F480523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 267 | 1560 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10122100|Ga0265314_101221002 |
| Length | 327 |
| Sequence | VRMSRRFNPGIRRGNYSLHESAGYHQIAAMTSTSKHVRRPTLACEIAADRVLAGRAADTGRMVEMAAARELAPGSVVPDLMEANLRDGVAIRQAIESALGSVGGRSRDVIAILPDTAVRVVLLDFETLPAKREEAEAVVRFRLKKSLPFDPNDARISYHAQPAGKGVRAVAAVVLNTVLEEYESAFRDAGYNPGLVMPSMLAALGAADAERPTLVVKVDARTISIAILDQEQLLLFRTLENLRGVTITGDQLAEEVYPSVVFFQDTYKLNIERVYVAGLPEAGGAAPALKNQSGAVVEELVATSQIGSTTGTVPRWRMAGVVGALIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 176 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 258 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 262 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 1.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 94.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265314_10122100 | 3300031711 | Unclassified | 1638 |
| 2 | JGI24752J21851_1000390 | 3300001976 | Bacteria | 6060 |
| 3 | JGI24034J26672_10000129 | 3300002239 | Bacteria | 11394 |
| 4 | JGI24751J29686_10001442 | 3300002459 | Bacteria | 4980 |
| 5 | rootH1_10241910 | 3300003323 | Bacteria | 1881 |
| 6 | Ga0065715_10089775 | 3300005293 | Bacteria | 8553 |
| 7 | Ga0070676_10007708 | 3300005328 | Bacteria | 5780 |
| 8 | Ga0070683_100000874 | 3300005329 | Bacteria | 22347 |
| 9 | Ga0070683_100034849 | 3300005329 | Unclassified | 4600 |
| 10 | Ga0070683_100060879 | 3300005329 | Unclassified | 3509 |
| 11 | Ga0070683_100093742 | 3300005329 | Bacteria | 2822 |
| 12 | Ga0070683_100248456 | 3300005329 | Bacteria | 1692 |
| 13 | Ga0070690_100067121 | 3300005330 | Bacteria | 2323 |
| 14 | Ga0070690_100159133 | 3300005330 | Bacteria | 1546 |
| 15 | Ga0070670_100003741 | 3300005331 | Bacteria | 12667 |
| 16 | Ga0070670_100026465 | 3300005331 | Bacteria | 4990 |
| 17 | Ga0070670_100226376 | 3300005331 | Bacteria | 1627 |
| 18 | Ga0068869_100001259 | 3300005334 | Bacteria | 14960 |
| 19 | Ga0068869_100305291 | 3300005334 | Unclassified | 1286 |
| 20 | Ga0070666_10014887 | 3300005335 | Unclassified | 4956 |
| 21 | Ga0070680_100038523 | 3300005336 | Bacteria | 3866 |
| 22 | Ga0070680_100049796 | 3300005336 | Unclassified | 3416 |
| 23 | Ga0070680_100058460 | 3300005336 | Bacteria | 3153 |
| 24 | Ga0070680_100090745 | 3300005336 | Bacteria | 2529 |
| 25 | Ga0068868_100002212 | 3300005338 | Bacteria | 13438 |
| 26 | Ga0068868_100005870 | 3300005338 | Bacteria | 8658 |
| 27 | Ga0068868_100025275 | 3300005338 | Bacteria | 4515 |
| 28 | Ga0068868_100031146 | 3300005338 | Bacteria | 4095 |
| 29 | Ga0068868_100064402 | 3300005338 | Unclassified | 2910 |
| 30 | Ga0068868_100103234 | 3300005338 | Bacteria | 2309 |
| 31 | Ga0070660_100018106 | 3300005339 | Bacteria | 5140 |
| 32 | Ga0070660_100103711 | 3300005339 | Bacteria | 2255 |
| 33 | Ga0070689_100019148 | 3300005340 | Bacteria | 5057 |
| 34 | Ga0070689_100056271 | 3300005340 | Bacteria | 3049 |
| 35 | Ga0070661_100025625 | 3300005344 | Bacteria | 4240 |
| 36 | Ga0070661_100039504 | 3300005344 | Bacteria | 3438 |
| 37 | Ga0070668_100005837 | 3300005347 | Bacteria | 9127 |
| 38 | Ga0070669_100009592 | 3300005353 | Bacteria | 6892 |
| 39 | Ga0070669_100432344 | 3300005353 | Unclassified | 1082 |
| 40 | Ga0070675_100083912 | 3300005354 | Bacteria | 2660 |
| 41 | Ga0070675_100242713 | 3300005354 | Bacteria | 1574 |
| 42 | Ga0070671_100040265 | 3300005355 | Bacteria | 3881 |
| 43 | Ga0070671_100090334 | 3300005355 | Archaea | 2564 |
| 44 | Ga0070671_100130936 | 3300005355 | Unclassified | 2113 |
| 45 | Ga0070673_100013626 | 3300005364 | Bacteria | 5632 |
| 46 | Ga0070673_100054833 | 3300005364 | Bacteria | 3138 |
| 47 | Ga0070688_100003095 | 3300005365 | Bacteria | 8503 |
| 48 | Ga0070659_100009927 | 3300005366 | Bacteria | 7001 |
| 49 | Ga0070659_100105820 | 3300005366 | Bacteria | 2267 |
| 50 | Ga0070659_100131464 | 3300005366 | Bacteria | 2033 |
| 51 | Ga0070667_100007683 | 3300005367 | Bacteria | 8943 |
| 52 | Ga0070709_10010147 | 3300005434 | Bacteria | 5207 |
| 53 | Ga0070709_10020841 | 3300005434 | Bacteria | 3812 |
| 54 | Ga0070709_10083051 | 3300005434 | Bacteria | 2095 |
| 55 | Ga0070709_10092779 | 3300005434 | Unclassified | 1995 |
| 56 | Ga0070709_10114906 | 3300005434 | Bacteria | 1815 |
| 57 | Ga0070709_10222938 | 3300005434 | Unclassified | 1345 |
| 58 | Ga0070709_10263946 | 3300005434 | Unclassified | 1245 |
| 59 | Ga0070709_10336952 | 3300005434 | Unclassified | 1111 |
| 60 | Ga0070714_100006206 | 3300005435 | Bacteria | 9194 |
| 61 | Ga0070714_100007756 | 3300005435 | Bacteria | 8364 |
| 62 | Ga0070714_100094857 | 3300005435 | Unclassified | 2619 |
| 63 | Ga0070714_100125332 | 3300005435 | Bacteria | 2289 |
| 64 | Ga0070714_100158612 | 3300005435 | Bacteria | 2045 |
| 65 | Ga0070714_100210640 | 3300005435 | Bacteria | 1781 |
| 66 | Ga0070714_100237689 | 3300005435 | Bacteria | 1681 |
| 67 | Ga0070713_100000520 | 3300005436 | Bacteria | 24388 |
| 68 | Ga0070713_100001539 | 3300005436 | Bacteria | 14725 |
| 69 | Ga0070713_100003494 | 3300005436 | Bacteria | 10370 |
| 70 | Ga0070713_100016785 | 3300005436 | Bacteria | 5514 |
| 71 | Ga0070713_100045274 | 3300005436 | Unclassified | 3604 |
| 72 | Ga0070713_100059275 | 3300005436 | Bacteria | 3196 |
| 73 | Ga0070713_100068251 | 3300005436 | Bacteria | 2996 |
| 74 | Ga0070713_100078235 | 3300005436 | Bacteria | 2815 |
| 75 | Ga0070713_100085090 | 3300005436 | Unclassified | 2708 |
| 76 | Ga0070713_100089550 | 3300005436 | Unclassified | 2643 |
| 77 | Ga0070713_100113642 | 3300005436 | Bacteria | 2364 |
| 78 | Ga0070713_100194349 | 3300005436 | Unclassified | 1830 |
| 79 | Ga0070713_100308887 | 3300005436 | Unclassified | 1458 |
| 80 | Ga0070710_10002794 | 3300005437 | Bacteria | 8319 |
| 81 | Ga0070710_10031978 | 3300005437 | Bacteria | 2846 |
| 82 | Ga0070710_10033231 | 3300005437 | Bacteria | 2800 |
| 83 | Ga0070710_10291422 | 3300005437 | Unclassified | 1062 |
| 84 | Ga0070711_100000560 | 3300005439 | Bacteria | 19430 |
| 85 | Ga0070711_100001162 | 3300005439 | Bacteria | 14174 |
| 86 | Ga0070711_100034950 | 3300005439 | Bacteria | 3356 |
| 87 | Ga0070711_100077972 | 3300005439 | Bacteria | 2353 |
| 88 | Ga0070711_100285549 | 3300005439 | Bacteria | 1307 |
| 89 | Ga0070711_100444786 | 3300005439 | Bacteria | 1060 |
| 90 | Ga0070700_100158923 | 3300005441 | Unclassified | 1554 |
| 91 | Ga0070708_100000527 | 3300005445 | Bacteria | 28842 |
| 92 | Ga0070708_100001360 | 3300005445 | Bacteria | 18636 |
| 93 | Ga0070708_100007787 | 3300005445 | Bacteria | 8586 |
| 94 | Ga0070708_100016031 | 3300005445 | Bacteria | 6207 |
| 95 | Ga0070708_100021654 | 3300005445 | Bacteria | 5439 |
| 96 | Ga0070708_100025395 | 3300005445 | Bacteria | 5064 |
| 97 | Ga0070708_100028671 | 3300005445 | Bacteria | 4794 |
| 98 | Ga0070663_100000458 | 3300005455 | Bacteria | 21626 |
| 99 | Ga0070678_100174950 | 3300005456 | Bacteria | 1752 |
| 100 | Ga0070678_100268194 | 3300005456 | Unclassified | 1439 |
| 101 | Ga0070678_100279117 | 3300005456 | Unclassified | 1412 |
| 102 | Ga0070662_100395149 | 3300005457 | Unclassified | 1140 |
| 103 | Ga0070681_10000026 | 3300005458 | Bacteria | 107615 |
| 104 | Ga0070681_10043896 | 3300005458 | Bacteria | 4475 |
| 105 | Ga0070681_10079554 | 3300005458 | Bacteria | 3235 |
| 106 | Ga0070681_10121877 | 3300005458 | Bacteria | 2541 |
| 107 | Ga0070681_10511113 | 3300005458 | Unclassified | 1114 |
| 108 | Ga0068867_100004366 | 3300005459 | Bacteria | 9954 |
| 109 | Ga0068867_100014627 | 3300005459 | Bacteria | 5561 |
| 110 | Ga0068867_100023296 | 3300005459 | Bacteria | 4433 |
| 111 | Ga0068867_100049359 | 3300005459 | Bacteria | 3098 |
| 112 | Ga0068867_100446887 | 3300005459 | Unclassified | 1100 |
| 113 | Ga0070685_10000811 | 3300005466 | Bacteria | 16975 |
| 114 | Ga0070706_100000991 | 3300005467 | Bacteria | 30868 |
| 115 | Ga0070706_100005854 | 3300005467 | Bacteria | 11663 |
| 116 | Ga0070706_100014724 | 3300005467 | Bacteria | 7226 |
| 117 | Ga0070706_100015879 | 3300005467 | Bacteria | 6952 |
| 118 | Ga0070706_100135520 | 3300005467 | Bacteria | 2298 |
| 119 | Ga0070707_100001774 | 3300005468 | Bacteria | 20733 |
| 120 | Ga0070707_100007949 | 3300005468 | Bacteria | 9848 |
| 121 | Ga0070707_100027902 | 3300005468 | Bacteria | 5370 |
| 122 | Ga0070707_100052624 | 3300005468 | Bacteria | 3904 |
| 123 | Ga0070707_100087850 | 3300005468 | Unclassified | 3007 |
| 124 | Ga0070707_100258819 | 3300005468 | Unclassified | 1693 |
| 125 | Ga0070707_100548184 | 3300005468 | Unclassified | 1119 |
| 126 | Ga0070698_100000182 | 3300005471 | Bacteria | 59279 |
| 127 | Ga0070698_100004474 | 3300005471 | Bacteria | 15363 |
| 128 | Ga0070698_100037802 | 3300005471 | Bacteria | 4977 |
| 129 | Ga0070699_100017051 | 3300005518 | Bacteria | 6238 |
| 130 | Ga0070699_100019075 | 3300005518 | Bacteria | 5899 |
| 131 | Ga0070699_100078263 | 3300005518 | Bacteria | 2880 |
| 132 | Ga0070699_100103823 | 3300005518 | Bacteria | 2492 |
| 133 | Ga0070699_100143052 | 3300005518 | Bacteria | 2113 |
| 134 | Ga0070699_100170584 | 3300005518 | Unclassified | 1928 |
| 135 | Ga0070679_100096586 | 3300005530 | Unclassified | 2942 |
| 136 | Ga0070679_100446243 | 3300005530 | Unclassified | 1238 |
| 137 | Ga0070684_100003033 | 3300005535 | Bacteria | 12524 |
| 138 | Ga0070684_100003393 | 3300005535 | Bacteria | 11950 |
| 139 | Ga0070684_100013112 | 3300005535 | Bacteria | 6672 |
| 140 | Ga0070684_100140568 | 3300005535 | Bacteria | 2183 |
| 141 | Ga0070697_100000145 | 3300005536 | Bacteria | 57445 |
| 142 | Ga0070697_100000271 | 3300005536 | Bacteria | 42185 |
