F480523

General Info

Members Datasets Scaffolds Average Seq Length
780 267 1560 298

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10122100|Ga0265314_101221002
Length 327
Sequence VRMSRRFNPGIRRGNYSLHESAGYHQIAAMTSTSKHVRRPTLACEIAADRVLAGRAADTGRMVEMAAARELAPGSVVPDLMEANLRDGVAIRQAIESALGSVGGRSRDVIAILPDTAVRVVLLDFETLPAKREEAEAVVRFRLKKSLPFDPNDARISYHAQPAGKGVRAVAAVVLNTVLEEYESAFRDAGYNPGLVMPSMLAALGAADAERPTLVVKVDARTISIAILDQEQLLLFRTLENLRGVTITGDQLAEEVYPSVVFFQDTYKLNIERVYVAGLPEAGGAAPALKNQSGAVVEELVATSQIGSTTGTVPRWRMAGVVGALIS

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.26
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10122100 3300031711 Unclassified 1638
2 JGI24752J21851_1000390 3300001976 Bacteria 6060
3 JGI24034J26672_10000129 3300002239 Bacteria 11394
4 JGI24751J29686_10001442 3300002459 Bacteria 4980
5 rootH1_10241910 3300003323 Bacteria 1881
6 Ga0065715_10089775 3300005293 Bacteria 8553
7 Ga0070676_10007708 3300005328 Bacteria 5780
8 Ga0070683_100000874 3300005329 Bacteria 22347
9 Ga0070683_100034849 3300005329 Unclassified 4600
10 Ga0070683_100060879 3300005329 Unclassified 3509
11 Ga0070683_100093742 3300005329 Bacteria 2822
12 Ga0070683_100248456 3300005329 Bacteria 1692
13 Ga0070690_100067121 3300005330 Bacteria 2323
14 Ga0070690_100159133 3300005330 Bacteria 1546
15 Ga0070670_100003741 3300005331 Bacteria 12667
16 Ga0070670_100026465 3300005331 Bacteria 4990
17 Ga0070670_100226376 3300005331 Bacteria 1627
18 Ga0068869_100001259 3300005334 Bacteria 14960
19 Ga0068869_100305291 3300005334 Unclassified 1286
20 Ga0070666_10014887 3300005335 Unclassified 4956
21 Ga0070680_100038523 3300005336 Bacteria 3866
22 Ga0070680_100049796 3300005336 Unclassified 3416
23 Ga0070680_100058460 3300005336 Bacteria 3153
24 Ga0070680_100090745 3300005336 Bacteria 2529
25 Ga0068868_100002212 3300005338 Bacteria 13438
26 Ga0068868_100005870 3300005338 Bacteria 8658
27 Ga0068868_100025275 3300005338 Bacteria 4515
28 Ga0068868_100031146 3300005338 Bacteria 4095
29 Ga0068868_100064402 3300005338 Unclassified 2910
30 Ga0068868_100103234 3300005338 Bacteria 2309
31 Ga0070660_100018106 3300005339 Bacteria 5140
32 Ga0070660_100103711 3300005339 Bacteria 2255
33 Ga0070689_100019148 3300005340 Bacteria 5057
34 Ga0070689_100056271 3300005340 Bacteria 3049
35 Ga0070661_100025625 3300005344 Bacteria 4240
36 Ga0070661_100039504 3300005344 Bacteria 3438
37 Ga0070668_100005837 3300005347 Bacteria 9127
38 Ga0070669_100009592 3300005353 Bacteria 6892
39 Ga0070669_100432344 3300005353 Unclassified 1082
40 Ga0070675_100083912 3300005354 Bacteria 2660
41 Ga0070675_100242713 3300005354 Bacteria 1574
42 Ga0070671_100040265 3300005355 Bacteria 3881
43 Ga0070671_100090334 3300005355 Archaea 2564
44 Ga0070671_100130936 3300005355 Unclassified 2113
45 Ga0070673_100013626 3300005364 Bacteria 5632
46 Ga0070673_100054833 3300005364 Bacteria 3138
47 Ga0070688_100003095 3300005365 Bacteria 8503
48 Ga0070659_100009927 3300005366 Bacteria 7001
49 Ga0070659_100105820 3300005366 Bacteria 2267
50 Ga0070659_100131464 3300005366 Bacteria 2033
51 Ga0070667_100007683 3300005367 Bacteria 8943
52 Ga0070709_10010147 3300005434 Bacteria 5207
53 Ga0070709_10020841 3300005434 Bacteria 3812
54 Ga0070709_10083051 3300005434 Bacteria 2095
55 Ga0070709_10092779 3300005434 Unclassified 1995
56 Ga0070709_10114906 3300005434 Bacteria 1815
57 Ga0070709_10222938 3300005434 Unclassified 1345
58 Ga0070709_10263946 3300005434 Unclassified 1245
59 Ga0070709_10336952 3300005434 Unclassified 1111
60 Ga0070714_100006206 3300005435 Bacteria 9194
61 Ga0070714_100007756 3300005435 Bacteria 8364
62 Ga0070714_100094857 3300005435 Unclassified 2619
63 Ga0070714_100125332 3300005435 Bacteria 2289
64 Ga0070714_100158612 3300005435 Bacteria 2045
65 Ga0070714_100210640 3300005435 Bacteria 1781
66 Ga0070714_100237689 3300005435 Bacteria 1681
67 Ga0070713_100000520 3300005436 Bacteria 24388
68 Ga0070713_100001539 3300005436 Bacteria 14725
69 Ga0070713_100003494 3300005436 Bacteria 10370
70 Ga0070713_100016785 3300005436 Bacteria 5514
71 Ga0070713_100045274 3300005436 Unclassified 3604
72 Ga0070713_100059275 3300005436 Bacteria 3196
73 Ga0070713_100068251 3300005436 Bacteria 2996
74 Ga0070713_100078235 3300005436 Bacteria 2815
75 Ga0070713_100085090 3300005436 Unclassified 2708
76 Ga0070713_100089550 3300005436 Unclassified 2643
77 Ga0070713_100113642 3300005436 Bacteria 2364
78 Ga0070713_100194349 3300005436 Unclassified 1830
79 Ga0070713_100308887 3300005436 Unclassified 1458
80 Ga0070710_10002794 3300005437 Bacteria 8319
81 Ga0070710_10031978 3300005437 Bacteria 2846
82 Ga0070710_10033231 3300005437 Bacteria 2800
83 Ga0070710_10291422 3300005437 Unclassified 1062
84 Ga0070711_100000560 3300005439 Bacteria 19430
85 Ga0070711_100001162 3300005439 Bacteria 14174
86 Ga0070711_100034950 3300005439 Bacteria 3356
87 Ga0070711_100077972 3300005439 Bacteria 2353
88 Ga0070711_100285549 3300005439 Bacteria 1307
89 Ga0070711_100444786 3300005439 Bacteria 1060
90 Ga0070700_100158923 3300005441 Unclassified 1554
91 Ga0070708_100000527 3300005445 Bacteria 28842
92 Ga0070708_100001360 3300005445 Bacteria 18636
93 Ga0070708_100007787 3300005445 Bacteria 8586
94 Ga0070708_100016031 3300005445 Bacteria 6207
95 Ga0070708_100021654 3300005445 Bacteria 5439
96 Ga0070708_100025395 3300005445 Bacteria 5064
97 Ga0070708_100028671 3300005445 Bacteria 4794
98 Ga0070663_100000458 3300005455 Bacteria 21626
99 Ga0070678_100174950 3300005456 Bacteria 1752
100 Ga0070678_100268194 3300005456 Unclassified 1439
101 Ga0070678_100279117 3300005456 Unclassified 1412
102 Ga0070662_100395149 3300005457 Unclassified 1140
103 Ga0070681_10000026 3300005458 Bacteria 107615
104 Ga0070681_10043896 3300005458 Bacteria 4475
105 Ga0070681_10079554 3300005458 Bacteria 3235
106 Ga0070681_10121877 3300005458 Bacteria 2541
107 Ga0070681_10511113 3300005458 Unclassified 1114
108 Ga0068867_100004366 3300005459 Bacteria 9954
109 Ga0068867_100014627 3300005459 Bacteria 5561
110 Ga0068867_100023296 3300005459 Bacteria 4433
111 Ga0068867_100049359 3300005459 Bacteria 3098
112 Ga0068867_100446887 3300005459 Unclassified 1100
113 Ga0070685_10000811 3300005466 Bacteria 16975
114 Ga0070706_100000991 3300005467 Bacteria 30868
115 Ga0070706_100005854 3300005467 Bacteria 11663
116 Ga0070706_100014724 3300005467 Bacteria 7226
117 Ga0070706_100015879 3300005467 Bacteria 6952
118 Ga0070706_100135520 3300005467 Bacteria 2298
119 Ga0070707_100001774 3300005468 Bacteria 20733
120 Ga0070707_100007949 3300005468 Bacteria 9848
121 Ga0070707_100027902 3300005468 Bacteria 5370
122 Ga0070707_100052624 3300005468 Bacteria 3904
123 Ga0070707_100087850 3300005468 Unclassified 3007
124 Ga0070707_100258819 3300005468 Unclassified 1693
125 Ga0070707_100548184 3300005468 Unclassified 1119
126 Ga0070698_100000182 3300005471 Bacteria 59279
127 Ga0070698_100004474 3300005471 Bacteria 15363
128 Ga0070698_100037802 3300005471 Bacteria 4977
129 Ga0070699_100017051 3300005518 Bacteria 6238
130 Ga0070699_100019075 3300005518 Bacteria 5899
131 Ga0070699_100078263 3300005518 Bacteria 2880
132 Ga0070699_100103823 3300005518 Bacteria 2492
133 Ga0070699_100143052 3300005518 Bacteria 2113
134 Ga0070699_100170584 3300005518 Unclassified 1928
135 Ga0070679_100096586 3300005530 Unclassified 2942
136 Ga0070679_100446243 3300005530 Unclassified 1238
137 Ga0070684_100003033 3300005535 Bacteria 12524
