 1580
76 Ga0068868_100433381 3300005338 Bacteria 1140
77 Ga0070660_100004164 3300005339 Bacteria 9991
78 Ga0070660_100202995 3300005339 Bacteria 1608
79 Ga0070660_100228197 3300005339 Bacteria 1515
80 Ga0070689_100044786 3300005340 Unclassified 3405
81 Ga0070691_10020993 3300005341 Bacteria 3020
82 Ga0070691_10161802 3300005341 Unclassified 1154
83 Ga0070661_100008471 3300005344 Bacteria 7113
84 Ga0070661_100242948 3300005344 Bacteria 1387
85 Ga0070668_100000859 3300005347 Bacteria 21121
86 Ga0070668_100279911 3300005347 Unclassified 1393
87 Ga0070668_100486000 3300005347 Bacteria 1067
88 Ga0070669_100043902 3300005353 Bacteria 3257
89 Ga0070669_100996238 3300005353 Unclassified 719
90 Ga0070675_100125401 3300005354 Bacteria 2184
91 Ga0070675_100152510 3300005354 Unclassified 1982
92 Ga0070675_100541788 3300005354 Bacteria 1052
93 Ga0070671_100022885 3300005355 Bacteria 5107
94 Ga0070671_100052161 3300005355 Bacteria 3401
95 Ga0070671_100092479 3300005355 Bacteria 2534
96 Ga0070671_100183430 3300005355 Bacteria 1772
97 Ga0070674_100173699 3300005356 Bacteria 1645
98 Ga0070674_100203274 3300005356 Unclassified 1531
99 Ga0070674_100412162 3300005356 Bacteria 1107
100 Ga0070673_100000448 3300005364 Bacteria 21839
101 Ga0070673_100030540 3300005364 Bacteria 4035
102 Ga0070673_100050694 3300005364 Bacteria 3246
103 Ga0070673_100091218 3300005364 Bacteria 2491
104 Ga0070673_100405374 3300005364 Unclassified 1220
105 Ga0070673_100700638 3300005364 Unclassified 930
106 Ga0070659_100009089 3300005366 Bacteria 7290
107 Ga0070667_100000482 3300005367 Bacteria 40557
108 Ga0070667_100130903 3300005367 Bacteria 2189
109 Ga0070667_100147132 3300005367 Bacteria 2067
110 Ga0070667_100414060 3300005367 Bacteria 1228
111 Ga0070667_100676469 3300005367 Bacteria 954
112 Ga0070667_100780695 3300005367 Bacteria 886
113 Ga0070667_100938123 3300005367 Unclassified 806
114 Ga0070700_100203486 3300005441 Unclassified 1392
115 Ga0070663_100261704 3300005455 Bacteria 1372
116 Ga0070678_100033217 3300005456 Bacteria 3580
117 Ga0070678_100080301 3300005456 Bacteria 2470
118 Ga0070678_100096047 3300005456 Bacteria 2285
119 Ga0070678_100232610 3300005456 Bacteria 1537
120 Ga0070662_100009485 3300005457 Bacteria 6368
121 Ga0070662_100145632 3300005457 Bacteria 1840
122 Ga0070681_10145809 3300005458 Bacteria 2296
123 Ga0068867_100005707 3300005459 Bacteria 8824
124 Ga0068867_100006698 3300005459 Bacteria 8144
125 Ga0068867_100178837 3300005459 Bacteria 1685
126 Ga0068867_100418801 3300005459 Unclassified 1134
127 Ga0070679_100018717 3300005530 Bacteria 6723
128 Ga0070679_100052315 3300005530 Bacteria 4069
129 Ga0070679_100058152 3300005530 Bacteria 3853
130 Ga0070684_100026351 3300005535 Bacteria 4896
131 Ga0068853_100007384 3300005539 Bacteria 8793
132 Ga0068853_100043469 3300005539 Bacteria 3843
133 Ga0068853_100047692 3300005539 Bacteria 3677
134 Ga0068853_100159655 3300005539 Bacteria 2033
135 Ga0068853_101230800 3300005539 Unclassified 723
136 Ga0070672_100000361 3300005543 Bacteria 26202
137 Ga0070672_100234716 3300005543 Unclassified 1541
138 Ga0070672_100513536 3300005543 Unclassified 1037
139 Ga0070672_100774091 3300005543 Unclassified 843
140 Ga0070686_100182653 3300005544 Unclassified 1491
141 Ga0070686_100923908 3300005544 Unclassified 711
142 Ga0070693_100013364 3300005547 Bacteria 4180
143 Ga0070693_100911376 3300005547 Unclassified 659
144 Ga0070665_100000001 3300005548 Bacteria 1083363
145 Ga0070665_100002163 3300005548 Bacteria 21925
146 Ga0070665_100008754 3300005548 Bacteria 10244
147 Ga0070665_100906380 3300005548 Bacteria 894
148 Ga0070665_101187688 3300005548 Bacteria 774
149 Ga0068855_100000089 3300005563 Bacteria 110845
150 Ga0068855_100009719 3300005563 Bacteria 11608
151 Ga0068855_100025328 3300005563 Bacteria 7099
152 Ga0068855_100038549 3300005563 Bacteria 5678
153 Ga0068855_100038985 3300005563 Bacteria 5641
154 Ga0068855_100046105 3300005563 Bacteria 5154
155 Ga0068855_100090222 3300005563 Bacteria 3537
156 Ga0068855_100145358 3300005563 Bacteria 2700
157 Ga0068855_100252214 3300005563 Bacteria 1968
158 Ga0068855_101451803 3300005563 Bacteria 705
159 Ga0070664_100942060 3300005564 Unclassified 810
160 Ga0070664_100955627 3300005564 Bacteria 804
161 Ga0068857_100005562 3300005577 Bacteria 10756
162 Ga0068857_100006566 3300005577 Bacteria 9983
163 Ga0068857_100134162 3300005577 Bacteria 2235
164 Ga0068857_100156342 3300005577 Bacteria 2068
165 Ga0068854_100048329 3300005578 Bacteria 3035
166 Ga0068854_100067427 3300005578 Bacteria 2607
167 Ga0068854_100182488 3300005578 Unclassified 1640
168 Ga0068854_100242577 3300005578 Bacteria 1436
169 Ga0068854_100339682 3300005578 Bacteria 1226
170 Ga0068854_100626211 3300005578 Unclassified 921
171 Ga0068856_100000129 3300005614 Bacteria 76536
172 Ga0068856_100020623 3300005614 Bacteria 6404
173 Ga0068856_100032772 3300005614 Bacteria 5088
174 Ga0068856_100043872 3300005614 Bacteria 4399
175 Ga0068856_100365035 3300005614 Bacteria 1462
176 Ga0068856_100478100 3300005614 Bacteria 1267
177 Ga0068856_100699999 3300005614 Unclassified 1033
178 Ga0068856_101250827 3300005614 Unclassified 758
179 Ga0070702_100155968 3300005615 Unclassified 1471
180 Ga0070702_100283030 3300005615 Bacteria 1139
181 Ga0068852_100000242 3300005616 Bacteria 37066
182 Ga0068852_100005191 3300005616 Bacteria 9287
183 Ga0068852_100103743 3300005616 Bacteria 2572
184 Ga0068852_100114231 3300005616 Bacteria 2460
185 Ga0068852_100149778 3300005616 Unclassified 2169
186 Ga0068852_100198533 3300005616 Bacteria 1897
187 Ga0068859_100000003 3300005617 Bacteria 479218
188 Ga0068859_100142729 3300005617 Bacteria 2468
189 Ga0068859_100167906 3300005617 Bacteria 2274
190 Ga0068859_100626379 3300005617 Bacteria 1168
191 Ga0068859_101308631 3300005617 Bacteria 799
192 Ga0068864_100000785 3300005618 Bacteria 26636
193 Ga0068864_100018349 3300005618 Bacteria 5844
194 Ga0068864_100101243 3300005618 Bacteria 2555
195 Ga0068861_100026816 3300005719 Bacteria 4192
196 Ga0068861_100758197 3300005719 Bacteria 907
197 Ga0068861_100962435 3300005719 Unclassified 812
198 Ga0068851_10008297 3300005834 Bacteria 4799
199 Ga0068870_10054743 3300005840 Bacteria 2123
200 Ga0068870_10337090 3300005840 Unclassified 963
201 Ga0068870_10367683 3300005840 Bacteria 927
202 Ga0068870_10571574 3300005840 Bacteria 764
203 Ga0068863_100000394 3300005841 Bacteria 44355
204 Ga0068863_100777484 3300005841 Bacteria 954
205 Ga0068858_100026331 3300005842 Bacteria 5405
206 Ga0068858_100042626 3300005842 Bacteria 4207
207 Ga0068858_100475728 3300005842 Unclassified 1205
208 Ga0068858_100543147 3300005842 Unclassified 1125
209 Ga0068860_100000097 3300005843 Bacteria 146573
210 Ga0068860_100001074 3300005843 Bacteria 30126
211 Ga0068860_100002836 3300005843 Bacteria 18019
212 Ga0068860_100006719 3300005843 Bacteria 11541
213 Ga0068860_100017594 3300005843 Bacteria 6965
214 Ga0068860_100050303 3300005843 Bacteria 3968
215 Ga0068860_100086520 3300005843 Bacteria 2983
216 Ga0068860_100115869 3300005843 Unclassified 2563
217 Ga0068860_100434992 3300005843 Unclassified 1302
218 Ga0081540_1017916 3300005983 Bacteria 4364
219 Ga0081539_10186221 3300005985 Bacteria 970
220 Ga0097621_100004135 3300006237 Bacteria 10062
221 Ga0097621_100010324 3300006237 Bacteria 6826
222 Ga0097621_100138601 3300006237 Bacteria 2077
223 Ga0097621_100178821 3300006237 Unclassified 1832
224 Ga0097621_100286549 3300006237 Bacteria 1451
225 Ga0097621_100367013 3300006237 Bacteria 1284
226 Ga0097621_100779169 3300006237 Bacteria 885
227 Ga0075370_10620101 3300006353 Bacteria 656
228 Ga0068871_100023830 3300006358 Bacteria 4741
229 Ga0068871_100048965 3300006358 Bacteria 3414
230 Ga0068871_100492880 3300006358 Bacteria 1104
231 Ga0068871_100930073 3300006358 Bacteria 807
232 Ga0068871_101269713 3300006358 Bacteria 692
233 Ga0068865_100021001 3300006881 Bacteria 4243
234 Ga0068865_100089792 3300006881 Bacteria 2226
235 Ga0068865_100133523 3300006881 Bacteria 1862
236 Ga0097620_100000003 3300006931 Bacteria 479218
237 Ga0097620_100142730 3300006931 Bacteria 2468
238 Ga0097620_100167901 3300006931 Bacteria 2274
239 Ga0097620_100626378 3300006931 Bacteria 1168
240 Ga0097620_101308671 3300006931 Bacteria 799
241 Ga0105240_10000754 3300009093 Bacteria 59023
242 Ga0105240_10000862 3300009093 Bacteria 54716
243 Ga0105240_10002072 3300009093 Bacteria 32853
244 Ga0105240_10003320 3300009093 Bacteria 25129
245 Ga0105240_10005940 3300009093 Bacteria 18085
246 Ga0105240_10014243 3300009093 Bacteria 10863
247 Ga0105240_10036865 3300009093 Bacteria 6286
248 Ga0105240_10102886 3300009093 Bacteria 3470
249 Ga0105240_10224199 3300009093 Bacteria 2188
250 Ga0105245_10136050 3300009098 Unclassified 2309
251 Ga0105245_10624377 3300009098 Bacteria 1106
252 Ga0105247_10003817 3300009101 Bacteria 9750
253 Ga0105247_10471379 3300009101 Bacteria 909
254 Ga0105243_10025290 3300009148 Bacteria 4535
255 Ga0105241_10001671 3300009174 Bacteria 16896
256 Ga0105241_10001857 3300009174 Bacteria 16027
257 Ga0105241_10004426 3300009174 Bacteria 10389
258 Ga0105241_10112786 3300009174 Bacteria 2178
259 Ga0105241_10138015 3300009174 Bacteria 1982
260 Ga0105241_10146570 3300009174 Bacteria 1927
261 Ga0105241_10218123 3300009174 Bacteria 1602
262 Ga0105241_10268150 3300009174 Bacteria 1453
263 Ga0105242_10020147 3300009176 Bacteria 5228
264 Ga0105242_10049156 3300009176 Bacteria 3431
265 Ga0105242_10053984 3300009176 Unclassified 3283
266 Ga0105242_10283338 3300009176 Unclassified 1506
267 Ga0105242_10446482 3300009176 Bacteria 1218
268 Ga0105248_10081980 3300009177 Bacteria 3627
269 Ga0105237_10001393 3300009545 Bacteria 31945
270 Ga0105237_10004900 3300009545 Bacteria 15325
271 Ga0105237_10012148 3300009545 Bacteria 9085
272 Ga0105237_10013542 3300009545 Bacteria 8546
273 Ga0105237_10018295 3300009545 Bacteria 7251
274 Ga0105237_10030014 3300009545 Bacteria 5523
275 Ga0105237_10043122 3300009545 Bacteria 4546
276 Ga0105237_10071773 3300009545 Bacteria 3456
277 Ga0105237_10100182 3300009545 Bacteria 2889
278 Ga0105237_10105253 3300009545 Bacteria 2813
279 Ga0105237_10397719 3300009545 Bacteria 1382
280 Ga0105237_10870577 3300009545 Bacteria 908
281 Ga0105238_10002044 3300009551 Bacteria 20361
282 Ga0105238_10014367 3300009551 Bacteria 8001