| 143 | Ga0070697_100002886 | 3300005536 | Bacteria | 13220 |
| 144 | Ga0070697_100005158 | 3300005536 | Bacteria | 10034 |
| 145 | Ga0070697_100007316 | 3300005536 | Bacteria | 8588 |
| 146 | Ga0070697_100007687 | 3300005536 | Bacteria | 8395 |
| 147 | Ga0070697_100024053 | 3300005536 | Bacteria | 4849 |
| 148 | Ga0070697_100033556 | 3300005536 | Bacteria | 4134 |
| 149 | Ga0070697_100044316 | 3300005536 | Bacteria | 3602 |
| 150 | Ga0068853_100046299 | 3300005539 | Bacteria | 3729 |
| 151 | Ga0068853_100053559 | 3300005539 | Unclassified | 3474 |
| 152 | Ga0068853_100312095 | 3300005539 | Bacteria | 1456 |
| 153 | Ga0070672_100001128 | 3300005543 | Bacteria | 16316 |
| 154 | Ga0070686_100002550 | 3300005544 | Bacteria | 10038 |
| 155 | Ga0070686_100054073 | 3300005544 | Unclassified | 2567 |
| 156 | Ga0070695_100003833 | 3300005545 | Bacteria | 8773 |
| 157 | Ga0070695_100127534 | 3300005545 | Bacteria | 1749 |
| 158 | Ga0070693_100051037 | 3300005547 | Bacteria | 2367 |
| 159 | Ga0070693_100058767 | 3300005547 | Bacteria | 2227 |
| 160 | Ga0070693_100060882 | 3300005547 | Bacteria | 2193 |
| 161 | Ga0070665_100064783 | 3300005548 | Bacteria | 3666 |
| 162 | Ga0070665_100138639 | 3300005548 | Bacteria | 2436 |
| 163 | Ga0068855_100000295 | 3300005563 | Bacteria | 61909 |
| 164 | Ga0068855_100001199 | 3300005563 | Bacteria | 32207 |
| 165 | Ga0068855_100020709 | 3300005563 | Bacteria | 7887 |
| 166 | Ga0068855_100046866 | 3300005563 | Bacteria | 5108 |
| 167 | Ga0068855_100073906 | 3300005563 | Bacteria | 3960 |
| 168 | Ga0068855_100096201 | 3300005563 | Bacteria | 3412 |
| 169 | Ga0068855_100159434 | 3300005563 | Bacteria | 2562 |
| 170 | Ga0068855_100403741 | 3300005563 | Bacteria | 1497 |
| 171 | Ga0070664_100003800 | 3300005564 | Bacteria | 12190 |
| 172 | Ga0070664_100006609 | 3300005564 | Bacteria | 9348 |
| 173 | Ga0070664_100027366 | 3300005564 | Bacteria | 4738 |
| 174 | Ga0070664_100088228 | 3300005564 | Unclassified | 2682 |
| 175 | Ga0070664_100288390 | 3300005564 | Unclassified | 1481 |
| 176 | Ga0070664_100585976 | 3300005564 | Unclassified | 1034 |
| 177 | Ga0068857_100000484 | 3300005577 | Bacteria | 28421 |
| 178 | Ga0068857_100024639 | 3300005577 | Bacteria | 5299 |
| 179 | Ga0068857_100036232 | 3300005577 | Bacteria | 4372 |
| 180 | Ga0068857_100038182 | 3300005577 | Bacteria | 4253 |
| 181 | Ga0068857_100216392 | 3300005577 | Bacteria | 1749 |
| 182 | Ga0068854_100004252 | 3300005578 | Bacteria | 9015 |
| 183 | Ga0068854_100011793 | 3300005578 | Bacteria | 5706 |
| 184 | Ga0068854_100015375 | 3300005578 | Bacteria | 5068 |
| 185 | Ga0068854_100026498 | 3300005578 | Bacteria | 3985 |
| 186 | Ga0068854_100068332 | 3300005578 | Bacteria | 2591 |
| 187 | Ga0068854_100111747 | 3300005578 | Unclassified | 2062 |
| 188 | Ga0068854_100165163 | 3300005578 | Unclassified | 1718 |
| 189 | Ga0068854_100544504 | 3300005578 | Bacteria | 983 |
| 190 | Ga0068856_100000574 | 3300005614 | Bacteria | 40092 |
| 191 | Ga0068856_100001473 | 3300005614 | Bacteria | 24654 |
| 192 | Ga0068856_100001552 | 3300005614 | Bacteria | 24044 |
| 193 | Ga0068856_100002096 | 3300005614 | Bacteria | 20678 |
| 194 | Ga0068856_100002636 | 3300005614 | Bacteria | 18418 |
| 195 | Ga0068856_100012186 | 3300005614 | Bacteria | 8331 |
| 196 | Ga0068856_100018702 | 3300005614 | Bacteria | 6715 |
| 197 | Ga0068856_100043593 | 3300005614 | Bacteria | 4414 |
| 198 | Ga0068856_100067880 | 3300005614 | Bacteria | 3524 |
| 199 | Ga0068856_100266142 | 3300005614 | Bacteria | 1730 |
| 200 | Ga0068852_100035645 | 3300005616 | Bacteria | 4153 |
| 201 | Ga0068852_100141970 | 3300005616 | Bacteria | 2224 |
| 202 | Ga0068859_100001753 | 3300005617 | Bacteria | 22082 |
| 203 | Ga0068859_100013963 | 3300005617 | Bacteria | 8055 |
| 204 | Ga0068859_100014947 | 3300005617 | Bacteria | 7790 |
| 205 | Ga0068859_100038558 | 3300005617 | Bacteria | 4793 |
| 206 | Ga0068864_100003537 | 3300005618 | Bacteria | 12924 |
| 207 | Ga0068864_100018866 | 3300005618 | Bacteria | 5766 |
| 208 | Ga0068864_100061168 | 3300005618 | Unclassified | 3262 |
| 209 | Ga0068866_10000590 | 3300005718 | Bacteria | 16525 |
| 210 | Ga0068866_10065720 | 3300005718 | Bacteria | 1898 |
| 211 | Ga0068861_100081852 | 3300005719 | Bacteria | 2529 |
| 212 | Ga0068851_10037717 | 3300005834 | Archaea | 2423 |
| 213 | Ga0068851_10047244 | 3300005834 | Bacteria | 2180 |
| 214 | Ga0068851_10051076 | 3300005834 | Bacteria | 2100 |
| 215 | Ga0068870_10003193 | 3300005840 | Bacteria | 6917 |
| 216 | Ga0068863_100012092 | 3300005841 | Bacteria | 8338 |
| 217 | Ga0068863_100019423 | 3300005841 | Bacteria | 6500 |
| 218 | Ga0068863_100048187 | 3300005841 | Unclassified | 4041 |
| 219 | Ga0068863_100411389 | 3300005841 | Unclassified | 1324 |
| 220 | Ga0068858_100011368 | 3300005842 | Bacteria | 8406 |
| 221 | Ga0068858_100018025 | 3300005842 | Bacteria | 6612 |
| 222 | Ga0068858_100028176 | 3300005842 | Bacteria | 5219 |
| 223 | Ga0068858_100054493 | 3300005842 | Bacteria | 3698 |
| 224 | Ga0068858_100120513 | 3300005842 | Bacteria | 2453 |
| 225 | Ga0068858_100263312 | 3300005842 | Unclassified | 1639 |
| 226 | Ga0068860_100026939 | 3300005843 | Bacteria | 5539 |
| 227 | Ga0068860_100095363 | 3300005843 | Bacteria | 2836 |
| 228 | Ga0068860_100113811 | 3300005843 | Unclassified | 2587 |
| 229 | Ga0068860_100360517 | 3300005843 | Unclassified | 1432 |
| 230 | Ga0068862_100005527 | 3300005844 | Bacteria | 10559 |
| 231 | Ga0068862_100060777 | 3300005844 | Unclassified | 3247 |
| 232 | Ga0081540_1099844 | 3300005983 | Unclassified | 1253 |
| 233 | Ga0070717_10000274 | 3300006028 | Bacteria | 35206 |
| 234 | Ga0070717_10000783 | 3300006028 | Bacteria | 20846 |
| 235 | Ga0070717_10001050 | 3300006028 | Bacteria | 18532 |
| 236 | Ga0070717_10009099 | 3300006028 | Bacteria | 7457 |
| 237 | Ga0070717_10030403 | 3300006028 | Bacteria | 4339 |
| 238 | Ga0070717_10045002 | 3300006028 | Bacteria | 3607 |
| 239 | Ga0070717_10068722 | 3300006028 | Bacteria | 2949 |
| 240 | Ga0070717_10074893 | 3300006028 | Bacteria | 2831 |
| 241 | Ga0070717_10088234 | 3300006028 | Bacteria | 2613 |
| 242 | Ga0070717_10236198 | 3300006028 | Bacteria | 1611 |
| 243 | Ga0070715_10001939 | 3300006163 | Bacteria | 6226 |
| 244 | Ga0070715_10034659 | 3300006163 | Bacteria | 2071 |
| 245 | Ga0070716_100000931 | 3300006173 | Bacteria | 12697 |
| 246 | Ga0070716_100002361 | 3300006173 | Bacteria | 8683 |
| 247 | Ga0070716_100010444 | 3300006173 | Bacteria | 4655 |
| 248 | Ga0070716_100021570 | 3300006173 | Bacteria | 3396 |
| 249 | Ga0070716_100034566 | 3300006173 | Bacteria | 2773 |
| 250 | Ga0070712_100000472 | 3300006175 | Bacteria | 23114 |
| 251 | Ga0070712_100002128 | 3300006175 | Bacteria | 12181 |
| 252 | Ga0070712_100002493 | 3300006175 | Bacteria | 11354 |
| 253 | Ga0070712_100021241 | 3300006175 | Bacteria | 4260 |
| 254 | Ga0070712_100022151 | 3300006175 | Unclassified | 4181 |
| 255 | Ga0070712_100031371 | 3300006175 | Bacteria | 3580 |
| 256 | Ga0097621_100000659 | 3300006237 | Bacteria | 24318 |
| 257 | Ga0097621_100002693 | 3300006237 | Bacteria | 12158 |
| 258 | Ga0097621_100003898 | 3300006237 | Bacteria | 10342 |
| 259 | Ga0097621_100025508 | 3300006237 | Bacteria | 4625 |
| 260 | Ga0097621_100070242 | 3300006237 | Bacteria | 2892 |
| 261 | Ga0097621_100074373 | 3300006237 | Bacteria | 2814 |
| 262 | Ga0068871_100000288 | 3300006358 | Bacteria | 35115 |
| 263 | Ga0068871_100000643 | 3300006358 | Bacteria | 24041 |
| 264 | Ga0068871_100006416 | 3300006358 | Bacteria | 8321 |
| 265 | Ga0068871_100043198 | 3300006358 | Bacteria | 3621 |
| 266 | Ga0075433_10000459 | 3300006852 | Bacteria | 26510 |
| 267 | Ga0075433_10019585 | 3300006852 | Bacteria | 5641 |
| 268 | Ga0075434_100004992 | 3300006871 | Bacteria | 12040 |
| 269 | Ga0075434_100005525 | 3300006871 | Bacteria | 11510 |
| 270 | Ga0068865_100008147 | 3300006881 | Bacteria | 6466 |
| 271 | Ga0068865_100155298 | 3300006881 | Bacteria | 1740 |
| 272 | Ga0068865_100184076 | 3300006881 | Unclassified | 1610 |
| 273 | Ga0075436_100001031 | 3300006914 | Bacteria | 18755 |
| 274 | Ga0075436_100002883 | 3300006914 | Bacteria | 11785 |
| 275 | Ga0075436_100008046 | 3300006914 | Bacteria | 7219 |
| 276 | Ga0097620_100001753 | 3300006931 | Bacteria | 22082 |
| 277 | Ga0097620_100013963 | 3300006931 | Bacteria | 8055 |
| 278 | Ga0097620_100014947 | 3300006931 | Bacteria | 7790 |
| 279 | Ga0097620_100038559 | 3300006931 | Bacteria | 4793 |
| 280 | Ga0075435_100001052 | 3300007076 | Bacteria | 17477 |
| 281 | Ga0075435_100076958 | 3300007076 | Bacteria | 2735 |
| 282 | Ga0075435_100077671 | 3300007076 | Unclassified | 2722 |
| 283 | Ga0075435_100209254 | 3300007076 | Bacteria | 1654 |
| 284 | Ga0099795_10024293 | 3300007788 | Bacteria | 2020 |
| 285 | Ga0099795_10031359 | 3300007788 | Bacteria | 1830 |
| 286 | Ga0105250_10008592 | 3300009092 | Bacteria | 4329 |
| 287 | Ga0105240_10030063 | 3300009093 | Bacteria | 7065 |
| 288 | Ga0105240_10059389 | 3300009093 | Bacteria | 4773 |
| 289 | Ga0105240_10102189 | 3300009093 | Bacteria | 3484 |
| 290 | Ga0105240_10121398 | 3300009093 | Bacteria | 3146 |
| 291 | Ga0105240_10126503 | 3300009093 | Bacteria | 3071 |
| 292 | Ga0105240_10475906 | 3300009093 | Unclassified | 1393 |
| 293 | Ga0105240_10779895 | 3300009093 | Unclassified | 1037 |
| 294 | Ga0105245_10009096 | 3300009098 | Bacteria | 8657 |
| 295 | Ga0105245_10013607 | 3300009098 | Bacteria | 7087 |
| 296 | Ga0105245_10014887 | 3300009098 | Bacteria | 6775 |
| 297 | Ga0105245_10027136 | 3300009098 | Bacteria | 5044 |