138 Ga0070684_100003393 3300005535 Bacteria 11950
139 Ga0070684_100013112 3300005535 Bacteria 6672
140 Ga0070684_100140568 3300005535 Bacteria 2183
141 Ga0070697_100000145 3300005536 Bacteria 57445
142 Ga0070697_100000271 3300005536 Bacteria 42185
143 Ga0070697_100002886 3300005536 Bacteria 13220
144 Ga0070697_100005158 3300005536 Bacteria 10034
145 Ga0070697_100007316 3300005536 Bacteria 8588
146 Ga0070697_100007687 3300005536 Bacteria 8395
147 Ga0070697_100024053 3300005536 Bacteria 4849
148 Ga0070697_100033556 3300005536 Bacteria 4134
149 Ga0070697_100044316 3300005536 Bacteria 3602
150 Ga0068853_100046299 3300005539 Bacteria 3729
151 Ga0068853_100053559 3300005539 Unclassified 3474
152 Ga0068853_100312095 3300005539 Bacteria 1456
153 Ga0070672_100001128 3300005543 Bacteria 16316
154 Ga0070686_100002550 3300005544 Bacteria 10038
155 Ga0070686_100054073 3300005544 Unclassified 2567
156 Ga0070695_100003833 3300005545 Bacteria 8773
157 Ga0070695_100127534 3300005545 Bacteria 1749
158 Ga0070693_100051037 3300005547 Bacteria 2367
159 Ga0070693_100058767 3300005547 Bacteria 2227
160 Ga0070693_100060882 3300005547 Bacteria 2193
161 Ga0070665_100064783 3300005548 Bacteria 3666
162 Ga0070665_100138639 3300005548 Bacteria 2436
163 Ga0068855_100000295 3300005563 Bacteria 61909
164 Ga0068855_100001199 3300005563 Bacteria 32207
165 Ga0068855_100020709 3300005563 Bacteria 7887
166 Ga0068855_100046866 3300005563 Bacteria 5108
167 Ga0068855_100073906 3300005563 Bacteria 3960
168 Ga0068855_100096201 3300005563 Bacteria 3412
169 Ga0068855_100159434 3300005563 Bacteria 2562
170 Ga0068855_100403741 3300005563 Bacteria 1497
171 Ga0070664_100003800 3300005564 Bacteria 12190
172 Ga0070664_100006609 3300005564 Bacteria 9348
173 Ga0070664_100027366 3300005564 Bacteria 4738
174 Ga0070664_100088228 3300005564 Unclassified 2682
175 Ga0070664_100288390 3300005564 Unclassified 1481
176 Ga0070664_100585976 3300005564 Unclassified 1034
177 Ga0068857_100000484 3300005577 Bacteria 28421
178 Ga0068857_100024639 3300005577 Bacteria 5299
179 Ga0068857_100036232 3300005577 Bacteria 4372
180 Ga0068857_100038182 3300005577 Bacteria 4253
181 Ga0068857_100216392 3300005577 Bacteria 1749
182 Ga0068854_100004252 3300005578 Bacteria 9015
183 Ga0068854_100011793 3300005578 Bacteria 5706
184 Ga0068854_100015375 3300005578 Bacteria 5068
185 Ga0068854_100026498 3300005578 Bacteria 3985
186 Ga0068854_100068332 3300005578 Bacteria 2591
187 Ga0068854_100111747 3300005578 Unclassified 2062
188 Ga0068854_100165163 3300005578 Unclassified 1718
189 Ga0068854_100544504 3300005578 Bacteria 983
190 Ga0068856_100000574 3300005614 Bacteria 40092
191 Ga0068856_100001473 3300005614 Bacteria 24654
192 Ga0068856_100001552 3300005614 Bacteria 24044
193 Ga0068856_100002096 3300005614 Bacteria 20678
194 Ga0068856_100002636 3300005614 Bacteria 18418
195 Ga0068856_100012186 3300005614 Bacteria 8331
196 Ga0068856_100018702 3300005614 Bacteria 6715
197 Ga0068856_100043593 3300005614 Bacteria 4414
198 Ga0068856_100067880 3300005614 Bacteria 3524
199 Ga0068856_100266142 3300005614 Bacteria 1730
200 Ga0068852_100035645 3300005616 Bacteria 4153
201 Ga0068852_100141970 3300005616 Bacteria 2224
202 Ga0068859_100001753 3300005617 Bacteria 22082
203 Ga0068859_100013963 3300005617 Bacteria 8055
204 Ga0068859_100014947 3300005617 Bacteria 7790
205 Ga0068859_100038558 3300005617 Bacteria 4793
206 Ga0068864_100003537 3300005618 Bacteria 12924
207 Ga0068864_100018866 3300005618 Bacteria 5766
208 Ga0068864_100061168 3300005618 Unclassified 3262
209 Ga0068866_10000590 3300005718 Bacteria 16525
210 Ga0068866_10065720 3300005718 Bacteria 1898
211 Ga0068861_100081852 3300005719 Bacteria 2529
212 Ga0068851_10037717 3300005834 Archaea 2423
213 Ga0068851_10047244 3300005834 Bacteria 2180
214 Ga0068851_10051076 3300005834 Bacteria 2100
215 Ga0068870_10003193 3300005840 Bacteria 6917
216 Ga0068863_100012092 3300005841 Bacteria 8338
217 Ga0068863_100019423 3300005841 Bacteria 6500
218 Ga0068863_100048187 3300005841 Unclassified 4041
219 Ga0068863_100411389 3300005841 Unclassified 1324
220 Ga0068858_100011368 3300005842 Bacteria 8406
221 Ga0068858_100018025 3300005842 Bacteria 6612
222 Ga0068858_100028176 3300005842 Bacteria 5219
223 Ga0068858_100054493 3300005842 Bacteria 3698
224 Ga0068858_100120513 3300005842 Bacteria 2453
225 Ga0068858_100263312 3300005842 Unclassified 1639
226 Ga0068860_100026939 3300005843 Bacteria 5539
227 Ga0068860_100095363 3300005843 Bacteria 2836
228 Ga0068860_100113811 3300005843 Unclassified 2587
229 Ga0068860_100360517 3300005843 Unclassified 1432
230 Ga0068862_100005527 3300005844 Bacteria 10559
231 Ga0068862_100060777 3300005844 Unclassified 3247
232 Ga0081540_1099844 3300005983 Unclassified 1253
233 Ga0070717_10000274 3300006028 Bacteria 35206
234 Ga0070717_10000783 3300006028 Bacteria 20846
235 Ga0070717_10001050 3300006028 Bacteria 18532
236 Ga0070717_10009099 3300006028 Bacteria 7457
237 Ga0070717_10030403 3300006028 Bacteria 4339
238 Ga0070717_10045002 3300006028 Bacteria 3607
239 Ga0070717_10068722 3300006028 Bacteria 2949
240 Ga0070717_10074893 3300006028 Bacteria 2831
241 Ga0070717_10088234 3300006028 Bacteria 2613
242 Ga0070717_10236198 3300006028 Bacteria 1611
243 Ga0070715_10001939 3300006163 Bacteria 6226
244 Ga0070715_10034659 3300006163 Bacteria 2071
245 Ga0070716_100000931 3300006173 Bacteria 12697
246 Ga0070716_100002361 3300006173 Bacteria 8683
247 Ga0070716_100010444 3300006173 Bacteria 4655
248 Ga0070716_100021570 3300006173 Bacteria 3396
249 Ga0070716_100034566 3300006173 Bacteria 2773
250 Ga0070712_100000472 3300006175 Bacteria 23114
251 Ga0070712_100002128 3300006175 Bacteria 12181
252 Ga0070712_100002493 3300006175 Bacteria 11354
253 Ga0070712_100021241 3300006175 Bacteria 4260
254 Ga0070712_100022151 3300006175 Unclassified 4181
255 Ga0070712_100031371 3300006175 Bacteria 3580
256 Ga0097621_100000659 3300006237 Bacteria 24318
257 Ga0097621_100002693 3300006237 Bacteria 12158
258 Ga0097621_100003898 3300006237 Bacteria 10342
259 Ga0097621_100025508 3300006237 Bacteria 4625
260 Ga0097621_100070242 3300006237 Bacteria 2892
261 Ga0097621_100074373 3300006237 Bacteria 2814
262 Ga0068871_100000288 3300006358 Bacteria 35115
263 Ga0068871_100000643 3300006358 Bacteria 24041
264 Ga0068871_100006416 3300006358 Bacteria 8321
265 Ga0068871_100043198 3300006358 Bacteria 3621
266 Ga0075433_10000459 3300006852 Bacteria 26510
267 Ga0075433_10019585 3300006852 Bacteria 5641
268 Ga0075434_100004992 3300006871 Bacteria 12040
269 Ga0075434_100005525 3300006871 Bacteria 11510
270 Ga0068865_100008147 3300006881 Bacteria 6466
271 Ga0068865_100155298 3300006881 Bacteria 1740
272 Ga0068865_100184076 3300006881 Unclassified 1610
273 Ga0075436_100001031 3300006914 Bacteria 18755
274 Ga0075436_100002883 3300006914 Bacteria 11785
275 Ga0075436_100008046 3300006914 Bacteria 7219
276 Ga0097620_100001753 3300006931 Bacteria 22082
277 Ga0097620_100013963 3300006931 Bacteria 8055
278 Ga0097620_100014947 3300006931 Bacteria 7790
279 Ga0097620_100038559 3300006931 Bacteria 4793
280 Ga0075435_100001052 3300007076 Bacteria 17477
281 Ga0075435_100076958 3300007076 Bacteria 2735
282 Ga0075435_100077671 3300007076 Unclassified 2722
283 Ga0075435_100209254 3300007076 Bacteria 1654
284 Ga0099795_10024293 3300007788 Bacteria 2020
285 Ga0099795_10031359 3300007788 Bacteria 1830