283 Ga0105238_10060424 3300009551 Bacteria 3794
284 Ga0105238_10239520 3300009551 Bacteria 1792
285 Ga0105249_10002967 3300009553 Bacteria 14640
286 Ga0105249_10019812 3300009553 Bacteria 6005
287 Ga0105249_10075804 3300009553 Bacteria 3115
288 Ga0105249_10139712 3300009553 Bacteria 2321
289 Ga0105249_10259817 3300009553 Bacteria 1725
290 Ga0105249_10676004 3300009553 Bacteria 1091
291 Ga0105239_10000529 3300010375 Bacteria 55233
292 Ga0105239_10003433 3300010375 Bacteria 19410
293 Ga0105239_10009088 3300010375 Bacteria 11244
294 Ga0105239_10009377 3300010375 Bacteria 11043
295 Ga0105239_10013995 3300010375 Bacteria 8909
296 Ga0105239_10019080 3300010375 Bacteria 7579
297 Ga0105239_10135806 3300010375 Unclassified 2738
298 Ga0105239_10200579 3300010375 Unclassified 2235
299 Ga0105239_10207637 3300010375 Bacteria 2195
300 Ga0105239_10293414 3300010375 Bacteria 1831
301 Ga0105239_10604337 3300010375 Bacteria 1251
302 Ga0105239_10638915 3300010375 Bacteria 1215
303 Ga0105239_10903747 3300010375 Bacteria 1013
304 Ga0105246_10029078 3300011119 Bacteria 3635
305 Ga0105246_10061764 3300011119 Bacteria 2608
306 Ga0105246_10566531 3300011119 Bacteria 976
307 Ga0157373_10007171 3300013100 Bacteria 8317
308 Ga0157373_10083630 3300013100 Bacteria 2250
309 Ga0157373_10113662 3300013100 Unclassified 1903
310 Ga0157371_10057536 3300013102 Bacteria 2757
311 Ga0157371_10104539 3300013102 Bacteria 2009
312 Ga0157371_10144610 3300013102 Bacteria 1694
313 Ga0157371_10677530 3300013102 Unclassified 771
314 Ga0157370_10002239 3300013104 Bacteria 23528
315 Ga0157370_10011697 3300013104 Bacteria 9159
316 Ga0157370_10030448 3300013104 Bacteria 5287
317 Ga0157370_10196198 3300013104 Bacteria 1873
318 Ga0157370_10262702 3300013104 Bacteria 1595
319 Ga0157370_10476091 3300013104 Bacteria 1147
320 Ga0157370_10775951 3300013104 Bacteria 873
321 Ga0157369_10006899 3300013105 Bacteria 13107
322 Ga0157369_10033481 3300013105 Bacteria 5646
323 Ga0157369_10082965 3300013105 Bacteria 3429
324 Ga0157369_10748863 3300013105 Bacteria 1005
325 Ga0157374_10000001 3300013296 Bacteria 1077351
326 Ga0157374_10002589 3300013296 Bacteria 15240
327 Ga0157374_10012630 3300013296 Bacteria 7354
328 Ga0157374_10100124 3300013296 Unclassified 2777
329 Ga0157374_10111273 3300013296 Bacteria 2634
330 Ga0157374_10585127 3300013296 Unclassified 1125
331 Ga0157378_10009315 3300013297 Bacteria 8552
332 Ga0157378_10026601 3300013297 Bacteria 5099
333 Ga0157378_10029608 3300013297 Bacteria 4835
334 Ga0157378_10035695 3300013297 Bacteria 4398
335 Ga0157378_10062135 3300013297 Bacteria 3335
336 Ga0157378_10148573 3300013297 Bacteria 2182
337 Ga0157378_10412406 3300013297 Unclassified 1333
338 Ga0163162_10000328 3300013306 Bacteria 43763
339 Ga0163162_10000377 3300013306 Bacteria 40533
340 Ga0163162_10003770 3300013306 Bacteria 14524
341 Ga0163162_10006392 3300013306 Bacteria 11408
342 Ga0163162_10011375 3300013306 Bacteria 8677
343 Ga0163162_10051173 3300013306 Bacteria 4144
344 Ga0163162_10077507 3300013306 Bacteria 3388
345 Ga0163162_10238891 3300013306 Bacteria 1947
346 Ga0163162_10246634 3300013306 Bacteria 1917
347 Ga0163162_10624346 3300013306 Bacteria 1203
348 Ga0163162_11083043 3300013306 Bacteria 908
349 Ga0163162_11419576 3300013306 Bacteria 790
350 Ga0163162_11640324 3300013306 Unclassified 734
351 Ga0157372_10001004 3300013307 Bacteria 30814
352 Ga0157372_10041370 3300013307 Bacteria 5096
353 Ga0157372_10051539 3300013307 Bacteria 4581
354 Ga0157372_10197916 3300013307 Bacteria 2327
355 Ga0157372_10344447 3300013307 Bacteria 1736
356 Ga0157375_10004745 3300013308 Bacteria 11813
357 Ga0157375_10153364 3300013308 Bacteria 2441
358 Ga0157375_10173794 3300013308 Bacteria 2303
359 Ga0157375_10365663 3300013308 Bacteria 1609
360 Ga0157375_10409079 3300013308 Unclassified 1523
361 Ga0157375_10672403 3300013308 Bacteria 1190
362 Ga0163163_10000752 3300014325 Bacteria 27543
363 Ga0163163_10109276 3300014325 Unclassified 2792
364 Ga0163163_10534761 3300014325 Unclassified 1234
365 Ga0163163_10573857 3300014325 Bacteria 1191
366 Ga0157380_10049655 3300014326 Unclassified 3310
367 Ga0157379_10000440 3300014968 Bacteria 33697
368 Ga0157379_10018199 3300014968 Bacteria 6190
369 Ga0157379_10313908 3300014968 Bacteria 1430
370 Ga0157379_10515172 3300014968 Bacteria 1110
371 Ga0157379_11517524 3300014968 Bacteria 652
372 Ga0157376_10000381 3300014969 Bacteria 28821
373 Ga0182006_1000134 3300015261 Bacteria 80259
374 Ga0163161_10009869 3300017792 Bacteria 6613
375 Ga0163161_10062200 3300017792 Bacteria 2719
376 Ga0163161_10323519 3300017792 Bacteria 1220
377 Ga0163161_10344771 3300017792 Bacteria 1183
378 Ga0163161_10355237 3300017792 Bacteria 1166
379 Ga0163161_10744215 3300017792 Bacteria 820
380 Ga0163161_11406790 3300017792 Unclassified 609
381 Ga0206352_10770432 3300020078 Bacteria 852
382 Ga0206350_10795179 3300020080 Bacteria 1407
383 Ga0213876_10000680 3300021384 Bacteria 24189
384 Ga0213876_10073833 3300021384 Bacteria 1801
385 Ga0209646_1000009 3300025246 Bacteria 652154
386 Ga0209026_1000197 3300025250 Bacteria 84123
387 Ga0209565_1000001 3300025263 Bacteria 2950419
388 Ga0209455_1017797 3300025272 Bacteria 1478
389 Ga0209673_1000001 3300025273 Bacteria 3176258
390 Ga0209673_1000016 3300025273 Bacteria 506202
391 Ga0209675_1000001 3300025291 Bacteria 2950293
392 Ga0209564_1000001 3300025295 Bacteria 3176258
393 Ga0209564_1011183 3300025295 Bacteria 4046
394 Ga0209564_1011455 3300025295 Bacteria 3972
395 Ga0209758_1007200 3300025297 Bacteria 7661
396 Ga0209758_1012031 3300025297 Bacteria 4910
397 Ga0209050_1000124 3300025298 Bacteria 194022
398 Ga0209256_1000002 3300025299 Bacteria 1906740
399 Ga0207426_1000052 3300025302 Bacteria 389825
400 Ga0207426_1001572 3300025302 Bacteria 18424
401 Ga0207426_1001894 3300025302 Bacteria 15188
402 Ga0207426_1053576 3300025302 Bacteria 1190
403 Ga0209051_1035622 3300025303 Bacteria 1848
404 Ga0209257_1004094 3300025304 Bacteria 11673
405 Ga0207697_10025166 3300025315 Bacteria 2434
406 Ga0207656_10000424 3300025321 Bacteria 14223
407 Ga0207682_10129934 3300025893 Unclassified 1124
408 Ga0207642_10172273 3300025899 Bacteria 1172
409 Ga0207710_10000906 3300025900 Bacteria 15850
410 Ga0207710_10263521 3300025900 Unclassified 864
411 Ga0207710_10326401 3300025900 Bacteria 779
412 Ga0207688_10025859 3300025901 Bacteria 3226
413 Ga0207688_10093027 3300025901 Bacteria 1733
414 Ga0207680_10000014 3300025903 Bacteria 179035
415 Ga0207680_10009667 3300025903 Bacteria 4794
416 Ga0207680_10026936 3300025903 Bacteria 3193
417 Ga0207647_10107096 3300025904 Bacteria 1654
418 Ga0207647_10186786 3300025904 Bacteria 1202
419 Ga0207647_10257031 3300025904 Unclassified 1001
420 Ga0207645_10000949 3300025907 Bacteria 24072
421 Ga0207645_10003031 3300025907 Bacteria 12943
422 Ga0207645_10022717 3300025907 Bacteria 4077
423 Ga0207643_10172958 3300025908 Bacteria 1304
424 Ga0207643_10484803 3300025908 Bacteria 789
425 Ga0207705_10014112 3300025909 Bacteria 5755
426 Ga0207705_10037679 3300025909 Bacteria 3460
427 Ga0207705_10459832 3300025909 Bacteria 987
428 Ga0207705_10540318 3300025909 Bacteria 906
429 Ga0207654_10001242 3300025911 Bacteria 13578
430 Ga0207654_10002095 3300025911 Bacteria 10217
431 Ga0207654_10005208 3300025911 Bacteria 6563
432 Ga0207654_10055619 3300025911 Bacteria 2292
433 Ga0207654_10646838 3300025911 Bacteria 757
434 Ga0207707_10002312 3300025912 Bacteria 17183
435 Ga0207707_10145062 3300025912 Unclassified 2075
436 Ga0207695_10000071 3300025913 Bacteria 315568
437 Ga0207695_10000084 3300025913 Bacteria 282392
438 Ga0207695_10000515 3300025913 Bacteria 82285
439 Ga0207695_10001197 3300025913 Bacteria 44626
440 Ga0207695_10015718 3300025913 Bacteria 8898
441 Ga0207695_10024440 3300025913 Bacteria 6800
442 Ga0207695_10024527 3300025913 Bacteria 6780
443 Ga0207695_10042003 3300025913 Bacteria 4889
444 Ga0207695_10042984 3300025913 Bacteria 4820
445 Ga0207695_10047145 3300025913 Bacteria 4563
446 Ga0207695_10132273 3300025913 Bacteria 2451
447 Ga0207695_10193040 3300025913 Bacteria 1953
448 Ga0207671_10000746 3300025914 Bacteria 41287
449 Ga0207671_10003348 3300025914 Bacteria 16085
450 Ga0207671_10003740 3300025914 Bacteria 14993
451 Ga0207671_10004160 3300025914 Bacteria 13983
452 Ga0207671_10005486 3300025914 Bacteria 11666
453 Ga0207671_10008007 3300025914 Bacteria 9048
454 Ga0207671_10056900 3300025914 Bacteria 2898
455 Ga0207671_10081878 3300025914 Bacteria 2421
456 Ga0207671_10089273 3300025914 Bacteria 2319
457 Ga0207660_10003846 3300025917 Bacteria 9785
458 Ga0207660_10036926 3300025917 Bacteria 3400
459 Ga0207660_10377308 3300025917 Bacteria 1139
460 Ga0207657_10002311 3300025919 Bacteria 20667
461 Ga0207649_10124045 3300025920 Bacteria 1745
462 Ga0207649_10334564 3300025920 Unclassified 1116
463 Ga0207652_10017345 3300025921 Bacteria 5892
464 Ga0207652_10033362 3300025921 Bacteria 4334
465 Ga0207652_10054841 3300025921 Bacteria 3427
466 Ga0207652_10595047 3300025921 Bacteria 992
467 Ga0207681_10026831 3300025923 Bacteria 3719
468 Ga0207681_10331527 3300025923 Bacteria 1213
469 Ga0207694_10011115 3300025924 Bacteria 6799
470 Ga0207694_10019150 3300025924 Bacteria 5175
471 Ga0207650_10183514 3300025925 Bacteria 1668
472 Ga0207650_10677585 3300025925 Unclassified 870
473 Ga0207659_10045002 3300025926 Bacteria 3109
474 Ga0207659_10096476 3300025926 Unclassified 2219
475 Ga0207659_10224559 3300025926 Bacteria 1512
476 Ga0207687_10253432 3300025927 Unclassified 1400
477 Ga0207644_10016463 3300025931 Bacteria 4975
478 Ga0207644_10162341 3300025931 Bacteria 1738
479 Ga0207644_10334885 3300025931 Unclassified 1226
480 Ga0207690_10322634 3300025932 Bacteria 1214
481 Ga0207706_10010472 3300025933 Bacteria 8472
482 Ga0207706_10031196 3300025933 Bacteria 4749
483 Ga0207686_10013604 3300025934 Bacteria 4505
484 Ga0207686_10092438 3300025934 Unclassified 2000
485 Ga0207686_10688317 3300025934 Bacteria 812
486 Ga0207709_10192079 3300025935 Bacteria 1451
487 Ga0207670_10364441 3300025936 Unclassified 1147
488 Ga0207669_10020055 3300025937 Bacteria 3496
489 Ga0207669_10621009 3300025937 Unclassified 881
490 Ga0207704_10004208 3300025938 Bacteria 6576
491 Ga0207704_10226476 3300025938 Unclassified 1387
492 Ga0207691_10000037 3300025940 Bacteria 108385
493 Ga0207691_10015603 3300025940 Bacteria 7222
