F480526

General Info

Members Datasets Scaffolds Average Seq Length
780 289 1560 146

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0090198|Ga0373935_0090198_260_763
Length 167
Sequence VLPYDPSPYVVEHTKTKELRSQMTDPPRLRRVLLVDDYPDAREMYSEYLKFSGFDVVEASNGVEALQRAIETSPDIILMDLSLPVMDGWEATRRLKADQRTKAIPVVALTGHALAGISEGARQAGCDAFVTKPCLPEDLVREIRKILDGPSSTIAKARRSGKHAKTS

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
109 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0090198 3300035692 Bacteria 2006
2 Ga0007417J51691_1069732 3300003544 Unclassified 590
3 Ga0032354_1077015 3300003693 Bacteria 1175
4 Ga0058863_11627866 3300004799 Bacteria 977
5 Ga0058863_11641791 3300004799 Bacteria 942
6 Ga0065712_10099405 3300005290 Bacteria 2067
7 Ga0065712_10148953 3300005290 Bacteria 1385
8 Ga0065712_10502582 3300005290 Bacteria 605
9 Ga0065712_10647783 3300005290 Bacteria 569
10 Ga0065715_10203731 3300005293 Bacteria 1348
11 Ga0065715_10584043 3300005293 Bacteria 718
12 Ga0065707_10125922 3300005295 Bacteria 2014
13 Ga0065707_10475197 3300005295 Bacteria 778
14 Ga0065707_10934785 3300005295 Bacteria 557
15 Ga0065707_11117197 3300005295 Unclassified 512
16 Ga0070658_10105987 3300005327 Bacteria 2325
17 Ga0070676_10026110 3300005328 Bacteria 3306
18 Ga0070683_100484861 3300005329 Bacteria 1181
19 Ga0070690_100005478 3300005330 Bacteria 7133
20 Ga0070670_100078032 3300005331 Bacteria 2845
21 Ga0070670_100103208 3300005331 Bacteria 2456
22 Ga0070670_100287175 3300005331 Bacteria 1437
23 Ga0070670_101189208 3300005331 Bacteria 697
24 Ga0070677_10169317 3300005333 Bacteria 1031
25 Ga0068869_100185008 3300005334 Bacteria 1635
26 Ga0068869_100377156 3300005334 Bacteria 1162
27 Ga0070666_10010955 3300005335 Bacteria 5682
28 Ga0070666_10112881 3300005335 Bacteria 1880
29 Ga0070666_10116839 3300005335 Bacteria 1848
30 Ga0070666_10762749 3300005335 Bacteria 711
31 Ga0070680_100219437 3300005336 Bacteria 1605
32 Ga0070680_100258188 3300005336 Bacteria 1474
33 Ga0068868_100309389 3300005338 Bacteria 1344
34 Ga0068868_100555236 3300005338 Bacteria 1012
35 Ga0068868_101289496 3300005338 Bacteria 678
36 Ga0070660_100030990 3300005339 Bacteria 4014
37 Ga0070689_100193283 3300005340 Bacteria 1658
38 Ga0070689_100628675 3300005340 Bacteria 932
39 Ga0070689_101232990 3300005340 Bacteria 672
40 Ga0070689_102054725 3300005340 Bacteria 523
41 Ga0070691_10004127 3300005341 Bacteria 6597
42 Ga0070687_100066342 3300005343 Bacteria 1922
43 Ga0070687_100279493 3300005343 Bacteria 1050
44 Ga0070661_100092664 3300005344 Bacteria 2239
45 Ga0070661_100209388 3300005344 Bacteria 1492
46 Ga0070692_10206506 3300005345 Bacteria 1153
47 Ga0070692_10602438 3300005345 Bacteria 727
48 Ga0070668_100110067 3300005347 Bacteria 2192
49 Ga0070668_100189498 3300005347 Bacteria 1684
50 Ga0070668_100286435 3300005347 Bacteria 1377
51 Ga0070668_101870510 3300005347 Bacteria 552
52 Ga0070669_100012638 3300005353 Bacteria 5992
53 Ga0070669_100080973 3300005353 Bacteria 2418
54 Ga0070669_100148323 3300005353 Bacteria 1814
55 Ga0070669_101179703 3300005353 Bacteria 661
56 Ga0070669_101838395 3300005353 Bacteria 529
57 Ga0070675_100115024 3300005354 Bacteria 2280
58 Ga0070675_100312631 3300005354 Bacteria 1386
59 Ga0070675_100438101 3300005354 Bacteria 1171
60 Ga0070671_100013155 3300005355 Bacteria 6667
61 Ga0070671_100483437 3300005355 Bacteria 1064
62 Ga0070671_100693534 3300005355 Bacteria 883
63 Ga0070674_100018482 3300005356 Bacteria 4409
64 Ga0070674_100111086 3300005356 Bacteria 2012
65 Ga0070674_100419570 3300005356 Bacteria 1097
66 Ga0070674_100477598 3300005356 Bacteria 1034
67 Ga0070674_100615947 3300005356 Bacteria 919
68 Ga0070673_100096207 3300005364 Bacteria 2430
69 Ga0070673_100189512 3300005364 Bacteria 1765
70 Ga0070688_100020363 3300005365 Bacteria 3856
71 Ga0070688_100149540 3300005365 Bacteria 1595
72 Ga0070688_100473079 3300005365 Bacteria 941
73 Ga0070659_100872239 3300005366 Unclassified 785
74 Ga0070667_100043407 3300005367 Bacteria 3773
75 Ga0070667_100174149 3300005367 Bacteria 1901
76 Ga0070667_100396308 3300005367 Bacteria 1256
77 Ga0070703_10405367 3300005406 Bacteria 595
78 Ga0070713_100088094 3300005436 Bacteria 2664
79 Ga0070701_10024255 3300005438 Bacteria 2933
80 Ga0070711_100325521 3300005439 Bacteria 1229
81 Ga0070705_100026862 3300005440 Bacteria 3137
82 Ga0070705_100171500 3300005440 Bacteria 1461
83 Ga0070700_100029372 3300005441 Bacteria 3277
84 Ga0070700_100162036 3300005441 Bacteria 1541
85 Ga0070700_100893014 3300005441 Unclassified 723
86 Ga0070700_100899430 3300005441 Bacteria 721
87 Ga0070694_100055381 3300005444 Bacteria 2689
88 Ga0070694_100159535 3300005444 Bacteria 1654
89 Ga0070694_100169154 3300005444 Bacteria 1609
90 Ga0070694_100896629 3300005444 Bacteria 732
91 Ga0070708_100248383 3300005445 Bacteria 1671
92 Ga0070678_100002975 3300005456 Bacteria 9387
93 Ga0070678_100253117 3300005456 Bacteria 1477
94 Ga0070678_100689497 3300005456 Bacteria 919
95 Ga0070662_100192563 3300005457 Bacteria 1614
96 Ga0070662_101632360 3300005457 Bacteria 557
97 Ga0070681_10020705 3300005458 Bacteria 6589
98 Ga0070681_11390559 3300005458 Bacteria 625
99 Ga0068867_100008447 3300005459 Bacteria 7263
100 Ga0068867_100061155 3300005459 Bacteria 2795
101 Ga0068867_100460025 3300005459 Bacteria 1086
102 Ga0068867_101398274 3300005459 Bacteria 649
103 Ga0068867_101487652 3300005459 Bacteria 630
104 Ga0070685_10023992 3300005466 Bacteria 3346
105 Ga0070706_100464358 3300005467 Bacteria 1178
106 Ga0070706_101017090 3300005467 Unclassified 764
107 Ga0070706_101046653 3300005467 Bacteria 752
108 Ga0070707_100277899 3300005468 Bacteria 1628
109 Ga0070707_100326893 3300005468 Bacteria 1490
110 Ga0070698_100018301 3300005471 Bacteria 7377
111 Ga0070698_100389356 3300005471 Bacteria 1327
112 Ga0070698_100563472 3300005471 Unclassified 1079
113 Ga0070698_100901259 3300005471 Bacteria 830
114 Ga0070699_100667739 3300005518 Unclassified 949
115 Ga0070699_101266390 3300005518 Unclassified 676
116 Ga0070679_100036059 3300005530 Bacteria 4907
117 Ga0070679_100089967 3300005530 Bacteria 3057
118 Ga0070684_100122544 3300005535 Bacteria 2339
119 Ga0070697_100486524 3300005536 Bacteria 1078
120 Ga0068853_100777057 3300005539 Bacteria 916
121 Ga0070672_100090961 3300005543 Bacteria 2462
122 Ga0070672_100433310 3300005543 Bacteria 1130
123 Ga0070672_100723188 3300005543 Unclassified 872
124 Ga0070672_100851817 3300005543 Bacteria 804
125 Ga0070686_100011506 3300005544 Bacteria 5019
126 Ga0070686_100212994 3300005544 Bacteria 1392
127 Ga0070686_100612938 3300005544 Bacteria 859
128 Ga0070695_100000811 3300005545 Bacteria 16822
129 Ga0070695_100070376 3300005545 Bacteria 2288
130 Ga0070695_101140937 3300005545 Bacteria 639
131 Ga0070696_100012980 3300005546 Bacteria 5591
132 Ga0070696_100037273 3300005546 Bacteria 3354
133 Ga0070696_100066986 3300005546 Bacteria 2519
134 Ga0070696_100560608 3300005546 Bacteria 916
135 Ga0070696_100611606 3300005546 Bacteria 880
136 Ga0070696_101300334 3300005546 Bacteria 617
137 Ga0070665_100004603 3300005548 Bacteria 14428
138 Ga0070665_100046683 3300005548 Bacteria 4349
139 Ga0070665_100047433 3300005548 Bacteria 4311
140 Ga0070665_100564386 3300005548 Bacteria 1151
141 Ga0070704_100019913 3300005549 Bacteria 4318
142 Ga0068855_100054357 3300005563 Bacteria 4706