| 298 | Ga0105245_10050356 | 3300009098 | Bacteria | 3733 |
| 299 | Ga0105245_10179249 | 3300009098 | Bacteria | 2023 |
| 300 | Ga0105245_10351785 | 3300009098 | Bacteria | 1460 |
| 301 | Ga0105247_10064280 | 3300009101 | Bacteria | 2279 |
| 302 | Ga0114129_10128091 | 3300009147 | Bacteria | 3489 |
| 303 | Ga0105243_10087816 | 3300009148 | Bacteria | 2553 |
| 304 | Ga0105241_10004698 | 3300009174 | Bacteria | 10084 |
| 305 | Ga0105241_10018956 | 3300009174 | Bacteria | 5071 |
| 306 | Ga0105241_10028983 | 3300009174 | Bacteria | 4126 |
| 307 | Ga0105241_10067422 | 3300009174 | Bacteria | 2770 |
| 308 | Ga0105241_10105268 | 3300009174 | Unclassified | 2250 |
| 309 | Ga0105241_10118398 | 3300009174 | Bacteria | 2129 |
| 310 | Ga0105241_10137399 | 3300009174 | Bacteria | 1986 |
| 311 | Ga0105241_10468173 | 3300009174 | Unclassified | 1118 |
| 312 | Ga0105241_10493018 | 3300009174 | Unclassified | 1091 |
| 313 | Ga0105242_10015449 | 3300009176 | Bacteria | 5929 |
| 314 | Ga0105242_10026278 | 3300009176 | Bacteria | 4614 |
| 315 | Ga0105242_10243086 | 3300009176 | Bacteria | 1619 |
| 316 | Ga0105248_10003676 | 3300009177 | Bacteria | 16990 |
| 317 | Ga0105248_10131279 | 3300009177 | Bacteria | 2826 |
| 318 | Ga0105248_10145134 | 3300009177 | Bacteria | 2678 |
| 319 | Ga0105248_10286693 | 3300009177 | Unclassified | 1854 |
| 320 | Ga0105237_10011049 | 3300009545 | Bacteria | 9573 |
| 321 | Ga0105237_10041433 | 3300009545 | Bacteria | 4644 |
| 322 | Ga0105237_10058508 | 3300009545 | Unclassified | 3857 |
| 323 | Ga0105237_10072346 | 3300009545 | Bacteria | 3442 |
| 324 | Ga0105237_10202261 | 3300009545 | Bacteria | 1986 |
| 325 | Ga0105238_10000188 | 3300009551 | Bacteria | 68217 |
| 326 | Ga0105238_10018779 | 3300009551 | Bacteria | 7039 |
| 327 | Ga0105238_10018989 | 3300009551 | Bacteria | 7001 |
| 328 | Ga0105249_10058909 | 3300009553 | Unclassified | 3521 |
| 329 | Ga0105249_10221038 | 3300009553 | Bacteria | 1864 |
| 330 | Ga0105239_10014081 | 3300010375 | Bacteria | 8879 |
| 331 | Ga0105239_10298269 | 3300010375 | Bacteria | 1815 |
| 332 | Ga0105246_10002167 | 3300011119 | Bacteria | 11862 |
| 333 | Ga0105246_10264557 | 3300011119 | Unclassified | 1372 |
| 334 | Ga0157373_10020329 | 3300013100 | Bacteria | 4827 |
| 335 | Ga0157373_10212128 | 3300013100 | Bacteria | 1365 |
| 336 | Ga0157373_10247583 | 3300013100 | Unclassified | 1260 |
| 337 | Ga0157371_10007230 | 3300013102 | Bacteria | 9017 |
| 338 | Ga0157371_10018449 | 3300013102 | Bacteria | 5158 |
| 339 | Ga0157371_10143674 | 3300013102 | Bacteria | 1700 |
| 340 | Ga0157370_10183298 | 3300013104 | Bacteria | 1945 |
| 341 | Ga0157369_10000124 | 3300013105 | Bacteria | 110693 |
| 342 | Ga0157369_10042601 | 3300013105 | Unclassified | 4951 |
| 343 | Ga0157369_10071438 | 3300013105 | Unclassified | 3726 |
| 344 | Ga0157369_10241145 | 3300013105 | Unclassified | 1888 |
| 345 | Ga0157369_10289140 | 3300013105 | Bacteria | 1706 |
| 346 | Ga0157369_10384237 | 3300013105 | Unclassified | 1457 |
| 347 | Ga0157374_10000705 | 3300013296 | Bacteria | 29341 |
| 348 | Ga0157374_10004648 | 3300013296 | Bacteria | 11512 |
| 349 | Ga0157374_10012459 | 3300013296 | Bacteria | 7399 |
| 350 | Ga0157374_10021739 | 3300013296 | Bacteria | 5713 |
| 351 | Ga0157374_10049433 | 3300013296 | Bacteria | 3906 |
| 352 | Ga0157378_10000020 | 3300013297 | Bacteria | 131245 |
| 353 | Ga0157378_10001169 | 3300013297 | Bacteria | 23875 |
| 354 | Ga0157378_10001927 | 3300013297 | Bacteria | 18622 |
| 355 | Ga0157378_10012122 | 3300013297 | Bacteria | 7550 |
| 356 | Ga0157378_10086629 | 3300013297 | Unclassified | 2840 |
| 357 | Ga0157378_10131150 | 3300013297 | Bacteria | 2320 |
| 358 | Ga0157378_10133126 | 3300013297 | Bacteria | 2303 |
| 359 | Ga0157378_10493661 | 3300013297 | Unclassified | 1222 |
| 360 | Ga0163162_10004938 | 3300013306 | Bacteria | 12855 |
| 361 | Ga0163162_10012372 | 3300013306 | Bacteria | 8332 |
| 362 | Ga0163162_10030363 | 3300013306 | Bacteria | 5355 |
| 363 | Ga0157372_10000084 | 3300013307 | Bacteria | 98431 |
| 364 | Ga0157372_10000328 | 3300013307 | Bacteria | 51987 |
| 365 | Ga0157372_10000579 | 3300013307 | Bacteria | 39972 |
| 366 | Ga0157372_10001691 | 3300013307 | Bacteria | 23865 |
| 367 | Ga0157372_10007626 | 3300013307 | Bacteria | 11505 |
| 368 | Ga0157372_10007962 | 3300013307 | Bacteria | 11267 |
| 369 | Ga0157372_10024610 | 3300013307 | Bacteria | 6543 |
| 370 | Ga0157372_10032366 | 3300013307 | Bacteria | 5734 |
| 371 | Ga0157372_10048056 | 3300013307 | Bacteria | 4743 |
| 372 | Ga0157372_10056122 | 3300013307 | Unclassified | 4401 |
| 373 | Ga0157372_10107446 | 3300013307 | Unclassified | 3193 |
| 374 | Ga0157372_10191958 | 3300013307 | Bacteria | 2366 |
| 375 | Ga0157372_10379357 | 3300013307 | Unclassified | 1648 |
| 376 | Ga0157375_10099880 | 3300013308 | Bacteria | 2981 |
| 377 | Ga0163163_10003536 | 3300014325 | Bacteria | 13275 |
| 378 | Ga0163163_10177088 | 3300014325 | Bacteria | 2179 |
| 379 | Ga0157380_10169299 | 3300014326 | Archaea | 1907 |
| 380 | Ga0182008_10057254 | 3300014497 | Bacteria | 1925 |
| 381 | Ga0157377_10002893 | 3300014745 | Bacteria | 7676 |
| 382 | Ga0157377_10190573 | 3300014745 | Bacteria | 1296 |
| 383 | Ga0157379_10015082 | 3300014968 | Bacteria | 6778 |
| 384 | Ga0157379_10038889 | 3300014968 | Bacteria | 4244 |
| 385 | Ga0157379_10038995 | 3300014968 | Bacteria | 4238 |
| 386 | Ga0157379_10592228 | 3300014968 | Unclassified | 1034 |
| 387 | Ga0157376_10046101 | 3300014969 | Bacteria | 3593 |
| 388 | Ga0157376_10056336 | 3300014969 | Bacteria | 3283 |
| 389 | Ga0157376_10117563 | 3300014969 | Bacteria | 2351 |
| 390 | Ga0157376_10169502 | 3300014969 | Bacteria | 1987 |
| 391 | Ga0182005_1013330 | 3300015265 | Bacteria | 2312 |
| 392 | Ga0163161_10003774 | 3300017792 | Bacteria | 10611 |
| 393 | Ga0213873_10001054 | 3300021358 | Bacteria | 4485 |
| 394 | Ga0224570_100396 | 3300022730 | Unclassified | 3440 |
| 395 | Ga0224572_1001820 | 3300024225 | Bacteria | 3279 |
| 396 | Ga0228598_1000623 | 3300024227 | Bacteria | 7439 |
| 397 | Ga0228598_1005928 | 3300024227 | Bacteria | 2539 |
| 398 | Ga0228598_1009110 | 3300024227 | Bacteria | 1993 |
| 399 | Ga0207656_10021502 | 3300025321 | Bacteria | 2579 |
| 400 | Ga0207696_1030889 | 3300025711 | Bacteria | 1624 |
| 401 | Ga0207692_10003776 | 3300025898 | Bacteria | 5948 |
| 402 | Ga0207692_10006241 | 3300025898 | Bacteria | 4828 |
| 403 | Ga0207692_10148631 | 3300025898 | Bacteria | 1339 |
| 404 | Ga0207710_10074249 | 3300025900 | Unclassified | 1565 |
| 405 | Ga0207688_10022711 | 3300025901 | Bacteria | 3434 |
| 406 | Ga0207680_10145864 | 3300025903 | Unclassified | 1573 |
| 407 | Ga0207647_10004664 | 3300025904 | Bacteria | 10154 |
| 408 | Ga0207647_10010375 | 3300025904 | Bacteria | 6578 |
| 409 | Ga0207647_10062588 | 3300025904 | Bacteria | 2267 |
| 410 | Ga0207685_10004859 | 3300025905 | Bacteria | 3475 |
| 411 | Ga0207685_10007485 | 3300025905 | Bacteria | 3046 |
| 412 | Ga0207699_10002040 | 3300025906 | Bacteria | 9539 |
| 413 | Ga0207699_10053961 | 3300025906 | Bacteria | 2386 |
| 414 | Ga0207699_10080961 | 3300025906 | Unclassified | 2013 |
| 415 | Ga0207699_10087373 | 3300025906 | Unclassified | 1949 |
| 416 | Ga0207699_10147899 | 3300025906 | Bacteria | 1551 |
| 417 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 418 | Ga0207645_10020422 | 3300025907 | Bacteria | 4336 |
| 419 | Ga0207643_10002181 | 3300025908 | Bacteria | 10678 |
| 420 | Ga0207684_10001275 | 3300025910 | Bacteria | 27799 |
| 421 | Ga0207684_10001561 | 3300025910 | Bacteria | 24473 |
| 422 | Ga0207684_10002945 | 3300025910 | Bacteria | 16860 |
| 423 | Ga0207684_10067642 | 3300025910 | Bacteria | 3036 |
| 424 | Ga0207654_10004137 | 3300025911 | Bacteria | 7314 |
| 425 | Ga0207654_10018300 | 3300025911 | Bacteria | 3674 |
| 426 | Ga0207654_10020317 | 3300025911 | Unclassified | 3519 |
| 427 | Ga0207654_10105940 | 3300025911 | Bacteria | 1740 |
| 428 | Ga0207654_10237373 | 3300025911 | Unclassified | 1217 |
| 429 | Ga0207707_10002179 | 3300025912 | Bacteria | 17732 |
| 430 | Ga0207707_10018423 | 3300025912 | Bacteria | 6087 |
| 431 | Ga0207707_10018929 | 3300025912 | Bacteria | 6003 |
| 432 | Ga0207707_10076732 | 3300025912 | Bacteria | 2916 |
| 433 | Ga0207707_10228457 | 3300025912 | Bacteria | 1619 |
| 434 | Ga0207695_10057023 | 3300025913 | Bacteria | 4061 |
| 435 | Ga0207695_10099615 | 3300025913 | Bacteria | 2903 |
| 436 | Ga0207695_10109776 | 3300025913 | Bacteria | 2740 |
| 437 | Ga0207695_10380141 | 3300025913 | Bacteria | 1298 |
| 438 | Ga0207671_10085456 | 3300025914 | Bacteria | 2371 |
| 439 | Ga0207671_10102110 | 3300025914 | Unclassified | 2173 |
| 440 | Ga0207693_10000621 | 3300025915 | Bacteria | 31746 |
| 441 | Ga0207693_10000631 | 3300025915 | Bacteria | 31514 |
| 442 | Ga0207693_10001998 | 3300025915 | Bacteria | 17899 |
| 443 | Ga0207693_10014811 | 3300025915 | Bacteria | 6265 |
| 444 | Ga0207693_10015842 | 3300025915 | Bacteria | 6039 |
| 445 | Ga0207693_10029176 | 3300025915 | Bacteria | 4360 |
| 446 | Ga0207663_10005255 | 3300025916 | Bacteria | 6520 |
| 447 | Ga0207663_10007637 | 3300025916 | Bacteria | 5620 |
| 448 | Ga0207663_10139037 | 3300025916 | Bacteria | 1689 |
| 449 | Ga0207663_10176798 | 3300025916 | Bacteria | 1521 |
| 450 | Ga0207663_10385079 | 3300025916 | Bacteria | 1069 |
| 451 | Ga0207660_10012689 | 3300025917 | Bacteria | 5518 |
| 452 | Ga0207660_10030517 | 3300025917 | Bacteria | 3705 |
| 453 | Ga0207657_10001605 | 3300025919 | Bacteria | 24326 |
| 454 | Ga0207657_10004718 | 3300025919 | Bacteria | 14382 |