286 Ga0105250_10008592 3300009092 Bacteria 4329
287 Ga0105240_10030063 3300009093 Bacteria 7065
288 Ga0105240_10059389 3300009093 Bacteria 4773
289 Ga0105240_10102189 3300009093 Bacteria 3484
290 Ga0105240_10121398 3300009093 Bacteria 3146
291 Ga0105240_10126503 3300009093 Bacteria 3071
292 Ga0105240_10475906 3300009093 Unclassified 1393
293 Ga0105240_10779895 3300009093 Unclassified 1037
294 Ga0105245_10009096 3300009098 Bacteria 8657
295 Ga0105245_10013607 3300009098 Bacteria 7087
296 Ga0105245_10014887 3300009098 Bacteria 6775
297 Ga0105245_10027136 3300009098 Bacteria 5044
298 Ga0105245_10050356 3300009098 Bacteria 3733
299 Ga0105245_10179249 3300009098 Bacteria 2023
300 Ga0105245_10351785 3300009098 Bacteria 1460
301 Ga0105247_10064280 3300009101 Bacteria 2279
302 Ga0114129_10128091 3300009147 Bacteria 3489
303 Ga0105243_10087816 3300009148 Bacteria 2553
304 Ga0105241_10004698 3300009174 Bacteria 10084
305 Ga0105241_10018956 3300009174 Bacteria 5071
306 Ga0105241_10028983 3300009174 Bacteria 4126
307 Ga0105241_10067422 3300009174 Bacteria 2770
308 Ga0105241_10105268 3300009174 Unclassified 2250
309 Ga0105241_10118398 3300009174 Bacteria 2129
310 Ga0105241_10137399 3300009174 Bacteria 1986
311 Ga0105241_10468173 3300009174 Unclassified 1118
312 Ga0105241_10493018 3300009174 Unclassified 1091
313 Ga0105242_10015449 3300009176 Bacteria 5929
314 Ga0105242_10026278 3300009176 Bacteria 4614
315 Ga0105242_10243086 3300009176 Bacteria 1619
316 Ga0105248_10003676 3300009177 Bacteria 16990
317 Ga0105248_10131279 3300009177 Bacteria 2826
318 Ga0105248_10145134 3300009177 Bacteria 2678
319 Ga0105248_10286693 3300009177 Unclassified 1854
320 Ga0105237_10011049 3300009545 Bacteria 9573
321 Ga0105237_10041433 3300009545 Bacteria 4644
322 Ga0105237_10058508 3300009545 Unclassified 3857
323 Ga0105237_10072346 3300009545 Bacteria 3442
324 Ga0105237_10202261 3300009545 Bacteria 1986
325 Ga0105238_10000188 3300009551 Bacteria 68217
326 Ga0105238_10018779 3300009551 Bacteria 7039
327 Ga0105238_10018989 3300009551 Bacteria 7001
328 Ga0105249_10058909 3300009553 Unclassified 3521
329 Ga0105249_10221038 3300009553 Bacteria 1864
330 Ga0105239_10014081 3300010375 Bacteria 8879
331 Ga0105239_10298269 3300010375 Bacteria 1815
332 Ga0105246_10002167 3300011119 Bacteria 11862
333 Ga0105246_10264557 3300011119 Unclassified 1372
334 Ga0157373_10020329 3300013100 Bacteria 4827
335 Ga0157373_10212128 3300013100 Bacteria 1365
336 Ga0157373_10247583 3300013100 Unclassified 1260
337 Ga0157371_10007230 3300013102 Bacteria 9017
338 Ga0157371_10018449 3300013102 Bacteria 5158
339 Ga0157371_10143674 3300013102 Bacteria 1700
340 Ga0157370_10183298 3300013104 Bacteria 1945
341 Ga0157369_10000124 3300013105 Bacteria 110693
342 Ga0157369_10042601 3300013105 Unclassified 4951
343 Ga0157369_10071438 3300013105 Unclassified 3726
344 Ga0157369_10241145 3300013105 Unclassified 1888
345 Ga0157369_10289140 3300013105 Bacteria 1706
346 Ga0157369_10384237 3300013105 Unclassified 1457
347 Ga0157374_10000705 3300013296 Bacteria 29341
348 Ga0157374_10004648 3300013296 Bacteria 11512
349 Ga0157374_10012459 3300013296 Bacteria 7399
350 Ga0157374_10021739 3300013296 Bacteria 5713
351 Ga0157374_10049433 3300013296 Bacteria 3906
352 Ga0157378_10000020 3300013297 Bacteria 131245
353 Ga0157378_10001169 3300013297 Bacteria 23875
354 Ga0157378_10001927 3300013297 Bacteria 18622
355 Ga0157378_10012122 3300013297 Bacteria 7550
356 Ga0157378_10086629 3300013297 Unclassified 2840
357 Ga0157378_10131150 3300013297 Bacteria 2320
358 Ga0157378_10133126 3300013297 Bacteria 2303
359 Ga0157378_10493661 3300013297 Unclassified 1222
360 Ga0163162_10004938 3300013306 Bacteria 12855
361 Ga0163162_10012372 3300013306 Bacteria 8332
362 Ga0163162_10030363 3300013306 Bacteria 5355
363 Ga0157372_10000084 3300013307 Bacteria 98431
364 Ga0157372_10000328 3300013307 Bacteria 51987
365 Ga0157372_10000579 3300013307 Bacteria 39972
366 Ga0157372_10001691 3300013307 Bacteria 23865
367 Ga0157372_10007626 3300013307 Bacteria 11505
368 Ga0157372_10007962 3300013307 Bacteria 11267
369 Ga0157372_10024610 3300013307 Bacteria 6543
370 Ga0157372_10032366 3300013307 Bacteria 5734
371 Ga0157372_10048056 3300013307 Bacteria 4743
372 Ga0157372_10056122 3300013307 Unclassified 4401
373 Ga0157372_10107446 3300013307 Unclassified 3193
374 Ga0157372_10191958 3300013307 Bacteria 2366
375 Ga0157372_10379357 3300013307 Unclassified 1648
376 Ga0157375_10099880 3300013308 Bacteria 2981
377 Ga0163163_10003536 3300014325 Bacteria 13275
378 Ga0163163_10177088 3300014325 Bacteria 2179
379 Ga0157380_10169299 3300014326 Archaea 1907
380 Ga0182008_10057254 3300014497 Bacteria 1925
381 Ga0157377_10002893 3300014745 Bacteria 7676
382 Ga0157377_10190573 3300014745 Bacteria 1296
383 Ga0157379_10015082 3300014968 Bacteria 6778
384 Ga0157379_10038889 3300014968 Bacteria 4244
385 Ga0157379_10038995 3300014968 Bacteria 4238
386 Ga0157379_10592228 3300014968 Unclassified 1034
387 Ga0157376_10046101 3300014969 Bacteria 3593
388 Ga0157376_10056336 3300014969 Bacteria 3283
389 Ga0157376_10117563 3300014969 Bacteria 2351
390 Ga0157376_10169502 3300014969 Bacteria 1987
391 Ga0182005_1013330 3300015265 Bacteria 2312
392 Ga0163161_10003774 3300017792 Bacteria 10611
393 Ga0213873_10001054 3300021358 Bacteria 4485
394 Ga0224570_100396 3300022730 Unclassified 3440
395 Ga0224572_1001820 3300024225 Bacteria 3279
396 Ga0228598_1000623 3300024227 Bacteria 7439
397 Ga0228598_1005928 3300024227 Bacteria 2539
398 Ga0228598_1009110 3300024227 Bacteria 1993
399 Ga0207656_10021502 3300025321 Bacteria 2579
400 Ga0207696_1030889 3300025711 Bacteria 1624
401 Ga0207692_10003776 3300025898 Bacteria 5948
402 Ga0207692_10006241 3300025898 Bacteria 4828
403 Ga0207692_10148631 3300025898 Bacteria 1339
404 Ga0207710_10074249 3300025900 Unclassified 1565
405 Ga0207688_10022711 3300025901 Bacteria 3434
406 Ga0207680_10145864 3300025903 Unclassified 1573
407 Ga0207647_10004664 3300025904 Bacteria 10154
408 Ga0207647_10010375 3300025904 Bacteria 6578
409 Ga0207647_10062588 3300025904 Bacteria 2267
410 Ga0207685_10004859 3300025905 Bacteria 3475
411 Ga0207685_10007485 3300025905 Bacteria 3046
412 Ga0207699_10002040 3300025906 Bacteria 9539
413 Ga0207699_10053961 3300025906 Bacteria 2386
414 Ga0207699_10080961 3300025906 Unclassified 2013
415 Ga0207699_10087373 3300025906 Unclassified 1949
416 Ga0207699_10147899 3300025906 Bacteria 1551
417 Ga0207645_10000181 3300025907 Bacteria 50200
418 Ga0207645_10020422 3300025907 Bacteria 4336
419 Ga0207643_10002181 3300025908 Bacteria 10678
420 Ga0207684_10001275 3300025910 Bacteria 27799
421 Ga0207684_10001561 3300025910 Bacteria 24473
422 Ga0207684_10002945 3300025910 Bacteria 16860
423 Ga0207684_10067642 3300025910 Bacteria 3036
424 Ga0207654_10004137 3300025911 Bacteria 7314
425 Ga0207654_10018300 3300025911 Bacteria 3674
426 Ga0207654_10020317 3300025911 Unclassified 3519
427 Ga0207654_10105940 3300025911 Bacteria 1740
428 Ga0207654_10237373 3300025911 Unclassified 1217
429 Ga0207707_10002179 3300025912 Bacteria 17732
430 Ga0207707_10018423 3300025912 Bacteria 6087
431 Ga0207707_10018929 3300025912 Bacteria 6003
432 Ga0207707_10076732 3300025912 Bacteria 2916
433 Ga0207707_10228457 3300025912 Bacteria 1619
434 Ga0207695_10057023 3300025913 Bacteria 4061
435 Ga0207695_10099615 3300025913 Bacteria 2903
436 Ga0207695_10109776 3300025913 Bacteria 2740