494 Ga0207691_10067065 3300025940 Bacteria 3245
495 Ga0207691_10098458 3300025940 Unclassified 2612
496 Ga0207691_10119013 3300025940 Bacteria 2342
497 Ga0207691_10284505 3300025940 Bacteria 1422
498 Ga0207711_10175960 3300025941 Bacteria 1944
499 Ga0207689_10002471 3300025942 Bacteria 17199
500 Ga0207689_10006705 3300025942 Bacteria 10156
501 Ga0207689_10062707 3300025942 Bacteria 3057
502 Ga0207689_10282084 3300025942 Bacteria 1376
503 Ga0207689_11114202 3300025942 Unclassified 665
504 Ga0207661_10011778 3300025944 Bacteria 6350
505 Ga0207661_10853259 3300025944 Bacteria 838
506 Ga0207679_10670335 3300025945 Unclassified 939
507 Ga0207679_11097643 3300025945 Bacteria 730
508 Ga0207667_10000209 3300025949 Bacteria 83277
509 Ga0207667_10001051 3300025949 Bacteria 35135
510 Ga0207667_10009260 3300025949 Bacteria 11626
511 Ga0207667_10016493 3300025949 Bacteria 8346
512 Ga0207667_10030056 3300025949 Bacteria 5882
513 Ga0207667_10052276 3300025949 Bacteria 4303
514 Ga0207667_10065568 3300025949 Bacteria 3787
515 Ga0207667_10134120 3300025949 Bacteria 2550
516 Ga0207667_10277346 3300025949 Bacteria 1713
517 Ga0207667_10609064 3300025949 Bacteria 1101
518 Ga0207651_10000443 3300025960 Bacteria 17529
519 Ga0207651_10066690 3300025960 Bacteria 2530
520 Ga0207651_10357867 3300025960 Bacteria 1231
521 Ga0207651_10497493 3300025960 Bacteria 1053
522 Ga0207651_10881002 3300025960 Bacteria 796
523 Ga0207712_10011116 3300025961 Bacteria 5728
524 Ga0207712_10071114 3300025961 Unclassified 2502
525 Ga0207712_10098348 3300025961 Bacteria 2170
526 Ga0207712_10284565 3300025961 Bacteria 1350
527 Ga0207668_10001307 3300025972 Bacteria 14792
528 Ga0207668_10081891 3300025972 Bacteria 2343
529 Ga0207668_10574412 3300025972 Unclassified 979
530 Ga0207640_10024969 3300025981 Bacteria 3612
531 Ga0207640_10144275 3300025981 Unclassified 1740
532 Ga0207658_10000629 3300025986 Bacteria 31155
533 Ga0207658_10233991 3300025986 Bacteria 1552
534 Ga0207658_10391069 3300025986 Bacteria 1220
535 Ga0207658_10602724 3300025986 Bacteria 987
536 Ga0207658_10778212 3300025986 Bacteria 868
537 Ga0207677_10004861 3300026023 Bacteria 7252
538 Ga0207677_10050852 3300026023 Bacteria 2806
539 Ga0207677_10052340 3300026023 Bacteria 2773
540 Ga0207677_10380101 3300026023 Bacteria 1192
541 Ga0207677_10389914 3300026023 Bacteria 1178
542 Ga0207703_10004145 3300026035 Bacteria 11957
543 Ga0207703_10093203 3300026035 Bacteria 2536
544 Ga0207703_10331636 3300026035 Bacteria 1396
545 Ga0207703_10552576 3300026035 Unclassified 1086
546 Ga0207639_10016611 3300026041 Bacteria 5211
547 Ga0207639_10018632 3300026041 Bacteria 4937
548 Ga0207639_10156773 3300026041 Bacteria 1913
549 Ga0207639_10320012 3300026041 Bacteria 1377
550 Ga0207639_10385562 3300026041 Unclassified 1259
551 Ga0207639_10484348 3300026041 Unclassified 1128
552 Ga0207639_10541615 3300026041 Bacteria 1068
553 Ga0207639_10579064 3300026041 Bacteria 1033
554 Ga0207708_10272109 3300026075 Bacteria 1370
555 Ga0207702_10000300 3300026078 Bacteria 57198
556 Ga0207702_10038638 3300026078 Bacteria 3997
557 Ga0207702_10084583 3300026078 Bacteria 2762
558 Ga0207702_10112852 3300026078 Bacteria 2419
559 Ga0207702_10230736 3300026078 Bacteria 1730
560 Ga0207702_10240589 3300026078 Bacteria 1695
561 Ga0207702_10380912 3300026078 Bacteria 1357
562 Ga0207641_10000015 3300026088 Bacteria 321332
563 Ga0207641_10239613 3300026088 Unclassified 1690
564 Ga0207648_10001276 3300026089 Bacteria 28144
565 Ga0207648_10002156 3300026089 Bacteria 21404
566 Ga0207648_10013274 3300026089 Bacteria 7675
567 Ga0207648_10059637 3300026089 Bacteria 3328
568 Ga0207648_10472966 3300026089 Unclassified 1144
569 Ga0207648_10994823 3300026089 Bacteria 785
570 Ga0207676_10002535 3300026095 Bacteria 13033
571 Ga0207676_10040303 3300026095 Bacteria 3579
572 Ga0207676_10171751 3300026095 Bacteria 1890
573 Ga0207676_10424070 3300026095 Bacteria 1248
574 Ga0207674_10014068 3300026116 Bacteria 8840
575 Ga0207674_10072510 3300026116 Bacteria 3460
576 Ga0207674_10086225 3300026116 Bacteria 3135
577 Ga0207674_10151233 3300026116 Bacteria 2278
578 Ga0207674_10247155 3300026116 Bacteria 1731
579 Ga0207675_100082228 3300026118 Bacteria 3020
580 Ga0207675_100324409 3300026118 Unclassified 1504
581 Ga0207675_100340726 3300026118 Bacteria 1468
582 Ga0207675_101262661 3300026118 Unclassified 759
583 Ga0207683_10063384 3300026121 Bacteria 3256
584 Ga0207683_10076193 3300026121 Bacteria 2970
585 Ga0207683_10097861 3300026121 Bacteria 2617
586 Ga0207698_10000781 3300026142 Bacteria 18499
587 Ga0207698_10001356 3300026142 Bacteria 14268
588 Ga0207698_10019600 3300026142 Bacteria 4635
589 Ga0207698_10360049 3300026142 Bacteria 1377
590 Ga0207698_10431788 3300026142 Bacteria 1267
591 Ga0207698_10809343 3300026142 Bacteria 939
592 Ga0207698_11085626 3300026142 Unclassified 813
593 Ga0268266_10000038 3300028379 Bacteria 325729
594 Ga0268266_10004818 3300028379 Bacteria 12818
595 Ga0268266_10023629 3300028379 Bacteria 5232
596 Ga0268266_10776664 3300028379 Bacteria 925
597 Ga0268266_11034053 3300028379 Bacteria 795
598 Ga0268265_10348303 3300028380 Bacteria 1352
599 Ga0268264_10000167 3300028381 Bacteria 146190
600 Ga0268264_10003753 3300028381 Bacteria 13045
601 Ga0268264_10006147 3300028381 Bacteria 10139
602 Ga0268264_10064089 3300028381 Bacteria 3092
603 Ga0268264_10153754 3300028381 Bacteria 2065
604 Ga0268264_10406699 3300028381 Bacteria 1309
605 Ga0268264_10612190 3300028381 Bacteria 1074
606 Ga0307517_10206908 3300028786 Unclassified 1216
607 Ga0307515_10000707 3300028794 Bacteria 76907
608 Ga0307515_10000993 3300028794 Bacteria 64832
609 Ga0307511_10007925 3300030521 Bacteria 10657
610 Ga0265327_10000115 3300031251 Bacteria 173854
611 Ga0307513_10304684 3300031456 Bacteria 1358
612 Ga0307516_10000656 3300031730 Bacteria 46771
613 Ga0307516_10311658 3300031730 Bacteria 1247
614 Ga0307410_10125443 3300031852 Bacteria 1879
615 Ga0307407_10177440 3300031903 Bacteria 1409
616 Ga0307412_10336655 3300031911 Bacteria 1206
617 Ga0307414_10050591 3300032004 Bacteria 2879
618 Ga0307414_10100657 3300032004 Bacteria 2174
619 Ga0307414_10250186 3300032004 Bacteria 1473
620 Ga0307411_10704405 3300032005 Bacteria 880
621 Ga0307510_10000584 3300033180 Bacteria 36797
622 Ga0307510_10378843 3300033180 Bacteria 860
623 Ga0373954_0234289 3300035118 Bacteria 904
624 Ga0395900_0173088 3300037418 Bacteria 2197
625 Ga0436365_1170113 3300039437 Bacteria 2032
626 Ga0436365_1468940 3300039437 Bacteria 37650
627 Ga0439436_0006309 3300041404 Bacteria 3641
628 Ga0439447_000932 3300041407 Bacteria 10686
629 Ga0451833_0564981 3300041491 Unclassified 760
630 Ga0451833_1433807 3300041491 Unclassified 691
631 Ga0451841_0881867 3300041498 Bacteria 1260
632 Ga0451843_0056518 3300041509 Bacteria 732
633 Ga0439431_0000264 3300041997 Bacteria 10760
634 Ga0439448_0064373 3300042005 Unclassified 1215
635 Ga0439449_0028526 3300042007 Bacteria 2080
636 Ga0439457_000583 3300042014 Bacteria 10682
637 Ga0439462_0008982 3300042015 Bacteria 2529
638 Ga0451577_0938505 3300042876 Bacteria 778
639 Ga0466969_0001216 3300044656 Bacteria 13901
640 Ga0466972_0000928 3300044658 Bacteria 14109
641 Ga0466966_0000184 3300044684 Bacteria 41499
642 Ga0466961_0034755 3300044693 Bacteria 3236
643 Ga0453684_1551179 3300044712 Bacteria 681
644 Ga0466971_0070821 3300044719 Bacteria 1583
645 Ga0466971_0112481 3300044719 Bacteria 1257
646 Ga0466968_0137233 3300044735 Unclassified 1116
647 Ga0466957_0881012 3300044842 Bacteria 639
648 Ga0466959_0000097 3300045049 Bacteria 55620
649 Ga0466959_0026078 3300045049 Bacteria 4334
650 Ga0466958_0044854 3300045836 Unclassified 2665
651 Ga0466967_0376354 3300045976 Bacteria 1378
652 Ga0495638_0044648 3300046460 Bacteria 2791
653 Ga0495638_0048014 3300046460 Bacteria 2674
654 Ga0495638_0214312 3300046460 Bacteria 1080
655 Ga0495651_0464255 3300046462 Bacteria 816
656 Ga0495650_0000273 3300046471 Bacteria 98757
657 Ga0495662_0386355 3300046476 Unclassified 687
658 Ga0495664_0149519 3300046477 Bacteria 1417
659 Ga0495585_0001701 3300046492 Bacteria 16773
660 Ga0495583_0024219 3300046506 Bacteria 3055
661 Ga0495606_0000130 3300046507 Bacteria 127805
662 Ga0495606_0054975 3300046507 Bacteria 2576
663 Ga0495606_0194015 3300046507 Bacteria 1162
664 Ga0495610_0009742 3300046512 Bacteria 6039
665 Ga0495616_0009400 3300046513 Bacteria 5723
666 Ga0495632_0130702 3300046519 Bacteria 1169
667 Ga0495632_0227832 3300046519 Bacteria 841
668 Ga0495648_0004026 3300046524 Bacteria 12694
669 Ga0495652_0126388 3300046529 Bacteria 2031
670 Ga0495640_0492136 3300046533 Unclassified 747
671 Ga0495586_0530015 3300046535 Unclassified 680
672 Ga0495597_0247340 3300046542 Bacteria 701
673 Ga0495633_0003361 3300046558 Bacteria 10732
674 Ga0495667_0263572 3300046559 Unclassified 1096
675 Ga0495668_0252547 3300046616 Bacteria 965
676 Ga0495611_0000575 3300046648 Bacteria 21197
677 Ga0495625_0000036 3300046660 Bacteria 221680
678 Ga0495661_0044534 3300046665 Bacteria 2719
679 Ga0495623_0188691 3300046679 Bacteria 1193
680 Ga0495613_0424596 3300046689 Bacteria 904
681 Ga0495649_0000017 3300046694 Bacteria 221685
682 Ga0495649_0036243 3300046694 Bacteria 2710
683 Ga0495600_0410183 3300046809 Unclassified 842
684 Ga0495660_0032812 3300046810 Bacteria 2915
685 Ga0495660_0137077 3300046810 Bacteria 1222
686 Ga0495581_0100444 3300047315 Bacteria 1681
687 Ga0495674_0083880 3300047319 Bacteria 2731
688 Ga0495672_0046637 3300047320 Bacteria 2583
689 Ga0495687_000001 3300047443 Bacteria 1215582
690 Ga0495686_0000004 3300047472 Bacteria 869019
691 Ga0496106_0793756 3300048909 Unclassified 751
692 Ga0496109_0028678 3300048912 Bacteria 4982
693 Ga0496115_0350418 3300048918 Bacteria 1204
694 Ga0496121_0000036 3300048924 Bacteria 362643
695 Ga0496122_0001285 3300048925 Bacteria 41682
696 Ga0496123_0003994 3300048926 Bacteria 15964
697 Ga0496125_0101909 3300048928 Bacteria 2111
698 Ga0501031_0036070 3300049568 Bacteria 3225
699 Ga0501032_0007417 3300049569 Bacteria 8011
700 Ga0501032_0101834 3300049569 Bacteria 1903
701 Ga0501033_0016645 3300049570 Bacteria 5562
702 Ga0501033_0374836 3300049570 Bacteria 995
703 Ga0501034_0048388 3300049571 Bacteria 4291
704 Ga0501034_0064484 3300049571 Bacteria 3677
705 Ga0501034_0144872 3300049571 Bacteria 2353
