F480532
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 315 | 770 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0376354|Ga0466967_0376354_612_1280 |
| Length | 222 |
| Sequence | VANAQQKNKSRVHKRKNLKQFYFYNRFKKSILIMDRRDAISRVALLLGGTVIGAEAFLKGCKPETKYGQSLKFTPDDVAYLDEVAETILPRTSTPGAKDAKVGQFMTVIVNDCYEDKDQKTFLDGMQKLDDASKKKNGKSFMESTPQQRHDLLVDLDKEAKDYQSKKKEDDPNHYFTLMKQLTLWGFFTSEPGATKALRYVAVPGRYEGCIPYKKGDKAWAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 5 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 6 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 7 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 8 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 9 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 33 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 216 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 295 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 298 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 299 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 302 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 303 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 310 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 315 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.82 |
| Metatranscriptomes | 0.9 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.82 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 85.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000909 | 3300001979 | Bacteria | 13118 |
| 2 | JGI24740J21852_10017204 | 3300001979 | Bacteria | 2591 |
| 3 | JGI24739J22299_10003098 | 3300001989 | Bacteria | 6347 |
| 4 | JGI24737J22298_10000041 | 3300001990 | Bacteria | 37211 |
| 5 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 6 | JGI25154J39366_1000012 | 3300002738 | Bacteria | 287601 |
| 7 | JGI25157J39369_1006716 | 3300002741 | Bacteria | 1724 |
| 8 | JGI25406J46586_10032261 | 3300003203 | Bacteria | 1948 |
| 9 | JGI25153J46596_10001521 | 3300003215 | Bacteria | 13807 |
| 10 | JGI25153J46596_10016658 | 3300003215 | Bacteria | 2931 |
| 11 | rootH1_10042093 | 3300003316 | Bacteria | 2072 |
| 12 | rootH1_10111220 | 3300003316 | Bacteria | 3056 |
| 13 | rootH1_10151956 | 3300003316 | Unclassified | 1841 |
| 14 | rootH2_10008932 | 3300003320 | Bacteria | 37271 |
| 15 | rootH2_10032886 | 3300003320 | Bacteria | 16021 |
| 16 | rootH2_10133367 | 3300003320 | Bacteria | 3739 |
| 17 | rootH2_10167396 | 3300003320 | Bacteria | 1267 |
| 18 | rootL2_10149769 | 3300003322 | Bacteria | 1429 |
| 19 | rootL2_10157062 | 3300003322 | Bacteria | 1521 |
| 20 | rootL2_10227972 | 3300003322 | Bacteria | 2539 |
| 21 | rootH1_10025877 | 3300003323 | Unclassified | 1855 |
| 22 | rootH1_10254323 | 3300003323 | Bacteria | 2773 |
| 23 | rootH1_10254552 | 3300003323 | Bacteria | 1709 |
| 24 | rootH1_10268100 | 3300003323 | Bacteria | 1518 |
| 25 | JGI25160J50197_1003572 | 3300003354 | Bacteria | 6911 |
| 26 | JGI25160J50197_1004764 | 3300003354 | Bacteria | 5792 |
| 27 | JGI25160J50197_1006581 | 3300003354 | Bacteria | 4681 |
| 28 | Ga0055526_1000006 | 3300003771 | Bacteria | 330857 |
| 29 | Ga0055526_1016576 | 3300003771 | Bacteria | 2871 |
| 30 | Ga0055526_1027605 | 3300003771 | Bacteria | 1748 |
| 31 | Ga0055537_1000003 | 3300003773 | Bacteria | 220933 |
| 32 | Ga0055537_1000018 | 3300003773 | Bacteria | 123452 |
| 33 | Ga0055524_1000009 | 3300003775 | Bacteria | 295254 |
| 34 | Ga0055534_1000004 | 3300003784 | Bacteria | 295251 |
| 35 | Ga0055528_1000003 | 3300003790 | Bacteria | 330875 |
| 36 | Ga0055528_1001024 | 3300003790 | Bacteria | 18512 |
| 37 | Ga0055530_10001218 | 3300003791 | Bacteria | 19831 |
| 38 | Ga0055531_10037765 | 3300003794 | Bacteria | 1462 |
| 39 | Ga0058863_10091895 | 3300004799 | Bacteria | 12700 |
| 40 | Ga0058861_12039234 | 3300004800 | Bacteria | 6175 |
| 41 | Ga0058860_11662651 | 3300004801 | Unclassified | 655 |
| 42 | Ga0058862_10284522 | 3300004803 | Bacteria | 9201 |
| 43 | Ga0065165_1000228 | 3300005262 | Bacteria | 98736 |
| 44 | Ga0065714_10075158 | 3300005288 | Bacteria | 2938 |
| 45 | Ga0065714_10172053 | 3300005288 | Unclassified | 1000 |
| 46 | Ga0065704_10113950 | 3300005289 | Bacteria | 1902 |
| 47 | Ga0065712_10237453 | 3300005290 | Bacteria | 994 |
| 48 | Ga0070658_10005453 | 3300005327 | Bacteria | 10313 |
| 49 | Ga0070658_10044669 | 3300005327 | Bacteria | 3581 |
| 50 | Ga0070658_10083170 | 3300005327 | Bacteria | 2631 |
| 51 | Ga0070658_10638602 | 3300005327 | Bacteria | 923 |
| 52 | Ga0070676_10000375 | 3300005328 | Bacteria | 20682 |
| 53 | Ga0070676_10027954 | 3300005328 | Unclassified | 3202 |
| 54 | Ga0070676_10766442 | 3300005328 | Unclassified | 709 |
| 55 | Ga0070683_100790402 | 3300005329 | Bacteria | 909 |
| 56 | Ga0070690_100061206 | 3300005330 | Unclassified | 2425 |
| 57 | Ga0070690_100144687 | 3300005330 | Unclassified | 1616 |
| 58 | Ga0070670_100228528 | 3300005331 | Bacteria | 1619 |
| 59 | Ga0070677_10074147 | 3300005333 | Unclassified | 1439 |
| 60 | Ga0070677_10173510 | 3300005333 | Bacteria | 1021 |
| 61 | Ga0068869_100127536 | 3300005334 | Bacteria | 1953 |
| 62 | Ga0068869_101349297 | 3300005334 | Unclassified | 630 |
| 63 | Ga0070666_10000132 | 3300005335 | Bacteria | 52718 |
| 64 | Ga0070666_10000885 | 3300005335 | Bacteria | 18201 |
| 65 | Ga0070666_10269935 | 3300005335 | Bacteria | 1207 |
| 66 | Ga0070666_10270683 | 3300005335 | Bacteria | 1205 |
| 67 | Ga0070680_100005853 | 3300005336 | Bacteria | 9329 |
| 68 | Ga0070680_100041989 | 3300005336 | Bacteria | 3710 |
| 69 | Ga0070682_100015574 | 3300005337 | Bacteria | 4409 |
| 70 | Ga0070682_100030591 | 3300005337 | Bacteria | 3251 |
| 71 | Ga0070682_100621294 | 3300005337 | Bacteria | 856 |
| 72 | Ga0068868_100000075 | 3300005338 | Bacteria | 58452 |
| 73 | Ga0068868_100023545 | 3300005338 | Bacteria | 4661 |
| 74 | Ga0068868_100191322 | 3300005338 | Bacteria | 1702 |
| 75 | Ga0068868_100222536 | 3300005338 | Unclassified | 1580 |
| 76 | Ga0068868_100433381 | 3300005338 | Bacteria | 1140 |
| 77 | Ga0070660_100004164 | 3300005339 | Bacteria | 9991 |
| 78 | Ga0070660_100202995 | 3300005339 | Bacteria | 1608 |
| 79 | Ga0070660_100228197 | 3300005339 | Bacteria | 1515 |
| 80 | Ga0070689_100044786 | 3300005340 | Unclassified | 3405 |
| 81 | Ga0070691_10020993 | 3300005341 | Bacteria | 3020 |
| 82 | Ga0070691_10161802 | 3300005341 | Unclassified | 1154 |
| 83 | Ga0070661_100008471 | 3300005344 | Bacteria | 7113 |
| 84 | Ga0070661_100242948 | 3300005344 | Bacteria | 1387 |
| 85 | Ga0070668_100000859 | 3300005347 | Bacteria | 21121 |
| 86 | Ga0070668_100279911 | 3300005347 | Unclassified | 1393 |
| 87 | Ga0070668_100486000 | 3300005347 | Bacteria | 1067 |
| 88 | Ga0070669_100043902 | 3300005353 | Bacteria | 3257 |
| 89 | Ga0070669_100996238 | 3300005353 | Unclassified | 719 |
| 90 | Ga0070675_100125401 | 3300005354 | Bacteria | 2184 |
| 91 | Ga0070675_100152510 | 3300005354 | Unclassified | 1982 |
| 92 | Ga0070675_100541788 | 3300005354 | Bacteria | 1052 |
| 93 | Ga0070671_100022885 | 3300005355 | Bacteria | 5107 |
| 94 | Ga0070671_100052161 | 3300005355 | Bacteria | 3401 |
| 95 | Ga0070671_100092479 | 3300005355 | Bacteria | 2534 |
| 96 | Ga0070671_100183430 | 3300005355 | Bacteria | 1772 |
| 97 | Ga0070674_100173699 | 3300005356 | Bacteria | 1645 |
| 98 | Ga0070674_100203274 | 3300005356 | Unclassified | 1531 |
| 99 | Ga0070674_100412162 | 3300005356 | Bacteria | 1107 |
| 100 | Ga0070673_100000448 | 3300005364 | Bacteria | 21839 |
| 101 | Ga0070673_100030540 | 3300005364 | Bacteria | 4035 |
| 102 | Ga0070673_100050694 | 3300005364 | Bacteria | 3246 |
| 103 | Ga0070673_100091218 | 3300005364 | Bacteria | 2491 |
| 104 | Ga0070673_100405374 | 3300005364 | Unclassified | 1220 |
| 105 | Ga0070673_100700638 | 3300005364 | Unclassified | 930 |
| 106 | Ga0070659_100009089 | 3300005366 | Bacteria | 7290 |
| 107 | Ga0070667_100000482 | 3300005367 | Bacteria | 40557 |
| 108 | Ga0070667_100130903 | 3300005367 | Bacteria | 2189 |
| 109 | Ga0070667_100147132 | 3300005367 | Bacteria | 2067 |
| 110 | Ga0070667_100414060 | 3300005367 | Bacteria | 1228 |
| 111 | Ga0070667_100676469 | 3300005367 | Bacteria | 954 |
| 112 | Ga0070667_100780695 | 3300005367 | Bacteria | 886 |
| 113 | Ga0070667_100938123 | 3300005367 | Unclassified | 806 |
| 114 | Ga0070700_100203486 | 3300005441 | Unclassified | 1392 |
| 115 | Ga0070663_100261704 | 3300005455 | Bacteria | 1372 |
| 116 | Ga0070678_100033217 | 3300005456 | Bacteria | 3580 |
| 117 | Ga0070678_100080301 | 3300005456 | Bacteria | 2470 |
| 118 | Ga0070678_100096047 | 3300005456 | Bacteria | 2285 |
| 119 | Ga0070678_100232610 | 3300005456 | Bacteria | 1537 |
| 120 | Ga0070662_100009485 | 3300005457 | Bacteria | 6368 |
| 121 | Ga0070662_100145632 | 3300005457 | Bacteria | 1840 |
| 122 | Ga0070681_10145809 | 3300005458 | Bacteria | 2296 |
| 123 | Ga0068867_100005707 | 3300005459 | Bacteria | 8824 |
| 124 | Ga0068867_100006698 | 3300005459 | Bacteria | 8144 |
| 125 | Ga0068867_100178837 | 3300005459 | Bacteria | 1685 |
| 126 | Ga0068867_100418801 | 3300005459 | Unclassified | 1134 |
| 127 | Ga0070679_100018717 | 3300005530 | Bacteria | 6723 |
| 128 | Ga0070679_100052315 | 3300005530 | Bacteria | 4069 |
| 129 | Ga0070679_100058152 | 3300005530 | Bacteria | 3853 |
| 130 | Ga0070684_100026351 | 3300005535 | Bacteria | 4896 |
| 131 | Ga0068853_100007384 | 3300005539 | Bacteria | 8793 |
| 132 | Ga0068853_100043469 | 3300005539 | Bacteria | 3843 |
| 133 | Ga0068853_100047692 | 3300005539 | Bacteria | 3677 |
| 134 | Ga0068853_100159655 | 3300005539 | Bacteria | 2033 |
| 135 | Ga0068853_101230800 | 3300005539 | Unclassified | 723 |
| 136 | Ga0070672_100000361 | 3300005543 | Bacteria | 26202 |
| 137 | Ga0070672_100234716 | 3300005543 | Unclassified | 1541 |
| 138 | Ga0070672_100513536 | 3300005543 | Unclassified | 1037 |
| 139 | Ga0070672_100774091 | 3300005543 | Unclassified | 843 |
| 140 | Ga0070686_100182653 | 3300005544 | Unclassified | 1491 |
| 141 | Ga0070686_100923908 | 3300005544 | Unclassified | 711 |
| 142 | Ga0070693_100013364 | 3300005547 | Bacteria | 4180 |
| 143 | Ga0070693_100911376 | 3300005547 | Unclassified | 659 |
| 144 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 145 | Ga0070665_100002163 | 3300005548 | Bacteria | 21925 |
| 146 | Ga0070665_100008754 | 3300005548 | Bacteria | 10244 |
| 147 | Ga0070665_100906380 | 3300005548 | Bacteria | 894 |
| 148 | Ga0070665_101187688 | 3300005548 | Bacteria | 774 |
| 149 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 150 | Ga0068855_100009719 | 3300005563 | Bacteria | 11608 |
| 151 | Ga0068855_100025328 | 3300005563 | Bacteria | 7099 |
| 152 | Ga0068855_100038549 | 3300005563 | Bacteria | 5678 |
| 153 | Ga0068855_100038985 | 3300005563 | Bacteria | 5641 |
| 154 | Ga0068855_100046105 | 3300005563 | Bacteria | 5154 |
| 155 | Ga0068855_100090222 | 3300005563 | Bacteria | 3537 |
| 156 | Ga0068855_100145358 | 3300005563 | Bacteria | 2700 |
| 157 | Ga0068855_100252214 | 3300005563 | Bacteria | 1968 |
| 158 | Ga0068855_101451803 | 3300005563 | Bacteria | 705 |
| 159 | Ga0070664_100942060 | 3300005564 | Unclassified | 810 |
| 160 | Ga0070664_100955627 | 3300005564 | Bacteria | 804 |
| 161 | Ga0068857_100005562 | 3300005577 | Bacteria | 10756 |
| 162 | Ga0068857_100006566 | 3300005577 | Bacteria | 9983 |
| 163 | Ga0068857_100134162 | 3300005577 | Bacteria | 2235 |
| 164 | Ga0068857_100156342 | 3300005577 | Bacteria | 2068 |
| 165 | Ga0068854_100048329 | 3300005578 | Bacteria | 3035 |
| 166 | Ga0068854_100067427 | 3300005578 | Bacteria | 2607 |
| 167 | Ga0068854_100182488 | 3300005578 | Unclassified | 1640 |
| 168 | Ga0068854_100242577 | 3300005578 | Bacteria | 1436 |
| 169 | Ga0068854_100339682 | 3300005578 | Bacteria | 1226 |
| 170 | Ga0068854_100626211 | 3300005578 | Unclassified | 921 |
| 171 | Ga0068856_100000129 | 3300005614 | Bacteria | 76536 |
| 172 | Ga0068856_100020623 | 3300005614 | Bacteria | 6404 |
| 173 | Ga0068856_100032772 | 3300005614 | Bacteria | 5088 |
| 174 | Ga0068856_100043872 | 3300005614 | Bacteria | 4399 |
| 175 | Ga0068856_100365035 | 3300005614 | Bacteria | 1462 |
| 176 | Ga0068856_100478100 | 3300005614 | Bacteria | 1267 |
| 177 | Ga0068856_100699999 | 3300005614 | Unclassified | 1033 |
| 178 | Ga0068856_101250827 | 3300005614 | Unclassified | 758 |
| 179 | Ga0070702_100155968 | 3300005615 | Unclassified | 1471 |
| 180 | Ga0070702_100283030 | 3300005615 | Bacteria | 1139 |
| 181 | Ga0068852_100000242 | 3300005616 | Bacteria | 37066 |
| 182 | Ga0068852_100005191 | 3300005616 | Bacteria | 9287 |
| 183 | Ga0068852_100103743 | 3300005616 | Bacteria | 2572 |
| 184 | Ga0068852_100114231 | 3300005616 | Bacteria | 2460 |
| 185 | Ga0068852_100149778 | 3300005616 | Unclassified | 2169 |
| 186 | Ga0068852_100198533 | 3300005616 | Bacteria | 1897 |
| 187 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 188 | Ga0068859_100142729 | 3300005617 | Bacteria | 2468 |
| 189 | Ga0068859_100167906 | 3300005617 | Bacteria | 2274 |
| 190 | Ga0068859_100626379 | 3300005617 | Bacteria | 1168 |
| 191 | Ga0068859_101308631 | 3300005617 | Bacteria | 799 |
| 192 | Ga0068864_100000785 | 3300005618 | Bacteria | 26636 |
| 193 | Ga0068864_100018349 | 3300005618 | Bacteria | 5844 |