143 Ga0068855_100379686 3300005563 Bacteria 1552
144 Ga0068855_100601976 3300005563 Bacteria 1185
145 Ga0068857_100163734 3300005577 Unclassified 2019
146 Ga0068857_100566793 3300005577 Bacteria 1071
147 Ga0068857_101542076 3300005577 Bacteria 648
148 Ga0068854_100224288 3300005578 Bacteria 1488
149 Ga0068854_101273198 3300005578 Bacteria 661
150 Ga0068856_100392896 3300005614 Bacteria 1407
151 Ga0070702_100013261 3300005615 Bacteria 4157
152 Ga0070702_100155650 3300005615 Bacteria 1472
153 Ga0070702_100600673 3300005615 Bacteria 825
154 Ga0068852_100194456 3300005616 Bacteria 1916
155 Ga0068859_100247943 3300005617 Bacteria 1871
156 Ga0068859_100296360 3300005617 Bacteria 1710
157 Ga0068859_100319849 3300005617 Bacteria 1646
158 Ga0068859_100556920 3300005617 Bacteria 1241
159 Ga0068859_100594710 3300005617 Bacteria 1200
160 Ga0068859_100603606 3300005617 Bacteria 1190
161 Ga0068859_100657301 3300005617 Bacteria 1140
162 Ga0068859_100747231 3300005617 Bacteria 1067
163 Ga0068864_100011217 3300005618 Bacteria 7407
164 Ga0068864_100023489 3300005618 Bacteria 5178
165 Ga0068864_101470919 3300005618 Bacteria 684
166 Ga0068866_10034896 3300005718 Bacteria 2453
167 Ga0068866_10263446 3300005718 Bacteria 1060
168 Ga0068866_10321153 3300005718 Bacteria 974
169 Ga0068866_11106707 3300005718 Bacteria 568
170 Ga0068866_11207907 3300005718 Bacteria 546
171 Ga0068861_100037471 3300005719 Bacteria 3605
172 Ga0068861_100068349 3300005719 Bacteria 2745
173 Ga0068861_100082599 3300005719 Bacteria 2518
174 Ga0068861_100091522 3300005719 Bacteria 2401
175 Ga0068861_100162292 3300005719 Bacteria 1844
176 Ga0068861_100609478 3300005719 Bacteria 1003
177 Ga0068861_100671462 3300005719 Bacteria 960
178 Ga0068851_10259045 3300005834 Bacteria 989
179 Ga0068851_10289211 3300005834 Bacteria 939
180 Ga0068870_10058468 3300005840 Bacteria 2064
181 Ga0068870_10284494 3300005840 Bacteria 1038
182 Ga0068870_10306930 3300005840 Bacteria 1004
183 Ga0068863_100003679 3300005841 Bacteria 15145
184 Ga0068863_100130130 3300005841 Bacteria 2403
185 Ga0068863_100480188 3300005841 Bacteria 1222
186 Ga0068858_100002279 3300005842 Bacteria 19420
187 Ga0068858_100113227 3300005842 Bacteria 2534
188 Ga0068858_100267862 3300005842 Bacteria 1625
189 Ga0068858_100286061 3300005842 Bacteria 1570
190 Ga0068858_100457815 3300005842 Bacteria 1230
191 Ga0068858_100759839 3300005842 Bacteria 945
192 Ga0068858_100815643 3300005842 Bacteria 911
193 Ga0068858_101495126 3300005842 Bacteria 666
194 Ga0068860_100143590 3300005843 Bacteria 2295
195 Ga0068860_100594335 3300005843 Bacteria 1112
196 Ga0068860_100802269 3300005843 Bacteria 955
197 Ga0068860_101425720 3300005843 Bacteria 714
198 Ga0068860_102299020 3300005843 Bacteria 560
199 Ga0068862_100021982 3300005844 Bacteria 5335
200 Ga0068862_100369613 3300005844 Bacteria 1335
201 Ga0068862_100402959 3300005844 Bacteria 1280
202 Ga0068862_100409085 3300005844 Bacteria 1271
203 Ga0068862_100568595 3300005844 Bacteria 1085
204 Ga0068862_101493955 3300005844 Bacteria 681
205 Ga0081539_10012425 3300005985 Bacteria 6564
206 Ga0070717_10217092 3300006028 Bacteria 1680
207 Ga0075432_10360957 3300006058 Bacteria 618
208 Ga0070715_10209252 3300006163 Bacteria 996
209 Ga0070716_100517680 3300006173 Bacteria 883
210 Ga0070712_100306329 3300006175 Bacteria 1287
211 Ga0070712_100452946 3300006175 Bacteria 1069
212 Ga0097621_100005974 3300006237 Bacteria 8607
213 Ga0097621_100017477 3300006237 Bacteria 5447
214 Ga0097621_100484005 3300006237 Bacteria 1119
215 Ga0068871_100002816 3300006358 Bacteria 11897
216 Ga0068871_100633586 3300006358 Bacteria 975
217 Ga0068871_100733976 3300006358 Bacteria 907
218 Ga0075428_100130865 3300006844 Bacteria 2729
219 Ga0075428_100870683 3300006844 Bacteria 956
220 Ga0075431_100618975 3300006847 Bacteria 1065
221 Ga0075431_100728587 3300006847 Unclassified 968
222 Ga0075433_10035341 3300006852 Bacteria 4296
223 Ga0075433_10052348 3300006852 Bacteria 3557
224 Ga0075433_10108684 3300006852 Bacteria 2460
225 Ga0075433_10221795 3300006852 Bacteria 1679
226 Ga0075433_10311557 3300006852 Bacteria 1393
227 Ga0075433_10368684 3300006852 Bacteria 1268
228 Ga0075433_10838305 3300006852 Bacteria 803
229 Ga0075434_100000100 3300006871 Bacteria 48123
230 Ga0075434_100005346 3300006871 Bacteria 11683
231 Ga0075434_100077651 3300006871 Bacteria 3315
232 Ga0075434_100112795 3300006871 Bacteria 2730
233 Ga0075434_100214876 3300006871 Bacteria 1943
234 Ga0075434_100587680 3300006871 Bacteria 1133
235 Ga0075434_100623900 3300006871 Bacteria 1097
236 Ga0075434_101202889 3300006871 Unclassified 770
237 Ga0075434_101909228 3300006871 Bacteria 600
238 Ga0075429_100157812 3300006880 Bacteria 1987
239 Ga0075429_100326121 3300006880 Bacteria 1344
240 Ga0075429_100391632 3300006880 Bacteria 1217
241 Ga0068865_100014135 3300006881 Bacteria 5067
242 Ga0068865_100137524 3300006881 Bacteria 1838
243 Ga0068865_100600762 3300006881 Bacteria 930
244 Ga0068865_100625805 3300006881 Bacteria 912
245 Ga0068865_101360913 3300006881 Bacteria 633
246 Ga0075436_100000583 3300006914 Bacteria 23900
247 Ga0075436_100004798 3300006914 Bacteria 9285
248 Ga0075436_100046312 3300006914 Bacteria 2999
249 Ga0075436_100055979 3300006914 Bacteria 2724
250 Ga0075436_100530574 3300006914 Bacteria 863
251 Ga0097620_100247919 3300006931 Bacteria 1871
252 Ga0097620_100296357 3300006931 Bacteria 1710
253 Ga0097620_100319835 3300006931 Bacteria 1646
254 Ga0097620_100556999 3300006931 Bacteria 1241
255 Ga0097620_100594733 3300006931 Bacteria 1200
256 Ga0097620_100603624 3300006931 Bacteria 1190
257 Ga0097620_100657252 3300006931 Bacteria 1140
258 Ga0097620_100747392 3300006931 Bacteria 1067
259 Ga0075435_100000192 3300007076 Bacteria 36826
260 Ga0075435_100001229 3300007076 Bacteria 16420
261 Ga0075435_100003621 3300007076 Bacteria 10515
262 Ga0075435_100006467 3300007076 Bacteria 8288
263 Ga0075435_100011627 3300007076 Bacteria 6487
264 Ga0075435_100032589 3300007076 Bacteria 4116
265 Ga0075435_100202652 3300007076 Bacteria 1681
266 Ga0075435_100297540 3300007076 Bacteria 1380
267 Ga0075435_100344695 3300007076 Bacteria 1277
268 Ga0099794_10212637 3300007265 Bacteria 992
269 Ga0099794_10353293 3300007265 Bacteria 765
270 Ga0105251_10235232 3300009011 Bacteria 825
271 Ga0105240_10011023 3300009093 Bacteria 12644
272 Ga0105240_10017877 3300009093 Bacteria 9540
273 Ga0111539_10001186 3300009094 Bacteria 34634
274 Ga0111539_10062811 3300009094 Unclassified 4395
275 Ga0111539_10189478 3300009094 Bacteria 2400
276 Ga0111539_10192934 3300009094 Bacteria 2376
277 Ga0111539_10200443 3300009094 Bacteria 2327
278 Ga0105245_10113029 3300009098 Bacteria 2528
279 Ga0105245_10202573 3300009098 Bacteria 1906
280 Ga0105245_10540397 3300009098 Bacteria 1186
281 Ga0105245_10568728 3300009098 Bacteria 1157
282 Ga0105245_10777013 3300009098 Bacteria 995
283 Ga0105245_11367375 3300009098 Bacteria 758
284 Ga0105247_10166645 3300009101 Bacteria 1462
285 Ga0105247_10666458 3300009101 Bacteria 779
286 Ga0105247_10717318 3300009101 Bacteria 754
287 Ga0114129_10000434 3300009147 Bacteria 49632
288 Ga0114129_10000838 3300009147 Bacteria 39812
289 Ga0114129_10001577 3300009147 Bacteria 30953
290 Ga0114129_10004637 3300009147 Bacteria 19399
291 Ga0114129_10009128 3300009147 Bacteria 14135
292 Ga0114129_10138930 3300009147 Bacteria 3332