706 Ga0501034_0344559 3300049571 Unclassified 1419
707 Ga0501034_0576225 3300049571 Bacteria 1033
708 Ga0501037_0005310 3300049573 Bacteria 9372
709 Ga0501037_0012307 3300049573 Bacteria 6298
710 Ga0501037_0378098 3300049573 Bacteria 974
711 Ga0501038_0033490 3300049574 Bacteria 4526
712 Ga0501043_0091900 3300049579 Bacteria 2386
713 Ga0501043_0416409 3300049579 Unclassified 1013
714 Ga0501043_1053607 3300049579 Bacteria 576
715 Ga0501046_0018347 3300049580 Bacteria 5824
716 Ga0501046_0038148 3300049580 Bacteria 3858
717 Ga0501047_0013489 3300049581 Bacteria 7746
718 Ga0501047_0033096 3300049581 Bacteria 4991
719 Ga0501047_0256271 3300049581 Bacteria 1598
720 Ga0501047_0378521 3300049581 Unclassified 1250
721 Ga0501048_0400940 3300049582 Bacteria 980
722 Ga0501067_0087767 3300049583 Bacteria 1726
723 Ga0501068_0315447 3300049584 Bacteria 1002
724 Ga0501070_0014914 3300049586 Bacteria 6536
725 Ga0501073_0183383 3300049589 Unclassified 1449
726 Ga0501074_0102988 3300049590 Unclassified 2044
727 Ga0501219_001673 3300049703 Bacteria 1969
728 Ga0501080_0121551 3300049742 Unclassified 2419
729 Ga0501080_0318364 3300049742 Bacteria 1409
730 Ga0501083_0039932 3300049744 Bacteria 3186
731 Ga0501035_0243029 3300049822 Bacteria 1531
732 Ga0501035_1039661 3300049822 Bacteria 642
733 Ga0501044_0014888 3300049823 Bacteria 8385
734 Ga0501044_0065026 3300049823 Bacteria 3720
735 Ga0501044_0077306 3300049823 Unclassified 3376
736 Ga0501044_0086137 3300049823 Bacteria 3174
737 Ga0501044_0763853 3300049823 Unclassified 848
738 Ga0501284_00002 3300050005 Bacteria 220402
739 Ga0500646_0013830 3300053090 Bacteria 2091
740 Ga0500646_0040563 3300053090 Bacteria 1309
741 Ga0500583_0000078 3300053092 Bacteria 58451
742 Ga0500583_0001571 3300053092 Bacteria 6613
743 Ga0500583_0013003 3300053092 Bacteria 3201
744 Ga0500583_0310796 3300053092 Unclassified 770
745 Ga0500651_0168722 3300053093 Bacteria 1306
746 Ga0500660_128294 3300053100 Bacteria 1038
747 Ga0500557_089211 3300053105 Bacteria 1021
748 Ga0500608_069319 3300053122 Bacteria 1678
749 Ga0500618_000004 3300053125 Bacteria 293180
750 Ga0500642_0035698 3300053130 Bacteria 2113
751 Ga0500652_005630 3300053131 Bacteria 3965
752 Ga0500658_0058455 3300053134 Bacteria 1597
753 Ga0500658_0079128 3300053134 Bacteria 1402
754 Ga0500559_0283329 3300053136 Bacteria 779
755 Ga0500603_020199 3300053150 Bacteria 1625
756 Ga0500604_0277708 3300053151 Unclassified 581
757 Ga0500616_0022794 3300053153 Bacteria 3494
758 Ga0500622_0006472 3300053156 Bacteria 6780
759 Ga0500622_0018889 3300053156 Bacteria 3663
760 Ga0500637_0090501 3300053178 Bacteria 1772
761 Ga0500637_0112221 3300053178 Unclassified 1581
762 Ga0500637_0149649 3300053178 Unclassified 1349
763 Ga0500611_028007 3300053727 Bacteria 1140
764 Ga0501084_0229319 3300054114 Unclassified 1568
765 Ga0587077_023405 3300059493 Bacteria 1115
766 Ga0501082_0346157 3300060353 Bacteria 1295
767 Ga0466962_0027711 3300061719 Bacteria 2717
768 Ga0466962_0073543 3300061719 Bacteria 1633
769 Ga0466962_0389622 3300061719 Unclassified 697
770 Ga0466962_0446222 3300061719 Unclassified 651

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10172053 Ga0065714_101720531 154
2 3300003323 rootH1_10268100 rootH1_102681002 162
3 3300025949 Ga0207667_10134120 Ga0207667_101341202 164
4 3300003323 rootH1_10025877 rootH1_100258772 166
5 3300028794 Ga0307515_10000993 Ga0307515_1000099338 168
6 3300046462 Ga0495651_0464255 Ga0495651_0464255_164_736 168
7 3300005341 Ga0070691_10161802 Ga0070691_101618022 170
8 3300005530 Ga0070679_100052315 Ga0070679_1000523157 170
9 3300005563 Ga0068855_100090222 Ga0068855_1000902222 170
10 3300005614 Ga0068856_100699999 Ga0068856_1006999991 170
11 3300009545 Ga0105237_10043122 Ga0105237_100431228 170
12 3300010375 Ga0105239_10013995 Ga0105239_100139952 170
13 3300013100 Ga0157373_10113662 Ga0157373_101136622 170
14 3300013307 Ga0157372_10197916 Ga0157372_101979162 170
15 3300025913 Ga0207695_10042984 Ga0207695_100429845 170
16 3300026041 Ga0207639_10385562 Ga0207639_103855622 170
17 3300053093 Ga0500651_0168722 Ga0500651_0168722_102_680 170
18 iso_pu_bacteria 2941489479 2941490337 171
19 3300003203 JGI25406J46586_10032261 JGI25406J46586_100322612 172
20 3300005329 Ga0070683_100790402 Ga0070683_1007904021 172
21 3300005335 Ga0070666_10270683 Ga0070666_102706833 172
22 3300005337 Ga0070682_100015574 Ga0070682_1000155742 172
23 3300005338 Ga0068868_100023545 Ga0068868_1000235454 172
24 3300005339 Ga0070660_100004164 Ga0070660_1000041647 172
25 3300005344 Ga0070661_100008471 Ga0070661_1000084713 172
26 3300005354 Ga0070675_100541788 Ga0070675_1005417882 172
27 3300005355 Ga0070671_100092479 Ga0070671_1000924793 172
28 3300005366 Ga0070659_100009089 Ga0070659_1000090894 172
29 3300005456 Ga0070678_100033217 Ga0070678_1000332173 172
30 3300005457 Ga0070662_100145632 Ga0070662_1001456322 172
31 3300005539 Ga0068853_100159655 Ga0068853_1001596552 172
32 3300005563 Ga0068855_100025328 Ga0068855_1000253282 172
33 3300005564 Ga0070664_100955627 Ga0070664_1009556271 172
34 3300005614 Ga0068856_100043872 Ga0068856_1000438722 172
35 3300005615 Ga0070702_100283030 Ga0070702_1002830301 172
36 3300005616 Ga0068852_100198533 Ga0068852_1001985333 172
37 3300006237 Ga0097621_100010324 Ga0097621_1000103246 172
38 3300013100 Ga0157373_10007171 Ga0157373_100071714 172
39 3300013102 Ga0157371_10144610 Ga0157371_101446102 172
40 3300013104 Ga0157370_10262702 Ga0157370_102627022 172
41 3300013105 Ga0157369_10006899 Ga0157369_100068998 172
42 3300013296 Ga0157374_10012630 Ga0157374_100126302 172
43 3300013297 Ga0157378_10035695 Ga0157378_100356952 172
44 3300013306 Ga0163162_10077507 Ga0163162_100775071 172
45 3300014968 Ga0157379_11517524 Ga0157379_115175241 172
46 3300025903 Ga0207680_10026936 Ga0207680_100269362 172
47 3300025911 Ga0207654_10055619 Ga0207654_100556193 172
48 3300025912 Ga0207707_10145062 Ga0207707_101450622 172
49 3300025917 Ga0207660_10377308 Ga0207660_103773082 172
50 3300025919 Ga0207657_10002311 Ga0207657_100023113 172
51 3300025920 Ga0207649_10124045 Ga0207649_101240452 172
52 3300025921 Ga0207652_10595047 Ga0207652_105950471 172
53 3300025926 Ga0207659_10045002 Ga0207659_100450022 172
54 3300025931 Ga0207644_10162341 Ga0207644_101623412 172
55 3300025932 Ga0207690_10322634 Ga0207690_103226341 172
56 3300025933 Ga0207706_10010472 Ga0207706_100104726 172
57 3300025944 Ga0207661_10853259 Ga0207661_108532591 172
58 3300025949 Ga0207667_10016493 Ga0207667_100164938 172
59 3300025949 Ga0207667_10052276 Ga0207667_100522762 172
60 3300025960 Ga0207651_10497493 Ga0207651_104974931 172
61 3300026023 Ga0207677_10050852 Ga0207677_100508522 172
62 3300026041 Ga0207639_10579064 Ga0207639_105790642 172
63 3300026078 Ga0207702_10084583 Ga0207702_100845831 172
64 3300026116 Ga0207674_10086225 Ga0207674_100862254 172
65 3300026121 Ga0207683_10097861 Ga0207683_100978611 172
66 3300026142 Ga0207698_10360049 Ga0207698_103600492 172
67 3300049742 Ga0501080_0318364 Ga0501080_0318364_658_1236 172
68 3300005535 Ga0070684_100026351 Ga0070684_1000263514 173
69 3300005577 Ga0068857_100006566 Ga0068857_1000065663 173
70 3300005578 Ga0068854_100048329 Ga0068854_1000483293 173
71 3300005614 Ga0068856_100032772 Ga0068856_1000327722 173
72 3300005616 Ga0068852_100000242 Ga0068852_10000024216 173
73 3300009093 Ga0105240_10014243 Ga0105240_100142436 173
74 3300009093 Ga0105240_10224199 Ga0105240_102241992 173
75 3300009545 Ga0105237_10100182 Ga0105237_101001821 173
76 3300009551 Ga0105238_10014367 Ga0105238_100143672 173
77 3300013104 Ga0157370_10002239 Ga0157370_100022397 173
78 3300013307 Ga0157372_10001004 Ga0157372_100010047 173
79 3300017792 Ga0163161_10744215 Ga0163161_107442151 173
80 3300025904 Ga0207647_10107096 Ga0207647_101070962 173
81 3300025913 Ga0207695_10024440 Ga0207695_100244405 173
82 3300025924 Ga0207694_10019150 Ga0207694_100191503 173
83 3300025949 Ga0207667_10001051 Ga0207667_1000105122 173
84 3300025981 Ga0207640_10024969 Ga0207640_100249693 173
85 3300026078 Ga0207702_10240589 Ga0207702_102405892 173
86 3300026116 Ga0207674_10014068 Ga0207674_100140685 173
87 3300026142 Ga0207698_10000781 Ga0207698_1000078118 173
88 3300041509 Ga0451843_0056518 Ga0451843_0056518_104_676 173
89 3300044719 Ga0466971_0112481 Ga0466971_0112481_210_782 173
90 3300044842 Ga0466957_0881012 Ga0466957_0881012_10_588 173
91 3300053136 Ga0500559_0283329 Ga0500559_0283329_212_754 173
92 3300053151 Ga0500604_0277708 Ga0500604_0277708_18_560 173
93 3300048928 Ga0496125_0101909 Ga0496125_0101909_24_608 174
94 3300003322 rootL2_10157062 rootL2_101570622 175
95 3300005337 Ga0070682_100621294 Ga0070682_1006212941 175
96 3300013105 Ga0157369_10748863 Ga0157369_107488632 175
97 3300041407 Ga0439447_000932 Ga0439447_000932_8345_8923 175
98 3300048924 Ga0496121_0000036 Ga0496121_0000036_307772_308347 175
99 3300003771 Ga0055526_1000006 Ga0055526_100000682 176
100 3300003773 Ga0055537_1000003 Ga0055537_1000003144 176
101 3300003773 Ga0055537_1000018 Ga0055537_100001882 176
102 3300003775 Ga0055524_1000009 Ga0055524_1000009144 176
103 3300003784 Ga0055534_1000004 Ga0055534_1000004144 176
104 3300003790 Ga0055528_1000003 Ga0055528_1000003177 176
105 3300005347 Ga0070668_100486000 Ga0070668_1004860002 176
106 3300005367 Ga0070667_100147132 Ga0070667_1001471321 176
107 3300009553 Ga0105249_10139712 Ga0105249_101397123 176
108 3300025263 Ga0209565_1000001 Ga0209565_10000012247 176
109 3300025273 Ga0209673_1000001 Ga0209673_10000012247 176
110 3300025291 Ga0209675_1000001 Ga0209675_1000001285 176
111 3300025295 Ga0209564_1000001 Ga0209564_1000001447 176
112 3300025299 Ga0209256_1000002 Ga0209256_10000021105 176
113 3300025961 Ga0207712_10284565 Ga0207712_102845651 176
114 3300025986 Ga0207658_10233991 Ga0207658_102339913 176
115 3300028786 Ga0307517_10206908 Ga0307517_102069082 177
116 3300028794 Ga0307515_10000707 Ga0307515_1000070735 177
117 3300053122 Ga0500608_069319 Ga0500608_069319_963_1535 177
118 3300061719 Ga0466962_0073543 Ga0466962_0073543_682_1233 177
119 3300005327 Ga0070658_10638602 Ga0070658_106386021 178
120 3300005339 Ga0070660_100228197 Ga0070660_1002281972 178
121 3300005578 Ga0068854_100242577 Ga0068854_1002425772 178
122 3300005614 Ga0068856_100478100 Ga0068856_1004781002 178