437 Ga0207695_10380141 3300025913 Bacteria 1298
438 Ga0207671_10085456 3300025914 Bacteria 2371
439 Ga0207671_10102110 3300025914 Unclassified 2173
440 Ga0207693_10000621 3300025915 Bacteria 31746
441 Ga0207693_10000631 3300025915 Bacteria 31514
442 Ga0207693_10001998 3300025915 Bacteria 17899
443 Ga0207693_10014811 3300025915 Bacteria 6265
444 Ga0207693_10015842 3300025915 Bacteria 6039
445 Ga0207693_10029176 3300025915 Bacteria 4360
446 Ga0207663_10005255 3300025916 Bacteria 6520
447 Ga0207663_10007637 3300025916 Bacteria 5620
448 Ga0207663_10139037 3300025916 Bacteria 1689
449 Ga0207663_10176798 3300025916 Bacteria 1521
450 Ga0207663_10385079 3300025916 Bacteria 1069
451 Ga0207660_10012689 3300025917 Bacteria 5518
452 Ga0207660_10030517 3300025917 Bacteria 3705
453 Ga0207657_10001605 3300025919 Bacteria 24326
454 Ga0207657_10004718 3300025919 Bacteria 14382
455 Ga0207657_10007241 3300025919 Bacteria 11398
456 Ga0207649_10036629 3300025920 Unclassified 2957
457 Ga0207649_10045908 3300025920 Bacteria 2681
458 Ga0207649_10113279 3300025920 Bacteria 1816
459 Ga0207652_10103383 3300025921 Bacteria 2519
460 Ga0207646_10003711 3300025922 Bacteria 17037
461 Ga0207646_10004583 3300025922 Bacteria 14954
462 Ga0207646_10031655 3300025922 Bacteria 4788
463 Ga0207646_10078034 3300025922 Bacteria 2960
464 Ga0207646_10103228 3300025922 Bacteria 2557
465 Ga0207646_10314468 3300025922 Bacteria 1415
466 Ga0207681_10078654 3300025923 Bacteria 2321
467 Ga0207694_10003741 3300025924 Bacteria 12056
468 Ga0207694_10039145 3300025924 Unclassified 3648
469 Ga0207650_10000651 3300025925 Bacteria 27555
470 Ga0207650_10107391 3300025925 Bacteria 2156
471 Ga0207659_10018615 3300025926 Bacteria 4556
472 Ga0207687_10014619 3300025927 Bacteria 5139
473 Ga0207700_10000734 3300025928 Bacteria 18904
474 Ga0207700_10002368 3300025928 Bacteria 10830
475 Ga0207700_10009198 3300025928 Bacteria 6161
476 Ga0207700_10026245 3300025928 Unclassified 4060
477 Ga0207700_10066446 3300025928 Bacteria 2756
478 Ga0207700_10128490 3300025928 Bacteria 2065
479 Ga0207700_10268306 3300025928 Unclassified 1464
480 Ga0207700_10292636 3300025928 Unclassified 1404
481 Ga0207700_10295912 3300025928 Bacteria 1396
482 Ga0207700_10606108 3300025928 Unclassified 975
483 Ga0207664_10000117 3300025929 Bacteria 69794
484 Ga0207664_10014623 3300025929 Bacteria 5676
485 Ga0207664_10059138 3300025929 Unclassified 3051
486 Ga0207664_10068669 3300025929 Bacteria 2848
487 Ga0207664_10103628 3300025929 Bacteria 2355
488 Ga0207664_10137815 3300025929 Bacteria 2061
489 Ga0207664_10150208 3300025929 Bacteria 1978
490 Ga0207664_10155982 3300025929 Bacteria 1943
491 Ga0207664_10197160 3300025929 Bacteria 1736
492 Ga0207644_10004055 3300025931 Bacteria 9501
493 Ga0207706_10000613 3300025933 Bacteria 37863
494 Ga0207706_10006173 3300025933 Bacteria 11126
495 Ga0207686_10047637 3300025934 Bacteria 2651
496 Ga0207686_10127014 3300025934 Unclassified 1744
497 Ga0207704_10111123 3300025938 Bacteria 1853
498 Ga0207704_10148113 3300025938 Archaea 1652
499 Ga0207665_10001868 3300025939 Bacteria 14199
500 Ga0207665_10004699 3300025939 Bacteria 9072
501 Ga0207665_10004932 3300025939 Bacteria 8901
502 Ga0207665_10007640 3300025939 Bacteria 7138
503 Ga0207665_10033810 3300025939 Bacteria 3391
504 Ga0207665_10041043 3300025939 Unclassified 3089
505 Ga0207665_10177471 3300025939 Unclassified 1541
506 Ga0207691_10002042 3300025940 Bacteria 19748
507 Ga0207711_10014633 3300025941 Bacteria 6520
508 Ga0207689_10003226 3300025942 Bacteria 14941
509 Ga0207689_10004719 3300025942 Bacteria 12299
510 Ga0207661_10002937 3300025944 Bacteria 11790
511 Ga0207661_10023885 3300025944 Unclassified 4625
512 Ga0207661_10118073 3300025944 Bacteria 2254
513 Ga0207661_10267290 3300025944 Bacteria 1525
514 Ga0207679_10000702 3300025945 Bacteria 22362
515 Ga0207679_10001183 3300025945 Bacteria 16595
516 Ga0207679_10039065 3300025945 Unclassified 3387
517 Ga0207679_10108707 3300025945 Bacteria 2184
518 Ga0207667_10000213 3300025949 Bacteria 81973
519 Ga0207667_10000959 3300025949 Bacteria 36774
520 Ga0207667_10037195 3300025949 Bacteria 5205
521 Ga0207651_10111832 3300025960 Bacteria 2052
522 Ga0207712_10061621 3300025961 Bacteria 2663
523 Ga0207712_10228095 3300025961 Bacteria 1493
524 Ga0207668_10017634 3300025972 Bacteria 4477
525 Ga0207640_10021477 3300025981 Bacteria 3848
526 Ga0207640_10034585 3300025981 Bacteria 3155
527 Ga0207640_10047329 3300025981 Bacteria 2773
528 Ga0207640_10060685 3300025981 Bacteria 2501
529 Ga0207640_10073000 3300025981 Bacteria 2317
530 Ga0207640_10149992 3300025981 Bacteria 1712
531 Ga0207658_10061736 3300025986 Bacteria 2801
532 Ga0207658_10505892 3300025986 Unclassified 1076
533 Ga0207677_10011130 3300026023 Bacteria 5116
534 Ga0207677_10038872 3300026023 Unclassified 3123
535 Ga0207677_10048257 3300026023 Unclassified 2866
536 Ga0207677_10051949 3300026023 Bacteria 2781
537 Ga0207677_10066899 3300026023 Bacteria 2514
538 Ga0207677_10078308 3300026023 Bacteria 2360
539 Ga0207703_10003860 3300026035 Bacteria 12454
540 Ga0207703_10033201 3300026035 Bacteria 4089
541 Ga0207639_10021287 3300026041 Bacteria 4656
542 Ga0207639_10056542 3300026041 Unclassified 3008
543 Ga0207639_10196414 3300026041 Unclassified 1727
544 Ga0207639_10239384 3300026041 Bacteria 1577
545 Ga0207678_10001157 3300026067 Bacteria 24143
546 Ga0207678_10001666 3300026067 Bacteria 20378
547 Ga0207702_10000114 3300026078 Bacteria 93951
548 Ga0207702_10000913 3300026078 Bacteria 30558
549 Ga0207702_10001223 3300026078 Bacteria 25973
550 Ga0207702_10031823 3300026078 Bacteria 4399
551 Ga0207702_10053599 3300026078 Bacteria 3415
552 Ga0207702_10065929 3300026078 Bacteria 3102
553 Ga0207702_10407610 3300026078 Bacteria 1312
554 Ga0207641_10001793 3300026088 Bacteria 20670
555 Ga0207641_10014846 3300026088 Bacteria 6384
556 Ga0207641_10155197 3300026088 Bacteria 2076
557 Ga0207648_10002054 3300026089 Bacteria 21941
558 Ga0207648_10008217 3300026089 Bacteria 10132
559 Ga0207648_10058095 3300026089 Bacteria 3374
560 Ga0207648_10474391 3300026089 Unclassified 1142
561 Ga0207676_10001106 3300026095 Bacteria 20371
562 Ga0207676_10049263 3300026095 Bacteria 3276
563 Ga0207676_10189804 3300026095 Bacteria 1807
564 Ga0207676_10431791 3300026095 Bacteria 1238
565 Ga0207674_10000668 3300026116 Bacteria 44621
566 Ga0207674_10006933 3300026116 Bacteria 13272
567 Ga0207674_10043536 3300026116 Bacteria 4629
568 Ga0207674_10052327 3300026116 Bacteria 4165
569 Ga0207674_10228461 3300026116 Bacteria 1809
570 Ga0207675_100014488 3300026118 Bacteria 7349
571 Ga0207675_100249992 3300026118 Unclassified 1716
572 Ga0207683_10000217 3300026121 Bacteria 50192
573 Ga0207683_10297023 3300026121 Unclassified 1478
574 Ga0207698_10024182 3300026142 Bacteria 4259
575 Ga0265356_1000474 3300028017 Bacteria 7224
576 Ga0265355_1003372 3300028036 Bacteria 1169
577 Ga0268266_10036915 3300028379 Bacteria 4163
578 Ga0268265_10005101 3300028380 Bacteria 9004
579 Ga0268265_10021210 3300028380 Unclassified 4547
580 Ga0268264_10027650 3300028381 Bacteria 4637
581 Ga0268264_10318532 3300028381 Unclassified 1470
582 Ga0265338_10009914 3300028800 Bacteria 11266
583 Ga0265338_10033226 3300028800 Bacteria 5011
584 Ga0265762_1000850 3300030760 Bacteria 5434
585 Ga0265762_1002978 3300030760 Bacteria 3028
586 Ga0265762_1004876 3300030760 Bacteria 2403