293 Ga0114129_10281423 3300009147 Bacteria 2222
294 Ga0114129_10290819 3300009147 Bacteria 2180
295 Ga0114129_10340441 3300009147 Bacteria 1989
296 Ga0114129_10511112 3300009147 Bacteria 1567
297 Ga0114129_10513492 3300009147 Bacteria 1563
298 Ga0114129_11210296 3300009147 Bacteria 940
299 Ga0114129_11801725 3300009147 Bacteria 744
300 Ga0105243_10047858 3300009148 Bacteria 3369
301 Ga0105243_10185370 3300009148 Bacteria 1813
302 Ga0105243_10299593 3300009148 Bacteria 1457
303 Ga0105243_10641933 3300009148 Bacteria 1028
304 Ga0105243_10928515 3300009148 Bacteria 868
305 Ga0105243_10957251 3300009148 Bacteria 856
306 Ga0105243_11331618 3300009148 Bacteria 736
307 Ga0105241_10057534 3300009174 Bacteria 2983
308 Ga0105241_10353149 3300009174 Unclassified 1277
309 Ga0105241_10440370 3300009174 Bacteria 1151
310 Ga0105242_10001523 3300009176 Bacteria 18223
311 Ga0105242_10005108 3300009176 Bacteria 10122
312 Ga0105242_10206820 3300009176 Bacteria 1746
313 Ga0105242_10218553 3300009176 Bacteria 1702
314 Ga0105242_10336722 3300009176 Bacteria 1389
315 Ga0105242_10719524 3300009176 Unclassified 979
316 Ga0105248_10001706 3300009177 Bacteria 24451
317 Ga0105248_10005355 3300009177 Bacteria 14118
318 Ga0105248_10067041 3300009177 Bacteria 4029
319 Ga0105248_10072200 3300009177 Bacteria 3879
320 Ga0105248_10097629 3300009177 Bacteria 3310
321 Ga0105248_10149466 3300009177 Bacteria 2635
322 Ga0105248_10150303 3300009177 Bacteria 2627
323 Ga0105248_11298779 3300009177 Bacteria 823
324 Ga0105248_11785616 3300009177 Bacteria 697
325 Ga0105238_10060920 3300009551 Bacteria 3777
326 Ga0105238_10208396 3300009551 Bacteria 1931
327 Ga0105238_10876865 3300009551 Bacteria 915
328 Ga0105238_11003168 3300009551 Bacteria 856
329 Ga0105238_11156865 3300009551 Bacteria 797
330 Ga0105249_10024006 3300009553 Bacteria 5476
331 Ga0105249_10157217 3300009553 Bacteria 2193
332 Ga0105249_10270597 3300009553 Bacteria 1692
333 Ga0105249_10434391 3300009553 Bacteria 1349
334 Ga0105249_11377882 3300009553 Bacteria 777
335 Ga0105239_10371472 3300010375 Bacteria 1616
336 Ga0105246_10114358 3300011119 Bacteria 1988
337 Ga0105246_11632592 3300011119 Unclassified 610
338 Ga0157325_1003743 3300012485 Bacteria 858
339 Ga0157316_1018169 3300012510 Bacteria 741
340 Ga0157369_10188677 3300013105 Bacteria 2167
341 Ga0157374_10021102 3300013296 Bacteria 5789
342 Ga0157374_10903905 3300013296 Bacteria 901
343 Ga0157374_10936401 3300013296 Bacteria 884
344 Ga0157378_10360747 3300013297 Bacteria 1422
345 Ga0163162_10539041 3300013306 Bacteria 1296
346 Ga0163162_10540876 3300013306 Bacteria 1293
347 Ga0163162_10612958 3300013306 Bacteria 1214
348 Ga0163162_10808508 3300013306 Bacteria 1054
349 Ga0157375_10238154 3300013308 Bacteria 1979
350 Ga0157375_10720211 3300013308 Bacteria 1150
351 Ga0163163_10019537 3300014325 Bacteria 6364
352 Ga0163163_10629251 3300014325 Bacteria 1136
353 Ga0163163_12790011 3300014325 Bacteria 545
354 Ga0157380_10100284 3300014326 Bacteria 2410
355 Ga0157380_12458166 3300014326 Bacteria 586
356 Ga0157379_10099809 3300014968 Bacteria 2606
357 Ga0157379_10146601 3300014968 Bacteria 2129
358 Ga0157379_10585310 3300014968 Bacteria 1041
359 Ga0157379_10924111 3300014968 Bacteria 829
360 Ga0157376_10018012 3300014969 Bacteria 5403
361 Ga0157376_10024132 3300014969 Bacteria 4770
362 Ga0157376_10062207 3300014969 Bacteria 3140
363 Ga0182005_1020919 3300015265 Bacteria 1797
364 Ga0163161_10433132 3300017792 Bacteria 1060
365 Ga0163161_11191533 3300017792 Bacteria 658
366 Ga0163161_11556407 3300017792 Bacteria 582
367 Ga0207697_10025957 3300025315 Bacteria 2395
368 Ga0207697_10186126 3300025315 Bacteria 911
369 Ga0207697_10324734 3300025315 Bacteria 683
370 Ga0207697_10395538 3300025315 Bacteria 614
371 Ga0207697_10511019 3300025315 Bacteria 530
372 Ga0207656_10183578 3300025321 Bacteria 1005
373 Ga0207642_10008235 3300025899 Bacteria 3565
374 Ga0207642_10027072 3300025899 Bacteria 2343
375 Ga0207642_10141636 3300025899 Bacteria 1269
376 Ga0207642_10849788 3300025899 Bacteria 583
377 Ga0207710_10063002 3300025900 Bacteria 1686
378 Ga0207710_10068876 3300025900 Bacteria 1619
379 Ga0207688_10414027 3300025901 Bacteria 837
380 Ga0207680_10021562 3300025903 Bacteria 3488
381 Ga0207680_10039576 3300025903 Bacteria 2737
382 Ga0207680_10199371 3300025903 Bacteria 1363
383 Ga0207680_10412975 3300025903 Bacteria 955
384 Ga0207699_10047010 3300025906 Bacteria 2528
385 Ga0207645_10002699 3300025907 Bacteria 13827
386 Ga0207645_10050836 3300025907 Bacteria 2647
387 Ga0207645_10329480 3300025907 Bacteria 1020
388 Ga0207643_10191752 3300025908 Bacteria 1241
389 Ga0207684_10231053 3300025910 Bacteria 1596
390 Ga0207684_10260324 3300025910 Bacteria 1497
391 Ga0207684_10408315 3300025910 Bacteria 1167
392 Ga0207684_10485441 3300025910 Bacteria 1060
393 Ga0207654_10103753 3300025911 Bacteria 1756
394 Ga0207707_10025126 3300025912 Bacteria 5210
395 Ga0207707_10646259 3300025912 Bacteria 892
396 Ga0207707_11080178 3300025912 Bacteria 655
397 Ga0207695_10026588 3300025913 Bacteria 6458
398 Ga0207695_10065699 3300025913 Bacteria 3729
399 Ga0207693_10374807 3300025915 Bacteria 1113
400 Ga0207663_10301245 3300025916 Bacteria 1198
401 Ga0207663_11380964 3300025916 Bacteria 567
402 Ga0207660_10329460 3300025917 Bacteria 1221
403 Ga0207662_10009277 3300025918 Bacteria 5406
404 Ga0207662_10409178 3300025918 Bacteria 921
405 Ga0207662_10659192 3300025918 Bacteria 731
406 Ga0207657_10013584 3300025919 Bacteria 7987
407 Ga0207657_10828560 3300025919 Bacteria 714
408 Ga0207649_10188715 3300025920 Bacteria 1448
409 Ga0207649_10409165 3300025920 Bacteria 1017
410 Ga0207652_10027474 3300025921 Bacteria 4741
411 Ga0207652_10199356 3300025921 Bacteria 1801
412 Ga0207652_10742810 3300025921 Bacteria 874
413 Ga0207646_10265152 3300025922 Bacteria 1552
414 Ga0207646_10484855 3300025922 Bacteria 1114
415 Ga0207646_10830131 3300025922 Bacteria 822
416 Ga0207646_10858513 3300025922 Bacteria 806
417 Ga0207681_10004545 3300025923 Bacteria 8545
418 Ga0207681_10045791 3300025923 Bacteria 2940
419 Ga0207681_10223407 3300025923 Bacteria 1458
420 Ga0207681_10258259 3300025923 Bacteria 1363
421 Ga0207681_10266712 3300025923 Bacteria 1342
422 Ga0207681_10633790 3300025923 Bacteria 885
423 Ga0207681_10826399 3300025923 Unclassified 774
424 Ga0207694_10223472 3300025924 Unclassified 1536
425 Ga0207694_10426685 3300025924 Bacteria 1105
426 Ga0207694_10729893 3300025924 Bacteria 836
427 Ga0207694_10890542 3300025924 Bacteria 752
428 Ga0207650_10166041 3300025925 Bacteria 1752
429 Ga0207650_10464443 3300025925 Bacteria 1055
430 Ga0207650_10468169 3300025925 Bacteria 1050
431 Ga0207650_10881073 3300025925 Bacteria 760
432 Ga0207659_10127983 3300025926 Bacteria 1956
433 Ga0207687_10030764 3300025927 Bacteria 3622
434 Ga0207687_10240620 3300025927 Bacteria 1434
435 Ga0207687_10383858 3300025927 Bacteria 1152
436 Ga0207700_10677137 3300025928 Bacteria 920
437 Ga0207664_10021735 3300025929 Bacteria 4779
438 Ga0207644_10021420 3300025931 Bacteria 4403
439 Ga0207644_10379793 3300025931 Bacteria 1152
440 Ga0207706_10016955 3300025933 Bacteria 6570
441 Ga0207706_10133429 3300025933 Bacteria 2184
442 Ga0207706_10260815 3300025933 Bacteria 1513
443 Ga0207706_11095839 3300025933 Bacteria 665
444 Ga0207686_10003296 3300025934 Bacteria 8681
445 Ga0207686_10006807 3300025934 Bacteria 6155