123 3300010375 Ga0105239_10638915 Ga0105239_106389152 178
124 3300025909 Ga0207705_10459832 Ga0207705_104598321 178
125 3300025917 Ga0207660_10036926 Ga0207660_100369262 178
126 3300025921 Ga0207652_10054841 Ga0207652_100548413 178
127 3300025949 Ga0207667_10609064 Ga0207667_106090642 178
128 3300026041 Ga0207639_10156773 Ga0207639_101567731 178
129 3300026078 Ga0207702_10380912 Ga0207702_103809121 178
130 3300026142 Ga0207698_10019600 Ga0207698_100196001 178
131 3300049579 Ga0501043_1053607 Ga0501043_1053607_20_556 178
132 3300049822 Ga0501035_0243029 Ga0501035_0243029_11_547 178
133 iso_pu_bacteria 2738541283 2738759328 178
134 3300003316 rootH1_10151956 rootH1_101519563 179
135 3300003320 rootH2_10008932 rootH2_100089322 179
136 3300003320 rootH2_10032886 rootH2_1003288610 179
137 3300003323 rootH1_10254323 rootH1_102543233 179
138 3300005563 Ga0068855_100046105 Ga0068855_1000461052 179
139 3300006237 Ga0097621_100178821 Ga0097621_1001788213 179
140 3300025914 Ga0207671_10089273 Ga0207671_100892732 179
141 3300025949 Ga0207667_10030056 Ga0207667_100300564 179
142 3300031251 Ga0265327_10000115 Ga0265327_1000011521 179
143 iso_pu_bacteria 2599185184 2599477133 179
144 iso_pu_bacteria 2928078545 2928079047 179
145 iso_pu_bacteria 2928147474 2928148582 179
146 iso_pu_bacteria 2932082852 2932085876 179
147 iso_pu_bacteria 2738541278 2738725241 180
148 3300009101 Ga0105247_10003817 Ga0105247_100038176 181
149 3300021384 Ga0213876_10000680 Ga0213876_1000068011 181
150 3300025900 Ga0207710_10000906 Ga0207710_100009063 181
151 3300039437 Ga0436365_1468940 Ga0436365_1468940_18401_18964 181
152 3300049570 Ga0501033_0016645 Ga0501033_0016645_2112_2675 181
153 3300049571 Ga0501034_0048388 Ga0501034_0048388_3529_4092 181
154 3300049571 Ga0501034_0064484 Ga0501034_0064484_2860_3423 181
155 3300049822 Ga0501035_1039661 Ga0501035_1039661_19_582 181
156 3300049823 Ga0501044_0014888 Ga0501044_0014888_6538_7101 181
157 3300005288 Ga0065714_10075158 Ga0065714_100751582 182
158 3300005617 Ga0068859_100167906 Ga0068859_1001679062 182
159 3300005843 Ga0068860_100050303 Ga0068860_1000503034 182
160 3300006931 Ga0097620_100167901 Ga0097620_1001679012 182
161 3300009098 Ga0105245_10624377 Ga0105245_106243771 182
162 3300009176 Ga0105242_10446482 Ga0105242_104464821 182
163 3300009545 Ga0105237_10012148 Ga0105237_100121485 182
164 3300009553 Ga0105249_10019812 Ga0105249_100198126 182
165 3300013104 Ga0157370_10476091 Ga0157370_104760911 182
166 3300013306 Ga0163162_10238891 Ga0163162_102388912 182
167 3300015261 Ga0182006_1000134 Ga0182006_100013433 182
168 3300017792 Ga0163161_10009869 Ga0163161_100098693 182
169 3300025914 Ga0207671_10008007 Ga0207671_100080076 182
170 3300025923 Ga0207681_10331527 Ga0207681_103315272 182
171 3300025940 Ga0207691_10284505 Ga0207691_102845052 182
172 3300028381 Ga0268264_10064089 Ga0268264_100640892 182
173 3300042876 Ga0451577_0938505 Ga0451577_0938505_89_658 182
174 3300044712 Ga0453684_1551179 Ga0453684_1551179_31_600 182
175 3300046689 Ga0495613_0424596 Ga0495613_0424596_172_777 182
176 3300048925 Ga0496122_0001285 Ga0496122_0001285_17453_18061 182
177 3300048926 Ga0496123_0003994 Ga0496123_0003994_4547_5155 182
178 3300001990 JGI24737J22298_10000041 JGI24737J22298_1000004122 183
179 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001499 183
180 3300003316 rootH1_10111220 rootH1_101112203 183
181 3300003320 rootH2_10167396 rootH2_101673962 183
182 3300003322 rootL2_10227972 rootL2_102279721 183
183 3300004801 Ga0058860_11662651 Ga0058860_116626511 183
184 3300005328 Ga0070676_10027954 Ga0070676_100279544 183
185 3300005328 Ga0070676_10766442 Ga0070676_107664421 183
186 3300005330 Ga0070690_100061206 Ga0070690_1000612062 183
187 3300005331 Ga0070670_100228528 Ga0070670_1002285282 183
188 3300005333 Ga0070677_10074147 Ga0070677_100741472 183
189 3300005334 Ga0068869_100127536 Ga0068869_1001275362 183
190 3300005335 Ga0070666_10000132 Ga0070666_1000013236 183
191 3300005335 Ga0070666_10269935 Ga0070666_102699351 183
192 3300005336 Ga0070680_100005853 Ga0070680_1000058536 183
193 3300005337 Ga0070682_100030591 Ga0070682_1000305914 183
194 3300005338 Ga0068868_100191322 Ga0068868_1001913222 183
195 3300005338 Ga0068868_100222536 Ga0068868_1002225362 183
196 3300005339 Ga0070660_100202995 Ga0070660_1002029952 183
197 3300005340 Ga0070689_100044786 Ga0070689_1000447865 183
198 3300005341 Ga0070691_10020993 Ga0070691_100209932 183
199 3300005347 Ga0070668_100279911 Ga0070668_1002799112 183
200 3300005353 Ga0070669_100043902 Ga0070669_1000439025 183
201 3300005354 Ga0070675_100125401 Ga0070675_1001254012 183
202 3300005354 Ga0070675_100152510 Ga0070675_1001525104 183
203 3300005355 Ga0070671_100022885 Ga0070671_1000228853 183
204 3300005355 Ga0070671_100052161 Ga0070671_1000521611 183
205 3300005356 Ga0070674_100173699 Ga0070674_1001736992 183
206 3300005356 Ga0070674_100412162 Ga0070674_1004121622 183
207 3300005364 Ga0070673_100030540 Ga0070673_1000305402 183
208 3300005364 Ga0070673_100050694 Ga0070673_1000506943 183
209 3300005364 Ga0070673_100091218 Ga0070673_1000912182 183
210 3300005364 Ga0070673_100405374 Ga0070673_1004053741 183
211 3300005364 Ga0070673_100700638 Ga0070673_1007006381 183
212 3300005367 Ga0070667_100130903 Ga0070667_1001309031 183
213 3300005367 Ga0070667_100414060 Ga0070667_1004140602 183
214 3300005441 Ga0070700_100203486 Ga0070700_1002034862 183
215 3300005456 Ga0070678_100096047 Ga0070678_1000960471 183
216 3300005456 Ga0070678_100232610 Ga0070678_1002326102 183
217 3300005458 Ga0070681_10145809 Ga0070681_101458094 183
218 3300005459 Ga0068867_100178837 Ga0068867_1001788372 183
219 3300005459 Ga0068867_100418801 Ga0068867_1004188012 183
220 3300005530 Ga0070679_100018717 Ga0070679_1000187174 183
221 3300005539 Ga0068853_101230800 Ga0068853_1012308001 183
222 3300005543 Ga0070672_100234716 Ga0070672_1002347162 183
223 3300005543 Ga0070672_100513536 Ga0070672_1005135362 183
224 3300005543 Ga0070672_100774091 Ga0070672_1007740912 183
225 3300005544 Ga0070686_100182653 Ga0070686_1001826532 183
226 3300005544 Ga0070686_100923908 Ga0070686_1009239081 183
227 3300005547 Ga0070693_100013364 Ga0070693_1000133644 183
228 3300005547 Ga0070693_100911376 Ga0070693_1009113761 183
229 3300005548 Ga0070665_100008754 Ga0070665_1000087542 183
230 3300005548 Ga0070665_100906380 Ga0070665_1009063802 183
231 3300005563 Ga0068855_100038985 Ga0068855_1000389853 183
232 3300005563 Ga0068855_100145358 Ga0068855_1001453582 183
233 3300005564 Ga0070664_100942060 Ga0070664_1009420602 183
234 3300005577 Ga0068857_100156342 Ga0068857_1001563422 183
235 3300005578 Ga0068854_100182488 Ga0068854_1001824882 183
236 3300005578 Ga0068854_100339682 Ga0068854_1003396823 183
237 3300005614 Ga0068856_100365035 Ga0068856_1003650352 183
238 3300005614 Ga0068856_101250827 Ga0068856_1012508271 183
239 3300005615 Ga0070702_100155968 Ga0070702_1001559682 183
240 3300005616 Ga0068852_100005191 Ga0068852_1000051913 183
241 3300005616 Ga0068852_100149778 Ga0068852_1001497782 183
242 3300005617 Ga0068859_100000003 Ga0068859_100000003331 183
243 3300005617 Ga0068859_100142729 Ga0068859_1001427292 183
244 3300005618 Ga0068864_100018349 Ga0068864_1000183493 183
245 3300005719 Ga0068861_100758197 Ga0068861_1007581971 183
246 3300005719 Ga0068861_100962435 Ga0068861_1009624351 183
247 3300005840 Ga0068870_10054743 Ga0068870_100547434 183
248 3300005840 Ga0068870_10337090 Ga0068870_103370902 183
249 3300005840 Ga0068870_10571574 Ga0068870_105715741 183
250 3300005841 Ga0068863_100000394 Ga0068863_10000039428 183
251 3300005841 Ga0068863_100777484 Ga0068863_1007774843 183
252 3300005842 Ga0068858_100026331 Ga0068858_1000263313 183
253 3300005842 Ga0068858_100543147 Ga0068858_1005431472 183
254 3300005843 Ga0068860_100006719 Ga0068860_10000671913 183
255 3300005843 Ga0068860_100017594 Ga0068860_1000175944 183
256 3300005843 Ga0068860_100086520 Ga0068860_1000865202 183
257 3300005985 Ga0081539_10186221 Ga0081539_101862212 183
258 3300006237 Ga0097621_100138601 Ga0097621_1001386012 183
259 3300006237 Ga0097621_100367013 Ga0097621_1003670131 183
260 3300006237 Ga0097621_100779169 Ga0097621_1007791691 183
261 3300006353 Ga0075370_10620101 Ga0075370_106201011 183
262 3300006358 Ga0068871_100023830 Ga0068871_1000238304 183
263 3300006358 Ga0068871_100492880 Ga0068871_1004928801 183
264 3300006358 Ga0068871_100930073 Ga0068871_1009300731 183
265 3300006881 Ga0068865_100089792 Ga0068865_1000897922 183
266 3300006881 Ga0068865_100133523 Ga0068865_1001335232 183
267 3300006931 Ga0097620_100000003 Ga0097620_100000003331 183
268 3300006931 Ga0097620_100142730 Ga0097620_1001427302 183
269 3300009093 Ga0105240_10005940 Ga0105240_1000594018 183
270 3300009098 Ga0105245_10136050 Ga0105245_101360502 183
271 3300009101 Ga0105247_10471379 Ga0105247_104713792 183
272 3300009174 Ga0105241_10001671 Ga0105241_100016716 183
273 3300009174 Ga0105241_10004426 Ga0105241_1000442611 183
274 3300009174 Ga0105241_10138015 Ga0105241_101380153 183
275 3300009174 Ga0105241_10218123 Ga0105241_102181232 183
276 3300009176 Ga0105242_10049156 Ga0105242_100491562 183
277 3300009176 Ga0105242_10283338 Ga0105242_102833381 183
278 3300009545 Ga0105237_10001393 Ga0105237_1000139314 183
279 3300009545 Ga0105237_10105253 Ga0105237_101052534 183
280 3300009545 Ga0105237_10397719 Ga0105237_103977192 183
281 3300009553 Ga0105249_10002967 Ga0105249_100029675 183
282 3300009553 Ga0105249_10676004 Ga0105249_106760041 183
283 3300010375 Ga0105239_10293414 Ga0105239_102934141 183
284 3300011119 Ga0105246_10029078 Ga0105246_100290782 183
285 3300013102 Ga0157371_10057536 Ga0157371_100575362 183
286 3300013104 Ga0157370_10030448 Ga0157370_100304482 183
287 3300013104 Ga0157370_10775951 Ga0157370_107759511 183
288 3300013105 Ga0157369_10033481 Ga0157369_100334814 183
289 3300013296 Ga0157374_10100124 Ga0157374_101001243 183
290 3300013296 Ga0157374_10111273 Ga0157374_101112732 183
291 3300013296 Ga0157374_10585127 Ga0157374_105851271 183
292 3300013297 Ga0157378_10009315 Ga0157378_100093154 183
293 3300013297 Ga0157378_10029608 Ga0157378_100296082 183
294 3300013297 Ga0157378_10062135 Ga0157378_100621353 183
295 3300013297 Ga0157378_10148573 Ga0157378_101485732 183
296 3300013306 Ga0163162_10000328 Ga0163162_1000032820 183