| 455 | Ga0207657_10007241 | 3300025919 | Bacteria | 11398 |
| 456 | Ga0207649_10036629 | 3300025920 | Unclassified | 2957 |
| 457 | Ga0207649_10045908 | 3300025920 | Bacteria | 2681 |
| 458 | Ga0207649_10113279 | 3300025920 | Bacteria | 1816 |
| 459 | Ga0207652_10103383 | 3300025921 | Bacteria | 2519 |
| 460 | Ga0207646_10003711 | 3300025922 | Bacteria | 17037 |
| 461 | Ga0207646_10004583 | 3300025922 | Bacteria | 14954 |
| 462 | Ga0207646_10031655 | 3300025922 | Bacteria | 4788 |
| 463 | Ga0207646_10078034 | 3300025922 | Bacteria | 2960 |
| 464 | Ga0207646_10103228 | 3300025922 | Bacteria | 2557 |
| 465 | Ga0207646_10314468 | 3300025922 | Bacteria | 1415 |
| 466 | Ga0207681_10078654 | 3300025923 | Bacteria | 2321 |
| 467 | Ga0207694_10003741 | 3300025924 | Bacteria | 12056 |
| 468 | Ga0207694_10039145 | 3300025924 | Unclassified | 3648 |
| 469 | Ga0207650_10000651 | 3300025925 | Bacteria | 27555 |
| 470 | Ga0207650_10107391 | 3300025925 | Bacteria | 2156 |
| 471 | Ga0207659_10018615 | 3300025926 | Bacteria | 4556 |
| 472 | Ga0207687_10014619 | 3300025927 | Bacteria | 5139 |
| 473 | Ga0207700_10000734 | 3300025928 | Bacteria | 18904 |
| 474 | Ga0207700_10002368 | 3300025928 | Bacteria | 10830 |
| 475 | Ga0207700_10009198 | 3300025928 | Bacteria | 6161 |
| 476 | Ga0207700_10026245 | 3300025928 | Unclassified | 4060 |
| 477 | Ga0207700_10066446 | 3300025928 | Bacteria | 2756 |
| 478 | Ga0207700_10128490 | 3300025928 | Bacteria | 2065 |
| 479 | Ga0207700_10268306 | 3300025928 | Unclassified | 1464 |
| 480 | Ga0207700_10292636 | 3300025928 | Unclassified | 1404 |
| 481 | Ga0207700_10295912 | 3300025928 | Bacteria | 1396 |
| 482 | Ga0207700_10606108 | 3300025928 | Unclassified | 975 |
| 483 | Ga0207664_10000117 | 3300025929 | Bacteria | 69794 |
| 484 | Ga0207664_10014623 | 3300025929 | Bacteria | 5676 |
| 485 | Ga0207664_10059138 | 3300025929 | Unclassified | 3051 |
| 486 | Ga0207664_10068669 | 3300025929 | Bacteria | 2848 |
| 487 | Ga0207664_10103628 | 3300025929 | Bacteria | 2355 |
| 488 | Ga0207664_10137815 | 3300025929 | Bacteria | 2061 |
| 489 | Ga0207664_10150208 | 3300025929 | Bacteria | 1978 |
| 490 | Ga0207664_10155982 | 3300025929 | Bacteria | 1943 |
| 491 | Ga0207664_10197160 | 3300025929 | Bacteria | 1736 |
| 492 | Ga0207644_10004055 | 3300025931 | Bacteria | 9501 |
| 493 | Ga0207706_10000613 | 3300025933 | Bacteria | 37863 |
| 494 | Ga0207706_10006173 | 3300025933 | Bacteria | 11126 |
| 495 | Ga0207686_10047637 | 3300025934 | Bacteria | 2651 |
| 496 | Ga0207686_10127014 | 3300025934 | Unclassified | 1744 |
| 497 | Ga0207704_10111123 | 3300025938 | Bacteria | 1853 |
| 498 | Ga0207704_10148113 | 3300025938 | Archaea | 1652 |
| 499 | Ga0207665_10001868 | 3300025939 | Bacteria | 14199 |
| 500 | Ga0207665_10004699 | 3300025939 | Bacteria | 9072 |
| 501 | Ga0207665_10004932 | 3300025939 | Bacteria | 8901 |
| 502 | Ga0207665_10007640 | 3300025939 | Bacteria | 7138 |
| 503 | Ga0207665_10033810 | 3300025939 | Bacteria | 3391 |
| 504 | Ga0207665_10041043 | 3300025939 | Unclassified | 3089 |
| 505 | Ga0207665_10177471 | 3300025939 | Unclassified | 1541 |
| 506 | Ga0207691_10002042 | 3300025940 | Bacteria | 19748 |
| 507 | Ga0207711_10014633 | 3300025941 | Bacteria | 6520 |
| 508 | Ga0207689_10003226 | 3300025942 | Bacteria | 14941 |
| 509 | Ga0207689_10004719 | 3300025942 | Bacteria | 12299 |
| 510 | Ga0207661_10002937 | 3300025944 | Bacteria | 11790 |
| 511 | Ga0207661_10023885 | 3300025944 | Unclassified | 4625 |
| 512 | Ga0207661_10118073 | 3300025944 | Bacteria | 2254 |
| 513 | Ga0207661_10267290 | 3300025944 | Bacteria | 1525 |
| 514 | Ga0207679_10000702 | 3300025945 | Bacteria | 22362 |
| 515 | Ga0207679_10001183 | 3300025945 | Bacteria | 16595 |
| 516 | Ga0207679_10039065 | 3300025945 | Unclassified | 3387 |
| 517 | Ga0207679_10108707 | 3300025945 | Bacteria | 2184 |
| 518 | Ga0207667_10000213 | 3300025949 | Bacteria | 81973 |
| 519 | Ga0207667_10000959 | 3300025949 | Bacteria | 36774 |
| 520 | Ga0207667_10037195 | 3300025949 | Bacteria | 5205 |
| 521 | Ga0207651_10111832 | 3300025960 | Bacteria | 2052 |
| 522 | Ga0207712_10061621 | 3300025961 | Bacteria | 2663 |
| 523 | Ga0207712_10228095 | 3300025961 | Bacteria | 1493 |
| 524 | Ga0207668_10017634 | 3300025972 | Bacteria | 4477 |
| 525 | Ga0207640_10021477 | 3300025981 | Bacteria | 3848 |
| 526 | Ga0207640_10034585 | 3300025981 | Bacteria | 3155 |
| 527 | Ga0207640_10047329 | 3300025981 | Bacteria | 2773 |
| 528 | Ga0207640_10060685 | 3300025981 | Bacteria | 2501 |
| 529 | Ga0207640_10073000 | 3300025981 | Bacteria | 2317 |
| 530 | Ga0207640_10149992 | 3300025981 | Bacteria | 1712 |
| 531 | Ga0207658_10061736 | 3300025986 | Bacteria | 2801 |
| 532 | Ga0207658_10505892 | 3300025986 | Unclassified | 1076 |
| 533 | Ga0207677_10011130 | 3300026023 | Bacteria | 5116 |
| 534 | Ga0207677_10038872 | 3300026023 | Unclassified | 3123 |
| 535 | Ga0207677_10048257 | 3300026023 | Unclassified | 2866 |
| 536 | Ga0207677_10051949 | 3300026023 | Bacteria | 2781 |
| 537 | Ga0207677_10066899 | 3300026023 | Bacteria | 2514 |
| 538 | Ga0207677_10078308 | 3300026023 | Bacteria | 2360 |
| 539 | Ga0207703_10003860 | 3300026035 | Bacteria | 12454 |
| 540 | Ga0207703_10033201 | 3300026035 | Bacteria | 4089 |
| 541 | Ga0207639_10021287 | 3300026041 | Bacteria | 4656 |
| 542 | Ga0207639_10056542 | 3300026041 | Unclassified | 3008 |
| 543 | Ga0207639_10196414 | 3300026041 | Unclassified | 1727 |
| 544 | Ga0207639_10239384 | 3300026041 | Bacteria | 1577 |
| 545 | Ga0207678_10001157 | 3300026067 | Bacteria | 24143 |
| 546 | Ga0207678_10001666 | 3300026067 | Bacteria | 20378 |
| 547 | Ga0207702_10000114 | 3300026078 | Bacteria | 93951 |
| 548 | Ga0207702_10000913 | 3300026078 | Bacteria | 30558 |
| 549 | Ga0207702_10001223 | 3300026078 | Bacteria | 25973 |
| 550 | Ga0207702_10031823 | 3300026078 | Bacteria | 4399 |
| 551 | Ga0207702_10053599 | 3300026078 | Bacteria | 3415 |
| 552 | Ga0207702_10065929 | 3300026078 | Bacteria | 3102 |
| 553 | Ga0207702_10407610 | 3300026078 | Bacteria | 1312 |
| 554 | Ga0207641_10001793 | 3300026088 | Bacteria | 20670 |
| 555 | Ga0207641_10014846 | 3300026088 | Bacteria | 6384 |
| 556 | Ga0207641_10155197 | 3300026088 | Bacteria | 2076 |
| 557 | Ga0207648_10002054 | 3300026089 | Bacteria | 21941 |
| 558 | Ga0207648_10008217 | 3300026089 | Bacteria | 10132 |
| 559 | Ga0207648_10058095 | 3300026089 | Bacteria | 3374 |
| 560 | Ga0207648_10474391 | 3300026089 | Unclassified | 1142 |
| 561 | Ga0207676_10001106 | 3300026095 | Bacteria | 20371 |
| 562 | Ga0207676_10049263 | 3300026095 | Bacteria | 3276 |
| 563 | Ga0207676_10189804 | 3300026095 | Bacteria | 1807 |
| 564 | Ga0207676_10431791 | 3300026095 | Bacteria | 1238 |
| 565 | Ga0207674_10000668 | 3300026116 | Bacteria | 44621 |
| 566 | Ga0207674_10006933 | 3300026116 | Bacteria | 13272 |
| 567 | Ga0207674_10043536 | 3300026116 | Bacteria | 4629 |
| 568 | Ga0207674_10052327 | 3300026116 | Bacteria | 4165 |
| 569 | Ga0207674_10228461 | 3300026116 | Bacteria | 1809 |
| 570 | Ga0207675_100014488 | 3300026118 | Bacteria | 7349 |
| 571 | Ga0207675_100249992 | 3300026118 | Unclassified | 1716 |
| 572 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 573 | Ga0207683_10297023 | 3300026121 | Unclassified | 1478 |
| 574 | Ga0207698_10024182 | 3300026142 | Bacteria | 4259 |
| 575 | Ga0265356_1000474 | 3300028017 | Bacteria | 7224 |
| 576 | Ga0265355_1003372 | 3300028036 | Bacteria | 1169 |
| 577 | Ga0268266_10036915 | 3300028379 | Bacteria | 4163 |
| 578 | Ga0268265_10005101 | 3300028380 | Bacteria | 9004 |
| 579 | Ga0268265_10021210 | 3300028380 | Unclassified | 4547 |
| 580 | Ga0268264_10027650 | 3300028381 | Bacteria | 4637 |
| 581 | Ga0268264_10318532 | 3300028381 | Unclassified | 1470 |
| 582 | Ga0265338_10009914 | 3300028800 | Bacteria | 11266 |
| 583 | Ga0265338_10033226 | 3300028800 | Bacteria | 5011 |
| 584 | Ga0265762_1000850 | 3300030760 | Bacteria | 5434 |
| 585 | Ga0265762_1002978 | 3300030760 | Bacteria | 3028 |
| 586 | Ga0265762_1004876 | 3300030760 | Bacteria | 2403 |
| 587 | Ga0265762_1006483 | 3300030760 | Bacteria | 2093 |
| 588 | Ga0265762_1013410 | 3300030760 | Unclassified | 1475 |
| 589 | Ga0265760_10000152 | 3300031090 | Bacteria | 17836 |
| 590 | Ga0265760_10001143 | 3300031090 | Bacteria | 7724 |
| 591 | Ga0265760_10013302 | 3300031090 | Bacteria | 2356 |
| 592 | Ga0265760_10018906 | 3300031090 | Unclassified | 1985 |
| 593 | Ga0265760_10037118 | 3300031090 | Unclassified | 1446 |
| 594 | Ga0265760_10058333 | 3300031090 | Bacteria | 1170 |
| 595 | Ga0265330_10039838 | 3300031235 | Bacteria | 2086 |
| 596 | Ga0265328_10012033 | 3300031239 | Bacteria | 3449 |
| 597 | Ga0265340_10022887 | 3300031247 | Bacteria | 3190 |
| 598 | Ga0265340_10092646 | 3300031247 | Bacteria | 1411 |
| 599 | Ga0265340_10107286 | 3300031247 | Bacteria | 1294 |
| 600 | Ga0265340_10169775 | 3300031247 | Unclassified | 988 |
| 601 | Ga0265339_10007498 | 3300031249 | Bacteria | 7041 |
| 602 | Ga0265339_10024104 | 3300031249 | Bacteria | 3511 |
| 603 | Ga0265339_10029382 | 3300031249 | Unclassified | 3118 |
| 604 | Ga0265339_10042915 | 3300031249 | Bacteria | 2503 |
| 605 | Ga0265316_10006473 | 3300031344 | Bacteria | 11176 |
| 606 | Ga0265316_10015429 | 3300031344 | Bacteria | 6681 |
| 607 | Ga0265316_10035416 | 3300031344 | Bacteria | 4046 |
| 608 | Ga0265314_10003741 | 3300031711 | Bacteria | 14567 |
| 609 | Ga0265314_10025177 | 3300031711 | Bacteria | 4496 |
| 610 | Ga0265314_10150417 | 3300031711 | Bacteria | 1428 |
| 611 | Ga0265342_10072306 | 3300031712 | Bacteria | 2008 |