587 Ga0265762_1006483 3300030760 Bacteria 2093
588 Ga0265762_1013410 3300030760 Unclassified 1475
589 Ga0265760_10000152 3300031090 Bacteria 17836
590 Ga0265760_10001143 3300031090 Bacteria 7724
591 Ga0265760_10013302 3300031090 Bacteria 2356
592 Ga0265760_10018906 3300031090 Unclassified 1985
593 Ga0265760_10037118 3300031090 Unclassified 1446
594 Ga0265760_10058333 3300031090 Bacteria 1170
595 Ga0265330_10039838 3300031235 Bacteria 2086
596 Ga0265328_10012033 3300031239 Bacteria 3449
597 Ga0265340_10022887 3300031247 Bacteria 3190
598 Ga0265340_10092646 3300031247 Bacteria 1411
599 Ga0265340_10107286 3300031247 Bacteria 1294
600 Ga0265340_10169775 3300031247 Unclassified 988
601 Ga0265339_10007498 3300031249 Bacteria 7041
602 Ga0265339_10024104 3300031249 Bacteria 3511
603 Ga0265339_10029382 3300031249 Unclassified 3118
604 Ga0265339_10042915 3300031249 Bacteria 2503
605 Ga0265316_10006473 3300031344 Bacteria 11176
606 Ga0265316_10015429 3300031344 Bacteria 6681
607 Ga0265316_10035416 3300031344 Bacteria 4046
608 Ga0265314_10003741 3300031711 Bacteria 14567
609 Ga0265314_10025177 3300031711 Bacteria 4496
610 Ga0265314_10150417 3300031711 Bacteria 1428
611 Ga0265342_10072306 3300031712 Bacteria 2008
612 Ga0307410_10001054 3300031852 Bacteria 11983
613 Ga0307410_10032705 3300031852 Unclassified 3351
614 Ga0307410_10074596 3300031852 Bacteria 2363
615 Ga0307406_10095810 3300031901 Bacteria 2009
616 Ga0307409_100002165 3300031995 Bacteria 10127
617 Ga0307416_100044581 3300032002 Bacteria 3484
618 Ga0307414_10409639 3300032004 Unclassified 1180
619 Ga0307411_10132537 3300032005 Bacteria 1824
620 Ga0307411_10154275 3300032005 Unclassified 1711
621 Ga0307415_100046956 3300032126 Bacteria 2904
622 Ga0373926_0007001 3300035083 Bacteria 3751
623 Ga0373926_0044469 3300035083 Bacteria 1591
624 Ga0373926_0070656 3300035083 Bacteria 1282
625 Ga0373934_0044823 3300035086 Bacteria 1748
626 Ga0373923_0010393 3300035111 Bacteria 3384
627 Ga0373923_0040134 3300035111 Bacteria 1925
628 Ga0373923_0127121 3300035111 Unclassified 1143
629 Ga0373936_0000893 3300035113 Bacteria 10644
630 Ga0373936_0007997 3300035113 Bacteria 3973
631 Ga0373945_0000867 3300035116 Bacteria 8927
632 Ga0373953_0006262 3300035117 Bacteria 3911
633 Ga0373954_0004867 3300035118 Bacteria 5795
634 Ga0373956_0003484 3300035119 Bacteria 6327
635 Ga0373960_0010570 3300035121 Unclassified 2258
636 Ga0373943_0000021 3300035170 Bacteria 52773
637 Ga0373943_0041727 3300035170 Bacteria 2220
638 Ga0373943_0098096 3300035170 Bacteria 1528
639 Ga0373943_0168880 3300035170 Bacteria 1196
640 Ga0373946_0152454 3300035171 Unclassified 1079
641 Ga0373955_0033049 3300035172 Bacteria 2721
642 Ga0373955_0119172 3300035172 Bacteria 1533
643 Ga0373924_0047968 3300035410 Bacteria 1763
644 Ga0373931_0103269 3300035691 Bacteria 1606
645 Ga0373931_0134500 3300035691 Unclassified 1426
646 Ga0373935_0003051 3300035692 Bacteria 9653
647 Ga0373935_0003262 3300035692 Bacteria 9384
648 Ga0373935_0109106 3300035692 Bacteria 1835
649 Ga0373935_0114862 3300035692 Bacteria 1791
650 Ga0373927_0000909 3300035695 Bacteria 22507
651 Ga0373927_0016042 3300035695 Bacteria 4945
652 Ga0373927_0052289 3300035695 Bacteria 2642
653 Ga0373927_0092478 3300035695 Bacteria 1965
654 Ga0373927_0279343 3300035695 Bacteria 1098
655 Ga0373933_0052077 3300035724 Bacteria 2448
656 Ga0373933_0336859 3300035724 Unclassified 979
657 Ga0373933_0418909 3300035724 Unclassified 875
658 Ga0373947_0001157 3300035725 Bacteria 16188
659 Ga0373947_0004511 3300035725 Bacteria 8166
660 Ga0373947_0126605 3300035725 Bacteria 1627
661 Ga0373947_0182737 3300035725 Bacteria 1366
662 Ga0373947_0222987 3300035725 Bacteria 1240
663 Ga0373947_0254926 3300035725 Unclassified 1161
664 Ga0373937_0033979 3300036401 Bacteria 4636
665 Ga0373937_0035209 3300036401 Bacteria 4556
666 Ga0373937_0097831 3300036401 Bacteria 2722
667 Ga0373937_0359939 3300036401 Unclassified 1379
668 Ga0265778_000654 3300036457 Unclassified 2808
669 Ga0373925_0000367 3300037068 Bacteria 47053
670 Ga0373925_0002436 3300037068 Bacteria 14926
671 Ga0373925_0017086 3300037068 Bacteria 5252
672 Ga0373925_0103233 3300037068 Bacteria 2194
673 Ga0373925_0395147 3300037068 Bacteria 1127
674 Ga0436364_0218463 3300037853 Bacteria 7334
675 Ga0436360_0377084 3300039438 Bacteria 2438
676 Ga0436363_0052309 3300039450 Bacteria 2168
677 Ga0436363_0770082 3300039450 Bacteria 3556
678 Ga0436363_0897691 3300039450 Bacteria 1503
679 Ga0436362_0990872 3300039453 Bacteria 11336
680 Ga0451577_0002999 3300042876 Bacteria 19237
681 Ga0453683_0050039 3300044673 Bacteria 2619
682 Ga0453683_0058256 3300044673 Bacteria 2417
683 Ga0466963_0065547 3300044694 Bacteria 2435
684 Ga0466963_0071639 3300044694 Bacteria 2333
685 Ga0453684_0000686 3300044712 Bacteria 120659
686 Ga0466959_0001551 3300045049 Bacteria 14132
687 Ga0451576_0010752 3300045051 Bacteria 10475
688 Ga0451576_0045843 3300045051 Bacteria 4603
689 Ga0451576_0071094 3300045051 Bacteria 3622
690 Ga0451576_0632984 3300045051 Bacteria 1124
691 Ga0466967_0038204 3300045976 Bacteria 4115
692 Ga0466967_0144255 3300045976 Bacteria 2220
693 Ga0495603_0070095 3300046455 Bacteria 2061
694 Ga0495653_0188783 3300046463 Bacteria 1408
695 Ga0495580_0000074 3300046472 Bacteria 62279
696 Ga0495580_0000187 3300046472 Bacteria 46797
697 Ga0495580_0003275 3300046472 Bacteria 13843
698 Ga0495580_0004661 3300046472 Bacteria 11500
699 Ga0495580_0013802 3300046472 Bacteria 6150
700 Ga0495580_0016952 3300046472 Bacteria 5459
701 Ga0495580_0017853 3300046472 Bacteria 5292
702 Ga0495580_0044621 3300046472 Bacteria 3152
703 Ga0495580_0068335 3300046472 Bacteria 2485
704 Ga0495580_0075872 3300046472 Bacteria 2345
705 Ga0495580_0091330 3300046472 Unclassified 2119
706 Ga0495582_0001534 3300046473 Bacteria 13033
707 Ga0495582_0002740 3300046473 Bacteria 9838
708 Ga0495582_0045143 3300046473 Bacteria 2427
709 Ga0495639_0033769 3300046475 Bacteria 2286
710 Ga0495664_0213719 3300046477 Bacteria 1168
711 Ga0495666_0100204 3300046526 Bacteria 1365
712 Ga0495652_0320938 3300046529 Unclassified 1119
713 Ga0495665_0007953 3300046531 Bacteria 5749
714 Ga0495665_0095529 3300046531 Unclassified 1561
715 Ga0495665_0100263 3300046531 Bacteria 1520
716 Ga0495665_0120341 3300046531 Bacteria 1375
717 Ga0495645_0192886 3300046543 Bacteria 1387
718 Ga0495599_0034208 3300046678 Bacteria 3193
719 Ga0495647_0046715 3300046681 Bacteria 1669
720 Ga0495624_0179442 3300046690 Unclassified 1291
721 Ga0495674_0066054 3300047319 Bacteria 3140
722 Ga0495593_0113868 3300047673 Bacteria 1380
723 Ga0496100_0051757 3300048903 Archaea 2667
724 Ga0496100_0320666 3300048903 Unclassified 1164
725 Ga0496101_0009652 3300048904 Bacteria 6349
726 Ga0496101_0210216 3300048904 Bacteria 1507
727 Ga0496102_0001348 3300048905 Bacteria 21995
728 Ga0496102_0037985 3300048905 Unclassified 4343
729 Ga0496102_0051259 3300048905 Unclassified 3760
730 Ga0496102_0249580 3300048905 Bacteria 1673
731 Ga0496102_0463208 3300048905 Unclassified 1188
732 Ga0496103_0081773 3300048906 Bacteria 2032
733 Ga0496104_0024866 3300048907 Bacteria 5515
734 Ga0496104_0035527 3300048907 Bacteria 4653
735 Ga0496104_0035550 3300048907 Bacteria 4652
736 Ga0496104_0058118 3300048907 Bacteria 3660
737 Ga0496104_0063732 3300048907 Bacteria 3496
738 Ga0496104_0072161 3300048907 Bacteria 3283
739 Ga0496104_0079878 3300048907 Unclassified 3118