| 194 | Ga0068864_100101243 | 3300005618 | Bacteria | 2555 |
| 195 | Ga0068861_100026816 | 3300005719 | Bacteria | 4192 |
| 196 | Ga0068861_100758197 | 3300005719 | Bacteria | 907 |
| 197 | Ga0068861_100962435 | 3300005719 | Unclassified | 812 |
| 198 | Ga0068851_10008297 | 3300005834 | Bacteria | 4799 |
| 199 | Ga0068870_10054743 | 3300005840 | Bacteria | 2123 |
| 200 | Ga0068870_10337090 | 3300005840 | Unclassified | 963 |
| 201 | Ga0068870_10367683 | 3300005840 | Bacteria | 927 |
| 202 | Ga0068870_10571574 | 3300005840 | Bacteria | 764 |
| 203 | Ga0068863_100000394 | 3300005841 | Bacteria | 44355 |
| 204 | Ga0068863_100777484 | 3300005841 | Bacteria | 954 |
| 205 | Ga0068858_100026331 | 3300005842 | Bacteria | 5405 |
| 206 | Ga0068858_100042626 | 3300005842 | Bacteria | 4207 |
| 207 | Ga0068858_100475728 | 3300005842 | Unclassified | 1205 |
| 208 | Ga0068858_100543147 | 3300005842 | Unclassified | 1125 |
| 209 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 210 | Ga0068860_100001074 | 3300005843 | Bacteria | 30126 |
| 211 | Ga0068860_100002836 | 3300005843 | Bacteria | 18019 |
| 212 | Ga0068860_100006719 | 3300005843 | Bacteria | 11541 |
| 213 | Ga0068860_100017594 | 3300005843 | Bacteria | 6965 |
| 214 | Ga0068860_100050303 | 3300005843 | Bacteria | 3968 |
| 215 | Ga0068860_100086520 | 3300005843 | Bacteria | 2983 |
| 216 | Ga0068860_100115869 | 3300005843 | Unclassified | 2563 |
| 217 | Ga0068860_100434992 | 3300005843 | Unclassified | 1302 |
| 218 | Ga0081540_1017916 | 3300005983 | Bacteria | 4364 |
| 219 | Ga0081539_10186221 | 3300005985 | Bacteria | 970 |
| 220 | Ga0097621_100004135 | 3300006237 | Bacteria | 10062 |
| 221 | Ga0097621_100010324 | 3300006237 | Bacteria | 6826 |
| 222 | Ga0097621_100138601 | 3300006237 | Bacteria | 2077 |
| 223 | Ga0097621_100178821 | 3300006237 | Unclassified | 1832 |
| 224 | Ga0097621_100286549 | 3300006237 | Bacteria | 1451 |
| 225 | Ga0097621_100367013 | 3300006237 | Bacteria | 1284 |
| 226 | Ga0097621_100779169 | 3300006237 | Bacteria | 885 |
| 227 | Ga0075370_10620101 | 3300006353 | Bacteria | 656 |
| 228 | Ga0068871_100023830 | 3300006358 | Bacteria | 4741 |
| 229 | Ga0068871_100048965 | 3300006358 | Bacteria | 3414 |
| 230 | Ga0068871_100492880 | 3300006358 | Bacteria | 1104 |
| 231 | Ga0068871_100930073 | 3300006358 | Bacteria | 807 |
| 232 | Ga0068871_101269713 | 3300006358 | Bacteria | 692 |
| 233 | Ga0068865_100021001 | 3300006881 | Bacteria | 4243 |
| 234 | Ga0068865_100089792 | 3300006881 | Bacteria | 2226 |
| 235 | Ga0068865_100133523 | 3300006881 | Bacteria | 1862 |
| 236 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 237 | Ga0097620_100142730 | 3300006931 | Bacteria | 2468 |
| 238 | Ga0097620_100167901 | 3300006931 | Bacteria | 2274 |
| 239 | Ga0097620_100626378 | 3300006931 | Bacteria | 1168 |
| 240 | Ga0097620_101308671 | 3300006931 | Bacteria | 799 |
| 241 | Ga0105240_10000754 | 3300009093 | Bacteria | 59023 |
| 242 | Ga0105240_10000862 | 3300009093 | Bacteria | 54716 |
| 243 | Ga0105240_10002072 | 3300009093 | Bacteria | 32853 |
| 244 | Ga0105240_10003320 | 3300009093 | Bacteria | 25129 |
| 245 | Ga0105240_10005940 | 3300009093 | Bacteria | 18085 |
| 246 | Ga0105240_10014243 | 3300009093 | Bacteria | 10863 |
| 247 | Ga0105240_10036865 | 3300009093 | Bacteria | 6286 |
| 248 | Ga0105240_10102886 | 3300009093 | Bacteria | 3470 |
| 249 | Ga0105240_10224199 | 3300009093 | Bacteria | 2188 |
| 250 | Ga0105245_10136050 | 3300009098 | Unclassified | 2309 |
| 251 | Ga0105245_10624377 | 3300009098 | Bacteria | 1106 |
| 252 | Ga0105247_10003817 | 3300009101 | Bacteria | 9750 |
| 253 | Ga0105247_10471379 | 3300009101 | Bacteria | 909 |
| 254 | Ga0105243_10025290 | 3300009148 | Bacteria | 4535 |
| 255 | Ga0105241_10001671 | 3300009174 | Bacteria | 16896 |
| 256 | Ga0105241_10001857 | 3300009174 | Bacteria | 16027 |
| 257 | Ga0105241_10004426 | 3300009174 | Bacteria | 10389 |
| 258 | Ga0105241_10112786 | 3300009174 | Bacteria | 2178 |
| 259 | Ga0105241_10138015 | 3300009174 | Bacteria | 1982 |
| 260 | Ga0105241_10146570 | 3300009174 | Bacteria | 1927 |
| 261 | Ga0105241_10218123 | 3300009174 | Bacteria | 1602 |
| 262 | Ga0105241_10268150 | 3300009174 | Bacteria | 1453 |
| 263 | Ga0105242_10020147 | 3300009176 | Bacteria | 5228 |
| 264 | Ga0105242_10049156 | 3300009176 | Bacteria | 3431 |
| 265 | Ga0105242_10053984 | 3300009176 | Unclassified | 3283 |
| 266 | Ga0105242_10283338 | 3300009176 | Unclassified | 1506 |
| 267 | Ga0105242_10446482 | 3300009176 | Bacteria | 1218 |
| 268 | Ga0105248_10081980 | 3300009177 | Bacteria | 3627 |
| 269 | Ga0105237_10001393 | 3300009545 | Bacteria | 31945 |
| 270 | Ga0105237_10004900 | 3300009545 | Bacteria | 15325 |
| 271 | Ga0105237_10012148 | 3300009545 | Bacteria | 9085 |
| 272 | Ga0105237_10013542 | 3300009545 | Bacteria | 8546 |
| 273 | Ga0105237_10018295 | 3300009545 | Bacteria | 7251 |
| 274 | Ga0105237_10030014 | 3300009545 | Bacteria | 5523 |
| 275 | Ga0105237_10043122 | 3300009545 | Bacteria | 4546 |
| 276 | Ga0105237_10071773 | 3300009545 | Bacteria | 3456 |
| 277 | Ga0105237_10100182 | 3300009545 | Bacteria | 2889 |
| 278 | Ga0105237_10105253 | 3300009545 | Bacteria | 2813 |
| 279 | Ga0105237_10397719 | 3300009545 | Bacteria | 1382 |
| 280 | Ga0105237_10870577 | 3300009545 | Bacteria | 908 |
| 281 | Ga0105238_10002044 | 3300009551 | Bacteria | 20361 |
| 282 | Ga0105238_10014367 | 3300009551 | Bacteria | 8001 |
| 283 | Ga0105238_10060424 | 3300009551 | Bacteria | 3794 |
| 284 | Ga0105238_10239520 | 3300009551 | Bacteria | 1792 |
| 285 | Ga0105249_10002967 | 3300009553 | Bacteria | 14640 |
| 286 | Ga0105249_10019812 | 3300009553 | Bacteria | 6005 |
| 287 | Ga0105249_10075804 | 3300009553 | Bacteria | 3115 |
| 288 | Ga0105249_10139712 | 3300009553 | Bacteria | 2321 |
| 289 | Ga0105249_10259817 | 3300009553 | Bacteria | 1725 |
| 290 | Ga0105249_10676004 | 3300009553 | Bacteria | 1091 |
| 291 | Ga0105239_10000529 | 3300010375 | Bacteria | 55233 |
| 292 | Ga0105239_10003433 | 3300010375 | Bacteria | 19410 |
| 293 | Ga0105239_10009088 | 3300010375 | Bacteria | 11244 |
| 294 | Ga0105239_10009377 | 3300010375 | Bacteria | 11043 |
| 295 | Ga0105239_10013995 | 3300010375 | Bacteria | 8909 |
| 296 | Ga0105239_10019080 | 3300010375 | Bacteria | 7579 |
| 297 | Ga0105239_10135806 | 3300010375 | Unclassified | 2738 |
| 298 | Ga0105239_10200579 | 3300010375 | Unclassified | 2235 |
| 299 | Ga0105239_10207637 | 3300010375 | Bacteria | 2195 |
| 300 | Ga0105239_10293414 | 3300010375 | Bacteria | 1831 |
| 301 | Ga0105239_10604337 | 3300010375 | Bacteria | 1251 |
| 302 | Ga0105239_10638915 | 3300010375 | Bacteria | 1215 |
| 303 | Ga0105239_10903747 | 3300010375 | Bacteria | 1013 |
| 304 | Ga0105246_10029078 | 3300011119 | Bacteria | 3635 |
| 305 | Ga0105246_10061764 | 3300011119 | Bacteria | 2608 |
| 306 | Ga0105246_10566531 | 3300011119 | Bacteria | 976 |
| 307 | Ga0157373_10007171 | 3300013100 | Bacteria | 8317 |
| 308 | Ga0157373_10083630 | 3300013100 | Bacteria | 2250 |
| 309 | Ga0157373_10113662 | 3300013100 | Unclassified | 1903 |
| 310 | Ga0157371_10057536 | 3300013102 | Bacteria | 2757 |
| 311 | Ga0157371_10104539 | 3300013102 | Bacteria | 2009 |
| 312 | Ga0157371_10144610 | 3300013102 | Bacteria | 1694 |
| 313 | Ga0157371_10677530 | 3300013102 | Unclassified | 771 |
| 314 | Ga0157370_10002239 | 3300013104 | Bacteria | 23528 |
| 315 | Ga0157370_10011697 | 3300013104 | Bacteria | 9159 |
| 316 | Ga0157370_10030448 | 3300013104 | Bacteria | 5287 |
| 317 | Ga0157370_10196198 | 3300013104 | Bacteria | 1873 |
| 318 | Ga0157370_10262702 | 3300013104 | Bacteria | 1595 |
| 319 | Ga0157370_10476091 | 3300013104 | Bacteria | 1147 |
| 320 | Ga0157370_10775951 | 3300013104 | Bacteria | 873 |
| 321 | Ga0157369_10006899 | 3300013105 | Bacteria | 13107 |
| 322 | Ga0157369_10033481 | 3300013105 | Bacteria | 5646 |
| 323 | Ga0157369_10082965 | 3300013105 | Bacteria | 3429 |
| 324 | Ga0157369_10748863 | 3300013105 | Bacteria | 1005 |
| 325 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 326 | Ga0157374_10002589 | 3300013296 | Bacteria | 15240 |
| 327 | Ga0157374_10012630 | 3300013296 | Bacteria | 7354 |
| 328 | Ga0157374_10100124 | 3300013296 | Unclassified | 2777 |
| 329 | Ga0157374_10111273 | 3300013296 | Bacteria | 2634 |
| 330 | Ga0157374_10585127 | 3300013296 | Unclassified | 1125 |
| 331 | Ga0157378_10009315 | 3300013297 | Bacteria | 8552 |
| 332 | Ga0157378_10026601 | 3300013297 | Bacteria | 5099 |
| 333 | Ga0157378_10029608 | 3300013297 | Bacteria | 4835 |
| 334 | Ga0157378_10035695 | 3300013297 | Bacteria | 4398 |
| 335 | Ga0157378_10062135 | 3300013297 | Bacteria | 3335 |
| 336 | Ga0157378_10148573 | 3300013297 | Bacteria | 2182 |
| 337 | Ga0157378_10412406 | 3300013297 | Unclassified | 1333 |
| 338 | Ga0163162_10000328 | 3300013306 | Bacteria | 43763 |
| 339 | Ga0163162_10000377 | 3300013306 | Bacteria | 40533 |
| 340 | Ga0163162_10003770 | 3300013306 | Bacteria | 14524 |
| 341 | Ga0163162_10006392 | 3300013306 | Bacteria | 11408 |
| 342 | Ga0163162_10011375 | 3300013306 | Bacteria | 8677 |
| 343 | Ga0163162_10051173 | 3300013306 | Bacteria | 4144 |
| 344 | Ga0163162_10077507 | 3300013306 | Bacteria | 3388 |
| 345 | Ga0163162_10238891 | 3300013306 | Bacteria | 1947 |
| 346 | Ga0163162_10246634 | 3300013306 | Bacteria | 1917 |
| 347 | Ga0163162_10624346 | 3300013306 | Bacteria | 1203 |
| 348 | Ga0163162_11083043 | 3300013306 | Bacteria | 908 |
| 349 | Ga0163162_11419576 | 3300013306 | Bacteria | 790 |
| 350 | Ga0163162_11640324 | 3300013306 | Unclassified | 734 |
| 351 | Ga0157372_10001004 | 3300013307 | Bacteria | 30814 |
| 352 | Ga0157372_10041370 | 3300013307 | Bacteria | 5096 |
| 353 | Ga0157372_10051539 | 3300013307 | Bacteria | 4581 |
| 354 | Ga0157372_10197916 | 3300013307 | Bacteria | 2327 |
| 355 | Ga0157372_10344447 | 3300013307 | Bacteria | 1736 |
| 356 | Ga0157375_10004745 | 3300013308 | Bacteria | 11813 |
| 357 | Ga0157375_10153364 | 3300013308 | Bacteria | 2441 |
| 358 | Ga0157375_10173794 | 3300013308 | Bacteria | 2303 |
| 359 | Ga0157375_10365663 | 3300013308 | Bacteria | 1609 |
| 360 | Ga0157375_10409079 | 3300013308 | Unclassified | 1523 |
| 361 | Ga0157375_10672403 | 3300013308 | Bacteria | 1190 |
| 362 | Ga0163163_10000752 | 3300014325 | Bacteria | 27543 |
| 363 | Ga0163163_10109276 | 3300014325 | Unclassified | 2792 |
| 364 | Ga0163163_10534761 | 3300014325 | Unclassified | 1234 |
| 365 | Ga0163163_10573857 | 3300014325 | Bacteria | 1191 |
| 366 | Ga0157380_10049655 | 3300014326 | Unclassified | 3310 |
| 367 | Ga0157379_10000440 | 3300014968 | Bacteria | 33697 |
| 368 | Ga0157379_10018199 | 3300014968 | Bacteria | 6190 |
| 369 | Ga0157379_10313908 | 3300014968 | Bacteria | 1430 |
| 370 | Ga0157379_10515172 | 3300014968 | Bacteria | 1110 |
| 371 | Ga0157379_11517524 | 3300014968 | Bacteria | 652 |
| 372 | Ga0157376_10000381 | 3300014969 | Bacteria | 28821 |
| 373 | Ga0182006_1000134 | 3300015261 | Bacteria | 80259 |
| 374 | Ga0163161_10009869 | 3300017792 | Bacteria | 6613 |
| 375 | Ga0163161_10062200 | 3300017792 | Bacteria | 2719 |
| 376 | Ga0163161_10323519 | 3300017792 | Bacteria | 1220 |
| 377 | Ga0163161_10344771 | 3300017792 | Bacteria | 1183 |
| 378 | Ga0163161_10355237 | 3300017792 | Bacteria | 1166 |
| 379 | Ga0163161_10744215 | 3300017792 | Bacteria | 820 |
| 380 | Ga0163161_11406790 | 3300017792 | Unclassified | 609 |
| 381 | Ga0206352_10770432 | 3300020078 | Bacteria | 852 |
| 382 | Ga0206350_10795179 | 3300020080 | Bacteria | 1407 |
| 383 | Ga0213876_10000680 | 3300021384 | Bacteria | 24189 |
| 384 | Ga0213876_10073833 | 3300021384 | Bacteria | 1801 |
| 385 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 386 | Ga0209026_1000197 | 3300025250 | Bacteria | 84123 |
| 387 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 388 | Ga0209455_1017797 | 3300025272 | Bacteria | 1478 |
| 389 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 390 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 391 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 392 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 393 | Ga0209564_1011183 | 3300025295 | Bacteria | 4046 |
| 394 | Ga0209564_1011455 | 3300025295 | Bacteria | 3972 |
| 395 | Ga0209758_1007200 | 3300025297 | Bacteria | 7661 |
| 396 | Ga0209758_1012031 | 3300025297 | Bacteria | 4910 |
| 397 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 398 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 399 | Ga0207426_1000052 | 3300025302 | Bacteria | 389825 |
| 400 | Ga0207426_1001572 | 3300025302 | Bacteria | 18424 |
| 401 | Ga0207426_1001894 | 3300025302 | Bacteria | 15188 |
| 402 | Ga0207426_1053576 | 3300025302 | Bacteria | 1190 |
| 403 | Ga0209051_1035622 | 3300025303 | Bacteria | 1848 |
| 404 | Ga0209257_1004094 | 3300025304 | Bacteria | 11673 |
| 405 | Ga0207697_10025166 | 3300025315 | Bacteria | 2434 |
| 406 | Ga0207656_10000424 | 3300025321 | Bacteria | 14223 |
| 407 | Ga0207682_10129934 | 3300025893 | Unclassified | 1124 |
| 408 | Ga0207642_10172273 | 3300025899 | Bacteria | 1172 |
| 409 | Ga0207710_10000906 | 3300025900 | Bacteria | 15850 |
| 410 | Ga0207710_10263521 | 3300025900 | Unclassified | 864 |
| 411 | Ga0207710_10326401 | 3300025900 | Bacteria | 779 |