| 612 | Ga0307410_10001054 | 3300031852 | Bacteria | 11983 |
| 613 | Ga0307410_10032705 | 3300031852 | Unclassified | 3351 |
| 614 | Ga0307410_10074596 | 3300031852 | Bacteria | 2363 |
| 615 | Ga0307406_10095810 | 3300031901 | Bacteria | 2009 |
| 616 | Ga0307409_100002165 | 3300031995 | Bacteria | 10127 |
| 617 | Ga0307416_100044581 | 3300032002 | Bacteria | 3484 |
| 618 | Ga0307414_10409639 | 3300032004 | Unclassified | 1180 |
| 619 | Ga0307411_10132537 | 3300032005 | Bacteria | 1824 |
| 620 | Ga0307411_10154275 | 3300032005 | Unclassified | 1711 |
| 621 | Ga0307415_100046956 | 3300032126 | Bacteria | 2904 |
| 622 | Ga0373926_0007001 | 3300035083 | Bacteria | 3751 |
| 623 | Ga0373926_0044469 | 3300035083 | Bacteria | 1591 |
| 624 | Ga0373926_0070656 | 3300035083 | Bacteria | 1282 |
| 625 | Ga0373934_0044823 | 3300035086 | Bacteria | 1748 |
| 626 | Ga0373923_0010393 | 3300035111 | Bacteria | 3384 |
| 627 | Ga0373923_0040134 | 3300035111 | Bacteria | 1925 |
| 628 | Ga0373923_0127121 | 3300035111 | Unclassified | 1143 |
| 629 | Ga0373936_0000893 | 3300035113 | Bacteria | 10644 |
| 630 | Ga0373936_0007997 | 3300035113 | Bacteria | 3973 |
| 631 | Ga0373945_0000867 | 3300035116 | Bacteria | 8927 |
| 632 | Ga0373953_0006262 | 3300035117 | Bacteria | 3911 |
| 633 | Ga0373954_0004867 | 3300035118 | Bacteria | 5795 |
| 634 | Ga0373956_0003484 | 3300035119 | Bacteria | 6327 |
| 635 | Ga0373960_0010570 | 3300035121 | Unclassified | 2258 |
| 636 | Ga0373943_0000021 | 3300035170 | Bacteria | 52773 |
| 637 | Ga0373943_0041727 | 3300035170 | Bacteria | 2220 |
| 638 | Ga0373943_0098096 | 3300035170 | Bacteria | 1528 |
| 639 | Ga0373943_0168880 | 3300035170 | Bacteria | 1196 |
| 640 | Ga0373946_0152454 | 3300035171 | Unclassified | 1079 |
| 641 | Ga0373955_0033049 | 3300035172 | Bacteria | 2721 |
| 642 | Ga0373955_0119172 | 3300035172 | Bacteria | 1533 |
| 643 | Ga0373924_0047968 | 3300035410 | Bacteria | 1763 |
| 644 | Ga0373931_0103269 | 3300035691 | Bacteria | 1606 |
| 645 | Ga0373931_0134500 | 3300035691 | Unclassified | 1426 |
| 646 | Ga0373935_0003051 | 3300035692 | Bacteria | 9653 |
| 647 | Ga0373935_0003262 | 3300035692 | Bacteria | 9384 |
| 648 | Ga0373935_0109106 | 3300035692 | Bacteria | 1835 |
| 649 | Ga0373935_0114862 | 3300035692 | Bacteria | 1791 |
| 650 | Ga0373927_0000909 | 3300035695 | Bacteria | 22507 |
| 651 | Ga0373927_0016042 | 3300035695 | Bacteria | 4945 |
| 652 | Ga0373927_0052289 | 3300035695 | Bacteria | 2642 |
| 653 | Ga0373927_0092478 | 3300035695 | Bacteria | 1965 |
| 654 | Ga0373927_0279343 | 3300035695 | Bacteria | 1098 |
| 655 | Ga0373933_0052077 | 3300035724 | Bacteria | 2448 |
| 656 | Ga0373933_0336859 | 3300035724 | Unclassified | 979 |
| 657 | Ga0373933_0418909 | 3300035724 | Unclassified | 875 |
| 658 | Ga0373947_0001157 | 3300035725 | Bacteria | 16188 |
| 659 | Ga0373947_0004511 | 3300035725 | Bacteria | 8166 |
| 660 | Ga0373947_0126605 | 3300035725 | Bacteria | 1627 |
| 661 | Ga0373947_0182737 | 3300035725 | Bacteria | 1366 |
| 662 | Ga0373947_0222987 | 3300035725 | Bacteria | 1240 |
| 663 | Ga0373947_0254926 | 3300035725 | Unclassified | 1161 |
| 664 | Ga0373937_0033979 | 3300036401 | Bacteria | 4636 |
| 665 | Ga0373937_0035209 | 3300036401 | Bacteria | 4556 |
| 666 | Ga0373937_0097831 | 3300036401 | Bacteria | 2722 |
| 667 | Ga0373937_0359939 | 3300036401 | Unclassified | 1379 |
| 668 | Ga0265778_000654 | 3300036457 | Unclassified | 2808 |
| 669 | Ga0373925_0000367 | 3300037068 | Bacteria | 47053 |
| 670 | Ga0373925_0002436 | 3300037068 | Bacteria | 14926 |
| 671 | Ga0373925_0017086 | 3300037068 | Bacteria | 5252 |
| 672 | Ga0373925_0103233 | 3300037068 | Bacteria | 2194 |
| 673 | Ga0373925_0395147 | 3300037068 | Bacteria | 1127 |
| 674 | Ga0436364_0218463 | 3300037853 | Bacteria | 7334 |
| 675 | Ga0436360_0377084 | 3300039438 | Bacteria | 2438 |
| 676 | Ga0436363_0052309 | 3300039450 | Bacteria | 2168 |
| 677 | Ga0436363_0770082 | 3300039450 | Bacteria | 3556 |
| 678 | Ga0436363_0897691 | 3300039450 | Bacteria | 1503 |
| 679 | Ga0436362_0990872 | 3300039453 | Bacteria | 11336 |
| 680 | Ga0451577_0002999 | 3300042876 | Bacteria | 19237 |
| 681 | Ga0453683_0050039 | 3300044673 | Bacteria | 2619 |
| 682 | Ga0453683_0058256 | 3300044673 | Bacteria | 2417 |
| 683 | Ga0466963_0065547 | 3300044694 | Bacteria | 2435 |
| 684 | Ga0466963_0071639 | 3300044694 | Bacteria | 2333 |
| 685 | Ga0453684_0000686 | 3300044712 | Bacteria | 120659 |
| 686 | Ga0466959_0001551 | 3300045049 | Bacteria | 14132 |
| 687 | Ga0451576_0010752 | 3300045051 | Bacteria | 10475 |
| 688 | Ga0451576_0045843 | 3300045051 | Bacteria | 4603 |
| 689 | Ga0451576_0071094 | 3300045051 | Bacteria | 3622 |
| 690 | Ga0451576_0632984 | 3300045051 | Bacteria | 1124 |
| 691 | Ga0466967_0038204 | 3300045976 | Bacteria | 4115 |
| 692 | Ga0466967_0144255 | 3300045976 | Bacteria | 2220 |
| 693 | Ga0495603_0070095 | 3300046455 | Bacteria | 2061 |
| 694 | Ga0495653_0188783 | 3300046463 | Bacteria | 1408 |
| 695 | Ga0495580_0000074 | 3300046472 | Bacteria | 62279 |
| 696 | Ga0495580_0000187 | 3300046472 | Bacteria | 46797 |
| 697 | Ga0495580_0003275 | 3300046472 | Bacteria | 13843 |
| 698 | Ga0495580_0004661 | 3300046472 | Bacteria | 11500 |
| 699 | Ga0495580_0013802 | 3300046472 | Bacteria | 6150 |
| 700 | Ga0495580_0016952 | 3300046472 | Bacteria | 5459 |
| 701 | Ga0495580_0017853 | 3300046472 | Bacteria | 5292 |
| 702 | Ga0495580_0044621 | 3300046472 | Bacteria | 3152 |
| 703 | Ga0495580_0068335 | 3300046472 | Bacteria | 2485 |
| 704 | Ga0495580_0075872 | 3300046472 | Bacteria | 2345 |
| 705 | Ga0495580_0091330 | 3300046472 | Unclassified | 2119 |
| 706 | Ga0495582_0001534 | 3300046473 | Bacteria | 13033 |
| 707 | Ga0495582_0002740 | 3300046473 | Bacteria | 9838 |
| 708 | Ga0495582_0045143 | 3300046473 | Bacteria | 2427 |
| 709 | Ga0495639_0033769 | 3300046475 | Bacteria | 2286 |
| 710 | Ga0495664_0213719 | 3300046477 | Bacteria | 1168 |
| 711 | Ga0495666_0100204 | 3300046526 | Bacteria | 1365 |
| 712 | Ga0495652_0320938 | 3300046529 | Unclassified | 1119 |
| 713 | Ga0495665_0007953 | 3300046531 | Bacteria | 5749 |
| 714 | Ga0495665_0095529 | 3300046531 | Unclassified | 1561 |
| 715 | Ga0495665_0100263 | 3300046531 | Bacteria | 1520 |
| 716 | Ga0495665_0120341 | 3300046531 | Bacteria | 1375 |
| 717 | Ga0495645_0192886 | 3300046543 | Bacteria | 1387 |
| 718 | Ga0495599_0034208 | 3300046678 | Bacteria | 3193 |
| 719 | Ga0495647_0046715 | 3300046681 | Bacteria | 1669 |
| 720 | Ga0495624_0179442 | 3300046690 | Unclassified | 1291 |
| 721 | Ga0495674_0066054 | 3300047319 | Bacteria | 3140 |
| 722 | Ga0495593_0113868 | 3300047673 | Bacteria | 1380 |
| 723 | Ga0496100_0051757 | 3300048903 | Archaea | 2667 |
| 724 | Ga0496100_0320666 | 3300048903 | Unclassified | 1164 |
| 725 | Ga0496101_0009652 | 3300048904 | Bacteria | 6349 |
| 726 | Ga0496101_0210216 | 3300048904 | Bacteria | 1507 |
| 727 | Ga0496102_0001348 | 3300048905 | Bacteria | 21995 |
| 728 | Ga0496102_0037985 | 3300048905 | Unclassified | 4343 |
| 729 | Ga0496102_0051259 | 3300048905 | Unclassified | 3760 |
| 730 | Ga0496102_0249580 | 3300048905 | Bacteria | 1673 |
| 731 | Ga0496102_0463208 | 3300048905 | Unclassified | 1188 |
| 732 | Ga0496103_0081773 | 3300048906 | Bacteria | 2032 |
| 733 | Ga0496104_0024866 | 3300048907 | Bacteria | 5515 |
| 734 | Ga0496104_0035527 | 3300048907 | Bacteria | 4653 |
| 735 | Ga0496104_0035550 | 3300048907 | Bacteria | 4652 |
| 736 | Ga0496104_0058118 | 3300048907 | Bacteria | 3660 |
| 737 | Ga0496104_0063732 | 3300048907 | Bacteria | 3496 |
| 738 | Ga0496104_0072161 | 3300048907 | Bacteria | 3283 |
| 739 | Ga0496104_0079878 | 3300048907 | Unclassified | 3118 |
| 740 | Ga0496105_0035676 | 3300048908 | Bacteria | 4094 |
| 741 | Ga0496105_0048354 | 3300048908 | Bacteria | 3511 |
| 742 | Ga0496105_0144862 | 3300048908 | Bacteria | 1954 |
| 743 | Ga0496107_0009504 | 3300048910 | Bacteria | 6746 |
| 744 | Ga0496108_0006211 | 3300048911 | Bacteria | 9673 |
| 745 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 746 | Ga0496109_0152360 | 3300048912 | Bacteria | 2165 |
| 747 | Ga0496109_0443264 | 3300048912 | Bacteria | 1227 |
| 748 | Ga0496110_0001695 | 3300048913 | Bacteria | 16198 |
| 749 | Ga0496111_0004157 | 3300048914 | Bacteria | 9106 |
| 750 | Ga0496112_0002198 | 3300048915 | Bacteria | 15534 |
| 751 | Ga0496112_0005621 | 3300048915 | Bacteria | 10877 |
| 752 | Ga0496112_0026609 | 3300048915 | Bacteria | 5571 |
| 753 | Ga0496112_0046268 | 3300048915 | Unclassified | 4267 |
| 754 | Ga0496112_0048144 | 3300048915 | Bacteria | 4180 |
| 755 | Ga0496112_0082567 | 3300048915 | Bacteria | 3178 |
| 756 | Ga0496112_0646214 | 3300048915 | Unclassified | 988 |
| 757 | Ga0496113_0006658 | 3300048916 | Bacteria | 7352 |
| 758 | Ga0496113_0207385 | 3300048916 | Bacteria | 1559 |
| 759 | Ga0496113_0313095 | 3300048916 | Bacteria | 1258 |
| 760 | Ga0496115_0004507 | 3300048918 | Bacteria | 10076 |
| 761 | Ga0496115_0007658 | 3300048918 | Bacteria | 7957 |
| 762 | Ga0496115_0012011 | 3300048918 | Bacteria | 6509 |
| 763 | Ga0496115_0435806 | 3300048918 | Unclassified | 1060 |
| 764 | Ga0501298_004571 | 3300049521 | Bacteria | 2187 |
| 765 | Ga0501299_011185 | 3300049522 | Bacteria | 1512 |
| 766 | Ga0501073_0045379 | 3300049589 | Unclassified | 3095 |
| 767 | Ga0501077_0184876 | 3300049593 | Bacteria | 1324 |
| 768 | Ga0501217_009295 | 3300049661 | Unclassified | 2136 |
| 769 | Ga0501283_016363 | 3300049779 | Bacteria | 1150 |
| 770 | nmdc:mga0n895_22137_c1 | 3300050512 | Bacteria | 5957 |
| 771 | nmdc:mga0n895_518_c1 | 3300050512 | Bacteria | 26232 |