446 Ga0207686_10261188 3300025934 Bacteria 1270
447 Ga0207686_10391183 3300025934 Unclassified 1057
448 Ga0207686_11377365 3300025934 Bacteria 580
449 Ga0207709_10017518 3300025935 Bacteria 3998
450 Ga0207670_10086152 3300025936 Bacteria 2209
451 Ga0207670_10985585 3300025936 Bacteria 709
452 Ga0207670_11249861 3300025936 Bacteria 629
453 Ga0207669_10013589 3300025937 Bacteria 4050
454 Ga0207669_10128825 3300025937 Bacteria 1734
455 Ga0207669_10954729 3300025937 Bacteria 719
456 Ga0207669_11033282 3300025937 Bacteria 692
457 Ga0207704_10014758 3300025938 Bacteria 3957
458 Ga0207704_10051140 3300025938 Bacteria 2497
459 Ga0207704_10345477 3300025938 Bacteria 1157
460 Ga0207665_10177694 3300025939 Unclassified 1540
461 Ga0207665_10874386 3300025939 Bacteria 712
462 Ga0207691_10006739 3300025940 Bacteria 11079
463 Ga0207691_10179255 3300025940 Bacteria 1852
464 Ga0207691_10236784 3300025940 Bacteria 1579
465 Ga0207711_10058797 3300025941 Bacteria 3310
466 Ga0207711_10061107 3300025941 Bacteria 3248
467 Ga0207711_10091361 3300025941 Bacteria 2678
468 Ga0207711_10173149 3300025941 Bacteria 1960
469 Ga0207711_10235233 3300025941 Bacteria 1679
470 Ga0207711_10276388 3300025941 Bacteria 1546
471 Ga0207711_10395187 3300025941 Bacteria 1284
472 Ga0207711_10439082 3300025941 Bacteria 1215
473 Ga0207689_10252532 3300025942 Bacteria 1458
474 Ga0207689_11329310 3300025942 Bacteria 603
475 Ga0207661_10070796 3300025944 Bacteria 2848
476 Ga0207661_10257996 3300025944 Bacteria 1552
477 Ga0207679_10726590 3300025945 Bacteria 902
478 Ga0207667_10153288 3300025949 Bacteria 2371
479 Ga0207667_10223732 3300025949 Bacteria 1928
480 Ga0207651_10032644 3300025960 Bacteria 3348
481 Ga0207651_10125876 3300025960 Bacteria 1952
482 Ga0207651_10201025 3300025960 Bacteria 1597
483 Ga0207651_11104194 3300025960 Bacteria 711
484 Ga0207712_10230146 3300025961 Bacteria 1487
485 Ga0207712_10367789 3300025961 Bacteria 1200
486 Ga0207712_10557187 3300025961 Bacteria 987
487 Ga0207712_10925711 3300025961 Unclassified 771
488 Ga0207712_11331869 3300025961 Bacteria 642
489 Ga0207668_10048499 3300025972 Bacteria 2915
490 Ga0207668_10103988 3300025972 Bacteria 2116
491 Ga0207668_10138957 3300025972 Bacteria 1865
492 Ga0207668_10802287 3300025972 Bacteria 833
493 Ga0207640_10001188 3300025981 Bacteria 14232
494 Ga0207640_10227153 3300025981 Bacteria 1433
495 Ga0207640_10464760 3300025981 Bacteria 1046
496 Ga0207640_11118057 3300025981 Bacteria 698
497 Ga0207658_10128020 3300025986 Bacteria 2035
498 Ga0207658_10468306 3300025986 Bacteria 1118
499 Ga0207658_10523379 3300025986 Bacteria 1059
500 Ga0207658_11997368 3300025986 Bacteria 528
501 Ga0207677_10064418 3300026023 Bacteria 2552
502 Ga0207677_10566580 3300026023 Bacteria 992
503 Ga0207677_10662265 3300026023 Bacteria 922
504 Ga0207677_10918024 3300026023 Bacteria 790
505 Ga0207703_10002624 3300026035 Bacteria 15514
506 Ga0207703_10029922 3300026035 Bacteria 4300
507 Ga0207703_10097354 3300026035 Bacteria 2486
508 Ga0207703_10134493 3300026035 Bacteria 2139
509 Ga0207703_10197156 3300026035 Bacteria 1787
510 Ga0207703_10239089 3300026035 Bacteria 1632
511 Ga0207703_10276754 3300026035 Bacteria 1523
512 Ga0207703_10458705 3300026035 Bacteria 1191
513 Ga0207703_10726025 3300026035 Bacteria 946
514 Ga0207703_11401958 3300026035 Bacteria 672
515 Ga0207708_10002578 3300026075 Bacteria 13332
516 Ga0207708_10044771 3300026075 Bacteria 3372
517 Ga0207708_10390834 3300026075 Bacteria 1148
518 Ga0207708_11716278 3300026075 Bacteria 551
519 Ga0207702_10677971 3300026078 Bacteria 1015
520 Ga0207641_10004435 3300026088 Bacteria 12160
521 Ga0207641_10110474 3300026088 Bacteria 2436
522 Ga0207641_10260364 3300026088 Bacteria 1624
523 Ga0207648_10005685 3300026089 Bacteria 12505
524 Ga0207648_10063653 3300026089 Bacteria 3214
525 Ga0207648_10121491 3300026089 Bacteria 2297
526 Ga0207648_10349250 3300026089 Bacteria 1333
527 Ga0207648_10516643 3300026089 Bacteria 1094
528 Ga0207648_10549128 3300026089 Bacteria 1061
529 Ga0207676_10019586 3300026095 Bacteria 4939
530 Ga0207676_10023481 3300026095 Bacteria 4550
531 Ga0207676_10135496 3300026095 Bacteria 2100
532 Ga0207676_11389700 3300026095 Bacteria 698
533 Ga0207674_10231924 3300026116 Bacteria 1794
534 Ga0207675_100000451 3300026118 Bacteria 39879
535 Ga0207675_100029362 3300026118 Bacteria 5124
536 Ga0207675_100030279 3300026118 Bacteria 5041
537 Ga0207675_100174965 3300026118 Bacteria 2053
538 Ga0207675_100286982 3300026118 Bacteria 1600
539 Ga0207675_100334029 3300026118 Bacteria 1482
540 Ga0207675_100581103 3300026118 Bacteria 1122
541 Ga0207675_100842191 3300026118 Bacteria 932
542 Ga0207675_100914002 3300026118 Bacteria 894
543 Ga0207675_101135246 3300026118 Bacteria 801
544 Ga0207683_10001757 3300026121 Bacteria 19177
545 Ga0207683_10126297 3300026121 Bacteria 2299
546 Ga0207683_10444293 3300026121 Bacteria 1195
547 Ga0207683_10895680 3300026121 Bacteria 824
548 Ga0207698_10172632 3300026142 Bacteria 1906
549 Ga0207698_10373765 3300026142 Bacteria 1354
550 Ga0207698_10468393 3300026142 Bacteria 1220
551 Ga0207428_10015557 3300027907 Bacteria 6576
552 Ga0207428_10031273 3300027907 Bacteria 4395
553 Ga0207428_10070738 3300027907 Unclassified 2742
554 Ga0207428_10199987 3300027907 Bacteria 1504
555 Ga0207428_10489771 3300027907 Bacteria 894
556 Ga0268266_10025873 3300028379 Bacteria 4992
557 Ga0268266_10077843 3300028379 Bacteria 2884
558 Ga0268266_11696563 3300028379 Bacteria 607
559 Ga0268265_10012197 3300028380 Bacteria 5820
560 Ga0268265_10184593 3300028380 Bacteria 1795
561 Ga0268265_10248626 3300028380 Bacteria 1573
562 Ga0268265_10281257 3300028380 Bacteria 1489
563 Ga0268265_10411179 3300028380 Unclassified 1253
564 Ga0268265_10476423 3300028380 Bacteria 1171
565 Ga0268265_10607418 3300028380 Bacteria 1046
566 Ga0268265_11035715 3300028380 Unclassified 812
567 Ga0268265_11903058 3300028380 Bacteria 602
568 Ga0268264_10086663 3300028381 Bacteria 2691
569 Ga0268264_10149895 3300028381 Bacteria 2090
570 Ga0268264_10225904 3300028381 Bacteria 1726
571 Ga0268264_10293032 3300028381 Bacteria 1529
572 Ga0268264_10299177 3300028381 Bacteria 1514
573 Ga0268264_12421262 3300028381 Bacteria 531
574 Ga0307517_10639702 3300028786 Unclassified 519
575 Ga0307408_100026475 3300031548 Unclassified 3985
576 Ga0307408_100131398 3300031548 Bacteria 1954
577 Ga0307408_100651688 3300031548 Bacteria 942
578 Ga0307408_101164310 3300031548 Bacteria 718
579 Ga0307406_10510553 3300031901 Bacteria 976
580 Ga0307409_101477923 3300031995 Bacteria 707
581 Ga0307416_100069257 3300032002 Unclassified 2919
582 Ga0307416_101186008 3300032002 Bacteria 869
583 Ga0307415_101375570 3300032126 Bacteria 671
584 Ga0373930_0000197 3300034816 Bacteria 7354
585 Ga0373948_0000671 3300034817 Bacteria 4436
586 Ga0373948_0137116 3300034817 Unclassified 603
587 Ga0373950_0006138 3300034818 Bacteria 1822
588 Ga0373958_0000928 3300034819 Bacteria 3790
589 Ga0373928_0001040 3300035084 Bacteria 5466
590 Ga0373929_0000912 3300035085 Bacteria 5750
591 Ga0373940_0001928 3300035088 Bacteria 3906
592 Ga0373940_0095610 3300035088 Bacteria 896
593 Ga0373949_0002147 3300035090 Bacteria 5181
594 Ga0373951_0001460 3300035091 Bacteria 6194
595 Ga0373951_0053075 3300035091 Bacteria 1001
596 Ga0373952_0001299 3300035092 Bacteria 4571
597 Ga0373952_0062425 3300035092 Bacteria 914