| 412 | Ga0207688_10025859 | 3300025901 | Bacteria | 3226 |
| 413 | Ga0207688_10093027 | 3300025901 | Bacteria | 1733 |
| 414 | Ga0207680_10000014 | 3300025903 | Bacteria | 179035 |
| 415 | Ga0207680_10009667 | 3300025903 | Bacteria | 4794 |
| 416 | Ga0207680_10026936 | 3300025903 | Bacteria | 3193 |
| 417 | Ga0207647_10107096 | 3300025904 | Bacteria | 1654 |
| 418 | Ga0207647_10186786 | 3300025904 | Bacteria | 1202 |
| 419 | Ga0207647_10257031 | 3300025904 | Unclassified | 1001 |
| 420 | Ga0207645_10000949 | 3300025907 | Bacteria | 24072 |
| 421 | Ga0207645_10003031 | 3300025907 | Bacteria | 12943 |
| 422 | Ga0207645_10022717 | 3300025907 | Bacteria | 4077 |
| 423 | Ga0207643_10172958 | 3300025908 | Bacteria | 1304 |
| 424 | Ga0207643_10484803 | 3300025908 | Bacteria | 789 |
| 425 | Ga0207705_10014112 | 3300025909 | Bacteria | 5755 |
| 426 | Ga0207705_10037679 | 3300025909 | Bacteria | 3460 |
| 427 | Ga0207705_10459832 | 3300025909 | Bacteria | 987 |
| 428 | Ga0207705_10540318 | 3300025909 | Bacteria | 906 |
| 429 | Ga0207654_10001242 | 3300025911 | Bacteria | 13578 |
| 430 | Ga0207654_10002095 | 3300025911 | Bacteria | 10217 |
| 431 | Ga0207654_10005208 | 3300025911 | Bacteria | 6563 |
| 432 | Ga0207654_10055619 | 3300025911 | Bacteria | 2292 |
| 433 | Ga0207654_10646838 | 3300025911 | Bacteria | 757 |
| 434 | Ga0207707_10002312 | 3300025912 | Bacteria | 17183 |
| 435 | Ga0207707_10145062 | 3300025912 | Unclassified | 2075 |
| 436 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 437 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 438 | Ga0207695_10000515 | 3300025913 | Bacteria | 82285 |
| 439 | Ga0207695_10001197 | 3300025913 | Bacteria | 44626 |
| 440 | Ga0207695_10015718 | 3300025913 | Bacteria | 8898 |
| 441 | Ga0207695_10024440 | 3300025913 | Bacteria | 6800 |
| 442 | Ga0207695_10024527 | 3300025913 | Bacteria | 6780 |
| 443 | Ga0207695_10042003 | 3300025913 | Bacteria | 4889 |
| 444 | Ga0207695_10042984 | 3300025913 | Bacteria | 4820 |
| 445 | Ga0207695_10047145 | 3300025913 | Bacteria | 4563 |
| 446 | Ga0207695_10132273 | 3300025913 | Bacteria | 2451 |
| 447 | Ga0207695_10193040 | 3300025913 | Bacteria | 1953 |
| 448 | Ga0207671_10000746 | 3300025914 | Bacteria | 41287 |
| 449 | Ga0207671_10003348 | 3300025914 | Bacteria | 16085 |
| 450 | Ga0207671_10003740 | 3300025914 | Bacteria | 14993 |
| 451 | Ga0207671_10004160 | 3300025914 | Bacteria | 13983 |
| 452 | Ga0207671_10005486 | 3300025914 | Bacteria | 11666 |
| 453 | Ga0207671_10008007 | 3300025914 | Bacteria | 9048 |
| 454 | Ga0207671_10056900 | 3300025914 | Bacteria | 2898 |
| 455 | Ga0207671_10081878 | 3300025914 | Bacteria | 2421 |
| 456 | Ga0207671_10089273 | 3300025914 | Bacteria | 2319 |
| 457 | Ga0207660_10003846 | 3300025917 | Bacteria | 9785 |
| 458 | Ga0207660_10036926 | 3300025917 | Bacteria | 3400 |
| 459 | Ga0207660_10377308 | 3300025917 | Bacteria | 1139 |
| 460 | Ga0207657_10002311 | 3300025919 | Bacteria | 20667 |
| 461 | Ga0207649_10124045 | 3300025920 | Bacteria | 1745 |
| 462 | Ga0207649_10334564 | 3300025920 | Unclassified | 1116 |
| 463 | Ga0207652_10017345 | 3300025921 | Bacteria | 5892 |
| 464 | Ga0207652_10033362 | 3300025921 | Bacteria | 4334 |
| 465 | Ga0207652_10054841 | 3300025921 | Bacteria | 3427 |
| 466 | Ga0207652_10595047 | 3300025921 | Bacteria | 992 |
| 467 | Ga0207681_10026831 | 3300025923 | Bacteria | 3719 |
| 468 | Ga0207681_10331527 | 3300025923 | Bacteria | 1213 |
| 469 | Ga0207694_10011115 | 3300025924 | Bacteria | 6799 |
| 470 | Ga0207694_10019150 | 3300025924 | Bacteria | 5175 |
| 471 | Ga0207650_10183514 | 3300025925 | Bacteria | 1668 |
| 472 | Ga0207650_10677585 | 3300025925 | Unclassified | 870 |
| 473 | Ga0207659_10045002 | 3300025926 | Bacteria | 3109 |
| 474 | Ga0207659_10096476 | 3300025926 | Unclassified | 2219 |
| 475 | Ga0207659_10224559 | 3300025926 | Bacteria | 1512 |
| 476 | Ga0207687_10253432 | 3300025927 | Unclassified | 1400 |
| 477 | Ga0207644_10016463 | 3300025931 | Bacteria | 4975 |
| 478 | Ga0207644_10162341 | 3300025931 | Bacteria | 1738 |
| 479 | Ga0207644_10334885 | 3300025931 | Unclassified | 1226 |
| 480 | Ga0207690_10322634 | 3300025932 | Bacteria | 1214 |
| 481 | Ga0207706_10010472 | 3300025933 | Bacteria | 8472 |
| 482 | Ga0207706_10031196 | 3300025933 | Bacteria | 4749 |
| 483 | Ga0207686_10013604 | 3300025934 | Bacteria | 4505 |
| 484 | Ga0207686_10092438 | 3300025934 | Unclassified | 2000 |
| 485 | Ga0207686_10688317 | 3300025934 | Bacteria | 812 |
| 486 | Ga0207709_10192079 | 3300025935 | Bacteria | 1451 |
| 487 | Ga0207670_10364441 | 3300025936 | Unclassified | 1147 |
| 488 | Ga0207669_10020055 | 3300025937 | Bacteria | 3496 |
| 489 | Ga0207669_10621009 | 3300025937 | Unclassified | 881 |
| 490 | Ga0207704_10004208 | 3300025938 | Bacteria | 6576 |
| 491 | Ga0207704_10226476 | 3300025938 | Unclassified | 1387 |
| 492 | Ga0207691_10000037 | 3300025940 | Bacteria | 108385 |
| 493 | Ga0207691_10015603 | 3300025940 | Bacteria | 7222 |
| 494 | Ga0207691_10067065 | 3300025940 | Bacteria | 3245 |
| 495 | Ga0207691_10098458 | 3300025940 | Unclassified | 2612 |
| 496 | Ga0207691_10119013 | 3300025940 | Bacteria | 2342 |
| 497 | Ga0207691_10284505 | 3300025940 | Bacteria | 1422 |
| 498 | Ga0207711_10175960 | 3300025941 | Bacteria | 1944 |
| 499 | Ga0207689_10002471 | 3300025942 | Bacteria | 17199 |
| 500 | Ga0207689_10006705 | 3300025942 | Bacteria | 10156 |
| 501 | Ga0207689_10062707 | 3300025942 | Bacteria | 3057 |
| 502 | Ga0207689_10282084 | 3300025942 | Bacteria | 1376 |
| 503 | Ga0207689_11114202 | 3300025942 | Unclassified | 665 |
| 504 | Ga0207661_10011778 | 3300025944 | Bacteria | 6350 |
| 505 | Ga0207661_10853259 | 3300025944 | Bacteria | 838 |
| 506 | Ga0207679_10670335 | 3300025945 | Unclassified | 939 |
| 507 | Ga0207679_11097643 | 3300025945 | Bacteria | 730 |
| 508 | Ga0207667_10000209 | 3300025949 | Bacteria | 83277 |
| 509 | Ga0207667_10001051 | 3300025949 | Bacteria | 35135 |
| 510 | Ga0207667_10009260 | 3300025949 | Bacteria | 11626 |
| 511 | Ga0207667_10016493 | 3300025949 | Bacteria | 8346 |
| 512 | Ga0207667_10030056 | 3300025949 | Bacteria | 5882 |
| 513 | Ga0207667_10052276 | 3300025949 | Bacteria | 4303 |
| 514 | Ga0207667_10065568 | 3300025949 | Bacteria | 3787 |
| 515 | Ga0207667_10134120 | 3300025949 | Bacteria | 2550 |
| 516 | Ga0207667_10277346 | 3300025949 | Bacteria | 1713 |
| 517 | Ga0207667_10609064 | 3300025949 | Bacteria | 1101 |
| 518 | Ga0207651_10000443 | 3300025960 | Bacteria | 17529 |
| 519 | Ga0207651_10066690 | 3300025960 | Bacteria | 2530 |
| 520 | Ga0207651_10357867 | 3300025960 | Bacteria | 1231 |
| 521 | Ga0207651_10497493 | 3300025960 | Bacteria | 1053 |
| 522 | Ga0207651_10881002 | 3300025960 | Bacteria | 796 |
| 523 | Ga0207712_10011116 | 3300025961 | Bacteria | 5728 |
| 524 | Ga0207712_10071114 | 3300025961 | Unclassified | 2502 |
| 525 | Ga0207712_10098348 | 3300025961 | Bacteria | 2170 |
| 526 | Ga0207712_10284565 | 3300025961 | Bacteria | 1350 |
| 527 | Ga0207668_10001307 | 3300025972 | Bacteria | 14792 |
| 528 | Ga0207668_10081891 | 3300025972 | Bacteria | 2343 |
| 529 | Ga0207668_10574412 | 3300025972 | Unclassified | 979 |
| 530 | Ga0207640_10024969 | 3300025981 | Bacteria | 3612 |
| 531 | Ga0207640_10144275 | 3300025981 | Unclassified | 1740 |
| 532 | Ga0207658_10000629 | 3300025986 | Bacteria | 31155 |
| 533 | Ga0207658_10233991 | 3300025986 | Bacteria | 1552 |
| 534 | Ga0207658_10391069 | 3300025986 | Bacteria | 1220 |
| 535 | Ga0207658_10602724 | 3300025986 | Bacteria | 987 |
| 536 | Ga0207658_10778212 | 3300025986 | Bacteria | 868 |
| 537 | Ga0207677_10004861 | 3300026023 | Bacteria | 7252 |
| 538 | Ga0207677_10050852 | 3300026023 | Bacteria | 2806 |
| 539 | Ga0207677_10052340 | 3300026023 | Bacteria | 2773 |
| 540 | Ga0207677_10380101 | 3300026023 | Bacteria | 1192 |
| 541 | Ga0207677_10389914 | 3300026023 | Bacteria | 1178 |
| 542 | Ga0207703_10004145 | 3300026035 | Bacteria | 11957 |
| 543 | Ga0207703_10093203 | 3300026035 | Bacteria | 2536 |
| 544 | Ga0207703_10331636 | 3300026035 | Bacteria | 1396 |
| 545 | Ga0207703_10552576 | 3300026035 | Unclassified | 1086 |
| 546 | Ga0207639_10016611 | 3300026041 | Bacteria | 5211 |
| 547 | Ga0207639_10018632 | 3300026041 | Bacteria | 4937 |
| 548 | Ga0207639_10156773 | 3300026041 | Bacteria | 1913 |
| 549 | Ga0207639_10320012 | 3300026041 | Bacteria | 1377 |
| 550 | Ga0207639_10385562 | 3300026041 | Unclassified | 1259 |
| 551 | Ga0207639_10484348 | 3300026041 | Unclassified | 1128 |
| 552 | Ga0207639_10541615 | 3300026041 | Bacteria | 1068 |
| 553 | Ga0207639_10579064 | 3300026041 | Bacteria | 1033 |
| 554 | Ga0207708_10272109 | 3300026075 | Bacteria | 1370 |
| 555 | Ga0207702_10000300 | 3300026078 | Bacteria | 57198 |
| 556 | Ga0207702_10038638 | 3300026078 | Bacteria | 3997 |
| 557 | Ga0207702_10084583 | 3300026078 | Bacteria | 2762 |
| 558 | Ga0207702_10112852 | 3300026078 | Bacteria | 2419 |
| 559 | Ga0207702_10230736 | 3300026078 | Bacteria | 1730 |
| 560 | Ga0207702_10240589 | 3300026078 | Bacteria | 1695 |
| 561 | Ga0207702_10380912 | 3300026078 | Bacteria | 1357 |
| 562 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 563 | Ga0207641_10239613 | 3300026088 | Unclassified | 1690 |
| 564 | Ga0207648_10001276 | 3300026089 | Bacteria | 28144 |
| 565 | Ga0207648_10002156 | 3300026089 | Bacteria | 21404 |
| 566 | Ga0207648_10013274 | 3300026089 | Bacteria | 7675 |
| 567 | Ga0207648_10059637 | 3300026089 | Bacteria | 3328 |
| 568 | Ga0207648_10472966 | 3300026089 | Unclassified | 1144 |
| 569 | Ga0207648_10994823 | 3300026089 | Bacteria | 785 |
| 570 | Ga0207676_10002535 | 3300026095 | Bacteria | 13033 |
| 571 | Ga0207676_10040303 | 3300026095 | Bacteria | 3579 |
| 572 | Ga0207676_10171751 | 3300026095 | Bacteria | 1890 |
| 573 | Ga0207676_10424070 | 3300026095 | Bacteria | 1248 |
| 574 | Ga0207674_10014068 | 3300026116 | Bacteria | 8840 |
| 575 | Ga0207674_10072510 | 3300026116 | Bacteria | 3460 |
| 576 | Ga0207674_10086225 | 3300026116 | Bacteria | 3135 |
| 577 | Ga0207674_10151233 | 3300026116 | Bacteria | 2278 |
| 578 | Ga0207674_10247155 | 3300026116 | Bacteria | 1731 |
| 579 | Ga0207675_100082228 | 3300026118 | Bacteria | 3020 |
| 580 | Ga0207675_100324409 | 3300026118 | Unclassified | 1504 |
| 581 | Ga0207675_100340726 | 3300026118 | Bacteria | 1468 |
| 582 | Ga0207675_101262661 | 3300026118 | Unclassified | 759 |
| 583 | Ga0207683_10063384 | 3300026121 | Bacteria | 3256 |
| 584 | Ga0207683_10076193 | 3300026121 | Bacteria | 2970 |
| 585 | Ga0207683_10097861 | 3300026121 | Bacteria | 2617 |
| 586 | Ga0207698_10000781 | 3300026142 | Bacteria | 18499 |
| 587 | Ga0207698_10001356 | 3300026142 | Bacteria | 14268 |
| 588 | Ga0207698_10019600 | 3300026142 | Bacteria | 4635 |
| 589 | Ga0207698_10360049 | 3300026142 | Bacteria | 1377 |
| 590 | Ga0207698_10431788 | 3300026142 | Bacteria | 1267 |
| 591 | Ga0207698_10809343 | 3300026142 | Bacteria | 939 |
| 592 | Ga0207698_11085626 | 3300026142 | Unclassified | 813 |
| 593 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 594 | Ga0268266_10004818 | 3300028379 | Bacteria | 12818 |
| 595 | Ga0268266_10023629 | 3300028379 | Bacteria | 5232 |
| 596 | Ga0268266_10776664 | 3300028379 | Bacteria | 925 |
| 597 | Ga0268266_11034053 | 3300028379 | Bacteria | 795 |
| 598 | Ga0268265_10348303 | 3300028380 | Bacteria | 1352 |
| 599 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 600 | Ga0268264_10003753 | 3300028381 | Bacteria | 13045 |
| 601 | Ga0268264_10006147 | 3300028381 | Bacteria | 10139 |
| 602 | Ga0268264_10064089 | 3300028381 | Bacteria | 3092 |
| 603 | Ga0268264_10153754 | 3300028381 | Bacteria | 2065 |
| 604 | Ga0268264_10406699 | 3300028381 | Bacteria | 1309 |
| 605 | Ga0268264_10612190 | 3300028381 | Bacteria | 1074 |
| 606 | Ga0307517_10206908 | 3300028786 | Unclassified | 1216 |
| 607 | Ga0307515_10000707 | 3300028794 | Bacteria | 76907 |
| 608 | Ga0307515_10000993 | 3300028794 | Bacteria | 64832 |
| 609 | Ga0307511_10007925 | 3300030521 | Bacteria | 10657 |
| 610 | Ga0265327_10000115 | 3300031251 | Bacteria | 173854 |
| 611 | Ga0307513_10304684 | 3300031456 | Bacteria | 1358 |
| 612 | Ga0307516_10000656 | 3300031730 | Bacteria | 46771 |
| 613 | Ga0307516_10311658 | 3300031730 | Bacteria | 1247 |
| 614 | Ga0307410_10125443 | 3300031852 | Bacteria | 1879 |
| 615 | Ga0307407_10177440 | 3300031903 | Bacteria | 1409 |
| 616 | Ga0307412_10336655 | 3300031911 | Bacteria | 1206 |
| 617 | Ga0307414_10050591 | 3300032004 | Bacteria | 2879 |
| 618 | Ga0307414_10100657 | 3300032004 | Bacteria | 2174 |
| 619 | Ga0307414_10250186 | 3300032004 | Bacteria | 1473 |
| 620 | Ga0307411_10704405 | 3300032005 | Bacteria | 880 |
| 621 | Ga0307510_10000584 | 3300033180 | Bacteria | 36797 |
| 622 | Ga0307510_10378843 | 3300033180 | Bacteria | 860 |
| 623 | Ga0373954_0234289 | 3300035118 | Bacteria | 904 |
| 624 | Ga0395900_0173088 | 3300037418 | Bacteria | 2197 |
| 625 | Ga0436365_1170113 | 3300039437 | Bacteria | 2032 |
| 626 | Ga0436365_1468940 | 3300039437 | Bacteria | 37650 |
| 627 | Ga0439436_0006309 | 3300041404 | Bacteria | 3641 |
| 628 | Ga0439447_000932 | 3300041407 | Bacteria | 10686 |
| 629 | Ga0451833_0564981 | 3300041491 | Unclassified | 760 |