| 772 | nmdc:mga0rr50_1782_c1 | 3300050513 | Bacteria | 11887 |
| 773 | nmdc:mga0rr50_243_c1 | 3300050513 | Bacteria | 29548 |
| 774 | nmdc:mga0rr50_60707_c1 | 3300050513 | Unclassified | 2845 |
| 775 | nmdc:mga08x19_3466_c1 | 3300050514 | Bacteria | 9402 |
| 776 | nmdc:mga08x19_5146_c1 | 3300050514 | Bacteria | 7733 |
| 777 | nmdc:mga08x19_6615_c1 | 3300050514 | Bacteria | 6871 |
| 778 | nmdc:mga0a205_1355_c1 | 3300050515 | Bacteria | 20638 |
| 779 | nmdc:mga0a205_6675_c1 | 3300050515 | Bacteria | 10441 |
| 780 | Ga0466962_0012149 | 3300061719 | Bacteria | 4140 |
| 781 | Ga0265314_10122100 | |||
| 782 | JGI24752J21851_1000390 | |||
| 783 | JGI24034J26672_10000129 | |||
| 784 | JGI24751J29686_10001442 | |||
| 785 | rootH1_10241910 | |||
| 786 | Ga0065715_10089775 | |||
| 787 | Ga0070676_10007708 | |||
| 788 | Ga0070683_100000874 | |||
| 789 | Ga0070683_100034849 | |||
| 790 | Ga0070683_100060879 | |||
| 791 | Ga0070683_100093742 | |||
| 792 | Ga0070683_100248456 | |||
| 793 | Ga0070690_100067121 | |||
| 794 | Ga0070690_100159133 | |||
| 795 | Ga0070670_100003741 | |||
| 796 | Ga0070670_100026465 | |||
| 797 | Ga0070670_100226376 | |||
| 798 | Ga0068869_100001259 | |||
| 799 | Ga0068869_100305291 | |||
| 800 | Ga0070666_10014887 | |||
| 801 | Ga0070680_100038523 | |||
| 802 | Ga0070680_100049796 | |||
| 803 | Ga0070680_100058460 | |||
| 804 | Ga0070680_100090745 | |||
| 805 | Ga0068868_100002212 | |||
| 806 | Ga0068868_100005870 | |||
| 807 | Ga0068868_100025275 | |||
| 808 | Ga0068868_100031146 | |||
| 809 | Ga0068868_100064402 | |||
| 810 | Ga0068868_100103234 | |||
| 811 | Ga0070660_100018106 | |||
| 812 | Ga0070660_100103711 | |||
| 813 | Ga0070689_100019148 | |||
| 814 | Ga0070689_100056271 | |||
| 815 | Ga0070661_100025625 | |||
| 816 | Ga0070661_100039504 | |||
| 817 | Ga0070668_100005837 | |||
| 818 | Ga0070669_100009592 | |||
| 819 | Ga0070669_100432344 | |||
| 820 | Ga0070675_100083912 | |||
| 821 | Ga0070675_100242713 | |||
| 822 | Ga0070671_100040265 | |||
| 823 | Ga0070671_100090334 | |||
| 824 | Ga0070671_100130936 | |||
| 825 | Ga0070673_100013626 | |||
| 826 | Ga0070673_100054833 | |||
| 827 | Ga0070688_100003095 | |||
| 828 | Ga0070659_100009927 | |||
| 829 | Ga0070659_100105820 | |||
| 830 | Ga0070659_100131464 | |||
| 831 | Ga0070667_100007683 | |||
| 832 | Ga0070709_10010147 | |||
| 833 | Ga0070709_10020841 | |||
| 834 | Ga0070709_10083051 | |||
| 835 | Ga0070709_10092779 | |||
| 836 | Ga0070709_10114906 | |||
| 837 | Ga0070709_10222938 | |||
| 838 | Ga0070709_10263946 | |||
| 839 | Ga0070709_10336952 | |||
| 840 | Ga0070714_100006206 | |||
| 841 | Ga0070714_100007756 | |||
| 842 | Ga0070714_100094857 | |||
| 843 | Ga0070714_100125332 | |||
| 844 | Ga0070714_100158612 | |||
| 845 | Ga0070714_100210640 | |||
| 846 | Ga0070714_100237689 | |||
| 847 | Ga0070713_100000520 | |||
| 848 | Ga0070713_100001539 | |||
| 849 | Ga0070713_100003494 | |||
| 850 | Ga0070713_100016785 | |||
| 851 | Ga0070713_100045274 | |||
| 852 | Ga0070713_100059275 | |||
| 853 | Ga0070713_100068251 | |||
| 854 | Ga0070713_100078235 | |||
| 855 | Ga0070713_100085090 | |||
| 856 | Ga0070713_100089550 | |||
| 857 | Ga0070713_100113642 | |||
| 858 | Ga0070713_100194349 | |||
| 859 | Ga0070713_100308887 | |||
| 860 | Ga0070710_10002794 | |||
| 861 | Ga0070710_10031978 | |||
| 862 | Ga0070710_10033231 | |||
| 863 | Ga0070710_10291422 | |||
| 864 | Ga0070711_100000560 | |||
| 865 | Ga0070711_100001162 | |||
| 866 | Ga0070711_100034950 | |||
| 867 | Ga0070711_100077972 | |||
| 868 | Ga0070711_100285549 | |||
| 869 | Ga0070711_100444786 | |||
| 870 | Ga0070700_100158923 | |||
| 871 | Ga0070708_100000527 | |||
| 872 | Ga0070708_100001360 | |||
| 873 | Ga0070708_100007787 | |||
| 874 | Ga0070708_100016031 | |||
| 875 | Ga0070708_100021654 | |||
| 876 | Ga0070708_100025395 | |||
| 877 | Ga0070708_100028671 | |||
| 878 | Ga0070663_100000458 | |||
| 879 | Ga0070678_100174950 | |||
| 880 | Ga0070678_100268194 | |||
| 881 | Ga0070678_100279117 | |||
| 882 | Ga0070662_100395149 | |||
| 883 | Ga0070681_10000026 | |||
| 884 | Ga0070681_10043896 | |||
| 885 | Ga0070681_10079554 | |||
| 886 | Ga0070681_10121877 | |||
| 887 | Ga0070681_10511113 | |||
| 888 | Ga0068867_100004366 | |||
| 889 | Ga0068867_100014627 | |||
| 890 | Ga0068867_100023296 | |||
| 891 | Ga0068867_100049359 | |||
| 892 | Ga0068867_100446887 | |||
| 893 | Ga0070685_10000811 | |||
| 894 | Ga0070706_100000991 | |||
| 895 | Ga0070706_100005854 | |||
| 896 | Ga0070706_100014724 | |||
| 897 | Ga0070706_100015879 | |||
| 898 | Ga0070706_100135520 | |||
| 899 | Ga0070707_100001774 | |||
| 900 | Ga0070707_100007949 | |||
| 901 | Ga0070707_100027902 | |||
| 902 | Ga0070707_100052624 | |||
| 903 | Ga0070707_100087850 | |||
| 904 | Ga0070707_100258819 | |||
| 905 | Ga0070707_100548184 | |||
| 906 | Ga0070698_100000182 | |||
| 907 | Ga0070698_100004474 | |||
| 908 | Ga0070698_100037802 | |||
| 909 | Ga0070699_100017051 | |||
| 910 | Ga0070699_100019075 | |||
| 911 | Ga0070699_100078263 | |||
| 912 | Ga0070699_100103823 | |||
| 913 | Ga0070699_100143052 | |||
| 914 | Ga0070699_100170584 | |||
| 915 | Ga0070679_100096586 | |||
| 916 | Ga0070679_100446243 | |||
| 917 | Ga0070684_100003033 | |||
| 918 | Ga0070684_100003393 | |||
| 919 | Ga0070684_100013112 | |||
| 920 | Ga0070684_100140568 | |||
| 921 | Ga0070697_100000145 | |||
| 922 | Ga0070697_100000271 | |||
| 923 | Ga0070697_100002886 | |||
| 924 | Ga0070697_100005158 | |||
| 925 | Ga0070697_100007316 | |||
| 926 | Ga0070697_100007687 | |||
| 927 | Ga0070697_100024053 | |||
| 928 | Ga0070697_100033556 | |||
| 929 | Ga0070697_100044316 | |||
| 930 | Ga0068853_100046299 | |||
| 931 | Ga0068853_100053559 | |||
| 932 | Ga0068853_100312095 | |||
| 933 | Ga0070672_100001128 | |||
| 934 | Ga0070686_100002550 | |||
| 935 | Ga0070686_100054073 | |||
| 936 | Ga0070695_100003833 | |||
| 937 | Ga0070695_100127534 | |||
| 938 | Ga0070693_100051037 | |||
| 939 | Ga0070693_100058767 | |||
| 940 | Ga0070693_100060882 | |||
| 941 | Ga0070665_100064783 | |||
| 942 | Ga0070665_100138639 | |||
| 943 | Ga0068855_100000295 | |||
| 944 | Ga0068855_100001199 | |||
| 945 | Ga0068855_100020709 | |||
| 946 | Ga0068855_100046866 | |||
| 947 | Ga0068855_100073906 | |||
| 948 | Ga0068855_100096201 | |||
| 949 | Ga0068855_100159434 | |||
| 950 | Ga0068855_100403741 | |||
| 951 | Ga0070664_100003800 | |||
| 952 | Ga0070664_100006609 | |||
| 953 | Ga0070664_100027366 | |||
| 954 | Ga0070664_100088228 | |||
| 955 | Ga0070664_100288390 | |||
| 956 | Ga0070664_100585976 | |||
| 957 | Ga0068857_100000484 | |||
| 958 | Ga0068857_100024639 | |||
| 959 | Ga0068857_100036232 | |||
| 960 | Ga0068857_100038182 | |||
| 961 | Ga0068857_100216392 | |||
| 962 | Ga0068854_100004252 | |||
| 963 | Ga0068854_100011793 | |||
| 964 | Ga0068854_100015375 | |||
| 965 | Ga0068854_100026498 | |||
| 966 | Ga0068854_100068332 | |||
| 967 | Ga0068854_100111747 | |||
| 968 | Ga0068854_100165163 | |||
| 969 | Ga0068854_100544504 | |||
| 970 | Ga0068856_100000574 | |||
| 971 | Ga0068856_100001473 | |||
| 972 | Ga0068856_100001552 | |||
| 973 | Ga0068856_100002096 | |||
| 974 | Ga0068856_100002636 | |||
| 975 | Ga0068856_100012186 | |||
| 976 | Ga0068856_100018702 | |||
| 977 | Ga0068856_100043593 | |||
| 978 | Ga0068856_100067880 | |||
| 979 | Ga0068856_100266142 | |||
| 980 | Ga0068852_100035645 | |||
| 981 | Ga0068852_100141970 | |||
| 982 | Ga0068859_100001753 | |||
| 983 | Ga0068859_100013963 | |||
| 984 | Ga0068859_100014947 | |||
| 985 | Ga0068859_100038558 | |||
| 986 | Ga0068864_100003537 | |||
| 987 | Ga0068864_100018866 | |||
| 988 | Ga0068864_100061168 | |||
| 989 | Ga0068866_10000590 | |||
| 990 | Ga0068866_10065720 | |||
| 991 | Ga0068861_100081852 | |||
| 992 | Ga0068851_10037717 | |||
| 993 | Ga0068851_10047244 | |||
| 994 | Ga0068851_10051076 | |||
| 995 | Ga0068870_10003193 | |||
| 996 | Ga0068863_100012092 | |||
| 997 | Ga0068863_100019423 | |||
| 998 | Ga0068863_100048187 | |||
| 999 | Ga0068863_100411389 | |||
| 1000 | Ga0068858_100011368 | |||
| 1001 | Ga0068858_100018025 | |||
| 1002 | Ga0068858_100028176 | |||
| 1003 | Ga0068858_100054493 | |||
| 1004 | Ga0068858_100120513 | |||
| 1005 | Ga0068858_100263312 | |||
| 1006 | Ga0068860_100026939 | |||
| 1007 | Ga0068860_100095363 | |||
| 1008 | Ga0068860_100113811 | |||
| 1009 | Ga0068860_100360517 | |||
| 1010 | Ga0068862_100005527 | |||
| 1011 | Ga0068862_100060777 | |||
| 1012 | Ga0081540_1099844 | |||
| 1013 | Ga0070717_10000274 | |||
| 1014 | Ga0070717_10000783 | |||
| 1015 | Ga0070717_10001050 | |||
| 1016 | Ga0070717_10009099 | |||
| 1017 | Ga0070717_10030403 | |||
| 1018 | Ga0070717_10045002 | |||
| 1019 | Ga0070717_10068722 | |||
| 1020 | Ga0070717_10074893 | |||
| 1021 | Ga0070717_10088234 | |||
| 1022 | Ga0070717_10236198 | |||
| 1023 | Ga0070715_10001939 | |||
| 1024 | Ga0070715_10034659 | |||
| 1025 | Ga0070716_100000931 | |||
| 1026 | Ga0070716_100002361 | |||
| 1027 | Ga0070716_100010444 | |||
| 1028 | Ga0070716_100021570 | |||
| 1029 | Ga0070716_100034566 | |||
| 1030 | Ga0070712_100000472 | |||
| 1031 | Ga0070712_100002128 | |||
| 1032 | Ga0070712_100002493 | |||
| 1033 | Ga0070712_100021241 | |||
| 1034 | Ga0070712_100022151 | |||
| 1035 | Ga0070712_100031371 | |||
| 1036 | Ga0097621_100000659 | |||
| 1037 | Ga0097621_100002693 | |||
| 1038 | Ga0097621_100003898 | |||
| 1039 | Ga0097621_100025508 | |||
| 1040 | Ga0097621_100070242 | |||
| 1041 | Ga0097621_100074373 | |||
| 1042 | Ga0068871_100000288 | |||
| 1043 | Ga0068871_100000643 | |||