598 Ga0373952_0121547 3300035092 Bacteria 709
599 Ga0373932_0000603 3300035112 Bacteria 10893
600 Ga0373932_0026038 3300035112 Bacteria 1589
601 Ga0373939_0000156 3300035114 Bacteria 19023
602 Ga0373939_0026819 3300035114 Bacteria 1627
603 Ga0373939_0141696 3300035114 Bacteria 867
604 Ga0373941_0000918 3300035115 Bacteria 6067
605 Ga0373941_0098090 3300035115 Bacteria 1016
606 Ga0373960_0000871 3300035121 Bacteria 6396
607 Ga0373943_0499067 3300035170 Bacteria 711
608 Ga0373946_0025207 3300035171 Bacteria 2338
609 Ga0373955_0268216 3300035172 Bacteria 1026
610 Ga0373942_0000327 3300035207 Bacteria 12950
611 Ga0373961_0001864 3300035241 Bacteria 5749
612 Ga0373961_0217229 3300035241 Bacteria 680
613 Ga0373962_0000316 3300035242 Bacteria 10486
614 Ga0373962_0036646 3300035242 Bacteria 1366
615 Ga0373931_0000411 3300035691 Bacteria 17541
616 Ga0373935_0084313 3300035692 Bacteria 2070
617 Ga0373935_1040702 3300035692 Bacteria 608
618 Ga0373935_1163312 3300035692 Bacteria 575
619 Ga0373927_1132788 3300035695 Bacteria 516
620 Ga0373933_0091157 3300035724 Bacteria 1881
621 Ga0373947_0182955 3300035725 Bacteria 1365
622 Ga0373937_0220411 3300036401 Bacteria 1786
623 Ga0373937_0718228 3300036401 Bacteria 946
624 Ga0373925_0075027 3300037068 Bacteria 2562
625 Ga0395901_0504177 3300038443 Bacteria 1232
626 Ga0439441_030763 3300042001 Bacteria 1039
627 Ga0450917_014417 3300042120 Unclassified 659
628 Ga0439446_0199116 3300042156 Bacteria 676
629 Ga0439435_0006207 3300042436 Bacteria 2676
630 Ga0466963_0095091 3300044694 Bacteria 2033
631 Ga0466957_1202361 3300044842 Bacteria 548
632 Ga0451576_0007440 3300045051 Bacteria 13087
633 Ga0451576_0263969 3300045051 Bacteria 1800
634 Ga0451576_0606941 3300045051 Bacteria 1150
635 Ga0466958_0359118 3300045836 Bacteria 938
636 Ga0466967_0543870 3300045976 Bacteria 1143
637 Ga0495603_0364575 3300046455 Bacteria 829
638 Ga0495603_0590520 3300046455 Bacteria 636
639 Ga0495629_0077571 3300046459 Bacteria 2319
640 Ga0495582_0782047 3300046473 Bacteria 552
641 Ga0495639_0240889 3300046475 Bacteria 893
642 Ga0495639_0382816 3300046475 Viruses 709
643 Ga0495664_0343041 3300046477 Bacteria 900
644 Ga0495585_0505638 3300046492 Unclassified 574
645 Ga0495594_0154950 3300046499 Bacteria 1301
646 Ga0495630_0667599 3300046517 Bacteria 796
647 Ga0495644_0190836 3300046523 Bacteria 789
648 Ga0495642_0118152 3300046528 Unclassified 1137
649 Ga0495642_0221714 3300046528 Bacteria 826
650 Ga0495640_0187527 3300046533 Bacteria 1316
651 Ga0495640_0318978 3300046533 Bacteria 963
652 Ga0495586_0062808 3300046535 Bacteria 2022
653 Ga0495586_0486163 3300046535 Unclassified 712
654 Ga0495586_0877713 3300046535 Bacteria 517
655 Ga0495598_0149672 3300046537 Bacteria 814
656 Ga0495645_0009220 3300046543 Bacteria 6896
657 Ga0495667_0494092 3300046559 Bacteria 767
658 Ga0495659_0152704 3300046664 Bacteria 928
659 Ga0495599_0142469 3300046678 Bacteria 1486
660 Ga0495647_0210237 3300046681 Bacteria 856
661 Ga0495658_0010901 3300046683 Bacteria 4555
662 Ga0495658_0051921 3300046683 Bacteria 2323
663 Ga0495658_0066166 3300046683 Bacteria 2087
664 Ga0495658_0417266 3300046683 Bacteria 856
665 Ga0495613_0179261 3300046689 Bacteria 1501
666 Ga0495581_0245542 3300047315 Bacteria 1047
667 Ga0495604_0233064 3300047317 Bacteria 1262
668 Ga0495674_0102053 3300047319 Bacteria 2440
669 Ga0495674_0862743 3300047319 Bacteria 701
670 Ga0495614_0071388 3300048089 Bacteria 1497
671 Ga0496101_0718460 3300048904 Bacteria 789
672 Ga0496102_0449304 3300048905 Bacteria 1209
673 Ga0496104_0071782 3300048907 Bacteria 3292
674 Ga0496104_0490587 3300048907 Unclassified 1140
675 Ga0496105_0980967 3300048908 Bacteria 633
676 Ga0496106_0082740 3300048909 Bacteria 2468
677 Ga0496107_0086831 3300048910 Bacteria 2284
678 Ga0496108_0013885 3300048911 Bacteria 6569
679 Ga0496108_1034445 3300048911 Bacteria 700
680 Ga0496109_0331595 3300048912 Bacteria 1437
681 Ga0496109_0478411 3300048912 Bacteria 1176
682 Ga0496109_1254857 3300048912 Bacteria 677
683 Ga0496110_0387792 3300048913 Bacteria 1273
684 Ga0496112_0132914 3300048915 Bacteria 2459
685 Ga0496112_0664080 3300048915 Bacteria 971
686 Ga0496112_0807771 3300048915 Bacteria 862
687 Ga0496112_0922023 3300048915 Bacteria 795
688 Ga0496112_1113094 3300048915 Bacteria 708
689 Ga0496112_1287714 3300048915 Bacteria 647
690 Ga0496113_0258531 3300048916 Bacteria 1391
691 Ga0496113_1427210 3300048916 Bacteria 536
692 Ga0496114_0248402 3300048917 Bacteria 1565
693 Ga0496114_0302250 3300048917 Bacteria 1413
694 Ga0496114_0555982 3300048917 Bacteria 1014
695 Ga0496115_0030447 3300048918 Bacteria 4246
696 Ga0501034_0024043 3300049571 Bacteria 6200
697 Ga0501034_0032446 3300049571 Bacteria 5304
698 Ga0501040_0481562 3300049576 Bacteria 894
699 Ga0501046_1115286 3300049580 Unclassified 544
700 Ga0501047_0003294 3300049581 Bacteria 15296
701 Ga0501047_0320923 3300049581 Bacteria 1389
702 Ga0501068_0756121 3300049584 Bacteria 636
703 Ga0501072_0437716 3300049588 Bacteria 1036
704 Ga0501072_1065753 3300049588 Bacteria 629
705 Ga0501073_0251900 3300049589 Bacteria 1219
706 Ga0501074_0421979 3300049590 Bacteria 946
707 Ga0501074_0887304 3300049590 Unclassified 628
708 Ga0501075_0379250 3300049591 Bacteria 1078
709 Ga0501077_0090578 3300049593 Bacteria 1938
710 Ga0501079_0581167 3300049741 Bacteria 881
711 Ga0501083_0050828 3300049744 Bacteria 2789
712 Ga0501083_0175484 3300049744 Bacteria 1400
713 Ga0501044_0001109 3300049823 Bacteria 32036
714 Ga0501045_0603491 3300049824 Bacteria 813
715 nmdc:mga05p37_1098561_c1 3300050507 Bacteria 833
716 nmdc:mga05p37_12328_c1 3300050507 Bacteria 10210
717 nmdc:mga05p37_127926_c1 3300050507 Bacteria 3118
718 nmdc:mga05p37_139483_c1 3300050507 Bacteria 2971
719 nmdc:mga05p37_1473_c1 3300050507 Bacteria 27340
720 nmdc:mga05p37_148359_c1 3300050507 Bacteria 2870
721 nmdc:mga05p37_18016_c1 3300050507 Bacteria 8529
722 nmdc:mga05p37_337156_c1 3300050507 Bacteria 1779
723 nmdc:mga05p37_42400_c1 3300050507 Bacteria 5591
724 nmdc:mga05p37_501628_c1 3300050507 Bacteria 1393
725 nmdc:mga05p37_5255_c1 3300050507 Bacteria 15196
726 nmdc:mga05p37_581889_c1 3300050507 Bacteria 1268
727 nmdc:mga05p37_845717_c1 3300050507 Bacteria 994
728 nmdc:mga09592_186442_c1 3300050508 Bacteria 1795
729 nmdc:mga09592_504154_c1 3300050508 Bacteria 1042
730 nmdc:mga06r32_123034_c1 3300050510 Bacteria 2560
731 nmdc:mga06r32_468211_c1 3300050510 Unclassified 1239
732 nmdc:mga08y16_14973_c1 3300050511 Bacteria 8158
733 nmdc:mga08y16_475137_c1 3300050511 Bacteria 1272
734 nmdc:mga08y16_49080_c1 3300050511 Unclassified 4417
735 nmdc:mga08y16_7975_c1 3300050511 Bacteria 11083
736 nmdc:mga08y16_81323_c1 3300050511 Bacteria 3378
737 nmdc:mga08y16_848893_c1 3300050511 Bacteria 903
738 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
739 nmdc:mga0n895_139634_c1 3300050512 Bacteria 2451
740 nmdc:mga0n895_1584246_c1 3300050512 Bacteria 620
741 nmdc:mga0n895_1672492_c1 3300050512 Bacteria 599
742 nmdc:mga0n895_174990_c1 3300050512 Bacteria 2177
743 nmdc:mga0n895_18942_c1 3300050512 Bacteria 6385
744 nmdc:mga0n895_364433_c1 3300050512 Bacteria 1463
745 nmdc:mga0n895_398263_c1 3300050512 Bacteria 1392
746 nmdc:mga0n895_43027_c1 3300050512 Bacteria 4399
747 nmdc:mga0n895_46753_c1 3300050512 Bacteria 4230
748 nmdc:mga0rr50_1059268_c1 3300050513 Bacteria 690