| 630 | Ga0451833_1433807 | 3300041491 | Unclassified | 691 |
| 631 | Ga0451841_0881867 | 3300041498 | Bacteria | 1260 |
| 632 | Ga0451843_0056518 | 3300041509 | Bacteria | 732 |
| 633 | Ga0439431_0000264 | 3300041997 | Bacteria | 10760 |
| 634 | Ga0439448_0064373 | 3300042005 | Unclassified | 1215 |
| 635 | Ga0439449_0028526 | 3300042007 | Bacteria | 2080 |
| 636 | Ga0439457_000583 | 3300042014 | Bacteria | 10682 |
| 637 | Ga0439462_0008982 | 3300042015 | Bacteria | 2529 |
| 638 | Ga0451577_0938505 | 3300042876 | Bacteria | 778 |
| 639 | Ga0466969_0001216 | 3300044656 | Bacteria | 13901 |
| 640 | Ga0466972_0000928 | 3300044658 | Bacteria | 14109 |
| 641 | Ga0466966_0000184 | 3300044684 | Bacteria | 41499 |
| 642 | Ga0466961_0034755 | 3300044693 | Bacteria | 3236 |
| 643 | Ga0453684_1551179 | 3300044712 | Bacteria | 681 |
| 644 | Ga0466971_0070821 | 3300044719 | Bacteria | 1583 |
| 645 | Ga0466971_0112481 | 3300044719 | Bacteria | 1257 |
| 646 | Ga0466968_0137233 | 3300044735 | Unclassified | 1116 |
| 647 | Ga0466957_0881012 | 3300044842 | Bacteria | 639 |
| 648 | Ga0466959_0000097 | 3300045049 | Bacteria | 55620 |
| 649 | Ga0466959_0026078 | 3300045049 | Bacteria | 4334 |
| 650 | Ga0466958_0044854 | 3300045836 | Unclassified | 2665 |
| 651 | Ga0466967_0376354 | 3300045976 | Bacteria | 1378 |
| 652 | Ga0495638_0044648 | 3300046460 | Bacteria | 2791 |
| 653 | Ga0495638_0048014 | 3300046460 | Bacteria | 2674 |
| 654 | Ga0495638_0214312 | 3300046460 | Bacteria | 1080 |
| 655 | Ga0495651_0464255 | 3300046462 | Bacteria | 816 |
| 656 | Ga0495650_0000273 | 3300046471 | Bacteria | 98757 |
| 657 | Ga0495662_0386355 | 3300046476 | Unclassified | 687 |
| 658 | Ga0495664_0149519 | 3300046477 | Bacteria | 1417 |
| 659 | Ga0495585_0001701 | 3300046492 | Bacteria | 16773 |
| 660 | Ga0495583_0024219 | 3300046506 | Bacteria | 3055 |
| 661 | Ga0495606_0000130 | 3300046507 | Bacteria | 127805 |
| 662 | Ga0495606_0054975 | 3300046507 | Bacteria | 2576 |
| 663 | Ga0495606_0194015 | 3300046507 | Bacteria | 1162 |
| 664 | Ga0495610_0009742 | 3300046512 | Bacteria | 6039 |
| 665 | Ga0495616_0009400 | 3300046513 | Bacteria | 5723 |
| 666 | Ga0495632_0130702 | 3300046519 | Bacteria | 1169 |
| 667 | Ga0495632_0227832 | 3300046519 | Bacteria | 841 |
| 668 | Ga0495648_0004026 | 3300046524 | Bacteria | 12694 |
| 669 | Ga0495652_0126388 | 3300046529 | Bacteria | 2031 |
| 670 | Ga0495640_0492136 | 3300046533 | Unclassified | 747 |
| 671 | Ga0495586_0530015 | 3300046535 | Unclassified | 680 |
| 672 | Ga0495597_0247340 | 3300046542 | Bacteria | 701 |
| 673 | Ga0495633_0003361 | 3300046558 | Bacteria | 10732 |
| 674 | Ga0495667_0263572 | 3300046559 | Unclassified | 1096 |
| 675 | Ga0495668_0252547 | 3300046616 | Bacteria | 965 |
| 676 | Ga0495611_0000575 | 3300046648 | Bacteria | 21197 |
| 677 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 678 | Ga0495661_0044534 | 3300046665 | Bacteria | 2719 |
| 679 | Ga0495623_0188691 | 3300046679 | Bacteria | 1193 |
| 680 | Ga0495613_0424596 | 3300046689 | Bacteria | 904 |
| 681 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 682 | Ga0495649_0036243 | 3300046694 | Bacteria | 2710 |
| 683 | Ga0495600_0410183 | 3300046809 | Unclassified | 842 |
| 684 | Ga0495660_0032812 | 3300046810 | Bacteria | 2915 |
| 685 | Ga0495660_0137077 | 3300046810 | Bacteria | 1222 |
| 686 | Ga0495581_0100444 | 3300047315 | Bacteria | 1681 |
| 687 | Ga0495674_0083880 | 3300047319 | Bacteria | 2731 |
| 688 | Ga0495672_0046637 | 3300047320 | Bacteria | 2583 |
| 689 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 690 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 691 | Ga0496106_0793756 | 3300048909 | Unclassified | 751 |
| 692 | Ga0496109_0028678 | 3300048912 | Bacteria | 4982 |
| 693 | Ga0496115_0350418 | 3300048918 | Bacteria | 1204 |
| 694 | Ga0496121_0000036 | 3300048924 | Bacteria | 362643 |
| 695 | Ga0496122_0001285 | 3300048925 | Bacteria | 41682 |
| 696 | Ga0496123_0003994 | 3300048926 | Bacteria | 15964 |
| 697 | Ga0496125_0101909 | 3300048928 | Bacteria | 2111 |
| 698 | Ga0501031_0036070 | 3300049568 | Bacteria | 3225 |
| 699 | Ga0501032_0007417 | 3300049569 | Bacteria | 8011 |
| 700 | Ga0501032_0101834 | 3300049569 | Bacteria | 1903 |
| 701 | Ga0501033_0016645 | 3300049570 | Bacteria | 5562 |
| 702 | Ga0501033_0374836 | 3300049570 | Bacteria | 995 |
| 703 | Ga0501034_0048388 | 3300049571 | Bacteria | 4291 |
| 704 | Ga0501034_0064484 | 3300049571 | Bacteria | 3677 |
| 705 | Ga0501034_0144872 | 3300049571 | Bacteria | 2353 |
| 706 | Ga0501034_0344559 | 3300049571 | Unclassified | 1419 |
| 707 | Ga0501034_0576225 | 3300049571 | Bacteria | 1033 |
| 708 | Ga0501037_0005310 | 3300049573 | Bacteria | 9372 |
| 709 | Ga0501037_0012307 | 3300049573 | Bacteria | 6298 |
| 710 | Ga0501037_0378098 | 3300049573 | Bacteria | 974 |
| 711 | Ga0501038_0033490 | 3300049574 | Bacteria | 4526 |
| 712 | Ga0501043_0091900 | 3300049579 | Bacteria | 2386 |
| 713 | Ga0501043_0416409 | 3300049579 | Unclassified | 1013 |
| 714 | Ga0501043_1053607 | 3300049579 | Bacteria | 576 |
| 715 | Ga0501046_0018347 | 3300049580 | Bacteria | 5824 |
| 716 | Ga0501046_0038148 | 3300049580 | Bacteria | 3858 |
| 717 | Ga0501047_0013489 | 3300049581 | Bacteria | 7746 |
| 718 | Ga0501047_0033096 | 3300049581 | Bacteria | 4991 |
| 719 | Ga0501047_0256271 | 3300049581 | Bacteria | 1598 |
| 720 | Ga0501047_0378521 | 3300049581 | Unclassified | 1250 |
| 721 | Ga0501048_0400940 | 3300049582 | Bacteria | 980 |
| 722 | Ga0501067_0087767 | 3300049583 | Bacteria | 1726 |
| 723 | Ga0501068_0315447 | 3300049584 | Bacteria | 1002 |
| 724 | Ga0501070_0014914 | 3300049586 | Bacteria | 6536 |
| 725 | Ga0501073_0183383 | 3300049589 | Unclassified | 1449 |
| 726 | Ga0501074_0102988 | 3300049590 | Unclassified | 2044 |
| 727 | Ga0501219_001673 | 3300049703 | Bacteria | 1969 |
| 728 | Ga0501080_0121551 | 3300049742 | Unclassified | 2419 |
| 729 | Ga0501080_0318364 | 3300049742 | Bacteria | 1409 |
| 730 | Ga0501083_0039932 | 3300049744 | Bacteria | 3186 |
| 731 | Ga0501035_0243029 | 3300049822 | Bacteria | 1531 |
| 732 | Ga0501035_1039661 | 3300049822 | Bacteria | 642 |
| 733 | Ga0501044_0014888 | 3300049823 | Bacteria | 8385 |
| 734 | Ga0501044_0065026 | 3300049823 | Bacteria | 3720 |
| 735 | Ga0501044_0077306 | 3300049823 | Unclassified | 3376 |
| 736 | Ga0501044_0086137 | 3300049823 | Bacteria | 3174 |
| 737 | Ga0501044_0763853 | 3300049823 | Unclassified | 848 |
| 738 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 739 | Ga0500646_0013830 | 3300053090 | Bacteria | 2091 |
| 740 | Ga0500646_0040563 | 3300053090 | Bacteria | 1309 |
| 741 | Ga0500583_0000078 | 3300053092 | Bacteria | 58451 |
| 742 | Ga0500583_0001571 | 3300053092 | Bacteria | 6613 |
| 743 | Ga0500583_0013003 | 3300053092 | Bacteria | 3201 |
| 744 | Ga0500583_0310796 | 3300053092 | Unclassified | 770 |
| 745 | Ga0500651_0168722 | 3300053093 | Bacteria | 1306 |
| 746 | Ga0500660_128294 | 3300053100 | Bacteria | 1038 |
| 747 | Ga0500557_089211 | 3300053105 | Bacteria | 1021 |
| 748 | Ga0500608_069319 | 3300053122 | Bacteria | 1678 |
| 749 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 750 | Ga0500642_0035698 | 3300053130 | Bacteria | 2113 |
| 751 | Ga0500652_005630 | 3300053131 | Bacteria | 3965 |
| 752 | Ga0500658_0058455 | 3300053134 | Bacteria | 1597 |
| 753 | Ga0500658_0079128 | 3300053134 | Bacteria | 1402 |
| 754 | Ga0500559_0283329 | 3300053136 | Bacteria | 779 |
| 755 | Ga0500603_020199 | 3300053150 | Bacteria | 1625 |
| 756 | Ga0500604_0277708 | 3300053151 | Unclassified | 581 |
| 757 | Ga0500616_0022794 | 3300053153 | Bacteria | 3494 |
| 758 | Ga0500622_0006472 | 3300053156 | Bacteria | 6780 |
| 759 | Ga0500622_0018889 | 3300053156 | Bacteria | 3663 |
| 760 | Ga0500637_0090501 | 3300053178 | Bacteria | 1772 |
| 761 | Ga0500637_0112221 | 3300053178 | Unclassified | 1581 |
| 762 | Ga0500637_0149649 | 3300053178 | Unclassified | 1349 |
| 763 | Ga0500611_028007 | 3300053727 | Bacteria | 1140 |
| 764 | Ga0501084_0229319 | 3300054114 | Unclassified | 1568 |
| 765 | Ga0587077_023405 | 3300059493 | Bacteria | 1115 |
| 766 | Ga0501082_0346157 | 3300060353 | Bacteria | 1295 |
| 767 | Ga0466962_0027711 | 3300061719 | Bacteria | 2717 |
| 768 | Ga0466962_0073543 | 3300061719 | Bacteria | 1633 |
| 769 | Ga0466962_0389622 | 3300061719 | Unclassified | 697 |
| 770 | Ga0466962_0446222 | 3300061719 | Unclassified | 651 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005288 | Ga0065714_10172053 | Ga0065714_101720531 | 154 |
| 2 | 3300003323 | rootH1_10268100 | rootH1_102681002 | 162 |
| 3 | 3300025949 | Ga0207667_10134120 | Ga0207667_101341202 | 164 |
| 4 | 3300003323 | rootH1_10025877 | rootH1_100258772 | 166 |
| 5 | 3300028794 | Ga0307515_10000993 | Ga0307515_1000099338 | 168 |
| 6 | 3300046462 | Ga0495651_0464255 | Ga0495651_0464255_164_736 | 168 |
| 7 | 3300005341 | Ga0070691_10161802 | Ga0070691_101618022 | 170 |
| 8 | 3300005530 | Ga0070679_100052315 | Ga0070679_1000523157 | 170 |
| 9 | 3300005563 | Ga0068855_100090222 | Ga0068855_1000902222 | 170 |
| 10 | 3300005614 | Ga0068856_100699999 | Ga0068856_1006999991 | 170 |
| 11 | 3300009545 | Ga0105237_10043122 | Ga0105237_100431228 | 170 |
| 12 | 3300010375 | Ga0105239_10013995 | Ga0105239_100139952 | 170 |
| 13 | 3300013100 | Ga0157373_10113662 | Ga0157373_101136622 | 170 |
| 14 | 3300013307 | Ga0157372_10197916 | Ga0157372_101979162 | 170 |
| 15 | 3300025913 | Ga0207695_10042984 | Ga0207695_100429845 | 170 |
| 16 | 3300026041 | Ga0207639_10385562 | Ga0207639_103855622 | 170 |
| 17 | 3300053093 | Ga0500651_0168722 | Ga0500651_0168722_102_680 | 170 |
| 18 | iso_pu_bacteria | 2941489479 | 2941490337 | 171 |
| 19 | 3300003203 | JGI25406J46586_10032261 | JGI25406J46586_100322612 | 172 |
| 20 | 3300005329 | Ga0070683_100790402 | Ga0070683_1007904021 | 172 |
| 21 | 3300005335 | Ga0070666_10270683 | Ga0070666_102706833 | 172 |
| 22 | 3300005337 | Ga0070682_100015574 | Ga0070682_1000155742 | 172 |
| 23 | 3300005338 | Ga0068868_100023545 | Ga0068868_1000235454 | 172 |
| 24 | 3300005339 | Ga0070660_100004164 | Ga0070660_1000041647 | 172 |
| 25 | 3300005344 | Ga0070661_100008471 | Ga0070661_1000084713 | 172 |
| 26 | 3300005354 | Ga0070675_100541788 | Ga0070675_1005417882 | 172 |
| 27 | 3300005355 | Ga0070671_100092479 | Ga0070671_1000924793 | 172 |
| 28 | 3300005366 | Ga0070659_100009089 | Ga0070659_1000090894 | 172 |
| 29 | 3300005456 | Ga0070678_100033217 | Ga0070678_1000332173 | 172 |
| 30 | 3300005457 | Ga0070662_100145632 | Ga0070662_1001456322 | 172 |
| 31 | 3300005539 | Ga0068853_100159655 | Ga0068853_1001596552 | 172 |
| 32 | 3300005563 | Ga0068855_100025328 | Ga0068855_1000253282 | 172 |
| 33 | 3300005564 | Ga0070664_100955627 | Ga0070664_1009556271 | 172 |
| 34 | 3300005614 | Ga0068856_100043872 | Ga0068856_1000438722 | 172 |
| 35 | 3300005615 | Ga0070702_100283030 | Ga0070702_1002830301 | 172 |
| 36 | 3300005616 | Ga0068852_100198533 | Ga0068852_1001985333 | 172 |
| 37 | 3300006237 | Ga0097621_100010324 | Ga0097621_1000103246 | 172 |
| 38 | 3300013100 | Ga0157373_10007171 | Ga0157373_100071714 | 172 |
| 39 | 3300013102 | Ga0157371_10144610 | Ga0157371_101446102 | 172 |
| 40 | 3300013104 | Ga0157370_10262702 | Ga0157370_102627022 | 172 |
| 41 | 3300013105 | Ga0157369_10006899 | Ga0157369_100068998 | 172 |
| 42 | 3300013296 | Ga0157374_10012630 | Ga0157374_100126302 | 172 |
| 43 | 3300013297 | Ga0157378_10035695 | Ga0157378_100356952 | 172 |
| 44 | 3300013306 | Ga0163162_10077507 | Ga0163162_100775071 | 172 |
| 45 | 3300014968 | Ga0157379_11517524 | Ga0157379_115175241 | 172 |
| 46 | 3300025903 | Ga0207680_10026936 | Ga0207680_100269362 | 172 |
| 47 | 3300025911 | Ga0207654_10055619 | Ga0207654_100556193 | 172 |
| 48 | 3300025912 | Ga0207707_10145062 | Ga0207707_101450622 | 172 |
| 49 | 3300025917 | Ga0207660_10377308 | Ga0207660_103773082 | 172 |
| 50 | 3300025919 | Ga0207657_10002311 | Ga0207657_100023113 | 172 |
| 51 | 3300025920 | Ga0207649_10124045 | Ga0207649_101240452 | 172 |
| 52 | 3300025921 | Ga0207652_10595047 | Ga0207652_105950471 | 172 |
| 53 | 3300025926 | Ga0207659_10045002 | Ga0207659_100450022 | 172 |
| 54 | 3300025931 | Ga0207644_10162341 | Ga0207644_101623412 | 172 |
| 55 | 3300025932 | Ga0207690_10322634 | Ga0207690_103226341 | 172 |
| 56 | 3300025933 | Ga0207706_10010472 | Ga0207706_100104726 | 172 |
| 57 | 3300025944 | Ga0207661_10853259 | Ga0207661_108532591 | 172 |
| 58 | 3300025949 | Ga0207667_10016493 | Ga0207667_100164938 | 172 |
| 59 | 3300025949 | Ga0207667_10052276 | Ga0207667_100522762 | 172 |
| 60 | 3300025960 | Ga0207651_10497493 | Ga0207651_104974931 | 172 |
| 61 | 3300026023 | Ga0207677_10050852 | Ga0207677_100508522 | 172 |
| 62 | 3300026041 | Ga0207639_10579064 | Ga0207639_105790642 | 172 |
| 63 | 3300026078 | Ga0207702_10084583 | Ga0207702_100845831 | 172 |
| 64 | 3300026116 | Ga0207674_10086225 | Ga0207674_100862254 | 172 |
| 65 | 3300026121 | Ga0207683_10097861 | Ga0207683_100978611 | 172 |
| 66 | 3300026142 | Ga0207698_10360049 | Ga0207698_103600492 | 172 |
| 67 | 3300049742 | Ga0501080_0318364 | Ga0501080_0318364_658_1236 | 172 |
| 68 | 3300005535 | Ga0070684_100026351 | Ga0070684_1000263514 | 173 |