| 1044 | Ga0068871_100006416 | |||
| 1045 | Ga0068871_100043198 | |||
| 1046 | Ga0075433_10000459 | |||
| 1047 | Ga0075433_10019585 | |||
| 1048 | Ga0075434_100004992 | |||
| 1049 | Ga0075434_100005525 | |||
| 1050 | Ga0068865_100008147 | |||
| 1051 | Ga0068865_100155298 | |||
| 1052 | Ga0068865_100184076 | |||
| 1053 | Ga0075436_100001031 | |||
| 1054 | Ga0075436_100002883 | |||
| 1055 | Ga0075436_100008046 | |||
| 1056 | Ga0097620_100001753 | |||
| 1057 | Ga0097620_100013963 | |||
| 1058 | Ga0097620_100014947 | |||
| 1059 | Ga0097620_100038559 | |||
| 1060 | Ga0075435_100001052 | |||
| 1061 | Ga0075435_100076958 | |||
| 1062 | Ga0075435_100077671 | |||
| 1063 | Ga0075435_100209254 | |||
| 1064 | Ga0099795_10024293 | |||
| 1065 | Ga0099795_10031359 | |||
| 1066 | Ga0105250_10008592 | |||
| 1067 | Ga0105240_10030063 | |||
| 1068 | Ga0105240_10059389 | |||
| 1069 | Ga0105240_10102189 | |||
| 1070 | Ga0105240_10121398 | |||
| 1071 | Ga0105240_10126503 | |||
| 1072 | Ga0105240_10475906 | |||
| 1073 | Ga0105240_10779895 | |||
| 1074 | Ga0105245_10009096 | |||
| 1075 | Ga0105245_10013607 | |||
| 1076 | Ga0105245_10014887 | |||
| 1077 | Ga0105245_10027136 | |||
| 1078 | Ga0105245_10050356 | |||
| 1079 | Ga0105245_10179249 | |||
| 1080 | Ga0105245_10351785 | |||
| 1081 | Ga0105247_10064280 | |||
| 1082 | Ga0114129_10128091 | |||
| 1083 | Ga0105243_10087816 | |||
| 1084 | Ga0105241_10004698 | |||
| 1085 | Ga0105241_10018956 | |||
| 1086 | Ga0105241_10028983 | |||
| 1087 | Ga0105241_10067422 | |||
| 1088 | Ga0105241_10105268 | |||
| 1089 | Ga0105241_10118398 | |||
| 1090 | Ga0105241_10137399 | |||
| 1091 | Ga0105241_10468173 | |||
| 1092 | Ga0105241_10493018 | |||
| 1093 | Ga0105242_10015449 | |||
| 1094 | Ga0105242_10026278 | |||
| 1095 | Ga0105242_10243086 | |||
| 1096 | Ga0105248_10003676 | |||
| 1097 | Ga0105248_10131279 | |||
| 1098 | Ga0105248_10145134 | |||
| 1099 | Ga0105248_10286693 | |||
| 1100 | Ga0105237_10011049 | |||
| 1101 | Ga0105237_10041433 | |||
| 1102 | Ga0105237_10058508 | |||
| 1103 | Ga0105237_10072346 | |||
| 1104 | Ga0105237_10202261 | |||
| 1105 | Ga0105238_10000188 | |||
| 1106 | Ga0105238_10018779 | |||
| 1107 | Ga0105238_10018989 | |||
| 1108 | Ga0105249_10058909 | |||
| 1109 | Ga0105249_10221038 | |||
| 1110 | Ga0105239_10014081 | |||
| 1111 | Ga0105239_10298269 | |||
| 1112 | Ga0105246_10002167 | |||
| 1113 | Ga0105246_10264557 | |||
| 1114 | Ga0157373_10020329 | |||
| 1115 | Ga0157373_10212128 | |||
| 1116 | Ga0157373_10247583 | |||
| 1117 | Ga0157371_10007230 | |||
| 1118 | Ga0157371_10018449 | |||
| 1119 | Ga0157371_10143674 | |||
| 1120 | Ga0157370_10183298 | |||
| 1121 | Ga0157369_10000124 | |||
| 1122 | Ga0157369_10042601 | |||
| 1123 | Ga0157369_10071438 | |||
| 1124 | Ga0157369_10241145 | |||
| 1125 | Ga0157369_10289140 | |||
| 1126 | Ga0157369_10384237 | |||
| 1127 | Ga0157374_10000705 | |||
| 1128 | Ga0157374_10004648 | |||
| 1129 | Ga0157374_10012459 | |||
| 1130 | Ga0157374_10021739 | |||
| 1131 | Ga0157374_10049433 | |||
| 1132 | Ga0157378_10000020 | |||
| 1133 | Ga0157378_10001169 | |||
| 1134 | Ga0157378_10001927 | |||
| 1135 | Ga0157378_10012122 | |||
| 1136 | Ga0157378_10086629 | |||
| 1137 | Ga0157378_10131150 | |||
| 1138 | Ga0157378_10133126 | |||
| 1139 | Ga0157378_10493661 | |||
| 1140 | Ga0163162_10004938 | |||
| 1141 | Ga0163162_10012372 | |||
| 1142 | Ga0163162_10030363 | |||
| 1143 | Ga0157372_10000084 | |||
| 1144 | Ga0157372_10000328 | |||
| 1145 | Ga0157372_10000579 | |||
| 1146 | Ga0157372_10001691 | |||
| 1147 | Ga0157372_10007626 | |||
| 1148 | Ga0157372_10007962 | |||
| 1149 | Ga0157372_10024610 | |||
| 1150 | Ga0157372_10032366 | |||
| 1151 | Ga0157372_10048056 | |||
| 1152 | Ga0157372_10056122 | |||
| 1153 | Ga0157372_10107446 | |||
| 1154 | Ga0157372_10191958 | |||
| 1155 | Ga0157372_10379357 | |||
| 1156 | Ga0157375_10099880 | |||
| 1157 | Ga0163163_10003536 | |||
| 1158 | Ga0163163_10177088 | |||
| 1159 | Ga0157380_10169299 | |||
| 1160 | Ga0182008_10057254 | |||
| 1161 | Ga0157377_10002893 | |||
| 1162 | Ga0157377_10190573 | |||
| 1163 | Ga0157379_10015082 | |||
| 1164 | Ga0157379_10038889 | |||
| 1165 | Ga0157379_10038995 | |||
| 1166 | Ga0157379_10592228 | |||
| 1167 | Ga0157376_10046101 | |||
| 1168 | Ga0157376_10056336 | |||
| 1169 | Ga0157376_10117563 | |||
| 1170 | Ga0157376_10169502 | |||
| 1171 | Ga0182005_1013330 | |||
| 1172 | Ga0163161_10003774 | |||
| 1173 | Ga0213873_10001054 | |||
| 1174 | Ga0224570_100396 | |||
| 1175 | Ga0224572_1001820 | |||
| 1176 | Ga0228598_1000623 | |||
| 1177 | Ga0228598_1005928 | |||
| 1178 | Ga0228598_1009110 | |||
| 1179 | Ga0207656_10021502 | |||
| 1180 | Ga0207696_1030889 | |||
| 1181 | Ga0207692_10003776 | |||
| 1182 | Ga0207692_10006241 | |||
| 1183 | Ga0207692_10148631 | |||
| 1184 | Ga0207710_10074249 | |||
| 1185 | Ga0207688_10022711 | |||
| 1186 | Ga0207680_10145864 | |||
| 1187 | Ga0207647_10004664 | |||
| 1188 | Ga0207647_10010375 | |||
| 1189 | Ga0207647_10062588 | |||
| 1190 | Ga0207685_10004859 | |||
| 1191 | Ga0207685_10007485 | |||
| 1192 | Ga0207699_10002040 | |||
| 1193 | Ga0207699_10053961 | |||
| 1194 | Ga0207699_10080961 | |||
| 1195 | Ga0207699_10087373 | |||
| 1196 | Ga0207699_10147899 | |||
| 1197 | Ga0207645_10000181 | |||
| 1198 | Ga0207645_10020422 | |||
| 1199 | Ga0207643_10002181 | |||
| 1200 | Ga0207684_10001275 | |||
| 1201 | Ga0207684_10001561 | |||
| 1202 | Ga0207684_10002945 | |||
| 1203 | Ga0207684_10067642 | |||
| 1204 | Ga0207654_10004137 | |||
| 1205 | Ga0207654_10018300 | |||
| 1206 | Ga0207654_10020317 | |||
| 1207 | Ga0207654_10105940 | |||
| 1208 | Ga0207654_10237373 | |||
| 1209 | Ga0207707_10002179 | |||
| 1210 | Ga0207707_10018423 | |||
| 1211 | Ga0207707_10018929 | |||
| 1212 | Ga0207707_10076732 | |||
| 1213 | Ga0207707_10228457 | |||
| 1214 | Ga0207695_10057023 | |||
| 1215 | Ga0207695_10099615 | |||
| 1216 | Ga0207695_10109776 | |||
| 1217 | Ga0207695_10380141 | |||
| 1218 | Ga0207671_10085456 | |||
| 1219 | Ga0207671_10102110 | |||
| 1220 | Ga0207693_10000621 | |||
| 1221 | Ga0207693_10000631 | |||
| 1222 | Ga0207693_10001998 | |||
| 1223 | Ga0207693_10014811 | |||
| 1224 | Ga0207693_10015842 | |||
| 1225 | Ga0207693_10029176 | |||
| 1226 | Ga0207663_10005255 | |||
| 1227 | Ga0207663_10007637 | |||
| 1228 | Ga0207663_10139037 | |||
| 1229 | Ga0207663_10176798 | |||
| 1230 | Ga0207663_10385079 | |||
| 1231 | Ga0207660_10012689 | |||
| 1232 | Ga0207660_10030517 | |||
| 1233 | Ga0207657_10001605 | |||
| 1234 | Ga0207657_10004718 | |||
| 1235 | Ga0207657_10007241 | |||
| 1236 | Ga0207649_10036629 | |||
| 1237 | Ga0207649_10045908 | |||
| 1238 | Ga0207649_10113279 | |||
| 1239 | Ga0207652_10103383 | |||
| 1240 | Ga0207646_10003711 | |||
| 1241 | Ga0207646_10004583 | |||
| 1242 | Ga0207646_10031655 | |||
| 1243 | Ga0207646_10078034 | |||
| 1244 | Ga0207646_10103228 | |||
| 1245 | Ga0207646_10314468 | |||
| 1246 | Ga0207681_10078654 | |||
| 1247 | Ga0207694_10003741 | |||
| 1248 | Ga0207694_10039145 | |||
| 1249 | Ga0207650_10000651 | |||
| 1250 | Ga0207650_10107391 | |||
| 1251 | Ga0207659_10018615 | |||
| 1252 | Ga0207687_10014619 | |||
| 1253 | Ga0207700_10000734 | |||
| 1254 | Ga0207700_10002368 | |||
| 1255 | Ga0207700_10009198 | |||
| 1256 | Ga0207700_10026245 | |||
| 1257 | Ga0207700_10066446 | |||
| 1258 | Ga0207700_10128490 | |||
| 1259 | Ga0207700_10268306 | |||
| 1260 | Ga0207700_10292636 | |||
| 1261 | Ga0207700_10295912 | |||
| 1262 | Ga0207700_10606108 | |||
| 1263 | Ga0207664_10000117 | |||
| 1264 | Ga0207664_10014623 | |||
| 1265 | Ga0207664_10059138 | |||
| 1266 | Ga0207664_10068669 | |||
| 1267 | Ga0207664_10103628 | |||
| 1268 | Ga0207664_10137815 | |||
| 1269 | Ga0207664_10150208 | |||
| 1270 | Ga0207664_10155982 | |||
| 1271 | Ga0207664_10197160 | |||
| 1272 | Ga0207644_10004055 | |||
| 1273 | Ga0207706_10000613 | |||
| 1274 | Ga0207706_10006173 | |||
| 1275 | Ga0207686_10047637 | |||
| 1276 | Ga0207686_10127014 | |||
| 1277 | Ga0207704_10111123 | |||
| 1278 | Ga0207704_10148113 | |||
| 1279 | Ga0207665_10001868 | |||
| 1280 | Ga0207665_10004699 | |||
| 1281 | Ga0207665_10004932 | |||
| 1282 | Ga0207665_10007640 | |||
| 1283 | Ga0207665_10033810 | |||
| 1284 | Ga0207665_10041043 | |||
| 1285 | Ga0207665_10177471 | |||
| 1286 | Ga0207691_10002042 | |||
| 1287 | Ga0207711_10014633 | |||
| 1288 | Ga0207689_10003226 | |||
| 1289 | Ga0207689_10004719 | |||
| 1290 | Ga0207661_10002937 | |||
| 1291 | Ga0207661_10023885 | |||
| 1292 | Ga0207661_10118073 | |||
| 1293 | Ga0207661_10267290 | |||
| 1294 | Ga0207679_10000702 | |||
| 1295 | Ga0207679_10001183 | |||
| 1296 | Ga0207679_10039065 | |||
| 1297 | Ga0207679_10108707 | |||
| 1298 | Ga0207667_10000213 | |||
| 1299 | Ga0207667_10000959 | |||
| 1300 | Ga0207667_10037195 | |||
| 1301 | Ga0207651_10111832 | |||
| 1302 | Ga0207712_10061621 | |||
| 1303 | Ga0207712_10228095 | |||
| 1304 | Ga0207668_10017634 | |||
| 1305 | Ga0207640_10021477 | |||
| 1306 | Ga0207640_10034585 | |||
| 1307 | Ga0207640_10047329 | |||
| 1308 | Ga0207640_10060685 | |||
| 1309 | Ga0207640_10073000 | |||
| 1310 | Ga0207640_10149992 | |||
| 1311 | Ga0207658_10061736 | |||
| 1312 | Ga0207658_10505892 | |||
| 1313 | Ga0207677_10011130 | |||
| 1314 | Ga0207677_10038872 | |||
| 1315 | Ga0207677_10048257 | |||
| 1316 | Ga0207677_10051949 | |||
| 1317 | Ga0207677_10066899 | |||
| 1318 | Ga0207677_10078308 | |||
| 1319 | Ga0207703_10003860 | |||
| 1320 | Ga0207703_10033201 | |||
| 1321 | Ga0207639_10021287 | |||
| 1322 | Ga0207639_10056542 | |||
| 1323 | Ga0207639_10196414 | |||
| 1324 | Ga0207639_10239384 | |||