297 3300013306 Ga0163162_10006392 Ga0163162_100063924 183
298 3300013306 Ga0163162_10011375 Ga0163162_100113753 183
299 3300013306 Ga0163162_10624346 Ga0163162_106243462 183
300 3300013306 Ga0163162_11640324 Ga0163162_116403241 183
301 3300013307 Ga0157372_10051539 Ga0157372_100515394 183
302 3300013308 Ga0157375_10173794 Ga0157375_101737942 183
303 3300013308 Ga0157375_10409079 Ga0157375_104090792 183
304 3300013308 Ga0157375_10672403 Ga0157375_106724032 183
305 3300014325 Ga0163163_10534761 Ga0163163_105347612 183
306 3300014325 Ga0163163_10573857 Ga0163163_105738572 183
307 3300014326 Ga0157380_10049655 Ga0157380_100496552 183
308 3300014968 Ga0157379_10018199 Ga0157379_100181994 183
309 3300014968 Ga0157379_10515172 Ga0157379_105151722 183
310 3300017792 Ga0163161_10344771 Ga0163161_103447712 183
311 3300017792 Ga0163161_11406790 Ga0163161_114067901 183
312 3300020080 Ga0206350_10795179 Ga0206350_107951791 183
313 3300021384 Ga0213876_10073833 Ga0213876_100738332 183
314 3300025893 Ga0207682_10129934 Ga0207682_101299341 183
315 3300025899 Ga0207642_10172273 Ga0207642_101722732 183
316 3300025900 Ga0207710_10263521 Ga0207710_102635211 183
317 3300025900 Ga0207710_10326401 Ga0207710_103264012 183
318 3300025901 Ga0207688_10025859 Ga0207688_100258592 183
319 3300025901 Ga0207688_10093027 Ga0207688_100930272 183
320 3300025903 Ga0207680_10000014 Ga0207680_10000014113 183
321 3300025904 Ga0207647_10186786 Ga0207647_101867861 183
322 3300025904 Ga0207647_10257031 Ga0207647_102570312 183
323 3300025907 Ga0207645_10003031 Ga0207645_1000303111 183
324 3300025907 Ga0207645_10022717 Ga0207645_100227173 183
325 3300025908 Ga0207643_10172958 Ga0207643_101729582 183
326 3300025908 Ga0207643_10484803 Ga0207643_104848031 183
327 3300025909 Ga0207705_10540318 Ga0207705_105403181 183
328 3300025911 Ga0207654_10001242 Ga0207654_100012424 183
329 3300025911 Ga0207654_10002095 Ga0207654_100020955 183
330 3300025912 Ga0207707_10002312 Ga0207707_1000231212 183
331 3300025913 Ga0207695_10024527 Ga0207695_100245272 183
332 3300025914 Ga0207671_10000746 Ga0207671_100007468 183
333 3300025917 Ga0207660_10003846 Ga0207660_100038465 183
334 3300025921 Ga0207652_10017345 Ga0207652_100173457 183
335 3300025923 Ga0207681_10026831 Ga0207681_100268313 183
336 3300025925 Ga0207650_10677585 Ga0207650_106775852 183
337 3300025926 Ga0207659_10096476 Ga0207659_100964764 183
338 3300025926 Ga0207659_10224559 Ga0207659_102245592 183
339 3300025927 Ga0207687_10253432 Ga0207687_102534322 183
340 3300025931 Ga0207644_10016463 Ga0207644_100164633 183
341 3300025931 Ga0207644_10334885 Ga0207644_103348851 183
342 3300025934 Ga0207686_10013604 Ga0207686_100136043 183
343 3300025934 Ga0207686_10688317 Ga0207686_106883171 183
344 3300025936 Ga0207670_10364441 Ga0207670_103644411 183
345 3300025937 Ga0207669_10020055 Ga0207669_100200554 183
346 3300025937 Ga0207669_10621009 Ga0207669_106210091 183
347 3300025938 Ga0207704_10226476 Ga0207704_102264762 183
348 3300025940 Ga0207691_10015603 Ga0207691_100156033 183
349 3300025940 Ga0207691_10067065 Ga0207691_100670651 183
350 3300025940 Ga0207691_10098458 Ga0207691_100984582 183
351 3300025940 Ga0207691_10119013 Ga0207691_101190132 183
352 3300025942 Ga0207689_10002471 Ga0207689_100024716 183
353 3300025942 Ga0207689_10006705 Ga0207689_100067054 183
354 3300025942 Ga0207689_10062707 Ga0207689_100627072 183
355 3300025945 Ga0207679_10670335 Ga0207679_106703352 183
356 3300025949 Ga0207667_10065568 Ga0207667_100655685 183
357 3300025949 Ga0207667_10277346 Ga0207667_102773462 183
358 3300025960 Ga0207651_10066690 Ga0207651_100666902 183
359 3300025960 Ga0207651_10357867 Ga0207651_103578672 183
360 3300025960 Ga0207651_10881002 Ga0207651_108810022 183
361 3300025961 Ga0207712_10071114 Ga0207712_100711143 183
362 3300025972 Ga0207668_10081891 Ga0207668_100818912 183
363 3300025972 Ga0207668_10574412 Ga0207668_105744122 183
364 3300025981 Ga0207640_10144275 Ga0207640_101442752 183
365 3300025986 Ga0207658_10391069 Ga0207658_103910691 183
366 3300025986 Ga0207658_10602724 Ga0207658_106027241 183
367 3300026023 Ga0207677_10052340 Ga0207677_100523402 183
368 3300026035 Ga0207703_10093203 Ga0207703_100932032 183
369 3300026075 Ga0207708_10272109 Ga0207708_102721091 183
370 3300026078 Ga0207702_10230736 Ga0207702_102307362 183
371 3300026088 Ga0207641_10000015 Ga0207641_10000015204 183
372 3300026089 Ga0207648_10002156 Ga0207648_1000215618 183
373 3300026089 Ga0207648_10059637 Ga0207648_100596371 183
374 3300026089 Ga0207648_10472966 Ga0207648_104729662 183
375 3300026089 Ga0207648_10994823 Ga0207648_109948231 183
376 3300026095 Ga0207676_10040303 Ga0207676_100403033 183
377 3300026095 Ga0207676_10171751 Ga0207676_101717512 183
378 3300026116 Ga0207674_10151233 Ga0207674_101512332 183
379 3300026118 Ga0207675_100082228 Ga0207675_1000822283 183
380 3300026118 Ga0207675_100324409 Ga0207675_1003244092 183
381 3300026118 Ga0207675_100340726 Ga0207675_1003407261 183
382 3300026121 Ga0207683_10063384 Ga0207683_100633844 183
383 3300026121 Ga0207683_10076193 Ga0207683_100761931 183
384 3300026142 Ga0207698_10001356 Ga0207698_100013563 183
385 3300026142 Ga0207698_10809343 Ga0207698_108093432 183
386 3300028379 Ga0268266_10023629 Ga0268266_100236294 183
387 3300028379 Ga0268266_10776664 Ga0268266_107766642 183
388 3300028379 Ga0268266_11034053 Ga0268266_110340531 183
389 3300028380 Ga0268265_10348303 Ga0268265_103483031 183
390 3300028381 Ga0268264_10003753 Ga0268264_100037534 183
391 3300028381 Ga0268264_10006147 Ga0268264_100061473 183
392 3300028381 Ga0268264_10612190 Ga0268264_106121901 183
393 3300039437 Ga0436365_1170113 Ga0436365_1170113_965_1537 183
394 3300045976 Ga0466967_0376354 Ga0466967_0376354_612_1280 183
395 3300046460 Ga0495638_0214312 Ga0495638_0214312_493_1059 183
396 3300046471 Ga0495650_0000273 Ga0495650_0000273_30088_30654 183
397 3300046492 Ga0495585_0001701 Ga0495585_0001701_9096_9662 183
398 3300046506 Ga0495583_0024219 Ga0495583_0024219_2061_2627 183
399 3300046507 Ga0495606_0000130 Ga0495606_0000130_31684_32250 183
400 3300046512 Ga0495610_0009742 Ga0495610_0009742_73_639 183
401 3300046513 Ga0495616_0009400 Ga0495616_0009400_1433_1999 183
402 3300046519 Ga0495632_0227832 Ga0495632_0227832_197_763 183
403 3300046558 Ga0495633_0003361 Ga0495633_0003361_6330_6896 183
404 3300046660 Ga0495625_0000036 Ga0495625_0000036_197126_197692 183
405 3300046665 Ga0495661_0044534 Ga0495661_0044534_1846_2412 183
406 3300046694 Ga0495649_0000017 Ga0495649_0000017_24032_24598 183
407 3300046810 Ga0495660_0032812 Ga0495660_0032812_2161_2727 183
408 3300049568 Ga0501031_0036070 Ga0501031_0036070_541_1110 183
409 3300049569 Ga0501032_0101834 Ga0501032_0101834_1194_1763 183
410 3300049571 Ga0501034_0344559 Ga0501034_0344559_520_1089 183
411 3300049573 Ga0501037_0012307 Ga0501037_0012307_4167_4736 183
412 3300049574 Ga0501038_0033490 Ga0501038_0033490_134_703 183
413 3300049579 Ga0501043_0416409 Ga0501043_0416409_77_646 183
414 3300049580 Ga0501046_0018347 Ga0501046_0018347_5207_5779 183
415 3300049580 Ga0501046_0038148 Ga0501046_0038148_3095_3664 183
416 3300049581 Ga0501047_0378521 Ga0501047_0378521_286_855 183
417 3300049583 Ga0501067_0087767 Ga0501067_0087767_960_1532 183
418 3300049584 Ga0501068_0315447 Ga0501068_0315447_198_770 183
419 3300049586 Ga0501070_0014914 Ga0501070_0014914_5355_5927 183
420 3300049589 Ga0501073_0183383 Ga0501073_0183383_541_1110 183
421 3300049590 Ga0501074_0102988 Ga0501074_0102988_32_604 183
422 3300049742 Ga0501080_0121551 Ga0501080_0121551_212_784 183
423 3300049744 Ga0501083_0039932 Ga0501083_0039932_958_1530 183
424 3300049823 Ga0501044_0077306 Ga0501044_0077306_2391_2963 183
425 3300049823 Ga0501044_0763853 Ga0501044_0763853_141_710 183
426 3300054114 Ga0501084_0229319 Ga0501084_0229319_176_748 183
427 3300060353 Ga0501082_0346157 Ga0501082_0346157_229_801 183
428 3300001979 JGI24740J21852_10017204 JGI24740J21852_100172043 184
429 3300003316 rootH1_10042093 rootH1_100420932 184
430 3300003320 rootH2_10133367 rootH2_101333671 184
431 3300003322 rootL2_10149769 rootL2_101497692 184
432 3300003323 rootH1_10254552 rootH1_102545521 184
433 3300003354 JGI25160J50197_1003572 JGI25160J50197_10035725 184
434 3300005289 Ga0065704_10113950 Ga0065704_101139502 184
435 3300005290 Ga0065712_10237453 Ga0065712_102374532 184
436 3300005327 Ga0070658_10005453 Ga0070658_100054533 184
437 3300005328 Ga0070676_10000375 Ga0070676_1000037515 184
438 3300005330 Ga0070690_100144687 Ga0070690_1001446872 184
439 3300005333 Ga0070677_10173510 Ga0070677_101735102 184
440 3300005334 Ga0068869_101349297 Ga0068869_1013492971 184
441 3300005335 Ga0070666_10000885 Ga0070666_100008852 184
442 3300005338 Ga0068868_100000075 Ga0068868_1000000757 184
443 3300005338 Ga0068868_100433381 Ga0068868_1004333811 184
444 3300005344 Ga0070661_100242948 Ga0070661_1002429482 184
445 3300005347 Ga0070668_100000859 Ga0070668_10000085916 184
446 3300005353 Ga0070669_100996238 Ga0070669_1009962381 184
447 3300005355 Ga0070671_100183430 Ga0070671_1001834301 184
448 3300005356 Ga0070674_100203274 Ga0070674_1002032742 184
449 3300005364 Ga0070673_100000448 Ga0070673_10000044814 184
450 3300005367 Ga0070667_100000482 Ga0070667_10000048224 184
451 3300005367 Ga0070667_100676469 Ga0070667_1006764691 184
452 3300005367 Ga0070667_100938123 Ga0070667_1009381231 184
453 3300005455 Ga0070663_100261704 Ga0070663_1002617041 184
454 3300005456 Ga0070678_100080301 Ga0070678_1000803012 184
455 3300005457 Ga0070662_100009485 Ga0070662_1000094855 184
456 3300005459 Ga0068867_100005707 Ga0068867_1000057074 184
457 3300005459 Ga0068867_100006698 Ga0068867_1000066982 184
458 3300005539 Ga0068853_100007384 Ga0068853_1000073848 184
459 3300005539 Ga0068853_100043469 Ga0068853_1000434692 184
460 3300005543 Ga0070672_100000361 Ga0070672_10000036117 184
461 3300005548 Ga0070665_100000001 Ga0070665_100000001583 184
462 3300005548 Ga0070665_100002163 Ga0070665_1000021634 184
463 3300005548 Ga0070665_101187688 Ga0070665_1011876881 184
464 3300005563 Ga0068855_100009719 Ga0068855_1000097194 184
465 3300005563 Ga0068855_100038549 Ga0068855_1000385492 184
466 3300005563 Ga0068855_101451803 Ga0068855_1014518031 184
467 3300005577 Ga0068857_100005562 Ga0068857_10000556210 184