| 69 | 3300005577 | Ga0068857_100006566 | Ga0068857_1000065663 | 173 |
| 70 | 3300005578 | Ga0068854_100048329 | Ga0068854_1000483293 | 173 |
| 71 | 3300005614 | Ga0068856_100032772 | Ga0068856_1000327722 | 173 |
| 72 | 3300005616 | Ga0068852_100000242 | Ga0068852_10000024216 | 173 |
| 73 | 3300009093 | Ga0105240_10014243 | Ga0105240_100142436 | 173 |
| 74 | 3300009093 | Ga0105240_10224199 | Ga0105240_102241992 | 173 |
| 75 | 3300009545 | Ga0105237_10100182 | Ga0105237_101001821 | 173 |
| 76 | 3300009551 | Ga0105238_10014367 | Ga0105238_100143672 | 173 |
| 77 | 3300013104 | Ga0157370_10002239 | Ga0157370_100022397 | 173 |
| 78 | 3300013307 | Ga0157372_10001004 | Ga0157372_100010047 | 173 |
| 79 | 3300017792 | Ga0163161_10744215 | Ga0163161_107442151 | 173 |
| 80 | 3300025904 | Ga0207647_10107096 | Ga0207647_101070962 | 173 |
| 81 | 3300025913 | Ga0207695_10024440 | Ga0207695_100244405 | 173 |
| 82 | 3300025924 | Ga0207694_10019150 | Ga0207694_100191503 | 173 |
| 83 | 3300025949 | Ga0207667_10001051 | Ga0207667_1000105122 | 173 |
| 84 | 3300025981 | Ga0207640_10024969 | Ga0207640_100249693 | 173 |
| 85 | 3300026078 | Ga0207702_10240589 | Ga0207702_102405892 | 173 |
| 86 | 3300026116 | Ga0207674_10014068 | Ga0207674_100140685 | 173 |
| 87 | 3300026142 | Ga0207698_10000781 | Ga0207698_1000078118 | 173 |
| 88 | 3300041509 | Ga0451843_0056518 | Ga0451843_0056518_104_676 | 173 |
| 89 | 3300044719 | Ga0466971_0112481 | Ga0466971_0112481_210_782 | 173 |
| 90 | 3300044842 | Ga0466957_0881012 | Ga0466957_0881012_10_588 | 173 |
| 91 | 3300053136 | Ga0500559_0283329 | Ga0500559_0283329_212_754 | 173 |
| 92 | 3300053151 | Ga0500604_0277708 | Ga0500604_0277708_18_560 | 173 |
| 93 | 3300048928 | Ga0496125_0101909 | Ga0496125_0101909_24_608 | 174 |
| 94 | 3300003322 | rootL2_10157062 | rootL2_101570622 | 175 |
| 95 | 3300005337 | Ga0070682_100621294 | Ga0070682_1006212941 | 175 |
| 96 | 3300013105 | Ga0157369_10748863 | Ga0157369_107488632 | 175 |
| 97 | 3300041407 | Ga0439447_000932 | Ga0439447_000932_8345_8923 | 175 |
| 98 | 3300048924 | Ga0496121_0000036 | Ga0496121_0000036_307772_308347 | 175 |
| 99 | 3300003771 | Ga0055526_1000006 | Ga0055526_100000682 | 176 |
| 100 | 3300003773 | Ga0055537_1000003 | Ga0055537_1000003144 | 176 |
| 101 | 3300003773 | Ga0055537_1000018 | Ga0055537_100001882 | 176 |
| 102 | 3300003775 | Ga0055524_1000009 | Ga0055524_1000009144 | 176 |
| 103 | 3300003784 | Ga0055534_1000004 | Ga0055534_1000004144 | 176 |
| 104 | 3300003790 | Ga0055528_1000003 | Ga0055528_1000003177 | 176 |
| 105 | 3300005347 | Ga0070668_100486000 | Ga0070668_1004860002 | 176 |
| 106 | 3300005367 | Ga0070667_100147132 | Ga0070667_1001471321 | 176 |
| 107 | 3300009553 | Ga0105249_10139712 | Ga0105249_101397123 | 176 |
| 108 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012247 | 176 |
| 109 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012247 | 176 |
| 110 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001285 | 176 |
| 111 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001447 | 176 |
| 112 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000021105 | 176 |
| 113 | 3300025961 | Ga0207712_10284565 | Ga0207712_102845651 | 176 |
| 114 | 3300025986 | Ga0207658_10233991 | Ga0207658_102339913 | 176 |
| 115 | 3300028786 | Ga0307517_10206908 | Ga0307517_102069082 | 177 |
| 116 | 3300028794 | Ga0307515_10000707 | Ga0307515_1000070735 | 177 |
| 117 | 3300053122 | Ga0500608_069319 | Ga0500608_069319_963_1535 | 177 |
| 118 | 3300061719 | Ga0466962_0073543 | Ga0466962_0073543_682_1233 | 177 |
| 119 | 3300005327 | Ga0070658_10638602 | Ga0070658_106386021 | 178 |
| 120 | 3300005339 | Ga0070660_100228197 | Ga0070660_1002281972 | 178 |
| 121 | 3300005578 | Ga0068854_100242577 | Ga0068854_1002425772 | 178 |
| 122 | 3300005614 | Ga0068856_100478100 | Ga0068856_1004781002 | 178 |
| 123 | 3300010375 | Ga0105239_10638915 | Ga0105239_106389152 | 178 |
| 124 | 3300025909 | Ga0207705_10459832 | Ga0207705_104598321 | 178 |
| 125 | 3300025917 | Ga0207660_10036926 | Ga0207660_100369262 | 178 |
| 126 | 3300025921 | Ga0207652_10054841 | Ga0207652_100548413 | 178 |
| 127 | 3300025949 | Ga0207667_10609064 | Ga0207667_106090642 | 178 |
| 128 | 3300026041 | Ga0207639_10156773 | Ga0207639_101567731 | 178 |
| 129 | 3300026078 | Ga0207702_10380912 | Ga0207702_103809121 | 178 |
| 130 | 3300026142 | Ga0207698_10019600 | Ga0207698_100196001 | 178 |
| 131 | 3300049579 | Ga0501043_1053607 | Ga0501043_1053607_20_556 | 178 |
| 132 | 3300049822 | Ga0501035_0243029 | Ga0501035_0243029_11_547 | 178 |
| 133 | iso_pu_bacteria | 2738541283 | 2738759328 | 178 |
| 134 | 3300003316 | rootH1_10151956 | rootH1_101519563 | 179 |
| 135 | 3300003320 | rootH2_10008932 | rootH2_100089322 | 179 |
| 136 | 3300003320 | rootH2_10032886 | rootH2_1003288610 | 179 |
| 137 | 3300003323 | rootH1_10254323 | rootH1_102543233 | 179 |
| 138 | 3300005563 | Ga0068855_100046105 | Ga0068855_1000461052 | 179 |
| 139 | 3300006237 | Ga0097621_100178821 | Ga0097621_1001788213 | 179 |
| 140 | 3300025914 | Ga0207671_10089273 | Ga0207671_100892732 | 179 |
| 141 | 3300025949 | Ga0207667_10030056 | Ga0207667_100300564 | 179 |
| 142 | 3300031251 | Ga0265327_10000115 | Ga0265327_1000011521 | 179 |
| 143 | iso_pu_bacteria | 2599185184 | 2599477133 | 179 |
| 144 | iso_pu_bacteria | 2928078545 | 2928079047 | 179 |
| 145 | iso_pu_bacteria | 2928147474 | 2928148582 | 179 |
| 146 | iso_pu_bacteria | 2932082852 | 2932085876 | 179 |
| 147 | iso_pu_bacteria | 2738541278 | 2738725241 | 180 |
| 148 | 3300009101 | Ga0105247_10003817 | Ga0105247_100038176 | 181 |
| 149 | 3300021384 | Ga0213876_10000680 | Ga0213876_1000068011 | 181 |
| 150 | 3300025900 | Ga0207710_10000906 | Ga0207710_100009063 | 181 |
| 151 | 3300039437 | Ga0436365_1468940 | Ga0436365_1468940_18401_18964 | 181 |
| 152 | 3300049570 | Ga0501033_0016645 | Ga0501033_0016645_2112_2675 | 181 |
| 153 | 3300049571 | Ga0501034_0048388 | Ga0501034_0048388_3529_4092 | 181 |
| 154 | 3300049571 | Ga0501034_0064484 | Ga0501034_0064484_2860_3423 | 181 |
| 155 | 3300049822 | Ga0501035_1039661 | Ga0501035_1039661_19_582 | 181 |
| 156 | 3300049823 | Ga0501044_0014888 | Ga0501044_0014888_6538_7101 | 181 |
| 157 | 3300005288 | Ga0065714_10075158 | Ga0065714_100751582 | 182 |
| 158 | 3300005617 | Ga0068859_100167906 | Ga0068859_1001679062 | 182 |
| 159 | 3300005843 | Ga0068860_100050303 | Ga0068860_1000503034 | 182 |
| 160 | 3300006931 | Ga0097620_100167901 | Ga0097620_1001679012 | 182 |
| 161 | 3300009098 | Ga0105245_10624377 | Ga0105245_106243771 | 182 |
| 162 | 3300009176 | Ga0105242_10446482 | Ga0105242_104464821 | 182 |
| 163 | 3300009545 | Ga0105237_10012148 | Ga0105237_100121485 | 182 |
| 164 | 3300009553 | Ga0105249_10019812 | Ga0105249_100198126 | 182 |
| 165 | 3300013104 | Ga0157370_10476091 | Ga0157370_104760911 | 182 |
| 166 | 3300013306 | Ga0163162_10238891 | Ga0163162_102388912 | 182 |
| 167 | 3300015261 | Ga0182006_1000134 | Ga0182006_100013433 | 182 |
| 168 | 3300017792 | Ga0163161_10009869 | Ga0163161_100098693 | 182 |
| 169 | 3300025914 | Ga0207671_10008007 | Ga0207671_100080076 | 182 |
| 170 | 3300025923 | Ga0207681_10331527 | Ga0207681_103315272 | 182 |
| 171 | 3300025940 | Ga0207691_10284505 | Ga0207691_102845052 | 182 |
| 172 | 3300028381 | Ga0268264_10064089 | Ga0268264_100640892 | 182 |
| 173 | 3300042876 | Ga0451577_0938505 | Ga0451577_0938505_89_658 | 182 |
| 174 | 3300044712 | Ga0453684_1551179 | Ga0453684_1551179_31_600 | 182 |
| 175 | 3300046689 | Ga0495613_0424596 | Ga0495613_0424596_172_777 | 182 |
| 176 | 3300048925 | Ga0496122_0001285 | Ga0496122_0001285_17453_18061 | 182 |
| 177 | 3300048926 | Ga0496123_0003994 | Ga0496123_0003994_4547_5155 | 182 |
| 178 | 3300001990 | JGI24737J22298_10000041 | JGI24737J22298_1000004122 | 183 |
| 179 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_10000001499 | 183 |
| 180 | 3300003316 | rootH1_10111220 | rootH1_101112203 | 183 |
| 181 | 3300003320 | rootH2_10167396 | rootH2_101673962 | 183 |
| 182 | 3300003322 | rootL2_10227972 | rootL2_102279721 | 183 |
| 183 | 3300004801 | Ga0058860_11662651 | Ga0058860_116626511 | 183 |
| 184 | 3300005328 | Ga0070676_10027954 | Ga0070676_100279544 | 183 |
| 185 | 3300005328 | Ga0070676_10766442 | Ga0070676_107664421 | 183 |
| 186 | 3300005330 | Ga0070690_100061206 | Ga0070690_1000612062 | 183 |
| 187 | 3300005331 | Ga0070670_100228528 | Ga0070670_1002285282 | 183 |
| 188 | 3300005333 | Ga0070677_10074147 | Ga0070677_100741472 | 183 |
| 189 | 3300005334 | Ga0068869_100127536 | Ga0068869_1001275362 | 183 |
| 190 | 3300005335 | Ga0070666_10000132 | Ga0070666_1000013236 | 183 |
| 191 | 3300005335 | Ga0070666_10269935 | Ga0070666_102699351 | 183 |
| 192 | 3300005336 | Ga0070680_100005853 | Ga0070680_1000058536 | 183 |
| 193 | 3300005337 | Ga0070682_100030591 | Ga0070682_1000305914 | 183 |
| 194 | 3300005338 | Ga0068868_100191322 | Ga0068868_1001913222 | 183 |
| 195 | 3300005338 | Ga0068868_100222536 | Ga0068868_1002225362 | 183 |
| 196 | 3300005339 | Ga0070660_100202995 | Ga0070660_1002029952 | 183 |
| 197 | 3300005340 | Ga0070689_100044786 | Ga0070689_1000447865 | 183 |
| 198 | 3300005341 | Ga0070691_10020993 | Ga0070691_100209932 | 183 |
| 199 | 3300005347 | Ga0070668_100279911 | Ga0070668_1002799112 | 183 |
| 200 | 3300005353 | Ga0070669_100043902 | Ga0070669_1000439025 | 183 |
| 201 | 3300005354 | Ga0070675_100125401 | Ga0070675_1001254012 | 183 |
| 202 | 3300005354 | Ga0070675_100152510 | Ga0070675_1001525104 | 183 |
| 203 | 3300005355 | Ga0070671_100022885 | Ga0070671_1000228853 | 183 |
| 204 | 3300005355 | Ga0070671_100052161 | Ga0070671_1000521611 | 183 |
| 205 | 3300005356 | Ga0070674_100173699 | Ga0070674_1001736992 | 183 |
| 206 | 3300005356 | Ga0070674_100412162 | Ga0070674_1004121622 | 183 |
| 207 | 3300005364 | Ga0070673_100030540 | Ga0070673_1000305402 | 183 |
| 208 | 3300005364 | Ga0070673_100050694 | Ga0070673_1000506943 | 183 |
| 209 | 3300005364 | Ga0070673_100091218 | Ga0070673_1000912182 | 183 |
| 210 | 3300005364 | Ga0070673_100405374 | Ga0070673_1004053741 | 183 |
| 211 | 3300005364 | Ga0070673_100700638 | Ga0070673_1007006381 | 183 |
| 212 | 3300005367 | Ga0070667_100130903 | Ga0070667_1001309031 | 183 |
| 213 | 3300005367 | Ga0070667_100414060 | Ga0070667_1004140602 | 183 |
| 214 | 3300005441 | Ga0070700_100203486 | Ga0070700_1002034862 | 183 |
| 215 | 3300005456 | Ga0070678_100096047 | Ga0070678_1000960471 | 183 |
| 216 | 3300005456 | Ga0070678_100232610 | Ga0070678_1002326102 | 183 |
| 217 | 3300005458 | Ga0070681_10145809 | Ga0070681_101458094 | 183 |
| 218 | 3300005459 | Ga0068867_100178837 | Ga0068867_1001788372 | 183 |
| 219 | 3300005459 | Ga0068867_100418801 | Ga0068867_1004188012 | 183 |
| 220 | 3300005530 | Ga0070679_100018717 | Ga0070679_1000187174 | 183 |
| 221 | 3300005539 | Ga0068853_101230800 | Ga0068853_1012308001 | 183 |
| 222 | 3300005543 | Ga0070672_100234716 | Ga0070672_1002347162 | 183 |
| 223 | 3300005543 | Ga0070672_100513536 | Ga0070672_1005135362 | 183 |
| 224 | 3300005543 | Ga0070672_100774091 | Ga0070672_1007740912 | 183 |
| 225 | 3300005544 | Ga0070686_100182653 | Ga0070686_1001826532 | 183 |
| 226 | 3300005544 | Ga0070686_100923908 | Ga0070686_1009239081 | 183 |
| 227 | 3300005547 | Ga0070693_100013364 | Ga0070693_1000133644 | 183 |
| 228 | 3300005547 | Ga0070693_100911376 | Ga0070693_1009113761 | 183 |
| 229 | 3300005548 | Ga0070665_100008754 | Ga0070665_1000087542 | 183 |
| 230 | 3300005548 | Ga0070665_100906380 | Ga0070665_1009063802 | 183 |
| 231 | 3300005563 | Ga0068855_100038985 | Ga0068855_1000389853 | 183 |
| 232 | 3300005563 | Ga0068855_100145358 | Ga0068855_1001453582 | 183 |
| 233 | 3300005564 | Ga0070664_100942060 | Ga0070664_1009420602 | 183 |
| 234 | 3300005577 | Ga0068857_100156342 | Ga0068857_1001563422 | 183 |
| 235 | 3300005578 | Ga0068854_100182488 | Ga0068854_1001824882 | 183 |
| 236 | 3300005578 | Ga0068854_100339682 | Ga0068854_1003396823 | 183 |
| 237 | 3300005614 | Ga0068856_100365035 | Ga0068856_1003650352 | 183 |
| 238 | 3300005614 | Ga0068856_101250827 | Ga0068856_1012508271 | 183 |
| 239 | 3300005615 | Ga0070702_100155968 | Ga0070702_1001559682 | 183 |
| 240 | 3300005616 | Ga0068852_100005191 | Ga0068852_1000051913 | 183 |
| 241 | 3300005616 | Ga0068852_100149778 | Ga0068852_1001497782 | 183 |
| 242 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003331 | 183 |
| 243 | 3300005617 | Ga0068859_100142729 | Ga0068859_1001427292 | 183 |
| 244 | 3300005618 | Ga0068864_100018349 | Ga0068864_1000183493 | 183 |
| 245 | 3300005719 | Ga0068861_100758197 | Ga0068861_1007581971 | 183 |
| 246 | 3300005719 | Ga0068861_100962435 | Ga0068861_1009624351 | 183 |
| 247 | 3300005840 | Ga0068870_10054743 | Ga0068870_100547434 | 183 |
| 248 | 3300005840 | Ga0068870_10337090 | Ga0068870_103370902 | 183 |
| 249 | 3300005840 | Ga0068870_10571574 | Ga0068870_105715741 | 183 |
| 250 | 3300005841 | Ga0068863_100000394 | Ga0068863_10000039428 | 183 |
| 251 | 3300005841 | Ga0068863_100777484 | Ga0068863_1007774843 | 183 |
| 252 | 3300005842 | Ga0068858_100026331 | Ga0068858_1000263313 | 183 |
| 253 | 3300005842 | Ga0068858_100543147 | Ga0068858_1005431472 | 183 |
| 254 | 3300005843 | Ga0068860_100006719 | Ga0068860_10000671913 | 183 |