749 nmdc:mga0rr50_14897_c1 3300050513 Bacteria 5117
750 nmdc:mga0rr50_1767111_c1 3300050513 Bacteria 521
751 nmdc:mga0rr50_209264_c1 3300050513 Bacteria 1606
752 nmdc:mga0rr50_22126_c1 3300050513 Bacteria 4357
753 nmdc:mga0rr50_2410_c1 3300050513 Bacteria 10522
754 nmdc:mga0rr50_53903_c1 3300050513 Bacteria 2993
755 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
756 nmdc:mga0rr50_78330_c1 3300050513 Bacteria 2543
757 nmdc:mga08x19_24370_c1 3300050514 Bacteria 3760
758 nmdc:mga08x19_334398_c1 3300050514 Bacteria 1056
759 nmdc:mga08x19_426_c1 3300050514 Bacteria 28960
760 nmdc:mga08x19_591402_c1 3300050514 Bacteria 786
761 nmdc:mga08x19_730361_c1 3300050514 Bacteria 703
762 nmdc:mga08x19_73455_c1 3300050514 Bacteria 2233
763 nmdc:mga0a205_203407_c1 3300050515 Bacteria 1870
764 nmdc:mga0a205_214917_c2 3300050515 Bacteria 1304
765 nmdc:mga0a205_220980_c1 3300050515 Bacteria 1780
766 nmdc:mga0a205_26219_c1 3300050515 Bacteria 5555
767 nmdc:mga0a205_266019_c1 3300050515 Bacteria 1592
768 nmdc:mga0a205_430608_c1 3300050515 Bacteria 1181
769 nmdc:mga0a205_558287_c1 3300050515 Bacteria 1000
770 nmdc:mga0a205_95453_c1 3300050515 Bacteria 2872
771 Ga0495601_0366385 3300053077 Bacteria 936
772 Ga0495601_0953316 3300053077 Bacteria 541
773 Ga0495595_0030441 3300053084 Bacteria 2422
774 Ga0495595_0378738 3300053084 Bacteria 716
775 Ga0495619_0047509 3300053085 Bacteria 2827
776 Ga0495619_0183476 3300053085 Bacteria 1448
777 Ga0495619_0367100 3300053085 Bacteria 995
778 Ga0587076_169810 3300059645 Bacteria 542
779 Ga0501082_0379579 3300060353 Bacteria 1233
780 Ga0530510_1067028 3300061734 Bacteria 619
781 Ga0373935_0090198
782 Ga0007417J51691_1069732
783 Ga0032354_1077015
784 Ga0058863_11627866
785 Ga0058863_11641791
786 Ga0065712_10099405
787 Ga0065712_10148953
788 Ga0065712_10502582
789 Ga0065712_10647783
790 Ga0065715_10203731
791 Ga0065715_10584043
792 Ga0065707_10125922
793 Ga0065707_10475197
794 Ga0065707_10934785
795 Ga0065707_11117197
796 Ga0070658_10105987
797 Ga0070676_10026110
798 Ga0070683_100484861
799 Ga0070690_100005478
800 Ga0070670_100078032
801 Ga0070670_100103208
802 Ga0070670_100287175
803 Ga0070670_101189208
804 Ga0070677_10169317
805 Ga0068869_100185008
806 Ga0068869_100377156
807 Ga0070666_10010955
808 Ga0070666_10112881
809 Ga0070666_10116839
810 Ga0070666_10762749
811 Ga0070680_100219437
812 Ga0070680_100258188
813 Ga0068868_100309389
814 Ga0068868_100555236
815 Ga0068868_101289496
816 Ga0070660_100030990
817 Ga0070689_100193283
818 Ga0070689_100628675
819 Ga0070689_101232990
820 Ga0070689_102054725
821 Ga0070691_10004127
822 Ga0070687_100066342
823 Ga0070687_100279493
824 Ga0070661_100092664
825 Ga0070661_100209388
826 Ga0070692_10206506
827 Ga0070692_10602438
828 Ga0070668_100110067
829 Ga0070668_100189498
830 Ga0070668_100286435
831 Ga0070668_101870510
832 Ga0070669_100012638
833 Ga0070669_100080973
834 Ga0070669_100148323
835 Ga0070669_101179703
836 Ga0070669_101838395
837 Ga0070675_100115024
838 Ga0070675_100312631
839 Ga0070675_100438101
840 Ga0070671_100013155
841 Ga0070671_100483437
842 Ga0070671_100693534
843 Ga0070674_100018482
844 Ga0070674_100111086
845 Ga0070674_100419570
846 Ga0070674_100477598
847 Ga0070674_100615947
848 Ga0070673_100096207
849 Ga0070673_100189512
850 Ga0070688_100020363
851 Ga0070688_100149540
852 Ga0070688_100473079
853 Ga0070659_100872239
854 Ga0070667_100043407
855 Ga0070667_100174149
856 Ga0070667_100396308
857 Ga0070703_10405367
858 Ga0070713_100088094
859 Ga0070701_10024255
860 Ga0070711_100325521
861 Ga0070705_100026862
862 Ga0070705_100171500
863 Ga0070700_100029372
864 Ga0070700_100162036
865 Ga0070700_100893014
866 Ga0070700_100899430
867 Ga0070694_100055381
868 Ga0070694_100159535
869 Ga0070694_100169154
870 Ga0070694_100896629
871 Ga0070708_100248383
872 Ga0070678_100002975
873 Ga0070678_100253117
874 Ga0070678_100689497
875 Ga0070662_100192563
876 Ga0070662_101632360
877 Ga0070681_10020705
878 Ga0070681_11390559
879 Ga0068867_100008447
880 Ga0068867_100061155
881 Ga0068867_100460025
882 Ga0068867_101398274
883 Ga0068867_101487652
884 Ga0070685_10023992
885 Ga0070706_100464358
886 Ga0070706_101017090
887 Ga0070706_101046653
888 Ga0070707_100277899
889 Ga0070707_100326893
890 Ga0070698_100018301
891 Ga0070698_100389356
892 Ga0070698_100563472
893 Ga0070698_100901259
894 Ga0070699_100667739
895 Ga0070699_101266390
896 Ga0070679_100036059
897 Ga0070679_100089967
898 Ga0070684_100122544
899 Ga0070697_100486524
900 Ga0068853_100777057
901 Ga0070672_100090961
902 Ga0070672_100433310
903 Ga0070672_100723188
904 Ga0070672_100851817
905 Ga0070686_100011506
906 Ga0070686_100212994
907 Ga0070686_100612938
908 Ga0070695_100000811
909 Ga0070695_100070376
910 Ga0070695_101140937
911 Ga0070696_100012980
912 Ga0070696_100037273
913 Ga0070696_100066986
914 Ga0070696_100560608
915 Ga0070696_100611606
916 Ga0070696_101300334
917 Ga0070665_100004603
918 Ga0070665_100046683
919 Ga0070665_100047433
920 Ga0070665_100564386
921 Ga0070704_100019913
922 Ga0068855_100054357
923 Ga0068855_100379686
924 Ga0068855_100601976
925 Ga0068857_100163734
926 Ga0068857_100566793
927 Ga0068857_101542076
928 Ga0068854_100224288
929 Ga0068854_101273198
930 Ga0068856_100392896
931 Ga0070702_100013261
932 Ga0070702_100155650
933 Ga0070702_100600673
934 Ga0068852_100194456
935 Ga0068859_100247943
936 Ga0068859_100296360
937 Ga0068859_100319849
938 Ga0068859_100556920
939 Ga0068859_100594710
940 Ga0068859_100603606
941 Ga0068859_100657301
942 Ga0068859_100747231
943 Ga0068864_100011217
944 Ga0068864_100023489
945 Ga0068864_101470919
946 Ga0068866_10034896
947 Ga0068866_10263446
948 Ga0068866_10321153
949 Ga0068866_11106707
950 Ga0068866_11207907
951 Ga0068861_100037471
952 Ga0068861_100068349
953 Ga0068861_100082599
954 Ga0068861_100091522
955 Ga0068861_100162292
956 Ga0068861_100609478
957 Ga0068861_100671462
958 Ga0068851_10259045
959 Ga0068851_10289211
960 Ga0068870_10058468
961 Ga0068870_10284494
962 Ga0068870_10306930
963 Ga0068863_100003679
964 Ga0068863_100130130
965 Ga0068863_100480188
966 Ga0068858_100002279
967 Ga0068858_100113227
968 Ga0068858_100267862
969 Ga0068858_100286061
970 Ga0068858_100457815
971 Ga0068858_100759839
972 Ga0068858_100815643
973 Ga0068858_101495126
974 Ga0068860_100143590
975 Ga0068860_100594335
976 Ga0068860_100802269
977 Ga0068860_101425720
978 Ga0068860_102299020
979 Ga0068862_100021982
980 Ga0068862_100369613
981 Ga0068862_100402959
982 Ga0068862_100409085
983 Ga0068862_100568595
984 Ga0068862_101493955
985 Ga0081539_10012425
986 Ga0070717_10217092
987 Ga0075432_10360957
988 Ga0070715_10209252
989 Ga0070716_100517680
990 Ga0070712_100306329
991 Ga0070712_100452946
992 Ga0097621_100005974
993 Ga0097621_100017477
994 Ga0097621_100484005
995 Ga0068871_100002816
996 Ga0068871_100633586
997 Ga0068871_100733976
998 Ga0075428_100130865
999 Ga0075428_100870683
1000 Ga0075431_100618975
1001 Ga0075431_100728587
1002 Ga0075433_10035341
1003 Ga0075433_10052348
1004 Ga0075433_10108684
1005 Ga0075433_10221795
1006 Ga0075433_10311557
1007 Ga0075433_10368684
1008 Ga0075433_10838305
1009 Ga0075434_100000100
1010 Ga0075434_100005346
1011 Ga0075434_100077651
1012 Ga0075434_100112795
1013 Ga0075434_100214876
1014 Ga0075434_100587680
1015 Ga0075434_100623900
1016 Ga0075434_101202889
1017 Ga0075434_101909228
1018 Ga0075429_100157812