468 3300005577 Ga0068857_100134162 Ga0068857_1001341622 184
469 3300005578 Ga0068854_100067427 Ga0068854_1000674273 184
470 3300005616 Ga0068852_100103743 Ga0068852_1001037432 184
471 3300005617 Ga0068859_100626379 Ga0068859_1006263792 184
472 3300005617 Ga0068859_101308631 Ga0068859_1013086311 184
473 3300005618 Ga0068864_100000785 Ga0068864_1000007859 184
474 3300005618 Ga0068864_100101243 Ga0068864_1001012432 184
475 3300005719 Ga0068861_100026816 Ga0068861_1000268161 184
476 3300005834 Ga0068851_10008297 Ga0068851_100082975 184
477 3300005840 Ga0068870_10367683 Ga0068870_103676831 184
478 3300005842 Ga0068858_100042626 Ga0068858_1000426262 184
479 3300005842 Ga0068858_100475728 Ga0068858_1004757282 184
480 3300005843 Ga0068860_100000097 Ga0068860_100000097133 184
481 3300005843 Ga0068860_100001074 Ga0068860_1000010743 184
482 3300005843 Ga0068860_100002836 Ga0068860_10000283618 184
483 3300005843 Ga0068860_100115869 Ga0068860_1001158692 184
484 3300006237 Ga0097621_100004135 Ga0097621_10000413511 184
485 3300006237 Ga0097621_100286549 Ga0097621_1002865492 184
486 3300006358 Ga0068871_100048965 Ga0068871_1000489652 184
487 3300006358 Ga0068871_101269713 Ga0068871_1012697131 184
488 3300006881 Ga0068865_100021001 Ga0068865_1000210012 184
489 3300006931 Ga0097620_100626378 Ga0097620_1006263782 184
490 3300006931 Ga0097620_101308671 Ga0097620_1013086711 184
491 3300009093 Ga0105240_10003320 Ga0105240_100033206 184
492 3300009093 Ga0105240_10036865 Ga0105240_100368653 184
493 3300009093 Ga0105240_10102886 Ga0105240_101028862 184
494 3300009148 Ga0105243_10025290 Ga0105243_100252905 184
495 3300009174 Ga0105241_10001857 Ga0105241_100018572 184
496 3300009174 Ga0105241_10146570 Ga0105241_101465702 184
497 3300009176 Ga0105242_10020147 Ga0105242_100201473 184
498 3300009176 Ga0105242_10053984 Ga0105242_100539842 184
499 3300009177 Ga0105248_10081980 Ga0105248_100819803 184
500 3300009545 Ga0105237_10004900 Ga0105237_100049004 184
501 3300009545 Ga0105237_10013542 Ga0105237_100135425 184
502 3300009545 Ga0105237_10018295 Ga0105237_100182952 184
503 3300009545 Ga0105237_10030014 Ga0105237_100300147 184
504 3300009545 Ga0105237_10870577 Ga0105237_108705772 184
505 3300009551 Ga0105238_10002044 Ga0105238_100020447 184
506 3300009551 Ga0105238_10239520 Ga0105238_102395203 184
507 3300009553 Ga0105249_10075804 Ga0105249_100758042 184
508 3300009553 Ga0105249_10259817 Ga0105249_102598172 184
509 3300010375 Ga0105239_10000529 Ga0105239_1000052914 184
510 3300010375 Ga0105239_10009377 Ga0105239_100093773 184
511 3300010375 Ga0105239_10019080 Ga0105239_100190804 184
512 3300010375 Ga0105239_10200579 Ga0105239_102005792 184
513 3300010375 Ga0105239_10604337 Ga0105239_106043372 184
514 3300010375 Ga0105239_10903747 Ga0105239_109037472 184
515 3300011119 Ga0105246_10061764 Ga0105246_100617641 184
516 3300011119 Ga0105246_10566531 Ga0105246_105665311 184
517 3300013102 Ga0157371_10677530 Ga0157371_106775301 184
518 3300013296 Ga0157374_10002589 Ga0157374_100025894 184
519 3300013297 Ga0157378_10026601 Ga0157378_100266012 184
520 3300013297 Ga0157378_10412406 Ga0157378_104124062 184
521 3300013306 Ga0163162_10000377 Ga0163162_100003774 184
522 3300013306 Ga0163162_10003770 Ga0163162_100037705 184
523 3300013306 Ga0163162_10246634 Ga0163162_102466342 184
524 3300013306 Ga0163162_11083043 Ga0163162_110830432 184
525 3300013306 Ga0163162_11419576 Ga0163162_114195761 184
526 3300013307 Ga0157372_10041370 Ga0157372_100413704 184
527 3300013307 Ga0157372_10344447 Ga0157372_103444472 184
528 3300013308 Ga0157375_10004745 Ga0157375_100047455 184
529 3300013308 Ga0157375_10365663 Ga0157375_103656632 184
530 3300014325 Ga0163163_10000752 Ga0163163_1000075218 184
531 3300014325 Ga0163163_10109276 Ga0163163_101092762 184
532 3300014968 Ga0157379_10000440 Ga0157379_100004403 184
533 3300014968 Ga0157379_10313908 Ga0157379_103139082 184
534 3300014969 Ga0157376_10000381 Ga0157376_100003814 184
535 3300017792 Ga0163161_10062200 Ga0163161_100622002 184
536 3300017792 Ga0163161_10323519 Ga0163161_103235191 184
537 3300025302 Ga0207426_1000052 Ga0207426_1000052104 184
538 3300025315 Ga0207697_10025166 Ga0207697_100251662 184
539 3300025321 Ga0207656_10000424 Ga0207656_1000042413 184
540 3300025903 Ga0207680_10009667 Ga0207680_100096672 184
541 3300025907 Ga0207645_10000949 Ga0207645_100009499 184
542 3300025909 Ga0207705_10014112 Ga0207705_100141125 184
543 3300025911 Ga0207654_10005208 Ga0207654_100052083 184
544 3300025911 Ga0207654_10646838 Ga0207654_106468381 184
545 3300025913 Ga0207695_10000515 Ga0207695_1000051549 184
546 3300025913 Ga0207695_10042003 Ga0207695_100420032 184
547 3300025913 Ga0207695_10047145 Ga0207695_100471453 184
548 3300025913 Ga0207695_10132273 Ga0207695_101322733 184
549 3300025914 Ga0207671_10003348 Ga0207671_1000334810 184
550 3300025914 Ga0207671_10003740 Ga0207671_100037404 184
551 3300025914 Ga0207671_10004160 Ga0207671_100041602 184
552 3300025914 Ga0207671_10056900 Ga0207671_100569003 184
553 3300025914 Ga0207671_10081878 Ga0207671_100818783 184
554 3300025920 Ga0207649_10334564 Ga0207649_103345642 184
555 3300025924 Ga0207694_10011115 Ga0207694_100111152 184
556 3300025925 Ga0207650_10183514 Ga0207650_101835142 184
557 3300025933 Ga0207706_10031196 Ga0207706_100311964 184
558 3300025934 Ga0207686_10092438 Ga0207686_100924382 184
559 3300025935 Ga0207709_10192079 Ga0207709_101920792 184
560 3300025938 Ga0207704_10004208 Ga0207704_100042084 184
561 3300025940 Ga0207691_10000037 Ga0207691_1000003789 184
562 3300025941 Ga0207711_10175960 Ga0207711_101759602 184
563 3300025942 Ga0207689_10282084 Ga0207689_102820842 184
564 3300025942 Ga0207689_11114202 Ga0207689_111142021 184
565 3300025945 Ga0207679_11097643 Ga0207679_110976431 184
566 3300025949 Ga0207667_10009260 Ga0207667_100092604 184
567 3300025960 Ga0207651_10000443 Ga0207651_1000044310 184
568 3300025961 Ga0207712_10098348 Ga0207712_100983482 184
569 3300025972 Ga0207668_10001307 Ga0207668_1000130710 184
570 3300025986 Ga0207658_10000629 Ga0207658_100006295 184
571 3300025986 Ga0207658_10778212 Ga0207658_107782122 184
572 3300026023 Ga0207677_10004861 Ga0207677_100048614 184
573 3300026023 Ga0207677_10380101 Ga0207677_103801012 184
574 3300026023 Ga0207677_10389914 Ga0207677_103899142 184
575 3300026035 Ga0207703_10004145 Ga0207703_100041455 184
576 3300026035 Ga0207703_10331636 Ga0207703_103316362 184
577 3300026035 Ga0207703_10552576 Ga0207703_105525762 184
578 3300026041 Ga0207639_10016611 Ga0207639_100166113 184
579 3300026041 Ga0207639_10320012 Ga0207639_103200122 184
580 3300026041 Ga0207639_10484348 Ga0207639_104843481 184
581 3300026041 Ga0207639_10541615 Ga0207639_105416152 184
582 3300026078 Ga0207702_10038638 Ga0207702_100386383 184
583 3300026088 Ga0207641_10239613 Ga0207641_102396132 184
584 3300026089 Ga0207648_10001276 Ga0207648_100012766 184
585 3300026089 Ga0207648_10013274 Ga0207648_100132741 184
586 3300026095 Ga0207676_10002535 Ga0207676_100025355 184
587 3300026095 Ga0207676_10424070 Ga0207676_104240702 184
588 3300026116 Ga0207674_10072510 Ga0207674_100725101 184
589 3300026116 Ga0207674_10247155 Ga0207674_102471552 184
590 3300026118 Ga0207675_101262661 Ga0207675_1012626612 184
591 3300026142 Ga0207698_10431788 Ga0207698_104317881 184
592 3300028379 Ga0268266_10000038 Ga0268266_1000003858 184
593 3300028379 Ga0268266_10004818 Ga0268266_100048184 184
594 3300028381 Ga0268264_10000167 Ga0268264_1000016794 184
595 3300028381 Ga0268264_10153754 Ga0268264_101537542 184
596 3300028381 Ga0268264_10406699 Ga0268264_104066992 184
597 3300030521 Ga0307511_10007925 Ga0307511_100079255 184
598 3300031456 Ga0307513_10304684 Ga0307513_103046842 184
599 3300031730 Ga0307516_10000656 Ga0307516_1000065628 184
600 3300031730 Ga0307516_10311658 Ga0307516_103116581 184
601 3300033180 Ga0307510_10378843 Ga0307510_103788432 184
602 3300035118 Ga0373954_0234289 Ga0373954_0234289_38_613 184
603 3300041404 Ga0439436_0006309 Ga0439436_0006309_2861_3436 184
604 3300041491 Ga0451833_1433807 Ga0451833_1433807_18_593 184
605 3300041498 Ga0451841_0881867 Ga0451841_0881867_222_797 184
606 3300042007 Ga0439449_0028526 Ga0439449_0028526_642_1217 184
607 3300042014 Ga0439457_000583 Ga0439457_000583_5501_6076 184
608 3300042015 Ga0439462_0008982 Ga0439462_0008982_416_991 184
609 3300044656 Ga0466969_0001216 Ga0466969_0001216_10710_11285 184
610 3300044658 Ga0466972_0000928 Ga0466972_0000928_3770_4348 184
611 3300044684 Ga0466966_0000184 Ga0466966_0000184_33621_34196 184
612 3300045049 Ga0466959_0000097 Ga0466959_0000097_25473_26048 184
613 3300046460 Ga0495638_0044648 Ga0495638_0044648_380_961 184
614 3300046460 Ga0495638_0048014 Ga0495638_0048014_1170_1748 184
615 3300046476 Ga0495662_0386355 Ga0495662_0386355_77_652 184
616 3300046477 Ga0495664_0149519 Ga0495664_0149519_795_1370 184
617 3300046507 Ga0495606_0194015 Ga0495606_0194015_468_1037 184
618 3300046519 Ga0495632_0130702 Ga0495632_0130702_434_1009 184
619 3300046524 Ga0495648_0004026 Ga0495648_0004026_1287_1865 184
620 3300046529 Ga0495652_0126388 Ga0495652_0126388_813_1388 184
621 3300046533 Ga0495640_0492136 Ga0495640_0492136_101_676 184
622 3300046535 Ga0495586_0530015 Ga0495586_0530015_59_634 184
623 3300046542 Ga0495597_0247340 Ga0495597_0247340_14_592 184
624 3300046559 Ga0495667_0263572 Ga0495667_0263572_109_684 184
625 3300046679 Ga0495623_0188691 Ga0495623_0188691_251_826 184
626 3300046694 Ga0495649_0036243 Ga0495649_0036243_555_1124 184
627 3300046809 Ga0495600_0410183 Ga0495600_0410183_80_655 184
628 3300047315 Ga0495581_0100444 Ga0495581_0100444_387_962 184
629 3300047319 Ga0495674_0083880 Ga0495674_0083880_2010_2585 184
630 3300047320 Ga0495672_0046637 Ga0495672_0046637_57_632 184
631 3300047443 Ga0495687_000001 Ga0495687_000001_528119_528697 184
632 3300048909 Ga0496106_0793756 Ga0496106_0793756_27_602 184
633 3300048912 Ga0496109_0028678 Ga0496109_0028678_2757_3332 184
634 3300048918 Ga0496115_0350418 Ga0496115_0350418_563_1141 184
635 3300049569 Ga0501032_0007417 Ga0501032_0007417_4953_5525 184
636 3300049571 Ga0501034_0576225 Ga0501034_0576225_76_651 184
637 3300049573 Ga0501037_0005310 Ga0501037_0005310_3933_4505 184
638 3300049579 Ga0501043_0091900 Ga0501043_0091900_1072_1647 184
639 3300049581 Ga0501047_0013489 Ga0501047_0013489_3721_4296 184