| 255 | 3300005843 | Ga0068860_100017594 | Ga0068860_1000175944 | 183 |
| 256 | 3300005843 | Ga0068860_100086520 | Ga0068860_1000865202 | 183 |
| 257 | 3300005985 | Ga0081539_10186221 | Ga0081539_101862212 | 183 |
| 258 | 3300006237 | Ga0097621_100138601 | Ga0097621_1001386012 | 183 |
| 259 | 3300006237 | Ga0097621_100367013 | Ga0097621_1003670131 | 183 |
| 260 | 3300006237 | Ga0097621_100779169 | Ga0097621_1007791691 | 183 |
| 261 | 3300006353 | Ga0075370_10620101 | Ga0075370_106201011 | 183 |
| 262 | 3300006358 | Ga0068871_100023830 | Ga0068871_1000238304 | 183 |
| 263 | 3300006358 | Ga0068871_100492880 | Ga0068871_1004928801 | 183 |
| 264 | 3300006358 | Ga0068871_100930073 | Ga0068871_1009300731 | 183 |
| 265 | 3300006881 | Ga0068865_100089792 | Ga0068865_1000897922 | 183 |
| 266 | 3300006881 | Ga0068865_100133523 | Ga0068865_1001335232 | 183 |
| 267 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003331 | 183 |
| 268 | 3300006931 | Ga0097620_100142730 | Ga0097620_1001427302 | 183 |
| 269 | 3300009093 | Ga0105240_10005940 | Ga0105240_1000594018 | 183 |
| 270 | 3300009098 | Ga0105245_10136050 | Ga0105245_101360502 | 183 |
| 271 | 3300009101 | Ga0105247_10471379 | Ga0105247_104713792 | 183 |
| 272 | 3300009174 | Ga0105241_10001671 | Ga0105241_100016716 | 183 |
| 273 | 3300009174 | Ga0105241_10004426 | Ga0105241_1000442611 | 183 |
| 274 | 3300009174 | Ga0105241_10138015 | Ga0105241_101380153 | 183 |
| 275 | 3300009174 | Ga0105241_10218123 | Ga0105241_102181232 | 183 |
| 276 | 3300009176 | Ga0105242_10049156 | Ga0105242_100491562 | 183 |
| 277 | 3300009176 | Ga0105242_10283338 | Ga0105242_102833381 | 183 |
| 278 | 3300009545 | Ga0105237_10001393 | Ga0105237_1000139314 | 183 |
| 279 | 3300009545 | Ga0105237_10105253 | Ga0105237_101052534 | 183 |
| 280 | 3300009545 | Ga0105237_10397719 | Ga0105237_103977192 | 183 |
| 281 | 3300009553 | Ga0105249_10002967 | Ga0105249_100029675 | 183 |
| 282 | 3300009553 | Ga0105249_10676004 | Ga0105249_106760041 | 183 |
| 283 | 3300010375 | Ga0105239_10293414 | Ga0105239_102934141 | 183 |
| 284 | 3300011119 | Ga0105246_10029078 | Ga0105246_100290782 | 183 |
| 285 | 3300013102 | Ga0157371_10057536 | Ga0157371_100575362 | 183 |
| 286 | 3300013104 | Ga0157370_10030448 | Ga0157370_100304482 | 183 |
| 287 | 3300013104 | Ga0157370_10775951 | Ga0157370_107759511 | 183 |
| 288 | 3300013105 | Ga0157369_10033481 | Ga0157369_100334814 | 183 |
| 289 | 3300013296 | Ga0157374_10100124 | Ga0157374_101001243 | 183 |
| 290 | 3300013296 | Ga0157374_10111273 | Ga0157374_101112732 | 183 |
| 291 | 3300013296 | Ga0157374_10585127 | Ga0157374_105851271 | 183 |
| 292 | 3300013297 | Ga0157378_10009315 | Ga0157378_100093154 | 183 |
| 293 | 3300013297 | Ga0157378_10029608 | Ga0157378_100296082 | 183 |
| 294 | 3300013297 | Ga0157378_10062135 | Ga0157378_100621353 | 183 |
| 295 | 3300013297 | Ga0157378_10148573 | Ga0157378_101485732 | 183 |
| 296 | 3300013306 | Ga0163162_10000328 | Ga0163162_1000032820 | 183 |
| 297 | 3300013306 | Ga0163162_10006392 | Ga0163162_100063924 | 183 |
| 298 | 3300013306 | Ga0163162_10011375 | Ga0163162_100113753 | 183 |
| 299 | 3300013306 | Ga0163162_10624346 | Ga0163162_106243462 | 183 |
| 300 | 3300013306 | Ga0163162_11640324 | Ga0163162_116403241 | 183 |
| 301 | 3300013307 | Ga0157372_10051539 | Ga0157372_100515394 | 183 |
| 302 | 3300013308 | Ga0157375_10173794 | Ga0157375_101737942 | 183 |
| 303 | 3300013308 | Ga0157375_10409079 | Ga0157375_104090792 | 183 |
| 304 | 3300013308 | Ga0157375_10672403 | Ga0157375_106724032 | 183 |
| 305 | 3300014325 | Ga0163163_10534761 | Ga0163163_105347612 | 183 |
| 306 | 3300014325 | Ga0163163_10573857 | Ga0163163_105738572 | 183 |
| 307 | 3300014326 | Ga0157380_10049655 | Ga0157380_100496552 | 183 |
| 308 | 3300014968 | Ga0157379_10018199 | Ga0157379_100181994 | 183 |
| 309 | 3300014968 | Ga0157379_10515172 | Ga0157379_105151722 | 183 |
| 310 | 3300017792 | Ga0163161_10344771 | Ga0163161_103447712 | 183 |
| 311 | 3300017792 | Ga0163161_11406790 | Ga0163161_114067901 | 183 |
| 312 | 3300020080 | Ga0206350_10795179 | Ga0206350_107951791 | 183 |
| 313 | 3300021384 | Ga0213876_10073833 | Ga0213876_100738332 | 183 |
| 314 | 3300025893 | Ga0207682_10129934 | Ga0207682_101299341 | 183 |
| 315 | 3300025899 | Ga0207642_10172273 | Ga0207642_101722732 | 183 |
| 316 | 3300025900 | Ga0207710_10263521 | Ga0207710_102635211 | 183 |
| 317 | 3300025900 | Ga0207710_10326401 | Ga0207710_103264012 | 183 |
| 318 | 3300025901 | Ga0207688_10025859 | Ga0207688_100258592 | 183 |
| 319 | 3300025901 | Ga0207688_10093027 | Ga0207688_100930272 | 183 |
| 320 | 3300025903 | Ga0207680_10000014 | Ga0207680_10000014113 | 183 |
| 321 | 3300025904 | Ga0207647_10186786 | Ga0207647_101867861 | 183 |
| 322 | 3300025904 | Ga0207647_10257031 | Ga0207647_102570312 | 183 |
| 323 | 3300025907 | Ga0207645_10003031 | Ga0207645_1000303111 | 183 |
| 324 | 3300025907 | Ga0207645_10022717 | Ga0207645_100227173 | 183 |
| 325 | 3300025908 | Ga0207643_10172958 | Ga0207643_101729582 | 183 |
| 326 | 3300025908 | Ga0207643_10484803 | Ga0207643_104848031 | 183 |
| 327 | 3300025909 | Ga0207705_10540318 | Ga0207705_105403181 | 183 |
| 328 | 3300025911 | Ga0207654_10001242 | Ga0207654_100012424 | 183 |
| 329 | 3300025911 | Ga0207654_10002095 | Ga0207654_100020955 | 183 |
| 330 | 3300025912 | Ga0207707_10002312 | Ga0207707_1000231212 | 183 |
| 331 | 3300025913 | Ga0207695_10024527 | Ga0207695_100245272 | 183 |
| 332 | 3300025914 | Ga0207671_10000746 | Ga0207671_100007468 | 183 |
| 333 | 3300025917 | Ga0207660_10003846 | Ga0207660_100038465 | 183 |
| 334 | 3300025921 | Ga0207652_10017345 | Ga0207652_100173457 | 183 |
| 335 | 3300025923 | Ga0207681_10026831 | Ga0207681_100268313 | 183 |
| 336 | 3300025925 | Ga0207650_10677585 | Ga0207650_106775852 | 183 |
| 337 | 3300025926 | Ga0207659_10096476 | Ga0207659_100964764 | 183 |
| 338 | 3300025926 | Ga0207659_10224559 | Ga0207659_102245592 | 183 |
| 339 | 3300025927 | Ga0207687_10253432 | Ga0207687_102534322 | 183 |
| 340 | 3300025931 | Ga0207644_10016463 | Ga0207644_100164633 | 183 |
| 341 | 3300025931 | Ga0207644_10334885 | Ga0207644_103348851 | 183 |
| 342 | 3300025934 | Ga0207686_10013604 | Ga0207686_100136043 | 183 |
| 343 | 3300025934 | Ga0207686_10688317 | Ga0207686_106883171 | 183 |
| 344 | 3300025936 | Ga0207670_10364441 | Ga0207670_103644411 | 183 |
| 345 | 3300025937 | Ga0207669_10020055 | Ga0207669_100200554 | 183 |
| 346 | 3300025937 | Ga0207669_10621009 | Ga0207669_106210091 | 183 |
| 347 | 3300025938 | Ga0207704_10226476 | Ga0207704_102264762 | 183 |
| 348 | 3300025940 | Ga0207691_10015603 | Ga0207691_100156033 | 183 |
| 349 | 3300025940 | Ga0207691_10067065 | Ga0207691_100670651 | 183 |
| 350 | 3300025940 | Ga0207691_10098458 | Ga0207691_100984582 | 183 |
| 351 | 3300025940 | Ga0207691_10119013 | Ga0207691_101190132 | 183 |
| 352 | 3300025942 | Ga0207689_10002471 | Ga0207689_100024716 | 183 |
| 353 | 3300025942 | Ga0207689_10006705 | Ga0207689_100067054 | 183 |
| 354 | 3300025942 | Ga0207689_10062707 | Ga0207689_100627072 | 183 |
| 355 | 3300025945 | Ga0207679_10670335 | Ga0207679_106703352 | 183 |
| 356 | 3300025949 | Ga0207667_10065568 | Ga0207667_100655685 | 183 |
| 357 | 3300025949 | Ga0207667_10277346 | Ga0207667_102773462 | 183 |
| 358 | 3300025960 | Ga0207651_10066690 | Ga0207651_100666902 | 183 |
| 359 | 3300025960 | Ga0207651_10357867 | Ga0207651_103578672 | 183 |
| 360 | 3300025960 | Ga0207651_10881002 | Ga0207651_108810022 | 183 |
| 361 | 3300025961 | Ga0207712_10071114 | Ga0207712_100711143 | 183 |
| 362 | 3300025972 | Ga0207668_10081891 | Ga0207668_100818912 | 183 |
| 363 | 3300025972 | Ga0207668_10574412 | Ga0207668_105744122 | 183 |
| 364 | 3300025981 | Ga0207640_10144275 | Ga0207640_101442752 | 183 |
| 365 | 3300025986 | Ga0207658_10391069 | Ga0207658_103910691 | 183 |
| 366 | 3300025986 | Ga0207658_10602724 | Ga0207658_106027241 | 183 |
| 367 | 3300026023 | Ga0207677_10052340 | Ga0207677_100523402 | 183 |
| 368 | 3300026035 | Ga0207703_10093203 | Ga0207703_100932032 | 183 |
| 369 | 3300026075 | Ga0207708_10272109 | Ga0207708_102721091 | 183 |
| 370 | 3300026078 | Ga0207702_10230736 | Ga0207702_102307362 | 183 |
| 371 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015204 | 183 |
| 372 | 3300026089 | Ga0207648_10002156 | Ga0207648_1000215618 | 183 |
| 373 | 3300026089 | Ga0207648_10059637 | Ga0207648_100596371 | 183 |
| 374 | 3300026089 | Ga0207648_10472966 | Ga0207648_104729662 | 183 |
| 375 | 3300026089 | Ga0207648_10994823 | Ga0207648_109948231 | 183 |
| 376 | 3300026095 | Ga0207676_10040303 | Ga0207676_100403033 | 183 |
| 377 | 3300026095 | Ga0207676_10171751 | Ga0207676_101717512 | 183 |
| 378 | 3300026116 | Ga0207674_10151233 | Ga0207674_101512332 | 183 |
| 379 | 3300026118 | Ga0207675_100082228 | Ga0207675_1000822283 | 183 |
| 380 | 3300026118 | Ga0207675_100324409 | Ga0207675_1003244092 | 183 |
| 381 | 3300026118 | Ga0207675_100340726 | Ga0207675_1003407261 | 183 |
| 382 | 3300026121 | Ga0207683_10063384 | Ga0207683_100633844 | 183 |
| 383 | 3300026121 | Ga0207683_10076193 | Ga0207683_100761931 | 183 |
| 384 | 3300026142 | Ga0207698_10001356 | Ga0207698_100013563 | 183 |
| 385 | 3300026142 | Ga0207698_10809343 | Ga0207698_108093432 | 183 |
| 386 | 3300028379 | Ga0268266_10023629 | Ga0268266_100236294 | 183 |
| 387 | 3300028379 | Ga0268266_10776664 | Ga0268266_107766642 | 183 |
| 388 | 3300028379 | Ga0268266_11034053 | Ga0268266_110340531 | 183 |
| 389 | 3300028380 | Ga0268265_10348303 | Ga0268265_103483031 | 183 |
| 390 | 3300028381 | Ga0268264_10003753 | Ga0268264_100037534 | 183 |
| 391 | 3300028381 | Ga0268264_10006147 | Ga0268264_100061473 | 183 |
| 392 | 3300028381 | Ga0268264_10612190 | Ga0268264_106121901 | 183 |
| 393 | 3300039437 | Ga0436365_1170113 | Ga0436365_1170113_965_1537 | 183 |
| 394 | 3300045976 | Ga0466967_0376354 | Ga0466967_0376354_612_1280 | 183 |
| 395 | 3300046460 | Ga0495638_0214312 | Ga0495638_0214312_493_1059 | 183 |
| 396 | 3300046471 | Ga0495650_0000273 | Ga0495650_0000273_30088_30654 | 183 |
| 397 | 3300046492 | Ga0495585_0001701 | Ga0495585_0001701_9096_9662 | 183 |
| 398 | 3300046506 | Ga0495583_0024219 | Ga0495583_0024219_2061_2627 | 183 |
| 399 | 3300046507 | Ga0495606_0000130 | Ga0495606_0000130_31684_32250 | 183 |
| 400 | 3300046512 | Ga0495610_0009742 | Ga0495610_0009742_73_639 | 183 |
| 401 | 3300046513 | Ga0495616_0009400 | Ga0495616_0009400_1433_1999 | 183 |
| 402 | 3300046519 | Ga0495632_0227832 | Ga0495632_0227832_197_763 | 183 |
| 403 | 3300046558 | Ga0495633_0003361 | Ga0495633_0003361_6330_6896 | 183 |
| 404 | 3300046660 | Ga0495625_0000036 | Ga0495625_0000036_197126_197692 | 183 |
| 405 | 3300046665 | Ga0495661_0044534 | Ga0495661_0044534_1846_2412 | 183 |
| 406 | 3300046694 | Ga0495649_0000017 | Ga0495649_0000017_24032_24598 | 183 |
| 407 | 3300046810 | Ga0495660_0032812 | Ga0495660_0032812_2161_2727 | 183 |
| 408 | 3300049568 | Ga0501031_0036070 | Ga0501031_0036070_541_1110 | 183 |
| 409 | 3300049569 | Ga0501032_0101834 | Ga0501032_0101834_1194_1763 | 183 |
| 410 | 3300049571 | Ga0501034_0344559 | Ga0501034_0344559_520_1089 | 183 |
| 411 | 3300049573 | Ga0501037_0012307 | Ga0501037_0012307_4167_4736 | 183 |
| 412 | 3300049574 | Ga0501038_0033490 | Ga0501038_0033490_134_703 | 183 |
| 413 | 3300049579 | Ga0501043_0416409 | Ga0501043_0416409_77_646 | 183 |
| 414 | 3300049580 | Ga0501046_0018347 | Ga0501046_0018347_5207_5779 | 183 |
| 415 | 3300049580 | Ga0501046_0038148 | Ga0501046_0038148_3095_3664 | 183 |
| 416 | 3300049581 | Ga0501047_0378521 | Ga0501047_0378521_286_855 | 183 |
| 417 | 3300049583 | Ga0501067_0087767 | Ga0501067_0087767_960_1532 | 183 |
| 418 | 3300049584 | Ga0501068_0315447 | Ga0501068_0315447_198_770 | 183 |
| 419 | 3300049586 | Ga0501070_0014914 | Ga0501070_0014914_5355_5927 | 183 |
| 420 | 3300049589 | Ga0501073_0183383 | Ga0501073_0183383_541_1110 | 183 |
| 421 | 3300049590 | Ga0501074_0102988 | Ga0501074_0102988_32_604 | 183 |
| 422 | 3300049742 | Ga0501080_0121551 | Ga0501080_0121551_212_784 | 183 |
| 423 | 3300049744 | Ga0501083_0039932 | Ga0501083_0039932_958_1530 | 183 |
| 424 | 3300049823 | Ga0501044_0077306 | Ga0501044_0077306_2391_2963 | 183 |
| 425 | 3300049823 | Ga0501044_0763853 | Ga0501044_0763853_141_710 | 183 |
| 426 | 3300054114 | Ga0501084_0229319 | Ga0501084_0229319_176_748 | 183 |
| 427 | 3300060353 | Ga0501082_0346157 | Ga0501082_0346157_229_801 | 183 |
| 428 | 3300001979 | JGI24740J21852_10017204 | JGI24740J21852_100172043 | 184 |
| 429 | 3300003316 | rootH1_10042093 | rootH1_100420932 | 184 |
| 430 | 3300003320 | rootH2_10133367 | rootH2_101333671 | 184 |
| 431 | 3300003322 | rootL2_10149769 | rootL2_101497692 | 184 |
| 432 | 3300003323 | rootH1_10254552 | rootH1_102545521 | 184 |
| 433 | 3300003354 | JGI25160J50197_1003572 | JGI25160J50197_10035725 | 184 |
| 434 | 3300005289 | Ga0065704_10113950 | Ga0065704_101139502 | 184 |
| 435 | 3300005290 | Ga0065712_10237453 | Ga0065712_102374532 | 184 |
| 436 | 3300005327 | Ga0070658_10005453 | Ga0070658_100054533 | 184 |
| 437 | 3300005328 | Ga0070676_10000375 | Ga0070676_1000037515 | 184 |
| 438 | 3300005330 | Ga0070690_100144687 | Ga0070690_1001446872 | 184 |