740 Ga0496105_0035676 3300048908 Bacteria 4094
741 Ga0496105_0048354 3300048908 Bacteria 3511
742 Ga0496105_0144862 3300048908 Bacteria 1954
743 Ga0496107_0009504 3300048910 Bacteria 6746
744 Ga0496108_0006211 3300048911 Bacteria 9673
745 Ga0496109_0000117 3300048912 Bacteria 82245
746 Ga0496109_0152360 3300048912 Bacteria 2165
747 Ga0496109_0443264 3300048912 Bacteria 1227
748 Ga0496110_0001695 3300048913 Bacteria 16198
749 Ga0496111_0004157 3300048914 Bacteria 9106
750 Ga0496112_0002198 3300048915 Bacteria 15534
751 Ga0496112_0005621 3300048915 Bacteria 10877
752 Ga0496112_0026609 3300048915 Bacteria 5571
753 Ga0496112_0046268 3300048915 Unclassified 4267
754 Ga0496112_0048144 3300048915 Bacteria 4180
755 Ga0496112_0082567 3300048915 Bacteria 3178
756 Ga0496112_0646214 3300048915 Unclassified 988
757 Ga0496113_0006658 3300048916 Bacteria 7352
758 Ga0496113_0207385 3300048916 Bacteria 1559
759 Ga0496113_0313095 3300048916 Bacteria 1258
760 Ga0496115_0004507 3300048918 Bacteria 10076
761 Ga0496115_0007658 3300048918 Bacteria 7957
762 Ga0496115_0012011 3300048918 Bacteria 6509
763 Ga0496115_0435806 3300048918 Unclassified 1060
764 Ga0501298_004571 3300049521 Bacteria 2187
765 Ga0501299_011185 3300049522 Bacteria 1512
766 Ga0501073_0045379 3300049589 Unclassified 3095
767 Ga0501077_0184876 3300049593 Bacteria 1324
768 Ga0501217_009295 3300049661 Unclassified 2136
769 Ga0501283_016363 3300049779 Bacteria 1150
770 nmdc:mga0n895_22137_c1 3300050512 Bacteria 5957
771 nmdc:mga0n895_518_c1 3300050512 Bacteria 26232
772 nmdc:mga0rr50_1782_c1 3300050513 Bacteria 11887
773 nmdc:mga0rr50_243_c1 3300050513 Bacteria 29548
774 nmdc:mga0rr50_60707_c1 3300050513 Unclassified 2845
775 nmdc:mga08x19_3466_c1 3300050514 Bacteria 9402
776 nmdc:mga08x19_5146_c1 3300050514 Bacteria 7733
777 nmdc:mga08x19_6615_c1 3300050514 Bacteria 6871
778 nmdc:mga0a205_1355_c1 3300050515 Bacteria 20638
779 nmdc:mga0a205_6675_c1 3300050515 Bacteria 10441
780 Ga0466962_0012149 3300061719 Bacteria 4140
781 Ga0265314_10122100
782 JGI24752J21851_1000390
783 JGI24034J26672_10000129
784 JGI24751J29686_10001442
785 rootH1_10241910
786 Ga0065715_10089775
787 Ga0070676_10007708
788 Ga0070683_100000874
789 Ga0070683_100034849
790 Ga0070683_100060879
791 Ga0070683_100093742
792 Ga0070683_100248456
793 Ga0070690_100067121
794 Ga0070690_100159133
795 Ga0070670_100003741
796 Ga0070670_100026465
797 Ga0070670_100226376
798 Ga0068869_100001259
799 Ga0068869_100305291
800 Ga0070666_10014887
801 Ga0070680_100038523
802 Ga0070680_100049796
803 Ga0070680_100058460
804 Ga0070680_100090745
805 Ga0068868_100002212
806 Ga0068868_100005870
807 Ga0068868_100025275
808 Ga0068868_100031146
809 Ga0068868_100064402
810 Ga0068868_100103234
811 Ga0070660_100018106
812 Ga0070660_100103711
813 Ga0070689_100019148
814 Ga0070689_100056271
815 Ga0070661_100025625
816 Ga0070661_100039504
817 Ga0070668_100005837
818 Ga0070669_100009592
819 Ga0070669_100432344
820 Ga0070675_100083912
821 Ga0070675_100242713
822 Ga0070671_100040265
823 Ga0070671_100090334
824 Ga0070671_100130936
825 Ga0070673_100013626
826 Ga0070673_100054833
827 Ga0070688_100003095
828 Ga0070659_100009927
829 Ga0070659_100105820
830 Ga0070659_100131464
831 Ga0070667_100007683
832 Ga0070709_10010147
833 Ga0070709_10020841
834 Ga0070709_10083051
835 Ga0070709_10092779
836 Ga0070709_10114906
837 Ga0070709_10222938
838 Ga0070709_10263946
839 Ga0070709_10336952
840 Ga0070714_100006206
841 Ga0070714_100007756
842 Ga0070714_100094857
843 Ga0070714_100125332
844 Ga0070714_100158612
845 Ga0070714_100210640
846 Ga0070714_100237689
847 Ga0070713_100000520
848 Ga0070713_100001539
849 Ga0070713_100003494
850 Ga0070713_100016785
851 Ga0070713_100045274
852 Ga0070713_100059275
853 Ga0070713_100068251
854 Ga0070713_100078235
855 Ga0070713_100085090
856 Ga0070713_100089550
857 Ga0070713_100113642
858 Ga0070713_100194349
859 Ga0070713_100308887
860 Ga0070710_10002794
861 Ga0070710_10031978
862 Ga0070710_10033231
863 Ga0070710_10291422
864 Ga0070711_100000560
865 Ga0070711_100001162
866 Ga0070711_100034950
867 Ga0070711_100077972
868 Ga0070711_100285549
869 Ga0070711_100444786
870 Ga0070700_100158923
871 Ga0070708_100000527
872 Ga0070708_100001360
873 Ga0070708_100007787
874 Ga0070708_100016031
875 Ga0070708_100021654
876 Ga0070708_100025395
877 Ga0070708_100028671
878 Ga0070663_100000458
879 Ga0070678_100174950
880 Ga0070678_100268194
881 Ga0070678_100279117
882 Ga0070662_100395149
883 Ga0070681_10000026
884 Ga0070681_10043896
885 Ga0070681_10079554
886 Ga0070681_10121877
887 Ga0070681_10511113
888 Ga0068867_100004366
889 Ga0068867_100014627
890 Ga0068867_100023296
891 Ga0068867_100049359
892 Ga0068867_100446887
893 Ga0070685_10000811
894 Ga0070706_100000991
895 Ga0070706_100005854
896 Ga0070706_100014724
897 Ga0070706_100015879
898 Ga0070706_100135520
899 Ga0070707_100001774
900 Ga0070707_100007949
901 Ga0070707_100027902
902 Ga0070707_100052624
903 Ga0070707_100087850
904 Ga0070707_100258819
905 Ga0070707_100548184
906 Ga0070698_100000182
907 Ga0070698_100004474
908 Ga0070698_100037802
909 Ga0070699_100017051
910 Ga0070699_100019075
911 Ga0070699_100078263
912 Ga0070699_100103823
913 Ga0070699_100143052
914 Ga0070699_100170584
915 Ga0070679_100096586
916 Ga0070679_100446243
917 Ga0070684_100003033
918 Ga0070684_100003393
919 Ga0070684_100013112
920 Ga0070684_100140568
921 Ga0070697_100000145
922 Ga0070697_100000271
923 Ga0070697_100002886
924 Ga0070697_100005158
925 Ga0070697_100007316
926 Ga0070697_100007687
927 Ga0070697_100024053
928 Ga0070697_100033556
929 Ga0070697_100044316
930 Ga0068853_100046299
931 Ga0068853_100053559
932 Ga0068853_100312095
933 Ga0070672_100001128
934 Ga0070686_100002550
935 Ga0070686_100054073
936 Ga0070695_100003833
937 Ga0070695_100127534
938 Ga0070693_100051037
939 Ga0070693_100058767
940 Ga0070693_100060882
941 Ga0070665_100064783
942 Ga0070665_100138639
943 Ga0068855_100000295
944 Ga0068855_100001199
945 Ga0068855_100020709
946 Ga0068855_100046866
947 Ga0068855_100073906
948 Ga0068855_100096201
949 Ga0068855_100159434
950 Ga0068855_100403741
951 Ga0070664_100003800
952 Ga0070664_100006609
953 Ga0070664_100027366
954 Ga0070664_100088228
955 Ga0070664_100288390
956 Ga0070664_100585976
957 Ga0068857_100000484
958 Ga0068857_100024639
959 Ga0068857_100036232
960 Ga0068857_100038182
961 Ga0068857_100216392
962 Ga0068854_100004252
963 Ga0068854_100011793
964 Ga0068854_100015375
965 Ga0068854_100026498
966 Ga0068854_100068332
967 Ga0068854_100111747
968 Ga0068854_100165163
969 Ga0068854_100544504
970 Ga0068856_100000574
971 Ga0068856_100001473
972 Ga0068856_100001552
973 Ga0068856_100002096
974 Ga0068856_100002636
975 Ga0068856_100012186
976 Ga0068856_100018702
977 Ga0068856_100043593
978 Ga0068856_100067880
979 Ga0068856_100266142
980 Ga0068852_100035645
981 Ga0068852_100141970
982 Ga0068859_100001753
983 Ga0068859_100013963
984 Ga0068859_100014947
985 Ga0068859_100038558
986 Ga0068864_100003537
987 Ga0068864_100018866
988 Ga0068864_100061168
989 Ga0068866_10000590
990 Ga0068866_10065720
991 Ga0068861_100081852
992 Ga0068851_10037717
993 Ga0068851_10047244
994 Ga0068851_10051076
995 Ga0068870_10003193
996 Ga0068863_100012092
997 Ga0068863_100019423
998 Ga0068863_100048187
999 Ga0068863_100411389
1000 Ga0068858_100011368
1001 Ga0068858_100018025
1002 Ga0068858_100028176
1003 Ga0068858_100054493
1004 Ga0068858_100120513
1005 Ga0068858_100263312
1006 Ga0068860_100026939
1007 Ga0068860_100095363
1008 Ga0068860_100113811
1009 Ga0068860_100360517
1010 Ga0068862_100005527
1011 Ga0068862_100060777
1012 Ga0081540_1099844
1013 Ga0070717_10000274
1014 Ga0070717_10000783
1015 Ga0070717_10001050
1016 Ga0070717_10009099
1017 Ga0070717_10030403
1018 Ga0070717_10045002
1019 Ga0070717_10068722
1020 Ga0070717_10074893
1021 Ga0070717_10088234
1022 Ga0070717_10236198
1023 Ga0070715_10001939
1024 Ga0070715_10034659
1025 Ga0070716_100000931
1026 Ga0070716_100002361
1027 Ga0070716_100010444
1028 Ga0070716_100021570
1029 Ga0070716_100034566
1030 Ga0070712_100000472
1031 Ga0070712_100002128
1032 Ga0070712_100002493
1033 Ga0070712_100021241
1034 Ga0070712_100022151
1035 Ga0070712_100031371
1036 Ga0097621_100000659
1037 Ga0097621_100002693
1038 Ga0097621_100003898
1039 Ga0097621_100025508
1040 Ga0097621_100070242
1041 Ga0097621_100074373
1042 Ga0068871_100000288
1043 Ga0068871_100000643
1044 Ga0068871_100006416
1045 Ga0068871_100043198
1046 Ga0075433_10000459
1047 Ga0075433_10019585
1048 Ga0075434_100004992
1049 Ga0075434_100005525
1050 Ga0068865_100008147
1051 Ga0068865_100155298
1052 Ga0068865_100184076
1053 Ga0075436_100001031
1054 Ga0075436_100002883
1055 Ga0075436_100008046
1056 Ga0097620_100001753
1057 Ga0097620_100013963
1058 Ga0097620_100014947
1059 Ga0097620_100038559
1060 Ga0075435_100001052
1061 Ga0075435_100076958
1062 Ga0075435_100077671
1063 Ga0075435_100209254
1064 Ga0099795_10024293
1065 Ga0099795_10031359
1066 Ga0105250_10008592
1067 Ga0105240_10030063
1068 Ga0105240_10059389
1069 Ga0105240_10102189
1070 Ga0105240_10121398
1071 Ga0105240_10126503
1072 Ga0105240_10475906
1073 Ga0105240_10779895
1074 Ga0105245_10009096
1075 Ga0105245_10013607
1076 Ga0105245_10014887
1077 Ga0105245_10027136
1078 Ga0105245_10050356
1079 Ga0105245_10179249
1080 Ga0105245_10351785
1081 Ga0105247_10064280
1082 Ga0114129_10128091
1083 Ga0105243_10087816
1084 Ga0105241_10004698
1085 Ga0105241_10018956
1086 Ga0105241_10028983
1087 Ga0105241_10067422
1088 Ga0105241_10105268
1089 Ga0105241_10118398
1090 Ga0105241_10137399
1091 Ga0105241_10468173
1092 Ga0105241_10493018
1093 Ga0105242_10015449
1094 Ga0105242_10026278
1095 Ga0105242_10243086
1096 Ga0105248_10003676
1097 Ga0105248_10131279
1098 Ga0105248_10145134
1099 Ga0105248_10286693
1100 Ga0105237_10011049
1101 Ga0105237_10041433
1102 Ga0105237_10058508
1103 Ga0105237_10072346
1104 Ga0105237_10202261
1105 Ga0105238_10000188
1106 Ga0105238_10018779
1107 Ga0105238_10018989
1108 Ga0105249_10058909
1109 Ga0105249_10221038
1110 Ga0105239_10014081
1111 Ga0105239_10298269
1112 Ga0105246_10002167
1113 Ga0105246_10264557
1114 Ga0157373_10020329
1115 Ga0157373_10212128
1116 Ga0157373_10247583
1117 Ga0157371_10007230
1118 Ga0157371_10018449
1119 Ga0157371_10143674
1120 Ga0157370_10183298
1121 Ga0157369_10000124
1122 Ga0157369_10042601
1123 Ga0157369_10071438
1124 Ga0157369_10241145
1125 Ga0157369_10289140
1126 Ga0157369_10384237
1127 Ga0157374_10000705
1128 Ga0157374_10004648
1129 Ga0157374_10012459
1130 Ga0157374_10021739
1131 Ga0157374_10049433
1132 Ga0157378_10000020
1133 Ga0157378_10001169
1134 Ga0157378_10001927
1135 Ga0157378_10012122
1136 Ga0157378_10086629
1137 Ga0157378_10131150
1138 Ga0157378_10133126
1139 Ga0157378_10493661
1140 Ga0163162_10004938
1141 Ga0163162_10012372
1142 Ga0163162_10030363
1143 Ga0157372_10000084
1144 Ga0157372_10000328
1145 Ga0157372_10000579
1146 Ga0157372_10001691
1147 Ga0157372_10007626
1148 Ga0157372_10007962
1149 Ga0157372_10024610
1150 Ga0157372_10032366
1151 Ga0157372_10048056
1152 Ga0157372_10056122
1153 Ga0157372_10107446
1154 Ga0157372_10191958
1155 Ga0157372_10379357
1156 Ga0157375_10099880
1157 Ga0163163_10003536
1158 Ga0163163_10177088
1159 Ga0157380_10169299
1160 Ga0182008_10057254
1161 Ga0157377_10002893
1162 Ga0157377_10190573
1163 Ga0157379_10015082
1164 Ga0157379_10038889
1165 Ga0157379_10038995
1166 Ga0157379_10592228
1167 Ga0157376_10046101
1168 Ga0157376_10056336
1169 Ga0157376_10117563
1170 Ga0157376_10169502
1171 Ga0182005_1013330
1172 Ga0163161_10003774
1173 Ga0213873_10001054
1174 Ga0224570_100396
1175 Ga0224572_1001820
1176 Ga0228598_1000623
1177 Ga0228598_1005928
1178 Ga0228598_1009110
1179 Ga0207656_10021502
1180 Ga0207696_1030889
1181 Ga0207692_10003776
1182 Ga0207692_10006241
1183 Ga0207692_10148631
1184 Ga0207710_10074249
1185 Ga0207688_10022711
1186 Ga0207680_10145864
1187 Ga0207647_10004664
1188 Ga0207647_10010375
1189 Ga0207647_10062588
1190 Ga0207685_10004859
1191 Ga0207685_10007485
1192 Ga0207699_10002040
1193 Ga0207699_10053961
1194 Ga0207699_10080961
1195 Ga0207699_10087373
1196 Ga0207699_10147899
1197 Ga0207645_10000181
1198 Ga0207645_10020422
1199 Ga0207643_10002181
1200 Ga0207684_10001275
1201 Ga0207684_10001561
1202 Ga0207684_10002945
1203 Ga0207684_10067642
1204 Ga0207654_10004137
1205 Ga0207654_10018300
1206 Ga0207654_10020317
1207 Ga0207654_10105940
1208 Ga0207654_10237373
1209 Ga0207707_10002179
1210 Ga0207707_10018423
1211 Ga0207707_10018929
1212 Ga0207707_10076732
1213 Ga0207707_10228457
1214 Ga0207695_10057023
1215 Ga0207695_10099615
1216 Ga0207695_10109776
1217 Ga0207695_10380141
1218 Ga0207671_10085456
1219 Ga0207671_10102110
1220 Ga0207693_10000621
1221 Ga0207693_10000631
1222 Ga0207693_10001998
1223 Ga0207693_10014811
1224 Ga0207693_10015842
1225 Ga0207693_10029176
1226 Ga0207663_10005255
1227 Ga0207663_10007637
1228 Ga0207663_10139037
1229 Ga0207663_10176798
1230 Ga0207663_10385079
1231 Ga0207660_10012689
1232 Ga0207660_10030517
1233 Ga0207657_10001605
1234 Ga0207657_10004718
1235 Ga0207657_10007241
1236 Ga0207649_10036629
1237 Ga0207649_10045908
1238 Ga0207649_10113279
1239 Ga0207652_10103383
1240 Ga0207646_10003711
1241 Ga0207646_10004583
1242 Ga0207646_10031655
1243 Ga0207646_10078034
1244 Ga0207646_10103228
1245 Ga0207646_10314468
1246 Ga0207681_10078654
1247 Ga0207694_10003741
1248 Ga0207694_10039145
1249 Ga0207650_10000651
1250 Ga0207650_10107391
1251 Ga0207659_10018615
1252 Ga0207687_10014619
1253 Ga0207700_10000734
1254 Ga0207700_10002368
1255 Ga0207700_10009198
1256 Ga0207700_10026245
1257 Ga0207700_10066446
1258 Ga0207700_10128490
1259 Ga0207700_10268306
1260 Ga0207700_10292636
1261 Ga0207700_10295912
1262 Ga0207700_10606108
1263 Ga0207664_10000117
1264 Ga0207664_10014623
1265 Ga0207664_10059138
1266 Ga0207664_10068669
1267 Ga0207664_10103628
1268 Ga0207664_10137815
1269 Ga0207664_10150208
1270 Ga0207664_10155982
1271 Ga0207664_10197160
1272 Ga0207644_10004055
1273 Ga0207706_10000613
1274 Ga0207706_10006173
1275 Ga0207686_10047637
1276 Ga0207686_10127014
1277 Ga0207704_10111123
1278 Ga0207704_10148113
1279 Ga0207665_10001868
1280 Ga0207665_10004699
1281 Ga0207665_10004932
1282 Ga0207665_10007640
1283 Ga0207665_10033810
1284 Ga0207665_10041043
1285 Ga0207665_10177471
1286 Ga0207691_10002042
1287 Ga0207711_10014633
1288 Ga0207689_10003226
1289 Ga0207689_10004719
1290 Ga0207661_10002937
1291 Ga0207661_10023885
1292 Ga0207661_10118073
1293 Ga0207661_10267290
1294 Ga0207679_10000702
1295 Ga0207679_10001183
1296 Ga0207679_10039065
1297 Ga0207679_10108707
1298 Ga0207667_10000213
1299 Ga0207667_10000959
1300 Ga0207667_10037195
1301 Ga0207651_10111832
1302 Ga0207712_10061621
1303 Ga0207712_10228095
1304 Ga0207668_10017634
1305 Ga0207640_10021477
1306 Ga0207640_10034585
1307 Ga0207640_10047329
1308 Ga0207640_10060685
1309 Ga0207640_10073000
1310 Ga0207640_10149992
1311 Ga0207658_10061736
1312 Ga0207658_10505892
1313 Ga0207677_10011130
1314 Ga0207677_10038872
1315 Ga0207677_10048257
1316 Ga0207677_10051949
1317 Ga0207677_10066899
1318 Ga0207677_10078308
1319 Ga0207703_10003860
1320 Ga0207703_10033201
1321 Ga0207639_10021287
1322 Ga0207639_10056542
1323 Ga0207639_10196414
1324 Ga0207639_10239384
1325 Ga0207678_10001157
1326 Ga0207678_10001666
1327 Ga0207702_10000114
1328 Ga0207702_10000913
1329 Ga0207702_10001223
1330 Ga0207702_10031823
1331 Ga0207702_10053599
1332 Ga0207702_10065929
1333 Ga0207702_10407610
1334 Ga0207641_10001793
1335 Ga0207641_10014846
1336 Ga0207641_10155197
1337 Ga0207648_10002054
1338 Ga0207648_10008217
1339 Ga0207648_10058095
1340 Ga0207648_10474391
1341 Ga0207676_10001106
1342 Ga0207676_10049263
1343 Ga0207676_10189804
1344 Ga0207676_10431791
1345 Ga0207674_10000668
1346 Ga0207674_10006933
1347 Ga0207674_10043536
1348 Ga0207674_10052327
1349 Ga0207674_10228461
1350 Ga0207675_100014488
1351 Ga0207675_100249992
1352 Ga0207683_10000217
1353 Ga0207683_10297023
1354 Ga0207698_10024182
1355 Ga0265356_1000474
1356 Ga0265355_1003372
1357 Ga0268266_10036915
1358 Ga0268265_10005101
1359 Ga0268265_10021210
1360 Ga0268264_10027650
1361 Ga0268264_10318532
1362 Ga0265338_10009914
1363 Ga0265338_10033226
1364 Ga0265762_1000850
1365 Ga0265762_1002978
1366 Ga0265762_1004876
1367 Ga0265762_1006483
1368 Ga0265762_1013410
1369 Ga0265760_10000152
1370 Ga0265760_10001143
1371 Ga0265760_10013302
1372 Ga0265760_10018906
1373 Ga0265760_10037118
1374 Ga0265760_10058333
1375 Ga0265330_10039838
1376 Ga0265328_10012033
1377 Ga0265340_10022887
1378 Ga0265340_10092646
1379 Ga0265340_10107286
1380 Ga0265340_10169775
1381 Ga0265339_10007498
1382 Ga0265339_10024104
1383 Ga0265339_10029382
1384 Ga0265339_10042915
1385 Ga0265316_10006473
1386 Ga0265316_10015429
1387 Ga0265316_10035416
1388 Ga0265314_10003741
1389 Ga0265314_10025177
1390 Ga0265314_10150417
1391 Ga0265342_10072306
1392 Ga0307410_10001054
1393 Ga0307410_10032705
1394 Ga0307410_10074596
1395 Ga0307406_10095810
1396 Ga0307409_100002165
1397 Ga0307416_100044581
1398 Ga0307414_10409639
1399 Ga0307411_10132537
1400 Ga0307411_10154275
1401 Ga0307415_100046956
1402 Ga0373926_0007001
1403 Ga0373926_0044469
1404 Ga0373926_0070656
1405 Ga0373934_0044823
1406 Ga0373923_0010393
1407 Ga0373923_0040134
1408 Ga0373923_0127121
1409 Ga0373936_0000893
1410 Ga0373936_0007997
1411 Ga0373945_0000867
1412 Ga0373953_0006262
1413 Ga0373954_0004867
1414 Ga0373956_0003484
1415 Ga0373960_0010570
1416 Ga0373943_0000021
1417 Ga0373943_0041727
1418 Ga0373943_0098096
1419 Ga0373943_0168880
1420 Ga0373946_0152454
1421 Ga0373955_0033049
1422 Ga0373955_0119172
1423 Ga0373924_0047968
1424 Ga0373931_0103269
1425 Ga0373931_0134500
1426 Ga0373935_0003051
1427 Ga0373935_0003262
1428 Ga0373935_0109106
1429 Ga0373935_0114862
1430 Ga0373927_0000909
1431 Ga0373927_0016042
1432 Ga0373927_0052289
1433 Ga0373927_0092478
1434 Ga0373927_0279343
1435 Ga0373933_0052077
1436 Ga0373933_0336859
1437 Ga0373933_0418909
1438 Ga0373947_0001157
1439 Ga0373947_0004511
1440 Ga0373947_0126605
1441 Ga0373947_0182737
1442 Ga0373947_0222987
1443 Ga0373947_0254926
1444 Ga0373937_0033979
1445 Ga0373937_0035209
1446 Ga0373937_0097831
1447 Ga0373937_0359939
1448 Ga0265778_000654
1449 Ga0373925_0000367
1450 Ga0373925_0002436
1451 Ga0373925_0017086
1452 Ga0373925_0103233
1453 Ga0373925_0395147
1454 Ga0436364_0218463
1455 Ga0436360_0377084
1456 Ga0436363_0052309
1457 Ga0436363_0770082
1458 Ga0436363_0897691
1459 Ga0436362_0990872
1460 Ga0451577_0002999
1461 Ga0453683_0050039
1462 Ga0453683_0058256
1463 Ga0466963_0065547
1464 Ga0466963_0071639
1465 Ga0453684_0000686
1466 Ga0466959_0001551
1467 Ga0451576_0010752
1468 Ga0451576_0045843
1469 Ga0451576_0071094
1470 Ga0451576_0632984
1471 Ga0466967_0038204
1472 Ga0466967_0144255
1473 Ga0495603_0070095
1474 Ga0495653_0188783
1475 Ga0495580_0000074
1476 Ga0495580_0000187
1477 Ga0495580_0003275
1478 Ga0495580_0004661
1479 Ga0495580_0013802
1480 Ga0495580_0016952
1481 Ga0495580_0017853
1482 Ga0495580_0044621
1483 Ga0495580_0068335
1484 Ga0495580_0075872
1485 Ga0495580_0091330
1486 Ga0495582_0001534
1487 Ga0495582_0002740
1488 Ga0495582_0045143
1489 Ga0495639_0033769
1490 Ga0495664_0213719
1491 Ga0495666_0100204
1492 Ga0495652_0320938
1493 Ga0495665_0007953
1494 Ga0495665_0095529
1495 Ga0495665_0100263
1496 Ga0495665_0120341
1497 Ga0495645_0192886
1498 Ga0495599_0034208
1499 Ga0495647_0046715
1500 Ga0495624_0179442
1501 Ga0495674_0066054
1502 Ga0495593_0113868
1503 Ga0496100_0051757
1504 Ga0496100_0320666
1505 Ga0496101_0009652
1506 Ga0496101_0210216
1507 Ga0496102_0001348
1508 Ga0496102_0037985
1509 Ga0496102_0051259
1510 Ga0496102_0249580
1511 Ga0496102_0463208
1512 Ga0496103_0081773
1513 Ga0496104_0024866
1514 Ga0496104_0035527
1515 Ga0496104_0035550
1516 Ga0496104_0058118
1517 Ga0496104_0063732
1518 Ga0496104_0072161
1519 Ga0496104_0079878
1520 Ga0496105_0035676
1521 Ga0496105_0048354
1522 Ga0496105_0144862
1523 Ga0496107_0009504
1524 Ga0496108_0006211
1525 Ga0496109_0000117
1526 Ga0496109_0152360
1527 Ga0496109_0443264
1528 Ga0496110_0001695
1529 Ga0496111_0004157
1530 Ga0496112_0002198
1531 Ga0496112_0005621
1532 Ga0496112_0026609
1533 Ga0496112_0046268
1534 Ga0496112_0048144
1535 Ga0496112_0082567
1536 Ga0496112_0646214
1537 Ga0496113_0006658
1538 Ga0496113_0207385
1539 Ga0496113_0313095
1540 Ga0496115_0004507
1541 Ga0496115_0007658
1542 Ga0496115_0012011
1543 Ga0496115_0435806
1544 Ga0501298_004571
1545 Ga0501299_011185
1546 Ga0501073_0045379
1547 Ga0501077_0184876
1548 Ga0501217_009295
1549 Ga0501283_016363
1550 nmdc:mga0n895_22137_c1
1551 nmdc:mga0n895_518_c1
1552 nmdc:mga0rr50_1782_c1
1553 nmdc:mga0rr50_243_c1
1554 nmdc:mga0rr50_60707_c1
1555 nmdc:mga08x19_3466_c1
1556 nmdc:mga08x19_5146_c1
1557 nmdc:mga08x19_6615_c1
1558 nmdc:mga0a205_1355_c1
1559 nmdc:mga0a205_6675_c1
1560 Ga0466962_0012149

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb3-assembly6.cif.gz_L structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8988 183 212
3jc8-assembly1.cif.gz_Ma architectural model of the type iva pilus machine in a piliated state 0.8256 10 279
2ych-assembly1.cif.gz_A pilm-piln type iv pilus biogenesis complex 0.8121 11 298
5eou-assembly2.cif.gz_B pseudomonas aeruginosa pilm:piln1-12 bound to atp 0.7945 13 298
2ych-assembly1.cif.gz_A pilm-piln type iv pilus biogenesis complex 0.7826 11 298
ID Description Score Start End Superfamily
af_A0A0P0XDX2_25_77_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8679 185 214 3.10.20.370
af_A0A0P0Y6D9_42_100_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7627 13 46 3.10.20.370
af_O62361_1_101_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7527 184 214 3.40.1000.30
af_P45753_11_197_3.30.420.380 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7498 17 204 3.30.420.380
af_P45753_11_197_3.30.420.380 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7327 17 204 3.30.420.380
ID Description Score Start End GO Terms
AF-A0A7W1Q4V4-F1-model_v4 Pilus assembly protein PilM 0.99 14 299
AF-A0A7W1Q4V4-F1-model_v4 Pilus assembly protein PilM 0.9832 14 299
AF-A0A2V9N7P8-F1-model_v4 Pilus assembly protein PilM 0.9668 1 299
AF-A0A2V9N7P8-F1-model_v4 Pilus assembly protein PilM 0.9636 1 299
AF-A0A2V9YNZ1-F1-model_v4 Pilus assembly protein PilM 0.9578 1 299

Map