640 3300049581 Ga0501047_0256271 Ga0501047_0256271_597_1172 184
641 3300049582 Ga0501048_0400940 Ga0501048_0400940_267_842 184
642 3300049823 Ga0501044_0065026 Ga0501044_0065026_1826_2401 184
643 3300053090 Ga0500646_0040563 Ga0500646_0040563_399_974 184
644 3300053092 Ga0500583_0000078 Ga0500583_0000078_13798_14373 184
645 3300053092 Ga0500583_0001571 Ga0500583_0001571_3792_4370 184
646 3300053092 Ga0500583_0013003 Ga0500583_0013003_2185_2760 184
647 3300053092 Ga0500583_0310796 Ga0500583_0310796_46_624 184
648 3300053130 Ga0500642_0035698 Ga0500642_0035698_124_702 184
649 3300053134 Ga0500658_0058455 Ga0500658_0058455_304_879 184
650 3300053150 Ga0500603_020199 Ga0500603_020199_970_1545 184
651 3300053156 Ga0500622_0006472 Ga0500622_0006472_1004_1582 184
652 3300053156 Ga0500622_0018889 Ga0500622_0018889_2061_2636 184
653 3300053178 Ga0500637_0090501 Ga0500637_0090501_606_1181 184
654 3300053178 Ga0500637_0112221 Ga0500637_0112221_781_1362 184
655 3300053727 Ga0500611_028007 Ga0500611_028007_238_813 184
656 3300061719 Ga0466962_0389622 Ga0466962_0389622_60_635 184
657 3300061719 Ga0466962_0446222 Ga0466962_0446222_64_639 184
658 3300005539 Ga0068853_100047692 Ga0068853_1000476923 185
659 3300005563 Ga0068855_100000089 Ga0068855_10000008996 185
660 3300005578 Ga0068854_100626211 Ga0068854_1006262112 185
661 3300005616 Ga0068852_100114231 Ga0068852_1001142312 185
662 3300005843 Ga0068860_100434992 Ga0068860_1004349922 185
663 3300005983 Ga0081540_1017916 Ga0081540_10179162 185
664 3300009093 Ga0105240_10000754 Ga0105240_1000075424 185
665 3300009093 Ga0105240_10000862 Ga0105240_1000086225 185
666 3300009093 Ga0105240_10002072 Ga0105240_100020726 185
667 3300009174 Ga0105241_10112786 Ga0105241_101127863 185
668 3300009174 Ga0105241_10268150 Ga0105241_102681502 185
669 3300009545 Ga0105237_10071773 Ga0105237_100717733 185
670 3300009551 Ga0105238_10060424 Ga0105238_100604242 185
671 3300010375 Ga0105239_10003433 Ga0105239_100034335 185
672 3300010375 Ga0105239_10009088 Ga0105239_100090887 185
673 3300010375 Ga0105239_10135806 Ga0105239_101358063 185
674 3300013100 Ga0157373_10083630 Ga0157373_100836302 185
675 3300013104 Ga0157370_10011697 Ga0157370_100116973 185
676 3300013105 Ga0157369_10082965 Ga0157369_100829652 185
677 3300013296 Ga0157374_10000001 Ga0157374_10000001342 185
678 3300020078 Ga0206352_10770432 Ga0206352_107704321 185
679 3300025913 Ga0207695_10000071 Ga0207695_10000071142 185
680 3300025913 Ga0207695_10000084 Ga0207695_1000008484 185
681 3300025913 Ga0207695_10001197 Ga0207695_1000119711 185
682 3300025913 Ga0207695_10015718 Ga0207695_100157184 185
683 3300025914 Ga0207671_10005486 Ga0207671_100054866 185
684 3300025944 Ga0207661_10011778 Ga0207661_100117784 185
685 3300025949 Ga0207667_10000209 Ga0207667_1000020924 185
686 3300026041 Ga0207639_10018632 Ga0207639_100186322 185
687 3300026078 Ga0207702_10112852 Ga0207702_101128523 185
688 3300026142 Ga0207698_11085626 Ga0207698_110856261 185
689 3300031852 Ga0307410_10125443 Ga0307410_101254431 185
690 3300031903 Ga0307407_10177440 Ga0307407_101774403 185
691 3300031911 Ga0307412_10336655 Ga0307412_103366552 185
692 3300032005 Ga0307411_10704405 Ga0307411_107044051 185
693 3300033180 Ga0307510_10000584 Ga0307510_1000058418 185
694 3300037418 Ga0395900_0173088 Ga0395900_0173088_1215_1787 185
695 3300042005 Ga0439448_0064373 Ga0439448_0064373_25_606 185
696 3300044693 Ga0466961_0034755 Ga0466961_0034755_1958_2539 185
697 3300044719 Ga0466971_0070821 Ga0466971_0070821_532_1113 185
698 3300044735 Ga0466968_0137233 Ga0466968_0137233_205_786 185
699 3300045049 Ga0466959_0026078 Ga0466959_0026078_641_1222 185
700 3300045836 Ga0466958_0044854 Ga0466958_0044854_232_813 185
701 3300046616 Ga0495668_0252547 Ga0495668_0252547_67_648 185
702 3300046648 Ga0495611_0000575 Ga0495611_0000575_15944_16525 185
703 3300047472 Ga0495686_0000004 Ga0495686_0000004_282319_282900 185
704 3300049703 Ga0501219_001673 Ga0501219_001673_551_1231 185
705 3300050005 Ga0501284_00002 Ga0501284_00002_195763_196443 185
706 3300053125 Ga0500618_000004 Ga0500618_000004_263164_263736 185
707 3300053178 Ga0500637_0149649 Ga0500637_0149649_279_860 185
708 3300059493 Ga0587077_023405 Ga0587077_023405_489_1067 185
709 3300061719 Ga0466962_0027711 Ga0466962_0027711_2031_2612 185
710 iso_pu_bacteria 2883068021 2883069483 185
711 3300004799 Ga0058863_10091895 Ga0058863_100918953 186
712 3300004800 Ga0058861_12039234 Ga0058861_120392344 186
713 3300004803 Ga0058862_10284522 Ga0058862_102845223 186
714 3300005327 Ga0070658_10044669 Ga0070658_100446693 186
715 3300005327 Ga0070658_10083170 Ga0070658_100831702 186
716 3300005336 Ga0070680_100041989 Ga0070680_1000419893 186
717 3300005367 Ga0070667_100780695 Ga0070667_1007806951 186
718 3300005530 Ga0070679_100058152 Ga0070679_1000581523 186
719 3300005563 Ga0068855_100252214 Ga0068855_1002522142 186
720 3300005614 Ga0068856_100020623 Ga0068856_1000206233 186
721 3300013306 Ga0163162_10051173 Ga0163162_100511733 186
722 3300013308 Ga0157375_10153364 Ga0157375_101533642 186
723 3300017792 Ga0163161_10355237 Ga0163161_103552372 186
724 3300025909 Ga0207705_10037679 Ga0207705_100376792 186
725 3300025913 Ga0207695_10193040 Ga0207695_101930402 186
726 3300025921 Ga0207652_10033362 Ga0207652_100333622 186
727 3300025961 Ga0207712_10011116 Ga0207712_100111164 186
728 3300032004 Ga0307414_10050591 Ga0307414_100505913 186
729 3300032004 Ga0307414_10100657 Ga0307414_101006571 186
730 3300041491 Ga0451833_0564981 Ga0451833_0564981_92_676 186
731 3300046507 Ga0495606_0054975 Ga0495606_0054975_507_1091 186
732 3300005614 Ga0068856_100000129 Ga0068856_10000012951 187
733 3300025272 Ga0209455_1017797 Ga0209455_10177972 187
734 3300026078 Ga0207702_10000300 Ga0207702_1000030030 187
735 3300032004 Ga0307414_10250186 Ga0307414_102501862 187
736 3300049571 Ga0501034_0144872 Ga0501034_0144872_1645_2211 187
737 iso_pu_bacteria 2929921140 2929924405 187
738 iso_pu_bacteria 8003151029 8003155367 187
739 3300041997 Ga0439431_0000264 Ga0439431_0000264_6728_7300 189
740 3300001979 JGI24740J21852_10000909 JGI24740J21852_1000090911 191
741 3300001989 JGI24739J22299_10003098 JGI24739J22299_100030983 191
742 3300002738 JGI25154J39366_1000012 JGI25154J39366_100001274 191
743 3300002741 JGI25157J39369_1006716 JGI25157J39369_10067162 191
744 3300003215 JGI25153J46596_10001521 JGI25153J46596_100015212 191
745 3300003215 JGI25153J46596_10016658 JGI25153J46596_100166585 191
746 3300003354 JGI25160J50197_1004764 JGI25160J50197_10047644 191
747 3300003354 JGI25160J50197_1006581 JGI25160J50197_10065813 191
748 3300003771 Ga0055526_1016576 Ga0055526_10165764 191
749 3300003771 Ga0055526_1027605 Ga0055526_10276052 191
750 3300003790 Ga0055528_1001024 Ga0055528_10010246 191
751 3300003791 Ga0055530_10001218 Ga0055530_1000121815 191
752 3300003794 Ga0055531_10037765 Ga0055531_100377652 191
753 3300005262 Ga0065165_1000228 Ga0065165_100022848 191
754 3300010375 Ga0105239_10207637 Ga0105239_102076372 191
755 3300013102 Ga0157371_10104539 Ga0157371_101045392 191
756 3300013104 Ga0157370_10196198 Ga0157370_101961983 191
757 3300025246 Ga0209646_1000009 Ga0209646_1000009200 191
758 3300025250 Ga0209026_1000197 Ga0209026_100019716 191
759 3300025273 Ga0209673_1000016 Ga0209673_1000016164 191
760 3300025295 Ga0209564_1011183 Ga0209564_10111833 191
761 3300025295 Ga0209564_1011455 Ga0209564_10114553 191
762 3300025297 Ga0209758_1007200 Ga0209758_10072005 191
763 3300025297 Ga0209758_1012031 Ga0209758_10120311 191
764 3300025298 Ga0209050_1000124 Ga0209050_100012415 191
765 3300025302 Ga0207426_1001572 Ga0207426_100157210 191
766 3300025302 Ga0207426_1001894 Ga0207426_100189411 191
767 3300025302 Ga0207426_1053576 Ga0207426_10535762 191
768 3300025303 Ga0209051_1035622 Ga0209051_10356222 191
769 3300025304 Ga0209257_1004094 Ga0209257_10040942 191
770 3300046810 Ga0495660_0137077 Ga0495660_0137077_501_1076 191
771 3300049570 Ga0501033_0374836 Ga0501033_0374836_43_618 191
772 3300049573 Ga0501037_0378098 Ga0501037_0378098_47_622 191
773 3300049581 Ga0501047_0033096 Ga0501047_0033096_2410_2985 191
774 3300049823 Ga0501044_0086137 Ga0501044_0086137_190_765 191
775 3300053090 Ga0500646_0013830 Ga0500646_0013830_490_1065 191
776 3300053100 Ga0500660_128294 Ga0500660_128294_192_767 191
777 3300053105 Ga0500557_089211 Ga0500557_089211_284_859 191
778 3300053131 Ga0500652_005630 Ga0500652_005630_596_1171 191
779 3300053134 Ga0500658_0079128 Ga0500658_0079128_95_670 191
780 3300053153 Ga0500616_0022794 Ga0500616_0022794_838_1413 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

75

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5in8-assembly1.cif.gz_B-2 crystal structure of q151h aspergillus terreus aristolochene synthase 0.3336 64 155
5jvn-assembly1.cif.gz_A-2 c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism 0.3201 41 161
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.2878 45 162
6fbx-assembly1.cif.gz_A crystal structure of a zebra-fish pro-survival protein nrz:bad bh3 complex 0.2793 43 157
5w88-assembly1.cif.gz_A nmr structure of the n-domain of troponin c bound to switch region of troponin i and 3-methyldiphenylamine (peptide mode) 0.2727 38 152
ID Description Score Start End Superfamily
af_P9WMV7_1_132_2.30.31.10 Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A 0.5987 36 157 2.30.31.10
af_P9WMV7_1_132_2.30.31.10 Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A 0.5027 36 157 2.30.31.10
af_Q6K370_56_142_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3871 41 154 1.10.10.60
af_A0A3B3IT52_34_123_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3833 41 149 1.10.10.60
af_A0A3B3IT52_34_123_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.365 41 149 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7C7KKN2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9213 41 115
AF-A0A358EDS1-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.912 35 122
AF-A0A2D8N6D1-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.889 41 161
AF-A0A2V7SG72-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8798 41 181
AF-A0A523NBH2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8748 39 181

Feature Viewer

pLDDT pTM Quality
83.4 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map