| 439 | 3300005333 | Ga0070677_10173510 | Ga0070677_101735102 | 184 |
| 440 | 3300005334 | Ga0068869_101349297 | Ga0068869_1013492971 | 184 |
| 441 | 3300005335 | Ga0070666_10000885 | Ga0070666_100008852 | 184 |
| 442 | 3300005338 | Ga0068868_100000075 | Ga0068868_1000000757 | 184 |
| 443 | 3300005338 | Ga0068868_100433381 | Ga0068868_1004333811 | 184 |
| 444 | 3300005344 | Ga0070661_100242948 | Ga0070661_1002429482 | 184 |
| 445 | 3300005347 | Ga0070668_100000859 | Ga0070668_10000085916 | 184 |
| 446 | 3300005353 | Ga0070669_100996238 | Ga0070669_1009962381 | 184 |
| 447 | 3300005355 | Ga0070671_100183430 | Ga0070671_1001834301 | 184 |
| 448 | 3300005356 | Ga0070674_100203274 | Ga0070674_1002032742 | 184 |
| 449 | 3300005364 | Ga0070673_100000448 | Ga0070673_10000044814 | 184 |
| 450 | 3300005367 | Ga0070667_100000482 | Ga0070667_10000048224 | 184 |
| 451 | 3300005367 | Ga0070667_100676469 | Ga0070667_1006764691 | 184 |
| 452 | 3300005367 | Ga0070667_100938123 | Ga0070667_1009381231 | 184 |
| 453 | 3300005455 | Ga0070663_100261704 | Ga0070663_1002617041 | 184 |
| 454 | 3300005456 | Ga0070678_100080301 | Ga0070678_1000803012 | 184 |
| 455 | 3300005457 | Ga0070662_100009485 | Ga0070662_1000094855 | 184 |
| 456 | 3300005459 | Ga0068867_100005707 | Ga0068867_1000057074 | 184 |
| 457 | 3300005459 | Ga0068867_100006698 | Ga0068867_1000066982 | 184 |
| 458 | 3300005539 | Ga0068853_100007384 | Ga0068853_1000073848 | 184 |
| 459 | 3300005539 | Ga0068853_100043469 | Ga0068853_1000434692 | 184 |
| 460 | 3300005543 | Ga0070672_100000361 | Ga0070672_10000036117 | 184 |
| 461 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001583 | 184 |
| 462 | 3300005548 | Ga0070665_100002163 | Ga0070665_1000021634 | 184 |
| 463 | 3300005548 | Ga0070665_101187688 | Ga0070665_1011876881 | 184 |
| 464 | 3300005563 | Ga0068855_100009719 | Ga0068855_1000097194 | 184 |
| 465 | 3300005563 | Ga0068855_100038549 | Ga0068855_1000385492 | 184 |
| 466 | 3300005563 | Ga0068855_101451803 | Ga0068855_1014518031 | 184 |
| 467 | 3300005577 | Ga0068857_100005562 | Ga0068857_10000556210 | 184 |
| 468 | 3300005577 | Ga0068857_100134162 | Ga0068857_1001341622 | 184 |
| 469 | 3300005578 | Ga0068854_100067427 | Ga0068854_1000674273 | 184 |
| 470 | 3300005616 | Ga0068852_100103743 | Ga0068852_1001037432 | 184 |
| 471 | 3300005617 | Ga0068859_100626379 | Ga0068859_1006263792 | 184 |
| 472 | 3300005617 | Ga0068859_101308631 | Ga0068859_1013086311 | 184 |
| 473 | 3300005618 | Ga0068864_100000785 | Ga0068864_1000007859 | 184 |
| 474 | 3300005618 | Ga0068864_100101243 | Ga0068864_1001012432 | 184 |
| 475 | 3300005719 | Ga0068861_100026816 | Ga0068861_1000268161 | 184 |
| 476 | 3300005834 | Ga0068851_10008297 | Ga0068851_100082975 | 184 |
| 477 | 3300005840 | Ga0068870_10367683 | Ga0068870_103676831 | 184 |
| 478 | 3300005842 | Ga0068858_100042626 | Ga0068858_1000426262 | 184 |
| 479 | 3300005842 | Ga0068858_100475728 | Ga0068858_1004757282 | 184 |
| 480 | 3300005843 | Ga0068860_100000097 | Ga0068860_100000097133 | 184 |
| 481 | 3300005843 | Ga0068860_100001074 | Ga0068860_1000010743 | 184 |
| 482 | 3300005843 | Ga0068860_100002836 | Ga0068860_10000283618 | 184 |
| 483 | 3300005843 | Ga0068860_100115869 | Ga0068860_1001158692 | 184 |
| 484 | 3300006237 | Ga0097621_100004135 | Ga0097621_10000413511 | 184 |
| 485 | 3300006237 | Ga0097621_100286549 | Ga0097621_1002865492 | 184 |
| 486 | 3300006358 | Ga0068871_100048965 | Ga0068871_1000489652 | 184 |
| 487 | 3300006358 | Ga0068871_101269713 | Ga0068871_1012697131 | 184 |
| 488 | 3300006881 | Ga0068865_100021001 | Ga0068865_1000210012 | 184 |
| 489 | 3300006931 | Ga0097620_100626378 | Ga0097620_1006263782 | 184 |
| 490 | 3300006931 | Ga0097620_101308671 | Ga0097620_1013086711 | 184 |
| 491 | 3300009093 | Ga0105240_10003320 | Ga0105240_100033206 | 184 |
| 492 | 3300009093 | Ga0105240_10036865 | Ga0105240_100368653 | 184 |
| 493 | 3300009093 | Ga0105240_10102886 | Ga0105240_101028862 | 184 |
| 494 | 3300009148 | Ga0105243_10025290 | Ga0105243_100252905 | 184 |
| 495 | 3300009174 | Ga0105241_10001857 | Ga0105241_100018572 | 184 |
| 496 | 3300009174 | Ga0105241_10146570 | Ga0105241_101465702 | 184 |
| 497 | 3300009176 | Ga0105242_10020147 | Ga0105242_100201473 | 184 |
| 498 | 3300009176 | Ga0105242_10053984 | Ga0105242_100539842 | 184 |
| 499 | 3300009177 | Ga0105248_10081980 | Ga0105248_100819803 | 184 |
| 500 | 3300009545 | Ga0105237_10004900 | Ga0105237_100049004 | 184 |
| 501 | 3300009545 | Ga0105237_10013542 | Ga0105237_100135425 | 184 |
| 502 | 3300009545 | Ga0105237_10018295 | Ga0105237_100182952 | 184 |
| 503 | 3300009545 | Ga0105237_10030014 | Ga0105237_100300147 | 184 |
| 504 | 3300009545 | Ga0105237_10870577 | Ga0105237_108705772 | 184 |
| 505 | 3300009551 | Ga0105238_10002044 | Ga0105238_100020447 | 184 |
| 506 | 3300009551 | Ga0105238_10239520 | Ga0105238_102395203 | 184 |
| 507 | 3300009553 | Ga0105249_10075804 | Ga0105249_100758042 | 184 |
| 508 | 3300009553 | Ga0105249_10259817 | Ga0105249_102598172 | 184 |
| 509 | 3300010375 | Ga0105239_10000529 | Ga0105239_1000052914 | 184 |
| 510 | 3300010375 | Ga0105239_10009377 | Ga0105239_100093773 | 184 |
| 511 | 3300010375 | Ga0105239_10019080 | Ga0105239_100190804 | 184 |
| 512 | 3300010375 | Ga0105239_10200579 | Ga0105239_102005792 | 184 |
| 513 | 3300010375 | Ga0105239_10604337 | Ga0105239_106043372 | 184 |
| 514 | 3300010375 | Ga0105239_10903747 | Ga0105239_109037472 | 184 |
| 515 | 3300011119 | Ga0105246_10061764 | Ga0105246_100617641 | 184 |
| 516 | 3300011119 | Ga0105246_10566531 | Ga0105246_105665311 | 184 |
| 517 | 3300013102 | Ga0157371_10677530 | Ga0157371_106775301 | 184 |
| 518 | 3300013296 | Ga0157374_10002589 | Ga0157374_100025894 | 184 |
| 519 | 3300013297 | Ga0157378_10026601 | Ga0157378_100266012 | 184 |
| 520 | 3300013297 | Ga0157378_10412406 | Ga0157378_104124062 | 184 |
| 521 | 3300013306 | Ga0163162_10000377 | Ga0163162_100003774 | 184 |
| 522 | 3300013306 | Ga0163162_10003770 | Ga0163162_100037705 | 184 |
| 523 | 3300013306 | Ga0163162_10246634 | Ga0163162_102466342 | 184 |
| 524 | 3300013306 | Ga0163162_11083043 | Ga0163162_110830432 | 184 |
| 525 | 3300013306 | Ga0163162_11419576 | Ga0163162_114195761 | 184 |
| 526 | 3300013307 | Ga0157372_10041370 | Ga0157372_100413704 | 184 |
| 527 | 3300013307 | Ga0157372_10344447 | Ga0157372_103444472 | 184 |
| 528 | 3300013308 | Ga0157375_10004745 | Ga0157375_100047455 | 184 |
| 529 | 3300013308 | Ga0157375_10365663 | Ga0157375_103656632 | 184 |
| 530 | 3300014325 | Ga0163163_10000752 | Ga0163163_1000075218 | 184 |
| 531 | 3300014325 | Ga0163163_10109276 | Ga0163163_101092762 | 184 |
| 532 | 3300014968 | Ga0157379_10000440 | Ga0157379_100004403 | 184 |
| 533 | 3300014968 | Ga0157379_10313908 | Ga0157379_103139082 | 184 |
| 534 | 3300014969 | Ga0157376_10000381 | Ga0157376_100003814 | 184 |
| 535 | 3300017792 | Ga0163161_10062200 | Ga0163161_100622002 | 184 |
| 536 | 3300017792 | Ga0163161_10323519 | Ga0163161_103235191 | 184 |
| 537 | 3300025302 | Ga0207426_1000052 | Ga0207426_1000052104 | 184 |
| 538 | 3300025315 | Ga0207697_10025166 | Ga0207697_100251662 | 184 |
| 539 | 3300025321 | Ga0207656_10000424 | Ga0207656_1000042413 | 184 |
| 540 | 3300025903 | Ga0207680_10009667 | Ga0207680_100096672 | 184 |
| 541 | 3300025907 | Ga0207645_10000949 | Ga0207645_100009499 | 184 |
| 542 | 3300025909 | Ga0207705_10014112 | Ga0207705_100141125 | 184 |
| 543 | 3300025911 | Ga0207654_10005208 | Ga0207654_100052083 | 184 |
| 544 | 3300025911 | Ga0207654_10646838 | Ga0207654_106468381 | 184 |
| 545 | 3300025913 | Ga0207695_10000515 | Ga0207695_1000051549 | 184 |
| 546 | 3300025913 | Ga0207695_10042003 | Ga0207695_100420032 | 184 |
| 547 | 3300025913 | Ga0207695_10047145 | Ga0207695_100471453 | 184 |
| 548 | 3300025913 | Ga0207695_10132273 | Ga0207695_101322733 | 184 |
| 549 | 3300025914 | Ga0207671_10003348 | Ga0207671_1000334810 | 184 |
| 550 | 3300025914 | Ga0207671_10003740 | Ga0207671_100037404 | 184 |
| 551 | 3300025914 | Ga0207671_10004160 | Ga0207671_100041602 | 184 |
| 552 | 3300025914 | Ga0207671_10056900 | Ga0207671_100569003 | 184 |
| 553 | 3300025914 | Ga0207671_10081878 | Ga0207671_100818783 | 184 |
| 554 | 3300025920 | Ga0207649_10334564 | Ga0207649_103345642 | 184 |
| 555 | 3300025924 | Ga0207694_10011115 | Ga0207694_100111152 | 184 |
| 556 | 3300025925 | Ga0207650_10183514 | Ga0207650_101835142 | 184 |
| 557 | 3300025933 | Ga0207706_10031196 | Ga0207706_100311964 | 184 |
| 558 | 3300025934 | Ga0207686_10092438 | Ga0207686_100924382 | 184 |
| 559 | 3300025935 | Ga0207709_10192079 | Ga0207709_101920792 | 184 |
| 560 | 3300025938 | Ga0207704_10004208 | Ga0207704_100042084 | 184 |
| 561 | 3300025940 | Ga0207691_10000037 | Ga0207691_1000003789 | 184 |
| 562 | 3300025941 | Ga0207711_10175960 | Ga0207711_101759602 | 184 |
| 563 | 3300025942 | Ga0207689_10282084 | Ga0207689_102820842 | 184 |
| 564 | 3300025942 | Ga0207689_11114202 | Ga0207689_111142021 | 184 |
| 565 | 3300025945 | Ga0207679_11097643 | Ga0207679_110976431 | 184 |
| 566 | 3300025949 | Ga0207667_10009260 | Ga0207667_100092604 | 184 |
| 567 | 3300025960 | Ga0207651_10000443 | Ga0207651_1000044310 | 184 |
| 568 | 3300025961 | Ga0207712_10098348 | Ga0207712_100983482 | 184 |
| 569 | 3300025972 | Ga0207668_10001307 | Ga0207668_1000130710 | 184 |
| 570 | 3300025986 | Ga0207658_10000629 | Ga0207658_100006295 | 184 |
| 571 | 3300025986 | Ga0207658_10778212 | Ga0207658_107782122 | 184 |
| 572 | 3300026023 | Ga0207677_10004861 | Ga0207677_100048614 | 184 |
| 573 | 3300026023 | Ga0207677_10380101 | Ga0207677_103801012 | 184 |
| 574 | 3300026023 | Ga0207677_10389914 | Ga0207677_103899142 | 184 |
| 575 | 3300026035 | Ga0207703_10004145 | Ga0207703_100041455 | 184 |
| 576 | 3300026035 | Ga0207703_10331636 | Ga0207703_103316362 | 184 |
| 577 | 3300026035 | Ga0207703_10552576 | Ga0207703_105525762 | 184 |
| 578 | 3300026041 | Ga0207639_10016611 | Ga0207639_100166113 | 184 |
| 579 | 3300026041 | Ga0207639_10320012 | Ga0207639_103200122 | 184 |
| 580 | 3300026041 | Ga0207639_10484348 | Ga0207639_104843481 | 184 |
| 581 | 3300026041 | Ga0207639_10541615 | Ga0207639_105416152 | 184 |
| 582 | 3300026078 | Ga0207702_10038638 | Ga0207702_100386383 | 184 |
| 583 | 3300026088 | Ga0207641_10239613 | Ga0207641_102396132 | 184 |
| 584 | 3300026089 | Ga0207648_10001276 | Ga0207648_100012766 | 184 |
| 585 | 3300026089 | Ga0207648_10013274 | Ga0207648_100132741 | 184 |
| 586 | 3300026095 | Ga0207676_10002535 | Ga0207676_100025355 | 184 |
| 587 | 3300026095 | Ga0207676_10424070 | Ga0207676_104240702 | 184 |
| 588 | 3300026116 | Ga0207674_10072510 | Ga0207674_100725101 | 184 |
| 589 | 3300026116 | Ga0207674_10247155 | Ga0207674_102471552 | 184 |
| 590 | 3300026118 | Ga0207675_101262661 | Ga0207675_1012626612 | 184 |
| 591 | 3300026142 | Ga0207698_10431788 | Ga0207698_104317881 | 184 |
| 592 | 3300028379 | Ga0268266_10000038 | Ga0268266_1000003858 | 184 |
| 593 | 3300028379 | Ga0268266_10004818 | Ga0268266_100048184 | 184 |
| 594 | 3300028381 | Ga0268264_10000167 | Ga0268264_1000016794 | 184 |
| 595 | 3300028381 | Ga0268264_10153754 | Ga0268264_101537542 | 184 |
| 596 | 3300028381 | Ga0268264_10406699 | Ga0268264_104066992 | 184 |
| 597 | 3300030521 | Ga0307511_10007925 | Ga0307511_100079255 | 184 |
| 598 | 3300031456 | Ga0307513_10304684 | Ga0307513_103046842 | 184 |
| 599 | 3300031730 | Ga0307516_10000656 | Ga0307516_1000065628 | 184 |
| 600 | 3300031730 | Ga0307516_10311658 | Ga0307516_103116581 | 184 |
| 601 | 3300033180 | Ga0307510_10378843 | Ga0307510_103788432 | 184 |
| 602 | 3300035118 | Ga0373954_0234289 | Ga0373954_0234289_38_613 | 184 |
| 603 | 3300041404 | Ga0439436_0006309 | Ga0439436_0006309_2861_3436 | 184 |
| 604 | 3300041491 | Ga0451833_1433807 | Ga0451833_1433807_18_593 | 184 |
| 605 | 3300041498 | Ga0451841_0881867 | Ga0451841_0881867_222_797 | 184 |
| 606 | 3300042007 | Ga0439449_0028526 | Ga0439449_0028526_642_1217 | 184 |
| 607 | 3300042014 | Ga0439457_000583 | Ga0439457_000583_5501_6076 | 184 |
| 608 | 3300042015 | Ga0439462_0008982 | Ga0439462_0008982_416_991 | 184 |
| 609 | 3300044656 | Ga0466969_0001216 | Ga0466969_0001216_10710_11285 | 184 |
| 610 | 3300044658 | Ga0466972_0000928 | Ga0466972_0000928_3770_4348 | 184 |
| 611 | 3300044684 | Ga0466966_0000184 | Ga0466966_0000184_33621_34196 | 184 |
| 612 | 3300045049 | Ga0466959_0000097 | Ga0466959_0000097_25473_26048 | 184 |
| 613 | 3300046460 | Ga0495638_0044648 | Ga0495638_0044648_380_961 | 184 |
| 614 | 3300046460 | Ga0495638_0048014 | Ga0495638_0048014_1170_1748 | 184 |
| 615 | 3300046476 | Ga0495662_0386355 | Ga0495662_0386355_77_652 | 184 |
| 616 | 3300046477 | Ga0495664_0149519 | Ga0495664_0149519_795_1370 | 184 |
| 617 | 3300046507 | Ga0495606_0194015 | Ga0495606_0194015_468_1037 | 184 |
| 618 | 3300046519 | Ga0495632_0130702 | Ga0495632_0130702_434_1009 | 184 |
| 619 | 3300046524 | Ga0495648_0004026 | Ga0495648_0004026_1287_1865 | 184 |
| 620 | 3300046529 | Ga0495652_0126388 | Ga0495652_0126388_813_1388 | 184 |
| 621 | 3300046533 | Ga0495640_0492136 | Ga0495640_0492136_101_676 | 184 |
| 622 | 3300046535 | Ga0495586_0530015 | Ga0495586_0530015_59_634 | 184 |
| 623 | 3300046542 | Ga0495597_0247340 | Ga0495597_0247340_14_592 | 184 |