| 1325 | Ga0207678_10001157 | |||
| 1326 | Ga0207678_10001666 | |||
| 1327 | Ga0207702_10000114 | |||
| 1328 | Ga0207702_10000913 | |||
| 1329 | Ga0207702_10001223 | |||
| 1330 | Ga0207702_10031823 | |||
| 1331 | Ga0207702_10053599 | |||
| 1332 | Ga0207702_10065929 | |||
| 1333 | Ga0207702_10407610 | |||
| 1334 | Ga0207641_10001793 | |||
| 1335 | Ga0207641_10014846 | |||
| 1336 | Ga0207641_10155197 | |||
| 1337 | Ga0207648_10002054 | |||
| 1338 | Ga0207648_10008217 | |||
| 1339 | Ga0207648_10058095 | |||
| 1340 | Ga0207648_10474391 | |||
| 1341 | Ga0207676_10001106 | |||
| 1342 | Ga0207676_10049263 | |||
| 1343 | Ga0207676_10189804 | |||
| 1344 | Ga0207676_10431791 | |||
| 1345 | Ga0207674_10000668 | |||
| 1346 | Ga0207674_10006933 | |||
| 1347 | Ga0207674_10043536 | |||
| 1348 | Ga0207674_10052327 | |||
| 1349 | Ga0207674_10228461 | |||
| 1350 | Ga0207675_100014488 | |||
| 1351 | Ga0207675_100249992 | |||
| 1352 | Ga0207683_10000217 | |||
| 1353 | Ga0207683_10297023 | |||
| 1354 | Ga0207698_10024182 | |||
| 1355 | Ga0265356_1000474 | |||
| 1356 | Ga0265355_1003372 | |||
| 1357 | Ga0268266_10036915 | |||
| 1358 | Ga0268265_10005101 | |||
| 1359 | Ga0268265_10021210 | |||
| 1360 | Ga0268264_10027650 | |||
| 1361 | Ga0268264_10318532 | |||
| 1362 | Ga0265338_10009914 | |||
| 1363 | Ga0265338_10033226 | |||
| 1364 | Ga0265762_1000850 | |||
| 1365 | Ga0265762_1002978 | |||
| 1366 | Ga0265762_1004876 | |||
| 1367 | Ga0265762_1006483 | |||
| 1368 | Ga0265762_1013410 | |||
| 1369 | Ga0265760_10000152 | |||
| 1370 | Ga0265760_10001143 | |||
| 1371 | Ga0265760_10013302 | |||
| 1372 | Ga0265760_10018906 | |||
| 1373 | Ga0265760_10037118 | |||
| 1374 | Ga0265760_10058333 | |||
| 1375 | Ga0265330_10039838 | |||
| 1376 | Ga0265328_10012033 | |||
| 1377 | Ga0265340_10022887 | |||
| 1378 | Ga0265340_10092646 | |||
| 1379 | Ga0265340_10107286 | |||
| 1380 | Ga0265340_10169775 | |||
| 1381 | Ga0265339_10007498 | |||
| 1382 | Ga0265339_10024104 | |||
| 1383 | Ga0265339_10029382 | |||
| 1384 | Ga0265339_10042915 | |||
| 1385 | Ga0265316_10006473 | |||
| 1386 | Ga0265316_10015429 | |||
| 1387 | Ga0265316_10035416 | |||
| 1388 | Ga0265314_10003741 | |||
| 1389 | Ga0265314_10025177 | |||
| 1390 | Ga0265314_10150417 | |||
| 1391 | Ga0265342_10072306 | |||
| 1392 | Ga0307410_10001054 | |||
| 1393 | Ga0307410_10032705 | |||
| 1394 | Ga0307410_10074596 | |||
| 1395 | Ga0307406_10095810 | |||
| 1396 | Ga0307409_100002165 | |||
| 1397 | Ga0307416_100044581 | |||
| 1398 | Ga0307414_10409639 | |||
| 1399 | Ga0307411_10132537 | |||
| 1400 | Ga0307411_10154275 | |||
| 1401 | Ga0307415_100046956 | |||
| 1402 | Ga0373926_0007001 | |||
| 1403 | Ga0373926_0044469 | |||
| 1404 | Ga0373926_0070656 | |||
| 1405 | Ga0373934_0044823 | |||
| 1406 | Ga0373923_0010393 | |||
| 1407 | Ga0373923_0040134 | |||
| 1408 | Ga0373923_0127121 | |||
| 1409 | Ga0373936_0000893 | |||
| 1410 | Ga0373936_0007997 | |||
| 1411 | Ga0373945_0000867 | |||
| 1412 | Ga0373953_0006262 | |||
| 1413 | Ga0373954_0004867 | |||
| 1414 | Ga0373956_0003484 | |||
| 1415 | Ga0373960_0010570 | |||
| 1416 | Ga0373943_0000021 | |||
| 1417 | Ga0373943_0041727 | |||
| 1418 | Ga0373943_0098096 | |||
| 1419 | Ga0373943_0168880 | |||
| 1420 | Ga0373946_0152454 | |||
| 1421 | Ga0373955_0033049 | |||
| 1422 | Ga0373955_0119172 | |||
| 1423 | Ga0373924_0047968 | |||
| 1424 | Ga0373931_0103269 | |||
| 1425 | Ga0373931_0134500 | |||
| 1426 | Ga0373935_0003051 | |||
| 1427 | Ga0373935_0003262 | |||
| 1428 | Ga0373935_0109106 | |||
| 1429 | Ga0373935_0114862 | |||
| 1430 | Ga0373927_0000909 | |||
| 1431 | Ga0373927_0016042 | |||
| 1432 | Ga0373927_0052289 | |||
| 1433 | Ga0373927_0092478 | |||
| 1434 | Ga0373927_0279343 | |||
| 1435 | Ga0373933_0052077 | |||
| 1436 | Ga0373933_0336859 | |||
| 1437 | Ga0373933_0418909 | |||
| 1438 | Ga0373947_0001157 | |||
| 1439 | Ga0373947_0004511 | |||
| 1440 | Ga0373947_0126605 | |||
| 1441 | Ga0373947_0182737 | |||
| 1442 | Ga0373947_0222987 | |||
| 1443 | Ga0373947_0254926 | |||
| 1444 | Ga0373937_0033979 | |||
| 1445 | Ga0373937_0035209 | |||
| 1446 | Ga0373937_0097831 | |||
| 1447 | Ga0373937_0359939 | |||
| 1448 | Ga0265778_000654 | |||
| 1449 | Ga0373925_0000367 | |||
| 1450 | Ga0373925_0002436 | |||
| 1451 | Ga0373925_0017086 | |||
| 1452 | Ga0373925_0103233 | |||
| 1453 | Ga0373925_0395147 | |||
| 1454 | Ga0436364_0218463 | |||
| 1455 | Ga0436360_0377084 | |||
| 1456 | Ga0436363_0052309 | |||
| 1457 | Ga0436363_0770082 | |||
| 1458 | Ga0436363_0897691 | |||
| 1459 | Ga0436362_0990872 | |||
| 1460 | Ga0451577_0002999 | |||
| 1461 | Ga0453683_0050039 | |||
| 1462 | Ga0453683_0058256 | |||
| 1463 | Ga0466963_0065547 | |||
| 1464 | Ga0466963_0071639 | |||
| 1465 | Ga0453684_0000686 | |||
| 1466 | Ga0466959_0001551 | |||
| 1467 | Ga0451576_0010752 | |||
| 1468 | Ga0451576_0045843 | |||
| 1469 | Ga0451576_0071094 | |||
| 1470 | Ga0451576_0632984 | |||
| 1471 | Ga0466967_0038204 | |||
| 1472 | Ga0466967_0144255 | |||
| 1473 | Ga0495603_0070095 | |||
| 1474 | Ga0495653_0188783 | |||
| 1475 | Ga0495580_0000074 | |||
| 1476 | Ga0495580_0000187 | |||
| 1477 | Ga0495580_0003275 | |||
| 1478 | Ga0495580_0004661 | |||
| 1479 | Ga0495580_0013802 | |||
| 1480 | Ga0495580_0016952 | |||
| 1481 | Ga0495580_0017853 | |||
| 1482 | Ga0495580_0044621 | |||
| 1483 | Ga0495580_0068335 | |||
| 1484 | Ga0495580_0075872 | |||
| 1485 | Ga0495580_0091330 | |||
| 1486 | Ga0495582_0001534 | |||
| 1487 | Ga0495582_0002740 | |||
| 1488 | Ga0495582_0045143 | |||
| 1489 | Ga0495639_0033769 | |||
| 1490 | Ga0495664_0213719 | |||
| 1491 | Ga0495666_0100204 | |||
| 1492 | Ga0495652_0320938 | |||
| 1493 | Ga0495665_0007953 | |||
| 1494 | Ga0495665_0095529 | |||
| 1495 | Ga0495665_0100263 | |||
| 1496 | Ga0495665_0120341 | |||
| 1497 | Ga0495645_0192886 | |||
| 1498 | Ga0495599_0034208 | |||
| 1499 | Ga0495647_0046715 | |||
| 1500 | Ga0495624_0179442 | |||
| 1501 | Ga0495674_0066054 | |||
| 1502 | Ga0495593_0113868 | |||
| 1503 | Ga0496100_0051757 | |||
| 1504 | Ga0496100_0320666 | |||
| 1505 | Ga0496101_0009652 | |||
| 1506 | Ga0496101_0210216 | |||
| 1507 | Ga0496102_0001348 | |||
| 1508 | Ga0496102_0037985 | |||
| 1509 | Ga0496102_0051259 | |||
| 1510 | Ga0496102_0249580 | |||
| 1511 | Ga0496102_0463208 | |||
| 1512 | Ga0496103_0081773 | |||
| 1513 | Ga0496104_0024866 | |||
| 1514 | Ga0496104_0035527 | |||
| 1515 | Ga0496104_0035550 | |||
| 1516 | Ga0496104_0058118 | |||
| 1517 | Ga0496104_0063732 | |||
| 1518 | Ga0496104_0072161 | |||
| 1519 | Ga0496104_0079878 | |||
| 1520 | Ga0496105_0035676 | |||
| 1521 | Ga0496105_0048354 | |||
| 1522 | Ga0496105_0144862 | |||
| 1523 | Ga0496107_0009504 | |||
| 1524 | Ga0496108_0006211 | |||
| 1525 | Ga0496109_0000117 | |||
| 1526 | Ga0496109_0152360 | |||
| 1527 | Ga0496109_0443264 | |||
| 1528 | Ga0496110_0001695 | |||
| 1529 | Ga0496111_0004157 | |||
| 1530 | Ga0496112_0002198 | |||
| 1531 | Ga0496112_0005621 | |||
| 1532 | Ga0496112_0026609 | |||
| 1533 | Ga0496112_0046268 | |||
| 1534 | Ga0496112_0048144 | |||
| 1535 | Ga0496112_0082567 | |||
| 1536 | Ga0496112_0646214 | |||
| 1537 | Ga0496113_0006658 | |||
| 1538 | Ga0496113_0207385 | |||
| 1539 | Ga0496113_0313095 | |||
| 1540 | Ga0496115_0004507 | |||
| 1541 | Ga0496115_0007658 | |||
| 1542 | Ga0496115_0012011 | |||
| 1543 | Ga0496115_0435806 | |||
| 1544 | Ga0501298_004571 | |||
| 1545 | Ga0501299_011185 | |||
| 1546 | Ga0501073_0045379 | |||
| 1547 | Ga0501077_0184876 | |||
| 1548 | Ga0501217_009295 | |||
| 1549 | Ga0501283_016363 | |||
| 1550 | nmdc:mga0n895_22137_c1 | |||
| 1551 | nmdc:mga0n895_518_c1 | |||
| 1552 | nmdc:mga0rr50_1782_c1 | |||
| 1553 | nmdc:mga0rr50_243_c1 | |||
| 1554 | nmdc:mga0rr50_60707_c1 | |||
| 1555 | nmdc:mga08x19_3466_c1 | |||
| 1556 | nmdc:mga08x19_5146_c1 | |||
| 1557 | nmdc:mga08x19_6615_c1 | |||
| 1558 | nmdc:mga0a205_1355_c1 | |||
| 1559 | nmdc:mga0a205_6675_c1 | |||
| 1560 | Ga0466962_0012149 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xb3-assembly6.cif.gz_L | structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] | 0.8988 | 183 | 212 |
| 3jc8-assembly1.cif.gz_Ma | architectural model of the type iva pilus machine in a piliated state | 0.8256 | 10 | 279 |
| 2ych-assembly1.cif.gz_A | pilm-piln type iv pilus biogenesis complex | 0.8121 | 11 | 298 |
| 5eou-assembly2.cif.gz_B | pseudomonas aeruginosa pilm:piln1-12 bound to atp | 0.7945 | 13 | 298 |
| 2ych-assembly1.cif.gz_A | pilm-piln type iv pilus biogenesis complex | 0.7826 | 11 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XDX2_25_77_3.10.20.370 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.8679 | 185 | 214 | 3.10.20.370 |
| af_A0A0P0Y6D9_42_100_3.10.20.370 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.7627 | 13 | 46 | 3.10.20.370 |
| af_O62361_1_101_3.40.1000.30 | Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; | 0.7527 | 184 | 214 | 3.40.1000.30 |
| af_P45753_11_197_3.30.420.380 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7498 | 17 | 204 | 3.30.420.380 |
| af_P45753_11_197_3.30.420.380 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7327 | 17 | 204 | 3.30.420.380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1Q4V4-F1-model_v4 | Pilus assembly protein PilM | 0.99 | 14 | 299 |
|
| AF-A0A7W1Q4V4-F1-model_v4 | Pilus assembly protein PilM | 0.9832 | 14 | 299 |
|
| AF-A0A2V9N7P8-F1-model_v4 | Pilus assembly protein PilM | 0.9668 | 1 | 299 |
|
| AF-A0A2V9N7P8-F1-model_v4 | Pilus assembly protein PilM | 0.9636 | 1 | 299 |
|
| AF-A0A2V9YNZ1-F1-model_v4 | Pilus assembly protein PilM | 0.9578 | 1 | 299 |
|