1019 Ga0075429_100326121
1020 Ga0075429_100391632
1021 Ga0068865_100014135
1022 Ga0068865_100137524
1023 Ga0068865_100600762
1024 Ga0068865_100625805
1025 Ga0068865_101360913
1026 Ga0075436_100000583
1027 Ga0075436_100004798
1028 Ga0075436_100046312
1029 Ga0075436_100055979
1030 Ga0075436_100530574
1031 Ga0097620_100247919
1032 Ga0097620_100296357
1033 Ga0097620_100319835
1034 Ga0097620_100556999
1035 Ga0097620_100594733
1036 Ga0097620_100603624
1037 Ga0097620_100657252
1038 Ga0097620_100747392
1039 Ga0075435_100000192
1040 Ga0075435_100001229
1041 Ga0075435_100003621
1042 Ga0075435_100006467
1043 Ga0075435_100011627
1044 Ga0075435_100032589
1045 Ga0075435_100202652
1046 Ga0075435_100297540
1047 Ga0075435_100344695
1048 Ga0099794_10212637
1049 Ga0099794_10353293
1050 Ga0105251_10235232
1051 Ga0105240_10011023
1052 Ga0105240_10017877
1053 Ga0111539_10001186
1054 Ga0111539_10062811
1055 Ga0111539_10189478
1056 Ga0111539_10192934
1057 Ga0111539_10200443
1058 Ga0105245_10113029
1059 Ga0105245_10202573
1060 Ga0105245_10540397
1061 Ga0105245_10568728
1062 Ga0105245_10777013
1063 Ga0105245_11367375
1064 Ga0105247_10166645
1065 Ga0105247_10666458
1066 Ga0105247_10717318
1067 Ga0114129_10000434
1068 Ga0114129_10000838
1069 Ga0114129_10001577
1070 Ga0114129_10004637
1071 Ga0114129_10009128
1072 Ga0114129_10138930
1073 Ga0114129_10281423
1074 Ga0114129_10290819
1075 Ga0114129_10340441
1076 Ga0114129_10511112
1077 Ga0114129_10513492
1078 Ga0114129_11210296
1079 Ga0114129_11801725
1080 Ga0105243_10047858
1081 Ga0105243_10185370
1082 Ga0105243_10299593
1083 Ga0105243_10641933
1084 Ga0105243_10928515
1085 Ga0105243_10957251
1086 Ga0105243_11331618
1087 Ga0105241_10057534
1088 Ga0105241_10353149
1089 Ga0105241_10440370
1090 Ga0105242_10001523
1091 Ga0105242_10005108
1092 Ga0105242_10206820
1093 Ga0105242_10218553
1094 Ga0105242_10336722
1095 Ga0105242_10719524
1096 Ga0105248_10001706
1097 Ga0105248_10005355
1098 Ga0105248_10067041
1099 Ga0105248_10072200
1100 Ga0105248_10097629
1101 Ga0105248_10149466
1102 Ga0105248_10150303
1103 Ga0105248_11298779
1104 Ga0105248_11785616
1105 Ga0105238_10060920
1106 Ga0105238_10208396
1107 Ga0105238_10876865
1108 Ga0105238_11003168
1109 Ga0105238_11156865
1110 Ga0105249_10024006
1111 Ga0105249_10157217
1112 Ga0105249_10270597
1113 Ga0105249_10434391
1114 Ga0105249_11377882
1115 Ga0105239_10371472
1116 Ga0105246_10114358
1117 Ga0105246_11632592
1118 Ga0157325_1003743
1119 Ga0157316_1018169
1120 Ga0157369_10188677
1121 Ga0157374_10021102
1122 Ga0157374_10903905
1123 Ga0157374_10936401
1124 Ga0157378_10360747
1125 Ga0163162_10539041
1126 Ga0163162_10540876
1127 Ga0163162_10612958
1128 Ga0163162_10808508
1129 Ga0157375_10238154
1130 Ga0157375_10720211
1131 Ga0163163_10019537
1132 Ga0163163_10629251
1133 Ga0163163_12790011
1134 Ga0157380_10100284
1135 Ga0157380_12458166
1136 Ga0157379_10099809
1137 Ga0157379_10146601
1138 Ga0157379_10585310
1139 Ga0157379_10924111
1140 Ga0157376_10018012
1141 Ga0157376_10024132
1142 Ga0157376_10062207
1143 Ga0182005_1020919
1144 Ga0163161_10433132
1145 Ga0163161_11191533
1146 Ga0163161_11556407
1147 Ga0207697_10025957
1148 Ga0207697_10186126
1149 Ga0207697_10324734
1150 Ga0207697_10395538
1151 Ga0207697_10511019
1152 Ga0207656_10183578
1153 Ga0207642_10008235
1154 Ga0207642_10027072
1155 Ga0207642_10141636
1156 Ga0207642_10849788
1157 Ga0207710_10063002
1158 Ga0207710_10068876
1159 Ga0207688_10414027
1160 Ga0207680_10021562
1161 Ga0207680_10039576
1162 Ga0207680_10199371
1163 Ga0207680_10412975
1164 Ga0207699_10047010
1165 Ga0207645_10002699
1166 Ga0207645_10050836
1167 Ga0207645_10329480
1168 Ga0207643_10191752
1169 Ga0207684_10231053
1170 Ga0207684_10260324
1171 Ga0207684_10408315
1172 Ga0207684_10485441
1173 Ga0207654_10103753
1174 Ga0207707_10025126
1175 Ga0207707_10646259
1176 Ga0207707_11080178
1177 Ga0207695_10026588
1178 Ga0207695_10065699
1179 Ga0207693_10374807
1180 Ga0207663_10301245
1181 Ga0207663_11380964
1182 Ga0207660_10329460
1183 Ga0207662_10009277
1184 Ga0207662_10409178
1185 Ga0207662_10659192
1186 Ga0207657_10013584
1187 Ga0207657_10828560
1188 Ga0207649_10188715
1189 Ga0207649_10409165
1190 Ga0207652_10027474
1191 Ga0207652_10199356
1192 Ga0207652_10742810
1193 Ga0207646_10265152
1194 Ga0207646_10484855
1195 Ga0207646_10830131
1196 Ga0207646_10858513
1197 Ga0207681_10004545
1198 Ga0207681_10045791
1199 Ga0207681_10223407
1200 Ga0207681_10258259
1201 Ga0207681_10266712
1202 Ga0207681_10633790
1203 Ga0207681_10826399
1204 Ga0207694_10223472
1205 Ga0207694_10426685
1206 Ga0207694_10729893
1207 Ga0207694_10890542
1208 Ga0207650_10166041
1209 Ga0207650_10464443
1210 Ga0207650_10468169
1211 Ga0207650_10881073
1212 Ga0207659_10127983
1213 Ga0207687_10030764
1214 Ga0207687_10240620
1215 Ga0207687_10383858
1216 Ga0207700_10677137
1217 Ga0207664_10021735
1218 Ga0207644_10021420
1219 Ga0207644_10379793
1220 Ga0207706_10016955
1221 Ga0207706_10133429
1222 Ga0207706_10260815
1223 Ga0207706_11095839
1224 Ga0207686_10003296
1225 Ga0207686_10006807
1226 Ga0207686_10261188
1227 Ga0207686_10391183
1228 Ga0207686_11377365
1229 Ga0207709_10017518
1230 Ga0207670_10086152
1231 Ga0207670_10985585
1232 Ga0207670_11249861
1233 Ga0207669_10013589
1234 Ga0207669_10128825
1235 Ga0207669_10954729
1236 Ga0207669_11033282
1237 Ga0207704_10014758
1238 Ga0207704_10051140
1239 Ga0207704_10345477
1240 Ga0207665_10177694
1241 Ga0207665_10874386
1242 Ga0207691_10006739
1243 Ga0207691_10179255
1244 Ga0207691_10236784
1245 Ga0207711_10058797
1246 Ga0207711_10061107
1247 Ga0207711_10091361
1248 Ga0207711_10173149
1249 Ga0207711_10235233
1250 Ga0207711_10276388
1251 Ga0207711_10395187
1252 Ga0207711_10439082
1253 Ga0207689_10252532
1254 Ga0207689_11329310
1255 Ga0207661_10070796
1256 Ga0207661_10257996
1257 Ga0207679_10726590
1258 Ga0207667_10153288
1259 Ga0207667_10223732
1260 Ga0207651_10032644
1261 Ga0207651_10125876
1262 Ga0207651_10201025
1263 Ga0207651_11104194
1264 Ga0207712_10230146
1265 Ga0207712_10367789
1266 Ga0207712_10557187
1267 Ga0207712_10925711
1268 Ga0207712_11331869
1269 Ga0207668_10048499
1270 Ga0207668_10103988
1271 Ga0207668_10138957
1272 Ga0207668_10802287
1273 Ga0207640_10001188
1274 Ga0207640_10227153
1275 Ga0207640_10464760
1276 Ga0207640_11118057
1277 Ga0207658_10128020
1278 Ga0207658_10468306
1279 Ga0207658_10523379
1280 Ga0207658_11997368
1281 Ga0207677_10064418
1282 Ga0207677_10566580
1283 Ga0207677_10662265
1284 Ga0207677_10918024
1285 Ga0207703_10002624
1286 Ga0207703_10029922
1287 Ga0207703_10097354
1288 Ga0207703_10134493
1289 Ga0207703_10197156
1290 Ga0207703_10239089
1291 Ga0207703_10276754
1292 Ga0207703_10458705
1293 Ga0207703_10726025
1294 Ga0207703_11401958
1295 Ga0207708_10002578
1296 Ga0207708_10044771
1297 Ga0207708_10390834
1298 Ga0207708_11716278
1299 Ga0207702_10677971
1300 Ga0207641_10004435
1301 Ga0207641_10110474
1302 Ga0207641_10260364
1303 Ga0207648_10005685
1304 Ga0207648_10063653
1305 Ga0207648_10121491
1306 Ga0207648_10349250
1307 Ga0207648_10516643
1308 Ga0207648_10549128
1309 Ga0207676_10019586
1310 Ga0207676_10023481
1311 Ga0207676_10135496
1312 Ga0207676_11389700
1313 Ga0207674_10231924
1314 Ga0207675_100000451
1315 Ga0207675_100029362
1316 Ga0207675_100030279
1317 Ga0207675_100174965
1318 Ga0207675_100286982
1319 Ga0207675_100334029
1320 Ga0207675_100581103
1321 Ga0207675_100842191
1322 Ga0207675_100914002
1323 Ga0207675_101135246
1324 Ga0207683_10001757
1325 Ga0207683_10126297
1326 Ga0207683_10444293
1327 Ga0207683_10895680
1328 Ga0207698_10172632
1329 Ga0207698_10373765
1330 Ga0207698_10468393
1331 Ga0207428_10015557
1332 Ga0207428_10031273
1333 Ga0207428_10070738
1334 Ga0207428_10199987
1335 Ga0207428_10489771
1336 Ga0268266_10025873
1337 Ga0268266_10077843
1338 Ga0268266_11696563
1339 Ga0268265_10012197
1340 Ga0268265_10184593
1341 Ga0268265_10248626
1342 Ga0268265_10281257
1343 Ga0268265_10411179
1344 Ga0268265_10476423
1345 Ga0268265_10607418
1346 Ga0268265_11035715
1347 Ga0268265_11903058
1348 Ga0268264_10086663
1349 Ga0268264_10149895
1350 Ga0268264_10225904
1351 Ga0268264_10293032
1352 Ga0268264_10299177
1353 Ga0268264_12421262
1354 Ga0307517_10639702
1355 Ga0307408_100026475
1356 Ga0307408_100131398
1357 Ga0307408_100651688
1358 Ga0307408_101164310
1359 Ga0307406_10510553
1360 Ga0307409_101477923
1361 Ga0307416_100069257
1362 Ga0307416_101186008
1363 Ga0307415_101375570
1364 Ga0373930_0000197
1365 Ga0373948_0000671
1366 Ga0373948_0137116
1367 Ga0373950_0006138
1368 Ga0373958_0000928
1369 Ga0373928_0001040
1370 Ga0373929_0000912
1371 Ga0373940_0001928
1372 Ga0373940_0095610
1373 Ga0373949_0002147
1374 Ga0373951_0001460
1375 Ga0373951_0053075
1376 Ga0373952_0001299
1377 Ga0373952_0062425
1378 Ga0373952_0121547
1379 Ga0373932_0000603
1380 Ga0373932_0026038
1381 Ga0373939_0000156
1382 Ga0373939_0026819
1383 Ga0373939_0141696
1384 Ga0373941_0000918
1385 Ga0373941_0098090
1386 Ga0373960_0000871
1387 Ga0373943_0499067
1388 Ga0373946_0025207
1389 Ga0373955_0268216
1390 Ga0373942_0000327
1391 Ga0373961_0001864
1392 Ga0373961_0217229
1393 Ga0373962_0000316
1394 Ga0373962_0036646
1395 Ga0373931_0000411
1396 Ga0373935_0084313
1397 Ga0373935_1040702
1398 Ga0373935_1163312
1399 Ga0373927_1132788
1400 Ga0373933_0091157
1401 Ga0373947_0182955
1402 Ga0373937_0220411
1403 Ga0373937_0718228
1404 Ga0373925_0075027
1405 Ga0395901_0504177
1406 Ga0439441_030763
1407 Ga0450917_014417
1408 Ga0439446_0199116
1409 Ga0439435_0006207
1410 Ga0466963_0095091
1411 Ga0466957_1202361
1412 Ga0451576_0007440
1413 Ga0451576_0263969
1414 Ga0451576_0606941
1415 Ga0466958_0359118
1416 Ga0466967_0543870
1417 Ga0495603_0364575
1418 Ga0495603_0590520
1419 Ga0495629_0077571
1420 Ga0495582_0782047
1421 Ga0495639_0240889
1422 Ga0495639_0382816
1423 Ga0495664_0343041
1424 Ga0495585_0505638
1425 Ga0495594_0154950
1426 Ga0495630_0667599
1427 Ga0495644_0190836
1428 Ga0495642_0118152
1429 Ga0495642_0221714
1430 Ga0495640_0187527
1431 Ga0495640_0318978
1432 Ga0495586_0062808
1433 Ga0495586_0486163
1434 Ga0495586_0877713
1435 Ga0495598_0149672
1436 Ga0495645_0009220
1437 Ga0495667_0494092
1438 Ga0495659_0152704
1439 Ga0495599_0142469
1440 Ga0495647_0210237
1441 Ga0495658_0010901
1442 Ga0495658_0051921
1443 Ga0495658_0066166
1444 Ga0495658_0417266
1445 Ga0495613_0179261
1446 Ga0495581_0245542
1447 Ga0495604_0233064
1448 Ga0495674_0102053
1449 Ga0495674_0862743
1450 Ga0495614_0071388
1451 Ga0496101_0718460
1452 Ga0496102_0449304
1453 Ga0496104_0071782
1454 Ga0496104_0490587
1455 Ga0496105_0980967
1456 Ga0496106_0082740
1457 Ga0496107_0086831
1458 Ga0496108_0013885
1459 Ga0496108_1034445
1460 Ga0496109_0331595
1461 Ga0496109_0478411
1462 Ga0496109_1254857
1463 Ga0496110_0387792
1464 Ga0496112_0132914
1465 Ga0496112_0664080
1466 Ga0496112_0807771
1467 Ga0496112_0922023
1468 Ga0496112_1113094
1469 Ga0496112_1287714
1470 Ga0496113_0258531
1471 Ga0496113_1427210
1472 Ga0496114_0248402
1473 Ga0496114_0302250
1474 Ga0496114_0555982
1475 Ga0496115_0030447
1476 Ga0501034_0024043
1477 Ga0501034_0032446
1478 Ga0501040_0481562
1479 Ga0501046_1115286
1480 Ga0501047_0003294
1481 Ga0501047_0320923
1482 Ga0501068_0756121
1483 Ga0501072_0437716
1484 Ga0501072_1065753
1485 Ga0501073_0251900
1486 Ga0501074_0421979
1487 Ga0501074_0887304
1488 Ga0501075_0379250
1489 Ga0501077_0090578
1490 Ga0501079_0581167
1491 Ga0501083_0050828
1492 Ga0501083_0175484
1493 Ga0501044_0001109
1494 Ga0501045_0603491
1495 nmdc:mga05p37_1098561_c1
1496 nmdc:mga05p37_12328_c1
1497 nmdc:mga05p37_127926_c1
1498 nmdc:mga05p37_139483_c1
1499 nmdc:mga05p37_1473_c1
1500 nmdc:mga05p37_148359_c1
1501 nmdc:mga05p37_18016_c1
1502 nmdc:mga05p37_337156_c1
1503 nmdc:mga05p37_42400_c1
1504 nmdc:mga05p37_501628_c1
1505 nmdc:mga05p37_5255_c1
1506 nmdc:mga05p37_581889_c1
1507 nmdc:mga05p37_845717_c1
1508 nmdc:mga09592_186442_c1
1509 nmdc:mga09592_504154_c1
1510 nmdc:mga06r32_123034_c1
1511 nmdc:mga06r32_468211_c1
1512 nmdc:mga08y16_14973_c1
1513 nmdc:mga08y16_475137_c1
1514 nmdc:mga08y16_49080_c1
1515 nmdc:mga08y16_7975_c1
1516 nmdc:mga08y16_81323_c1
1517 nmdc:mga08y16_848893_c1
1518 nmdc:mga0n895_111_c1
1519 nmdc:mga0n895_139634_c1
1520 nmdc:mga0n895_1584246_c1
1521 nmdc:mga0n895_1672492_c1
1522 nmdc:mga0n895_174990_c1
1523 nmdc:mga0n895_18942_c1
1524 nmdc:mga0n895_364433_c1
1525 nmdc:mga0n895_398263_c1
1526 nmdc:mga0n895_43027_c1
1527 nmdc:mga0n895_46753_c1
1528 nmdc:mga0rr50_1059268_c1
1529 nmdc:mga0rr50_14897_c1
1530 nmdc:mga0rr50_1767111_c1
1531 nmdc:mga0rr50_209264_c1
1532 nmdc:mga0rr50_22126_c1
1533 nmdc:mga0rr50_2410_c1
1534 nmdc:mga0rr50_53903_c1
1535 nmdc:mga0rr50_57_c1
1536 nmdc:mga0rr50_78330_c1
1537 nmdc:mga08x19_24370_c1
1538 nmdc:mga08x19_334398_c1
1539 nmdc:mga08x19_426_c1
1540 nmdc:mga08x19_591402_c1
1541 nmdc:mga08x19_730361_c1
1542 nmdc:mga08x19_73455_c1
1543 nmdc:mga0a205_203407_c1
1544 nmdc:mga0a205_214917_c2
1545 nmdc:mga0a205_220980_c1
1546 nmdc:mga0a205_26219_c1
1547 nmdc:mga0a205_266019_c1
1548 nmdc:mga0a205_430608_c1
1549 nmdc:mga0a205_558287_c1
1550 nmdc:mga0a205_95453_c1
1551 Ga0495601_0366385
1552 Ga0495601_0953316
1553 Ga0495595_0030441
1554 Ga0495595_0378738
1555 Ga0495619_0047509
1556 Ga0495619_0183476
1557 Ga0495619_0367100
1558 Ga0587076_169810
1559 Ga0501082_0379579
1560 Ga0530510_1067028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

32

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9499 12 128
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9443 11 129
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9439 12 128
3n53-assembly3.cif.gz_B crystal structure of a response regulator receiver modulated diguanylate cyclase from pelobacter carbinolicus 0.9404 11 128
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.939 11 129
ID Description Score Start End Superfamily
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9439 12 128 3.40.50.2300
3n53B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9399 11 128 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9355 9 128 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9345 10 91 3.40.50.2300
2v0nA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9256 10 128 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5C0ARP4-F1-model_v4 Response regulator transcription factor 0.9679 10 128 GO:0000156
GO:0000976
GO:0003700
GO:0005829
GO:0032993
AF-A0A382V3P2-F1-model_v4 Response regulatory domain-containing protein 0.9617 10 128 GO:0000160
AF-A0A838R9U2-F1-model_v4 Response regulator 0.9583 11 128 GO:0000160
AF-A0A661J3K5-F1-model_v4 Type II secretion system protein GspE 0.958 10 128 GO:0000160
GO:0005524
GO:0005886
GO:0016887
AF-A0A7C3B7I2-F1-model_v4 Response regulator 0.9578 10 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map