| 624 | 3300046559 | Ga0495667_0263572 | Ga0495667_0263572_109_684 | 184 |
| 625 | 3300046679 | Ga0495623_0188691 | Ga0495623_0188691_251_826 | 184 |
| 626 | 3300046694 | Ga0495649_0036243 | Ga0495649_0036243_555_1124 | 184 |
| 627 | 3300046809 | Ga0495600_0410183 | Ga0495600_0410183_80_655 | 184 |
| 628 | 3300047315 | Ga0495581_0100444 | Ga0495581_0100444_387_962 | 184 |
| 629 | 3300047319 | Ga0495674_0083880 | Ga0495674_0083880_2010_2585 | 184 |
| 630 | 3300047320 | Ga0495672_0046637 | Ga0495672_0046637_57_632 | 184 |
| 631 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_528119_528697 | 184 |
| 632 | 3300048909 | Ga0496106_0793756 | Ga0496106_0793756_27_602 | 184 |
| 633 | 3300048912 | Ga0496109_0028678 | Ga0496109_0028678_2757_3332 | 184 |
| 634 | 3300048918 | Ga0496115_0350418 | Ga0496115_0350418_563_1141 | 184 |
| 635 | 3300049569 | Ga0501032_0007417 | Ga0501032_0007417_4953_5525 | 184 |
| 636 | 3300049571 | Ga0501034_0576225 | Ga0501034_0576225_76_651 | 184 |
| 637 | 3300049573 | Ga0501037_0005310 | Ga0501037_0005310_3933_4505 | 184 |
| 638 | 3300049579 | Ga0501043_0091900 | Ga0501043_0091900_1072_1647 | 184 |
| 639 | 3300049581 | Ga0501047_0013489 | Ga0501047_0013489_3721_4296 | 184 |
| 640 | 3300049581 | Ga0501047_0256271 | Ga0501047_0256271_597_1172 | 184 |
| 641 | 3300049582 | Ga0501048_0400940 | Ga0501048_0400940_267_842 | 184 |
| 642 | 3300049823 | Ga0501044_0065026 | Ga0501044_0065026_1826_2401 | 184 |
| 643 | 3300053090 | Ga0500646_0040563 | Ga0500646_0040563_399_974 | 184 |
| 644 | 3300053092 | Ga0500583_0000078 | Ga0500583_0000078_13798_14373 | 184 |
| 645 | 3300053092 | Ga0500583_0001571 | Ga0500583_0001571_3792_4370 | 184 |
| 646 | 3300053092 | Ga0500583_0013003 | Ga0500583_0013003_2185_2760 | 184 |
| 647 | 3300053092 | Ga0500583_0310796 | Ga0500583_0310796_46_624 | 184 |
| 648 | 3300053130 | Ga0500642_0035698 | Ga0500642_0035698_124_702 | 184 |
| 649 | 3300053134 | Ga0500658_0058455 | Ga0500658_0058455_304_879 | 184 |
| 650 | 3300053150 | Ga0500603_020199 | Ga0500603_020199_970_1545 | 184 |
| 651 | 3300053156 | Ga0500622_0006472 | Ga0500622_0006472_1004_1582 | 184 |
| 652 | 3300053156 | Ga0500622_0018889 | Ga0500622_0018889_2061_2636 | 184 |
| 653 | 3300053178 | Ga0500637_0090501 | Ga0500637_0090501_606_1181 | 184 |
| 654 | 3300053178 | Ga0500637_0112221 | Ga0500637_0112221_781_1362 | 184 |
| 655 | 3300053727 | Ga0500611_028007 | Ga0500611_028007_238_813 | 184 |
| 656 | 3300061719 | Ga0466962_0389622 | Ga0466962_0389622_60_635 | 184 |
| 657 | 3300061719 | Ga0466962_0446222 | Ga0466962_0446222_64_639 | 184 |
| 658 | 3300005539 | Ga0068853_100047692 | Ga0068853_1000476923 | 185 |
| 659 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008996 | 185 |
| 660 | 3300005578 | Ga0068854_100626211 | Ga0068854_1006262112 | 185 |
| 661 | 3300005616 | Ga0068852_100114231 | Ga0068852_1001142312 | 185 |
| 662 | 3300005843 | Ga0068860_100434992 | Ga0068860_1004349922 | 185 |
| 663 | 3300005983 | Ga0081540_1017916 | Ga0081540_10179162 | 185 |
| 664 | 3300009093 | Ga0105240_10000754 | Ga0105240_1000075424 | 185 |
| 665 | 3300009093 | Ga0105240_10000862 | Ga0105240_1000086225 | 185 |
| 666 | 3300009093 | Ga0105240_10002072 | Ga0105240_100020726 | 185 |
| 667 | 3300009174 | Ga0105241_10112786 | Ga0105241_101127863 | 185 |
| 668 | 3300009174 | Ga0105241_10268150 | Ga0105241_102681502 | 185 |
| 669 | 3300009545 | Ga0105237_10071773 | Ga0105237_100717733 | 185 |
| 670 | 3300009551 | Ga0105238_10060424 | Ga0105238_100604242 | 185 |
| 671 | 3300010375 | Ga0105239_10003433 | Ga0105239_100034335 | 185 |
| 672 | 3300010375 | Ga0105239_10009088 | Ga0105239_100090887 | 185 |
| 673 | 3300010375 | Ga0105239_10135806 | Ga0105239_101358063 | 185 |
| 674 | 3300013100 | Ga0157373_10083630 | Ga0157373_100836302 | 185 |
| 675 | 3300013104 | Ga0157370_10011697 | Ga0157370_100116973 | 185 |
| 676 | 3300013105 | Ga0157369_10082965 | Ga0157369_100829652 | 185 |
| 677 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001342 | 185 |
| 678 | 3300020078 | Ga0206352_10770432 | Ga0206352_107704321 | 185 |
| 679 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071142 | 185 |
| 680 | 3300025913 | Ga0207695_10000084 | Ga0207695_1000008484 | 185 |
| 681 | 3300025913 | Ga0207695_10001197 | Ga0207695_1000119711 | 185 |
| 682 | 3300025913 | Ga0207695_10015718 | Ga0207695_100157184 | 185 |
| 683 | 3300025914 | Ga0207671_10005486 | Ga0207671_100054866 | 185 |
| 684 | 3300025944 | Ga0207661_10011778 | Ga0207661_100117784 | 185 |
| 685 | 3300025949 | Ga0207667_10000209 | Ga0207667_1000020924 | 185 |
| 686 | 3300026041 | Ga0207639_10018632 | Ga0207639_100186322 | 185 |
| 687 | 3300026078 | Ga0207702_10112852 | Ga0207702_101128523 | 185 |
| 688 | 3300026142 | Ga0207698_11085626 | Ga0207698_110856261 | 185 |
| 689 | 3300031852 | Ga0307410_10125443 | Ga0307410_101254431 | 185 |
| 690 | 3300031903 | Ga0307407_10177440 | Ga0307407_101774403 | 185 |
| 691 | 3300031911 | Ga0307412_10336655 | Ga0307412_103366552 | 185 |
| 692 | 3300032005 | Ga0307411_10704405 | Ga0307411_107044051 | 185 |
| 693 | 3300033180 | Ga0307510_10000584 | Ga0307510_1000058418 | 185 |
| 694 | 3300037418 | Ga0395900_0173088 | Ga0395900_0173088_1215_1787 | 185 |
| 695 | 3300042005 | Ga0439448_0064373 | Ga0439448_0064373_25_606 | 185 |
| 696 | 3300044693 | Ga0466961_0034755 | Ga0466961_0034755_1958_2539 | 185 |
| 697 | 3300044719 | Ga0466971_0070821 | Ga0466971_0070821_532_1113 | 185 |
| 698 | 3300044735 | Ga0466968_0137233 | Ga0466968_0137233_205_786 | 185 |
| 699 | 3300045049 | Ga0466959_0026078 | Ga0466959_0026078_641_1222 | 185 |
| 700 | 3300045836 | Ga0466958_0044854 | Ga0466958_0044854_232_813 | 185 |
| 701 | 3300046616 | Ga0495668_0252547 | Ga0495668_0252547_67_648 | 185 |
| 702 | 3300046648 | Ga0495611_0000575 | Ga0495611_0000575_15944_16525 | 185 |
| 703 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_282319_282900 | 185 |
| 704 | 3300049703 | Ga0501219_001673 | Ga0501219_001673_551_1231 | 185 |
| 705 | 3300050005 | Ga0501284_00002 | Ga0501284_00002_195763_196443 | 185 |
| 706 | 3300053125 | Ga0500618_000004 | Ga0500618_000004_263164_263736 | 185 |
| 707 | 3300053178 | Ga0500637_0149649 | Ga0500637_0149649_279_860 | 185 |
| 708 | 3300059493 | Ga0587077_023405 | Ga0587077_023405_489_1067 | 185 |
| 709 | 3300061719 | Ga0466962_0027711 | Ga0466962_0027711_2031_2612 | 185 |
| 710 | iso_pu_bacteria | 2883068021 | 2883069483 | 185 |
| 711 | 3300004799 | Ga0058863_10091895 | Ga0058863_100918953 | 186 |
| 712 | 3300004800 | Ga0058861_12039234 | Ga0058861_120392344 | 186 |
| 713 | 3300004803 | Ga0058862_10284522 | Ga0058862_102845223 | 186 |
| 714 | 3300005327 | Ga0070658_10044669 | Ga0070658_100446693 | 186 |
| 715 | 3300005327 | Ga0070658_10083170 | Ga0070658_100831702 | 186 |
| 716 | 3300005336 | Ga0070680_100041989 | Ga0070680_1000419893 | 186 |
| 717 | 3300005367 | Ga0070667_100780695 | Ga0070667_1007806951 | 186 |
| 718 | 3300005530 | Ga0070679_100058152 | Ga0070679_1000581523 | 186 |
| 719 | 3300005563 | Ga0068855_100252214 | Ga0068855_1002522142 | 186 |
| 720 | 3300005614 | Ga0068856_100020623 | Ga0068856_1000206233 | 186 |
| 721 | 3300013306 | Ga0163162_10051173 | Ga0163162_100511733 | 186 |
| 722 | 3300013308 | Ga0157375_10153364 | Ga0157375_101533642 | 186 |
| 723 | 3300017792 | Ga0163161_10355237 | Ga0163161_103552372 | 186 |
| 724 | 3300025909 | Ga0207705_10037679 | Ga0207705_100376792 | 186 |
| 725 | 3300025913 | Ga0207695_10193040 | Ga0207695_101930402 | 186 |
| 726 | 3300025921 | Ga0207652_10033362 | Ga0207652_100333622 | 186 |
| 727 | 3300025961 | Ga0207712_10011116 | Ga0207712_100111164 | 186 |
| 728 | 3300032004 | Ga0307414_10050591 | Ga0307414_100505913 | 186 |
| 729 | 3300032004 | Ga0307414_10100657 | Ga0307414_101006571 | 186 |
| 730 | 3300041491 | Ga0451833_0564981 | Ga0451833_0564981_92_676 | 186 |
| 731 | 3300046507 | Ga0495606_0054975 | Ga0495606_0054975_507_1091 | 186 |
| 732 | 3300005614 | Ga0068856_100000129 | Ga0068856_10000012951 | 187 |
| 733 | 3300025272 | Ga0209455_1017797 | Ga0209455_10177972 | 187 |
| 734 | 3300026078 | Ga0207702_10000300 | Ga0207702_1000030030 | 187 |
| 735 | 3300032004 | Ga0307414_10250186 | Ga0307414_102501862 | 187 |
| 736 | 3300049571 | Ga0501034_0144872 | Ga0501034_0144872_1645_2211 | 187 |
| 737 | iso_pu_bacteria | 2929921140 | 2929924405 | 187 |
| 738 | iso_pu_bacteria | 8003151029 | 8003155367 | 187 |
| 739 | 3300041997 | Ga0439431_0000264 | Ga0439431_0000264_6728_7300 | 189 |
| 740 | 3300001979 | JGI24740J21852_10000909 | JGI24740J21852_1000090911 | 191 |
| 741 | 3300001989 | JGI24739J22299_10003098 | JGI24739J22299_100030983 | 191 |
| 742 | 3300002738 | JGI25154J39366_1000012 | JGI25154J39366_100001274 | 191 |
| 743 | 3300002741 | JGI25157J39369_1006716 | JGI25157J39369_10067162 | 191 |
| 744 | 3300003215 | JGI25153J46596_10001521 | JGI25153J46596_100015212 | 191 |
| 745 | 3300003215 | JGI25153J46596_10016658 | JGI25153J46596_100166585 | 191 |
| 746 | 3300003354 | JGI25160J50197_1004764 | JGI25160J50197_10047644 | 191 |
| 747 | 3300003354 | JGI25160J50197_1006581 | JGI25160J50197_10065813 | 191 |
| 748 | 3300003771 | Ga0055526_1016576 | Ga0055526_10165764 | 191 |
| 749 | 3300003771 | Ga0055526_1027605 | Ga0055526_10276052 | 191 |
| 750 | 3300003790 | Ga0055528_1001024 | Ga0055528_10010246 | 191 |
| 751 | 3300003791 | Ga0055530_10001218 | Ga0055530_1000121815 | 191 |
| 752 | 3300003794 | Ga0055531_10037765 | Ga0055531_100377652 | 191 |
| 753 | 3300005262 | Ga0065165_1000228 | Ga0065165_100022848 | 191 |
| 754 | 3300010375 | Ga0105239_10207637 | Ga0105239_102076372 | 191 |
| 755 | 3300013102 | Ga0157371_10104539 | Ga0157371_101045392 | 191 |
| 756 | 3300013104 | Ga0157370_10196198 | Ga0157370_101961983 | 191 |
| 757 | 3300025246 | Ga0209646_1000009 | Ga0209646_1000009200 | 191 |
| 758 | 3300025250 | Ga0209026_1000197 | Ga0209026_100019716 | 191 |
| 759 | 3300025273 | Ga0209673_1000016 | Ga0209673_1000016164 | 191 |
| 760 | 3300025295 | Ga0209564_1011183 | Ga0209564_10111833 | 191 |
| 761 | 3300025295 | Ga0209564_1011455 | Ga0209564_10114553 | 191 |
| 762 | 3300025297 | Ga0209758_1007200 | Ga0209758_10072005 | 191 |
| 763 | 3300025297 | Ga0209758_1012031 | Ga0209758_10120311 | 191 |
| 764 | 3300025298 | Ga0209050_1000124 | Ga0209050_100012415 | 191 |
| 765 | 3300025302 | Ga0207426_1001572 | Ga0207426_100157210 | 191 |
| 766 | 3300025302 | Ga0207426_1001894 | Ga0207426_100189411 | 191 |
| 767 | 3300025302 | Ga0207426_1053576 | Ga0207426_10535762 | 191 |
| 768 | 3300025303 | Ga0209051_1035622 | Ga0209051_10356222 | 191 |
| 769 | 3300025304 | Ga0209257_1004094 | Ga0209257_10040942 | 191 |
| 770 | 3300046810 | Ga0495660_0137077 | Ga0495660_0137077_501_1076 | 191 |
| 771 | 3300049570 | Ga0501033_0374836 | Ga0501033_0374836_43_618 | 191 |
| 772 | 3300049573 | Ga0501037_0378098 | Ga0501037_0378098_47_622 | 191 |
| 773 | 3300049581 | Ga0501047_0033096 | Ga0501047_0033096_2410_2985 | 191 |
| 774 | 3300049823 | Ga0501044_0086137 | Ga0501044_0086137_190_765 | 191 |
| 775 | 3300053090 | Ga0500646_0013830 | Ga0500646_0013830_490_1065 | 191 |
| 776 | 3300053100 | Ga0500660_128294 | Ga0500660_128294_192_767 | 191 |
| 777 | 3300053105 | Ga0500557_089211 | Ga0500557_089211_284_859 | 191 |
| 778 | 3300053131 | Ga0500652_005630 | Ga0500652_005630_596_1171 | 191 |
| 779 | 3300053134 | Ga0500658_0079128 | Ga0500658_0079128_95_670 | 191 |
| 780 | 3300053153 | Ga0500616_0022794 | Ga0500616_0022794_838_1413 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5in8-assembly1.cif.gz_B-2 | crystal structure of q151h aspergillus terreus aristolochene synthase | 0.3336 | 64 | 155 |
| 5jvn-assembly1.cif.gz_A-2 | c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism | 0.3201 | 41 | 161 |
| 4eya-assembly1.cif.gz_A | crystal structure of a plectonemic rna supercoil | 0.2878 | 45 | 162 |
| 6fbx-assembly1.cif.gz_A | crystal structure of a zebra-fish pro-survival protein nrz:bad bh3 complex | 0.2793 | 43 | 157 |
| 5w88-assembly1.cif.gz_A | nmr structure of the n-domain of troponin c bound to switch region of troponin i and 3-methyldiphenylamine (peptide mode) | 0.2727 | 38 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMV7_1_132_2.30.31.10 | Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A | 0.5987 | 36 | 157 | 2.30.31.10 |
| af_P9WMV7_1_132_2.30.31.10 | Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A | 0.5027 | 36 | 157 | 2.30.31.10 |
| af_Q6K370_56_142_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.3871 | 41 | 154 | 1.10.10.60 |
| af_A0A3B3IT52_34_123_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.3833 | 41 | 149 | 1.10.10.60 |
| af_A0A3B3IT52_34_123_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.365 | 41 | 149 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7KKN2-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9213 | 41 | 115 |
|
| AF-A0A358EDS1-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.912 | 35 | 122 |
|
| AF-A0A2D8N6D1-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.889 | 41 | 161 |
|
| AF-A0A2V7SG72-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8798 | 41 | 181 |
|
| AF-A0A523NBH2-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8748 | 39 | 181 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar