F480436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 452 | 695 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0252377|Ga0501069_0252377_214_900 |
| Length | 228 |
| Sequence | MGELIVVLRRSISRLCNNQIIAFGTDDAFPMKLVADTLACTRGGREVFAGLSFSVAAGEALLVTGRNGAGKSSLLRAIAGLVRLTAGTLALDPDRETSLAEQVHYLGHHDAVKSALSVGENLRFWTAYLGGSGNTGDALTAVGLDAIGHLPAGTLSAGQKRRLSIARLLSVKRPVWLLDEPTASLDAPAQSALAGIMDRHLHGGGIVIAATHADIGLKSARSLRLGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 5 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 6 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 7 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 8 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 9 | 2791355199 | |||
| 10 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 11 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 12 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 13 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 14 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 15 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 16 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 17 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 18 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 19 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 20 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 21 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 22 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 23 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 24 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 25 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 26 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 27 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 28 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 29 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 30 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 31 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 32 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 33 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 34 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 35 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 36 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 37 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 38 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 39 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 40 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 41 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 42 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 43 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 44 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 45 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 46 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 47 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 48 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 49 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 50 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 51 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 52 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 53 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 54 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 55 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 56 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 57 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 58 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 59 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 60 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 61 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 62 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 63 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 64 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 65 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 66 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 67 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 68 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 69 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 70 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 109 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 123 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 124 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 125 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 126 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 127 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 128 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 129 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 130 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 132 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 404 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 409 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 411 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 414 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 416 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 417 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 418 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 419 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 423 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 425 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 433 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 434 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 439 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 440 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 441 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 442 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 443 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 444 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 445 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 446 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 447 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 448 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 449 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 450 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 451 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 452 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.45 |
| Metatranscriptomes | 0 |
| Isolates | 10.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.18 |
| Nodule | 9.25 |
| Rhizoplane | 4.88 |
| Rhizosphere | 69.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001038 | 3300003203 | Bacteria | 12982 |
| 2 | JGI25406J46586_10002413 | 3300003203 | Bacteria | 8830 |
| 3 | JGI25153J46596_10001456 | 3300003215 | Bacteria | 14140 |
| 4 | JGI25160J50197_1035435 | 3300003354 | Bacteria | 1224 |
| 5 | JGI25404J52841_10009666 | 3300003659 | Bacteria | 2065 |
| 6 | JGI25404J52841_10066849 | 3300003659 | Bacteria | 752 |
| 7 | Ga0070658_10185537 | 3300005327 | Bacteria | 1751 |
| 8 | Ga0070658_10242526 | 3300005327 | Bacteria | 1528 |
| 9 | Ga0070658_10486872 | 3300005327 | Bacteria | 1065 |
| 10 | Ga0070676_10432815 | 3300005328 | Bacteria | 921 |
| 11 | Ga0070683_100816987 | 3300005329 | Bacteria | 894 |
| 12 | Ga0070690_100216613 | 3300005330 | Bacteria | 1339 |
| 13 | Ga0070677_10015940 | 3300005333 | Bacteria | 2669 |
| 14 | Ga0070677_10264150 | 3300005333 | Bacteria | 860 |
| 15 | Ga0068869_100312880 | 3300005334 | Bacteria | 1271 |
| 16 | Ga0068869_100582355 | 3300005334 | Bacteria | 943 |
| 17 | Ga0070666_10419588 | 3300005335 | Bacteria | 964 |
| 18 | Ga0070666_10499889 | 3300005335 | Unclassified | 881 |
| 19 | Ga0070680_100022680 | 3300005336 | Bacteria | 5003 |
| 20 | Ga0068868_100064772 | 3300005338 | Bacteria | 2902 |
| 21 | Ga0068868_100651456 | 3300005338 | Bacteria | 938 |
| 22 | Ga0070660_100368233 | 3300005339 | Bacteria | 1185 |
| 23 | Ga0070689_100004675 | 3300005340 | Bacteria | 9278 |
| 24 | Ga0070689_100359825 | 3300005340 | Bacteria | 1222 |
| 25 | Ga0070689_100766489 | 3300005340 | Bacteria | 846 |
| 26 | Ga0070692_10232270 | 3300005345 | Bacteria | 1095 |
| 27 | Ga0070668_100055932 | 3300005347 | Bacteria | 3046 |
| 28 | Ga0070668_100350373 | 3300005347 | Bacteria | 1249 |
| 29 | Ga0070668_100611407 | 3300005347 | Bacteria | 954 |
| 30 | Ga0070668_101039032 | 3300005347 | Bacteria | 737 |
| 31 | Ga0070675_100269430 | 3300005354 | Bacteria | 1494 |
| 32 | Ga0070675_100505271 | 3300005354 | Bacteria | 1089 |
| 33 | Ga0070671_100117043 | 3300005355 | Bacteria | 2241 |
| 34 | Ga0070674_100042830 | 3300005356 | Bacteria | 3077 |
| 35 | Ga0070688_100055270 | 3300005365 | Bacteria | 2489 |
| 36 | Ga0070688_100124953 | 3300005365 | Bacteria | 1728 |
| 37 | Ga0070688_100162897 | 3300005365 | Bacteria | 1533 |
| 38 | Ga0070659_100060958 | 3300005366 | Bacteria | 2981 |
| 39 | Ga0070659_100427619 | 3300005366 | Bacteria | 1121 |
| 40 | Ga0070667_100068086 | 3300005367 | Bacteria | 3029 |
| 41 | Ga0070667_100328876 | 3300005367 | Bacteria | 1380 |
| 42 | Ga0070667_100342219 | 3300005367 | Bacteria | 1353 |
| 43 | Ga0070667_100378511 | 3300005367 | Bacteria | 1285 |
| 44 | Ga0070714_100094125 | 3300005435 | Bacteria | 2629 |
| 45 | Ga0070713_100335420 | 3300005436 | Bacteria | 1400 |
| 46 | Ga0070701_10303906 | 3300005438 | Bacteria | 982 |
| 47 | Ga0070705_100274329 | 3300005440 | Bacteria | 1196 |
| 48 | Ga0070700_100545849 | 3300005441 | Bacteria | 900 |
| 49 | Ga0070694_100272091 | 3300005444 | Bacteria | 1288 |
| 50 | Ga0070663_100072771 | 3300005455 | Bacteria | 2505 |
| 51 | Ga0070663_100112170 | 3300005455 | Bacteria | 2050 |
| 52 | Ga0070663_100285004 | 3300005455 | Bacteria | 1317 |
| 53 | Ga0070663_100307214 | 3300005455 | Bacteria | 1271 |
| 54 | Ga0070663_100757614 | 3300005455 | Bacteria | 829 |
| 55 | Ga0070663_100845261 | 3300005455 | Bacteria | 787 |
| 56 | Ga0070678_100060031 | 3300005456 | Bacteria | 2797 |
| 57 | Ga0070678_100382070 | 3300005456 | Bacteria | 1219 |
| 58 | Ga0070662_100136564 | 3300005457 | Bacteria | 1896 |
| 59 | Ga0068867_100133168 | 3300005459 | Bacteria | 1934 |
| 60 | Ga0070685_10175005 | 3300005466 | Bacteria | 1377 |
| 61 | Ga0070706_100208739 | 3300005467 | Bacteria | 1824 |
| 62 | Ga0070698_100349788 | 3300005471 | Bacteria | 1409 |
| 63 | Ga0070699_100248271 | 3300005518 | Bacteria | 1589 |
| 64 | Ga0070697_100494583 | 3300005536 | Bacteria | 1069 |
| 65 | Ga0068853_100709790 | 3300005539 | Bacteria | 960 |
| 66 | Ga0070672_100155551 | 3300005543 | Bacteria | 1893 |
| 67 | Ga0070672_100339121 | 3300005543 | Bacteria | 1280 |
| 68 | Ga0070686_100170052 | 3300005544 | Bacteria | 1541 |
| 69 | Ga0070665_100181509 | 3300005548 | Bacteria | 2105 |
| 70 | Ga0070665_100250653 | 3300005548 | Bacteria | 1771 |
| 71 | Ga0070665_100294329 | 3300005548 | Bacteria | 1626 |
| 72 | Ga0070665_100326553 | 3300005548 | Bacteria | 1538 |
| 73 | Ga0070665_100339711 | 3300005548 | Bacteria | 1506 |
| 74 | Ga0068855_100186751 | 3300005563 | Bacteria | 2340 |
| 75 | Ga0068857_100872843 | 3300005577 | Bacteria | 862 |
| 76 | Ga0068854_100181925 | 3300005578 | Bacteria | 1642 |
| 77 | Ga0068854_100416746 | 3300005578 | Bacteria | 1115 |
| 78 | Ga0068856_100266367 | 3300005614 | Bacteria | 1729 |
| 79 | Ga0070702_100048893 | 3300005615 | Bacteria | 2409 |
| 80 | Ga0070702_100108554 | 3300005615 | Bacteria | 1716 |
| 81 | Ga0068852_100037900 | 3300005616 | Bacteria | 4047 |
| 82 | Ga0068852_100230708 | 3300005616 | Bacteria | 1764 |
| 83 | Ga0068859_100042524 | 3300005617 | Bacteria | 4565 |
| 84 | Ga0068859_100116665 | 3300005617 | Bacteria | 2734 |
| 85 | Ga0068864_100156690 | 3300005618 | Bacteria | 2067 |
| 86 | Ga0068866_10077367 | 3300005718 | Bacteria | 1777 |
| 87 | Ga0068866_10115469 | 3300005718 | Bacteria | 1504 |
| 88 | Ga0068861_100054773 | 3300005719 | Bacteria | 3039 |
| 89 | Ga0068861_100056139 | 3300005719 | Bacteria | 3005 |
| 90 | Ga0068861_100352492 | 3300005719 | Bacteria | 1291 |
| 91 | Ga0068870_10102585 | 3300005840 | Bacteria | 1619 |
| 92 | Ga0068863_100554902 | 3300005841 | Bacteria | 1134 |
| 93 | Ga0068858_100038802 | 3300005842 | Bacteria | 4418 |
| 94 | Ga0068858_100509174 | 3300005842 | Bacteria | 1163 |
| 95 | Ga0068858_100858520 | 3300005842 | Bacteria | 887 |
| 96 | Ga0068860_100135420 | 3300005843 | Bacteria | 2365 |
| 97 | Ga0068860_100359235 | 3300005843 | Bacteria | 1435 |
| 98 | Ga0068860_101480190 | 3300005843 | Bacteria | 701 |
| 99 | Ga0068862_100220883 | 3300005844 | Bacteria | 1715 |
| 100 | Ga0068862_100441921 | 3300005844 | Bacteria | 1224 |
| 101 | Ga0068862_100914051 | 3300005844 | Bacteria | 863 |
| 102 | Ga0081455_10007381 | 3300005937 | Bacteria | 11587 |
| 103 | Ga0081455_10050780 | 3300005937 | Bacteria | 3563 |
| 104 | Ga0081540_1003488 | 3300005983 | Bacteria | 12411 |
| 105 | Ga0081540_1005580 | 3300005983 | Bacteria | 9369 |
| 106 | Ga0081540_1034639 | 3300005983 | Bacteria | 2718 |
| 107 | Ga0081540_1043025 | 3300005983 | Bacteria | 2322 |
| 108 | Ga0081540_1057059 | 3300005983 | Bacteria | 1891 |
| 109 | Ga0081540_1125650 | 3300005983 | Bacteria | 1056 |
| 110 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 111 | Ga0070717_10112306 | 3300006028 | Bacteria | 2325 |
| 112 | Ga0075365_10078749 | 3300006038 | Bacteria | 2229 |
| 113 | Ga0075365_10249056 | 3300006038 | Bacteria | 1248 |
| 114 | Ga0075365_10341134 | 3300006038 | Bacteria | 1056 |
| 115 | Ga0075365_10388110 | 3300006038 | Bacteria | 985 |
| 116 | Ga0075368_10052409 | 3300006042 | Bacteria | 1623 |
| 117 | Ga0070716_100447190 | 3300006173 | Bacteria | 941 |
| 118 | Ga0070712_100138553 | 3300006175 | Bacteria | 1854 |
| 119 | Ga0075362_10234520 | 3300006177 | Bacteria | 899 |
| 120 | Ga0075367_10004142 | 3300006178 | Bacteria | 7034 |
| 121 | Ga0075367_10206293 | 3300006178 | Bacteria | 1228 |
| 122 | Ga0075367_10296083 | 3300006178 | Bacteria | 1018 |
| 123 | Ga0075369_10209849 | 3300006186 | Bacteria | 900 |
| 124 | Ga0075366_10169439 | 3300006195 | Bacteria | 1325 |
| 125 | Ga0075366_10405279 | 3300006195 | Bacteria | 839 |
| 126 | Ga0097621_100717010 | 3300006237 | Bacteria | 922 |
| 127 | Ga0075370_10234127 | 3300006353 | Bacteria | 1087 |
| 128 | Ga0075370_10334385 | 3300006353 | Bacteria | 903 |
| 129 | Ga0068865_100187859 | 3300006881 | Bacteria | 1595 |
| 130 | Ga0097620_100042524 | 3300006931 | Bacteria | 4565 |
| 131 | Ga0097620_100116665 | 3300006931 | Bacteria | 2734 |
| 132 | Ga0075435_100022340 | 3300007076 | Bacteria | 4882 |
| 133 | Ga0099794_10079544 | 3300007265 | Bacteria | 1615 |
| 134 | Ga0111539_10027367 | 3300009094 | Bacteria | 6964 |
| 135 | Ga0111539_10479383 | 3300009094 | Bacteria | 1449 |
| 136 | Ga0105245_10065652 | 3300009098 | Bacteria | 3282 |
| 137 | Ga0105245_11360462 | 3300009098 | Bacteria | 759 |
| 138 | Ga0114129_11668549 | 3300009147 | Bacteria | 778 |
| 139 | Ga0105243_10017286 | 3300009148 | Bacteria | 5453 |
| 140 | Ga0105243_10279153 | 3300009148 | Bacteria | 1504 |
| 141 | Ga0105243_10287471 | 3300009148 | Bacteria | 1484 |
| 142 | Ga0105242_10408322 | 3300009176 | Bacteria | 1269 |
| 143 | Ga0105248_10870614 | 3300009177 | Bacteria | 1017 |
| 144 | Ga0105237_10240406 | 3300009545 | Bacteria | 1812 |
| 145 | Ga0105249_10404182 | 3300009553 | Bacteria | 1396 |
| 146 | Ga0105249_11263706 | 3300009553 | Bacteria | 810 |
| 147 | Ga0099796_10080818 | 3300010159 | Bacteria | 1191 |
| 148 | Ga0105239_10891805 | 3300010375 | Bacteria | 1021 |
| 149 | Ga0105246_10178652 | 3300011119 | Bacteria | 1632 |
| 150 | Ga0105246_10189923 | 3300011119 | Bacteria | 1589 |
| 151 | Ga0105246_10529514 | 3300011119 | Bacteria | 1006 |
| 152 | Ga0157371_10029898 | 3300013102 | Bacteria | 3933 |
| 153 | Ga0157370_10219374 | 3300013104 | Bacteria | 1762 |
| 154 | Ga0157378_10128247 | 3300013297 | Bacteria | 2345 |
| 155 | Ga0157378_10143352 | 3300013297 | Bacteria | 2220 |
| 156 | Ga0157378_10444907 | 3300013297 | Bacteria | 1285 |
| 157 | Ga0163162_10096952 | 3300013306 | Bacteria | 3037 |
| 158 | Ga0163162_10246129 | 3300013306 | Bacteria | 1920 |
| 159 | Ga0163162_10446030 | 3300013306 | Bacteria | 1426 |
| 160 | Ga0157375_10094489 | 3300013308 | Bacteria | 3059 |
| 161 | Ga0157375_10188592 | 3300013308 | Bacteria | 2216 |
| 162 | Ga0157375_10541565 | 3300013308 | Bacteria | 1326 |
| 163 | Ga0157375_11717602 | 3300013308 | Bacteria | 743 |
| 164 | Ga0163163_10021994 | 3300014325 | Bacteria | 6029 |
| 165 | Ga0163163_10123792 | 3300014325 | Bacteria | 2621 |
| 166 | Ga0163163_10167803 | 3300014325 | Bacteria | 2241 |
| 167 | Ga0157380_10127438 | 3300014326 | Bacteria | 2166 |
| 168 | Ga0157380_10541571 | 3300014326 | Bacteria | 1140 |
| 169 | Ga0157376_10285393 | 3300014969 | Bacteria | 1556 |
| 170 | Ga0157376_10325397 | 3300014969 | Bacteria | 1463 |
| 171 | Ga0163161_10087055 | 3300017792 | Bacteria | 2307 |
| 172 | Ga0209673_1035657 | 3300025273 | Bacteria | 1486 |
| 173 | Ga0209758_1003254 | 3300025297 | Bacteria | 15064 |
| 174 | Ga0209758_1005533 | 3300025297 | Bacteria | 9644 |
| 175 | Ga0209758_1033834 | 3300025297 | Bacteria | 2045 |
| 176 | Ga0209758_1060491 | 3300025297 | Bacteria | 1253 |
| 177 | Ga0207682_10094612 | 3300025893 | Bacteria | 1300 |
| 178 | Ga0207642_10204044 | 3300025899 | Bacteria | 1094 |
| 179 | Ga0207710_10301007 | 3300025900 | Bacteria | 810 |
| 180 | Ga0207688_10055213 | 3300025901 | Bacteria | 2229 |
| 181 | Ga0207688_10234211 | 3300025901 | Bacteria | 1109 |
| 182 | Ga0207688_10330408 | 3300025901 | Bacteria | 937 |
| 183 | Ga0207688_10507983 | 3300025901 | Bacteria | 755 |
| 184 | Ga0207680_10229433 | 3300025903 | Bacteria | 1276 |
| 185 | Ga0207645_10378032 | 3300025907 | Bacteria | 950 |
| 186 | Ga0207643_10027901 | 3300025908 | Bacteria | 3133 |
| 187 | Ga0207643_10506996 | 3300025908 | Bacteria | 772 |
| 188 | Ga0207705_10383306 | 3300025909 | Bacteria | 1086 |
| 189 | Ga0207684_10516367 | 3300025910 | Bacteria | 1023 |
| 190 | Ga0207654_10400552 | 3300025911 | Bacteria | 954 |
| 191 | Ga0207671_10041905 | 3300025914 | Bacteria | 3389 |
| 192 | Ga0207662_10072853 | 3300025918 | Bacteria | 2083 |
| 193 | Ga0207657_10184324 | 3300025919 | Bacteria | 1686 |
| 194 | Ga0207694_10465023 | 3300025924 | Bacteria | 1057 |
| 195 | Ga0207650_10257832 | 3300025925 | Bacteria | 1414 |
| 196 | Ga0207659_10139481 | 3300025926 | Bacteria | 1881 |
| 197 | Ga0207659_10182571 | 3300025926 | Bacteria | 1663 |
| 198 | Ga0207687_10047519 | 3300025927 | Bacteria | 2976 |
| 199 | Ga0207664_10642554 | 3300025929 | Bacteria | 953 |
| 200 | Ga0207644_10083124 | 3300025931 | Bacteria | 2370 |
| 201 | Ga0207644_10137677 | 3300025931 | Bacteria | 1876 |
| 202 | Ga0207706_10467405 | 3300025933 | Bacteria | 1090 |
| 203 | Ga0207670_10288939 | 3300025936 | Bacteria | 1280 |
| 204 | Ga0207670_10350627 | 3300025936 | Bacteria | 1169 |
| 205 | Ga0207670_10446006 | 3300025936 | Bacteria | 1042 |
| 206 | Ga0207669_10127763 | 3300025937 | Bacteria | 1740 |
| 207 | Ga0207704_10055671 | 3300025938 | Bacteria | 2418 |
| 208 | Ga0207704_10191077 | 3300025938 | Bacteria | 1489 |
| 209 | Ga0207665_10028702 | 3300025939 | Bacteria | 3677 |
| 210 | Ga0207691_10264783 | 3300025940 | Bacteria | 1481 |
| 211 | Ga0207691_10469031 | 3300025940 | Bacteria | 1070 |
| 212 | Ga0207691_10596346 | 3300025940 | Bacteria | 935 |
| 213 | Ga0207711_10339804 | 3300025941 | Bacteria | 1389 |
| 214 | Ga0207689_10125055 | 3300025942 | Bacteria | 2116 |
| 215 | Ga0207689_10569751 | 3300025942 | Bacteria | 952 |
| 216 | Ga0207679_10514915 | 3300025945 | Bacteria | 1069 |
| 217 | Ga0207667_11420070 | 3300025949 | Bacteria | 667 |
| 218 | Ga0207651_10373036 | 3300025960 | Bacteria | 1207 |
| 219 | Ga0207712_10092594 | 3300025961 | Bacteria | 2229 |
| 220 | Ga0207712_10367141 | 3300025961 | Bacteria | 1201 |
| 221 | Ga0207668_10083672 | 3300025972 | Bacteria | 2322 |
| 222 | Ga0207668_10274960 | 3300025972 | Bacteria | 1378 |
| 223 | Ga0207668_10391492 | 3300025972 | Bacteria | 1172 |
| 224 | Ga0207640_10206208 | 3300025981 | Bacteria | 1494 |
| 225 | Ga0207640_10865327 | 3300025981 | Bacteria | 787 |
| 226 | Ga0207658_10226107 | 3300025986 | Bacteria | 1577 |
| 227 | Ga0207658_10561494 | 3300025986 | Bacteria | 1022 |
| 228 | Ga0207677_10212664 | 3300026023 | Bacteria | 1545 |
| 229 | Ga0207703_10037725 | 3300026035 | Bacteria | 3851 |
| 230 | Ga0207703_10089355 | 3300026035 | Bacteria | 2587 |
| 231 | Ga0207639_10919523 | 3300026041 | Bacteria | 818 |
| 232 | Ga0207678_10004213 | 3300026067 | Bacteria | 12909 |
| 233 | Ga0207678_10359713 | 3300026067 | Bacteria | 1256 |
| 234 | Ga0207678_10370903 | 3300026067 | Bacteria | 1236 |
| 235 | Ga0207678_10483861 | 3300026067 | Bacteria | 1078 |
| 236 | Ga0207678_10628902 | 3300026067 | Bacteria | 942 |
| 237 | Ga0207708_10066280 | 3300026075 | Bacteria | 2761 |
| 238 | Ga0207702_10156027 | 3300026078 | Bacteria | 2081 |
| 239 | Ga0207702_10753079 | 3300026078 | Bacteria | 962 |
| 240 | Ga0207641_11038456 | 3300026088 | Bacteria | 817 |
| 241 | Ga0207648_10034157 | 3300026089 | Bacteria | 4485 |
| 242 | Ga0207648_10074297 | 3300026089 | Bacteria | 2963 |
| 243 | Ga0207648_10130555 | 3300026089 | Bacteria | 2212 |
| 244 | Ga0207676_10133659 | 3300026095 | Bacteria | 2113 |
| 245 | Ga0207674_10378676 | 3300026116 | Bacteria | 1368 |
| 246 | Ga0207675_100069784 | 3300026118 | Bacteria | 3284 |
| 247 | Ga0207675_100102602 | 3300026118 | Bacteria | 2695 |
| 248 | Ga0207683_10130438 | 3300026121 | Bacteria | 2261 |
| 249 | Ga0207683_10441975 | 3300026121 | Bacteria | 1199 |
| 250 | Ga0207698_10129535 | 3300026142 | Bacteria | 2153 |
| 251 | Ga0207698_10170561 | 3300026142 | Bacteria | 1915 |
| 252 | Ga0209588_1140868 | 3300027671 | Bacteria | 766 |
| 253 | Ga0207428_10040827 | 3300027907 | Bacteria | 3759 |
| 254 | Ga0268266_10001906 | 3300028379 | Bacteria | 23472 |
| 255 | Ga0268266_10039111 | 3300028379 | Bacteria | 4039 |
| 256 | Ga0268266_10892597 | 3300028379 | Bacteria | 859 |
| 257 | Ga0268264_10508080 | 3300028381 | Bacteria | 1176 |
| 258 | Ga0268264_10586467 | 3300028381 | Bacteria | 1097 |
| 259 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 260 | Ga0307512_10178733 | 3300030522 | Bacteria | 1198 |
| 261 | Ga0265330_10020800 | 3300031235 | Bacteria | 2998 |
| 262 | Ga0265328_10151576 | 3300031239 | Bacteria | 872 |
| 263 | Ga0265325_10046397 | 3300031241 | Bacteria | 2254 |
| 264 | Ga0265340_10014378 | 3300031247 | Bacteria | 4135 |
| 265 | Ga0265331_10012035 | 3300031250 | Bacteria | 4711 |
| 266 | Ga0265316_10239997 | 3300031344 | Bacteria | 1333 |
| 267 | Ga0307509_10473816 | 3300031507 | Bacteria | 941 |
| 268 | Ga0265314_10178567 | 3300031711 | Bacteria | 1274 |
| 269 | Ga0265342_10016250 | 3300031712 | Bacteria | 4868 |
| 270 | Ga0307516_10601117 | 3300031730 | Bacteria | 754 |
| 271 | Ga0307413_10165625 | 3300031824 | Bacteria | 1558 |
| 272 | Ga0307412_10375761 | 3300031911 | Bacteria | 1149 |
| 273 | Ga0307409_100644211 | 3300031995 | Bacteria | 1053 |
| 274 | Ga0307416_100452416 | 3300032002 | Bacteria | 1337 |
| 275 | Ga0307416_101234116 | 3300032002 | Bacteria | 853 |
| 276 | Ga0307415_100576864 | 3300032126 | Bacteria | 997 |
| 277 | Ga0307510_10065796 | 3300033180 | Bacteria | 3666 |
| 278 | Ga0373950_0021747 | 3300034818 | Bacteria | 1137 |
| 279 | Ga0373934_0155506 | 3300035086 | Bacteria | 937 |
| 280 | Ga0373923_0057623 | 3300035111 | Bacteria | 1643 |
| 281 | Ga0373939_0032740 | 3300035114 | Bacteria | 1513 |
| 282 | Ga0373953_0009823 | 3300035117 | Bacteria | 3309 |
| 283 | Ga0373954_0001251 | 3300035118 | Bacteria | 10243 |
| 284 | Ga0373956_0002392 | 3300035119 | Bacteria | 7665 |
| 285 | Ga0373957_0034018 | 3300035120 | Bacteria | 1884 |
| 286 | Ga0373955_0002799 | 3300035172 | Bacteria | 7662 |
| 287 | Ga0373924_0008694 | 3300035410 | Bacteria | 3701 |
| 288 | Ga0373935_0194184 | 3300035692 | Bacteria | 1400 |
| 289 | Ga0373935_0425496 | 3300035692 | Bacteria | 956 |
| 290 | Ga0373937_0019726 | 3300036401 | Bacteria | 6038 |
| 291 | Ga0373925_0602642 | 3300037068 | Bacteria | 905 |
| 292 | Ga0395899_0203479 | 3300037312 | Bacteria | 1379 |
| 293 | Ga0395900_0013190 | 3300037418 | Bacteria | 8447 |
| 294 | Ga0395898_0384830 | 3300037466 | Bacteria | 1338 |
| 295 | Ga0395905_0406929 | 3300037471 | Bacteria | 1256 |
| 296 | Ga0395901_0031964 | 3300038443 | Bacteria | 5429 |
| 297 | Ga0451789_0036013 | 3300041443 | Bacteria | 1226 |
| 298 | Ga0439431_0148455 | 3300041997 | Bacteria | 665 |
| 299 | Ga0439458_0024859 | 3300042157 | Bacteria | 1402 |
| 300 | Ga0439464_0066430 | 3300042439 | Bacteria | 1062 |
| 301 | Ga0466969_0060548 | 3300044656 | Bacteria | 1840 |
| 302 | Ga0466959_0216260 | 3300045049 | Bacteria | 1330 |
| 303 | Ga0495592_0004510 | 3300046454 | Bacteria | 10194 |
| 304 | Ga0495592_0518573 | 3300046454 | Bacteria | 737 |
| 305 | Ga0495603_0031230 | 3300046455 | Bacteria | 3206 |
| 306 | Ga0495603_0326583 | 3300046455 | Bacteria | 881 |
| 307 | Ga0495590_0142800 | 3300046457 | Bacteria | 865 |
| 308 | Ga0495629_0004360 | 3300046459 | Bacteria | 10610 |
| 309 | Ga0495629_0017285 | 3300046459 | Bacteria | 5171 |
| 310 | Ga0495629_0432694 | 3300046459 | Bacteria | 892 |
| 311 | Ga0495629_0537582 | 3300046459 | Bacteria | 785 |
| 312 | Ga0495638_0063557 | 3300046460 | Bacteria | 2275 |
| 313 | Ga0495641_0155872 | 3300046461 | Bacteria | 1021 |
| 314 | Ga0495651_0049620 | 3300046462 | Bacteria | 3240 |
| 315 | Ga0495651_0144593 | 3300046462 | Bacteria | 1720 |
| 316 | Ga0495651_0149658 | 3300046462 | Bacteria | 1684 |
| 317 | Ga0495653_0011881 | 3300046463 | Bacteria | 7112 |
| 318 | Ga0495650_0111712 | 3300046471 | Bacteria | 1014 |
| 319 | Ga0495650_0155653 | 3300046471 | Bacteria | 818 |
| 320 | Ga0495662_0173379 | 3300046476 | Bacteria | 1063 |
| 321 | Ga0495664_0100410 | 3300046477 | Bacteria | 1743 |
| 322 | Ga0495585_0445845 | 3300046492 | Bacteria | 619 |
| 323 | Ga0495594_0066233 | 3300046499 | Bacteria | 2004 |
| 324 | Ga0495594_0099816 | 3300046499 | Bacteria | 1633 |
| 325 | Ga0495596_0093990 | 3300046500 | Bacteria | 1164 |
| 326 | Ga0495607_0014122 | 3300046501 | Bacteria | 5212 |
| 327 | Ga0495607_0152782 | 3300046501 | Bacteria | 1180 |
| 328 | Ga0495606_0005524 | 3300046507 | Bacteria | 12067 |
| 329 | Ga0495606_0116238 | 3300046507 | Bacteria | 1607 |
| 330 | Ga0495606_0167353 | 3300046507 | Bacteria | 1278 |
| 331 | Ga0495608_0004196 | 3300046511 | Bacteria | 10325 |
| 332 | Ga0495610_0080001 | 3300046512 | Bacteria | 1503 |
| 333 | Ga0495616_0110214 | 3300046513 | Bacteria | 1279 |
| 334 | Ga0495618_0014329 | 3300046514 | Bacteria | 4830 |
| 335 | Ga0495620_0028200 | 3300046515 | Bacteria | 2614 |
| 336 | Ga0495628_0017593 | 3300046516 | Bacteria | 5945 |
| 337 | Ga0495628_0288579 | 3300046516 | Bacteria | 1217 |
| 338 | Ga0495628_0487783 | 3300046516 | Bacteria | 891 |
| 339 | Ga0495630_1001900 | 3300046517 | Bacteria | 635 |
| 340 | Ga0495631_0005921 | 3300046518 | Bacteria | 6363 |
| 341 | Ga0495631_0090814 | 3300046518 | Bacteria | 1315 |
| 342 | Ga0495631_0185321 | 3300046518 | Bacteria | 891 |
| 343 | Ga0495643_0054634 | 3300046522 | Bacteria | 2137 |
| 344 | Ga0495644_0057738 | 3300046523 | Bacteria | 1459 |
| 345 | Ga0495648_0153781 | 3300046524 | Bacteria | 1197 |
| 346 | Ga0495648_0209335 | 3300046524 | Bacteria | 970 |
| 347 | Ga0495666_0059085 | 3300046526 | Bacteria | 1834 |
| 348 | Ga0495652_0021450 | 3300046529 | Bacteria | 5742 |
| 349 | Ga0495652_0082023 | 3300046529 | Bacteria | 2659 |
| 350 | Ga0495654_0016517 | 3300046530 | Bacteria | 3900 |
| 351 | Ga0495640_0017203 | 3300046533 | Bacteria | 5394 |
| 352 | Ga0495640_0018260 | 3300046533 | Bacteria | 5208 |
| 353 | Ga0495587_0009714 | 3300046536 | Bacteria | 6152 |
| 354 | Ga0495597_0038307 | 3300046542 | Bacteria | 2149 |
| 355 | Ga0495645_0201305 | 3300046543 | Bacteria | 1351 |
| 356 | Ga0495622_0089265 | 3300046557 | Bacteria | 1416 |
| 357 | Ga0495622_0198980 | 3300046557 | Bacteria | 893 |
| 358 | Ga0495633_0106235 | 3300046558 | Bacteria | 1302 |
| 359 | Ga0495633_0256683 | 3300046558 | Bacteria | 797 |
| 360 | Ga0495667_0003525 | 3300046559 | Bacteria | 10504 |
| 361 | Ga0495656_0064515 | 3300046615 | Bacteria | 1608 |
| 362 | Ga0495668_0121514 | 3300046616 | Bacteria | 1429 |
| 363 | Ga0495668_0186912 | 3300046616 | Bacteria | 1135 |
| 364 | Ga0495668_0280332 | 3300046616 | Bacteria | 913 |
| 365 | Ga0495668_0311076 | 3300046616 | Bacteria | 864 |
| 366 | Ga0495634_0515185 | 3300046642 | Bacteria | 700 |
| 367 | Ga0495611_0065013 | 3300046648 | Bacteria | 1662 |
| 368 | Ga0495625_0051205 | 3300046660 | Bacteria | 2960 |
| 369 | Ga0495625_0279783 | 3300046660 | Bacteria | 1074 |
| 370 | Ga0495635_0003646 | 3300046663 | Bacteria | 10680 |
| 371 | Ga0495635_0007981 | 3300046663 | Bacteria | 7400 |
| 372 | Ga0495659_0027918 | 3300046664 | Bacteria | 1950 |
| 373 | Ga0495661_0052161 | 3300046665 | Bacteria | 2465 |
| 374 | Ga0495588_0167095 | 3300046674 | Bacteria | 1163 |
| 375 | Ga0495657_0004913 | 3300046675 | Bacteria | 10635 |
| 376 | Ga0495657_0282008 | 3300046675 | Bacteria | 994 |
| 377 | Ga0495599_0011722 | 3300046678 | Bacteria | 5388 |
| 378 | Ga0495623_0016409 | 3300046679 | Bacteria | 4784 |
| 379 | Ga0495646_0007134 | 3300046680 | Bacteria | 7098 |
| 380 | Ga0495669_0049163 | 3300046684 | Bacteria | 1887 |
| 381 | Ga0495613_0087361 | 3300046689 | Bacteria | 2260 |
| 382 | Ga0495624_0070244 | 3300046690 | Bacteria | 2180 |
| 383 | Ga0495670_0004607 | 3300046691 | Bacteria | 6763 |
| 384 | Ga0495670_0109527 | 3300046691 | Bacteria | 1428 |
| 385 | Ga0495670_0253334 | 3300046691 | Bacteria | 939 |
| 386 | Ga0495589_0149912 | 3300046794 | Bacteria | 1114 |
| 387 | Ga0495600_0086940 | 3300046809 | Bacteria | 2039 |
| 388 | Ga0495600_0203956 | 3300046809 | Bacteria | 1269 |
| 389 | Ga0495660_0316707 | 3300046810 | Bacteria | 702 |
| 390 | Ga0495581_0027362 | 3300047315 | Bacteria | 3307 |
| 391 | Ga0495581_0110234 | 3300047315 | Bacteria | 1600 |
| 392 | Ga0495604_0002900 | 3300047317 | Bacteria | 13743 |
| 393 | Ga0495604_0040985 | 3300047317 | Bacteria | 3633 |
| 394 | Ga0495676_0155589 | 3300047321 | Bacteria | 1622 |
| 395 | Ga0495680_0025446 | 3300047322 | Bacteria | 4897 |
| 396 | Ga0495680_0161446 | 3300047322 | Bacteria | 1627 |
| 397 | Ga0495687_053686 | 3300047443 | Bacteria | 1696 |
| 398 | Ga0495675_0016233 | 3300047444 | Bacteria | 4709 |
| 399 | Ga0495677_0014886 | 3300047445 | Bacteria | 2829 |
| 400 | Ga0495673_0162680 | 3300047469 | Bacteria | 856 |
| 401 | Ga0495681_0080380 | 3300047470 | Bacteria | 1456 |
| 402 | Ga0495684_0019011 | 3300047471 | Bacteria | 5289 |
| 403 | Ga0495686_0113872 | 3300047472 | Bacteria | 1619 |
| 404 | Ga0495686_0214948 | 3300047472 | Bacteria | 1096 |
| 405 | Ga0495593_0003761 | 3300047673 | Bacteria | 9064 |
| 406 | Ga0495602_0031219 | 3300048088 | Bacteria | 5040 |
| 407 | Ga0495602_0173091 | 3300048088 | Bacteria | 1674 |
| 408 | Ga0495602_0390876 | 3300048088 | Bacteria | 994 |
| 409 | Ga0496100_0168494 | 3300048903 | Bacteria | 1575 |
| 410 | Ga0496101_0474026 | 3300048904 | Bacteria | 988 |
| 411 | Ga0496102_0521133 | 3300048905 | Bacteria | 1111 |
| 412 | Ga0496102_1003362 | 3300048905 | Bacteria | 755 |
| 413 | Ga0496103_0397891 | 3300048906 | Bacteria | 885 |
| 414 | Ga0496103_0443226 | 3300048906 | Bacteria | 833 |
| 415 | Ga0496104_0005504 | 3300048907 | Bacteria | 11092 |
| 416 | Ga0496104_0083684 | 3300048907 | Bacteria | 3043 |
| 417 | Ga0496104_0486541 | 3300048907 | Bacteria | 1145 |
| 418 | Ga0496104_0942968 | 3300048907 | Bacteria | 768 |
| 419 | Ga0496105_0589020 | 3300048908 | Bacteria | 864 |
| 420 | Ga0496105_0650616 | 3300048908 | Bacteria | 813 |
| 421 | Ga0496106_0001943 | 3300048909 | Bacteria | 15501 |
| 422 | Ga0496106_0338567 | 3300048909 | Bacteria | 1208 |
| 423 | Ga0496106_0521282 | 3300048909 | Bacteria | 954 |
| 424 | Ga0496107_0007455 | 3300048910 | Bacteria | 7542 |
| 425 | Ga0496108_0000927 | 3300048911 | Bacteria | 22857 |
| 426 | Ga0496108_0096970 | 3300048911 | Bacteria | 2512 |
| 427 | Ga0496108_0361334 | 3300048911 | Bacteria | 1267 |
| 428 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 429 | Ga0496109_0035650 | 3300048912 | Bacteria | 4489 |
| 430 | Ga0496109_0433336 | 3300048912 | Bacteria | 1242 |
| 431 | Ga0496109_0473021 | 3300048912 | Bacteria | 1183 |
| 432 | Ga0496110_0054510 | 3300048913 | Bacteria | 3517 |
| 433 | Ga0496110_0175183 | 3300048913 | Bacteria | 1947 |
| 434 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 435 | Ga0496112_0001343 | 3300048915 | Bacteria | 18708 |
| 436 | Ga0496112_0072258 | 3300048915 | Bacteria | 3410 |
| 437 | Ga0496112_0334827 | 3300048915 | Bacteria | 1457 |
| 438 | Ga0496112_0476361 | 3300048915 | Bacteria | 1185 |
| 439 | Ga0496112_0641583 | 3300048915 | Bacteria | 992 |
| 440 | Ga0496112_1134706 | 3300048915 | Bacteria | 699 |
| 441 | Ga0496113_0115029 | 3300048916 | Bacteria | 2098 |
| 442 | Ga0496113_0265274 | 3300048916 | Bacteria | 1372 |
| 443 | Ga0496114_0451408 | 3300048917 | Bacteria | 1139 |
| 444 | Ga0496114_1164105 | 3300048917 | Bacteria | 657 |
| 445 | Ga0496115_0463331 | 3300048918 | Bacteria | 1022 |
| 446 | Ga0496116_0219226 | 3300048919 | Bacteria | 977 |
| 447 | Ga0496117_0221736 | 3300048920 | Bacteria | 1052 |
| 448 | Ga0496119_0035028 | 3300048922 | Bacteria | 3295 |
| 449 | Ga0496119_0341273 | 3300048922 | Bacteria | 728 |
| 450 | Ga0496120_0012939 | 3300048923 | Bacteria | 5648 |
| 451 | Ga0496120_0064399 | 3300048923 | Bacteria | 2035 |
| 452 | Ga0496121_0095221 | 3300048924 | Bacteria | 2314 |
| 453 | Ga0496121_0237799 | 3300048924 | Bacteria | 1271 |
| 454 | Ga0496121_0388794 | 3300048924 | Bacteria | 917 |
| 455 | Ga0496121_0389309 | 3300048924 | Bacteria | 917 |
| 456 | Ga0496122_0012751 | 3300048925 | Bacteria | 8318 |
| 457 | Ga0496122_0326670 | 3300048925 | Bacteria | 813 |
| 458 | Ga0496123_0009028 | 3300048926 | Bacteria | 9040 |
| 459 | Ga0496124_0229037 | 3300048927 | Bacteria | 1391 |
| 460 | Ga0496124_0456659 | 3300048927 | Bacteria | 869 |
| 461 | Ga0496125_0000843 | 3300048928 | Bacteria | 49244 |
| 462 | Ga0496125_0091066 | 3300048928 | Bacteria | 2286 |
| 463 | Ga0496126_0006001 | 3300048929 | Bacteria | 13646 |
| 464 | Ga0496126_0011123 | 3300048929 | Bacteria | 9346 |
| 465 | Ga0496126_0154742 | 3300048929 | Bacteria | 1963 |
| 466 | Ga0496126_0587014 | 3300048929 | Bacteria | 879 |
| 467 | Ga0496126_0663484 | 3300048929 | Bacteria | 814 |
| 468 | Ga0496126_0804901 | 3300048929 | Bacteria | 721 |
| 469 | Ga0495682_0159325 | 3300049460 | Bacteria | 804 |
| 470 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 471 | Ga0501031_0010399 | 3300049568 | Bacteria | 6059 |
| 472 | Ga0501031_0128730 | 3300049568 | Bacteria | 1653 |
| 473 | Ga0501032_0000252 | 3300049569 | Bacteria | 44619 |
| 474 | Ga0501032_0006386 | 3300049569 | Bacteria | 8683 |
| 475 | Ga0501032_0010617 | 3300049569 | Bacteria | 6631 |
| 476 | Ga0501032_0042888 | 3300049569 | Bacteria | 3067 |
| 477 | Ga0501032_0092620 | 3300049569 | Bacteria | 2004 |
| 478 | Ga0501032_0115315 | 3300049569 | Bacteria | 1776 |
| 479 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 480 | Ga0501033_0002710 | 3300049570 | Bacteria | 14858 |
| 481 | Ga0501033_0015402 | 3300049570 | Bacteria | 5801 |
| 482 | Ga0501033_0023648 | 3300049570 | Bacteria | 4634 |
| 483 | Ga0501033_0044297 | 3300049570 | Bacteria | 3312 |
| 484 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 485 | Ga0501034_0003727 | 3300049571 | Bacteria | 17214 |
| 486 | Ga0501034_0046721 | 3300049571 | Bacteria | 4374 |
| 487 | Ga0501034_0091436 | 3300049571 | Bacteria | 3040 |
| 488 | Ga0501034_0101586 | 3300049571 | Bacteria | 2869 |
| 489 | Ga0501034_0390619 | 3300049571 | Bacteria | 1315 |
| 490 | Ga0501034_0391780 | 3300049571 | Bacteria | 1313 |
| 491 | Ga0501036_0001268 | 3300049572 | Bacteria | 19351 |
| 492 | Ga0501036_0001281 | 3300049572 | Bacteria | 19291 |
| 493 | Ga0501036_0062524 | 3300049572 | Bacteria | 3153 |
| 494 | Ga0501036_0100597 | 3300049572 | Bacteria | 2445 |
| 495 | Ga0501036_0343167 | 3300049572 | Bacteria | 1247 |
| 496 | Ga0501036_0518562 | 3300049572 | Bacteria | 991 |
| 497 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 498 | Ga0501037_0000618 | 3300049573 | Bacteria | 27557 |
| 499 | Ga0501037_0002956 | 3300049573 | Bacteria | 12324 |
| 500 | Ga0501037_0003059 | 3300049573 | Bacteria | 12126 |
| 501 | Ga0501037_0084767 | 3300049573 | Bacteria | 2294 |
| 502 | Ga0501037_0257493 | 3300049573 | Bacteria | 1220 |
| 503 | Ga0501037_0342966 | 3300049573 | Bacteria | 1032 |
| 504 | Ga0501038_0000538 | 3300049574 | Bacteria | 33271 |
| 505 | Ga0501038_0003724 | 3300049574 | Bacteria | 14201 |
| 506 | Ga0501038_0006827 | 3300049574 | Bacteria | 10543 |
| 507 | Ga0501038_0016712 | 3300049574 | Bacteria | 6647 |
| 508 | Ga0501038_0131534 | 3300049574 | Bacteria | 2054 |
| 509 | Ga0501038_0809905 | 3300049574 | Bacteria | 695 |
| 510 | Ga0501039_0000123 | 3300049575 | Bacteria | 53579 |
| 511 | Ga0501039_0001032 | 3300049575 | Bacteria | 20355 |
| 512 | Ga0501039_0039725 | 3300049575 | Bacteria | 3633 |
| 513 | Ga0501039_0220929 | 3300049575 | Bacteria | 1489 |
| 514 | Ga0501039_0349500 | 3300049575 | Bacteria | 1162 |
| 515 | Ga0501040_0020499 | 3300049576 | Bacteria | 4406 |
| 516 | Ga0501040_0202117 | 3300049576 | Bacteria | 1411 |
| 517 | Ga0501040_0310652 | 3300049576 | Bacteria | 1127 |
| 518 | Ga0501041_0201110 | 3300049577 | Bacteria | 1249 |
| 519 | Ga0501041_0386923 | 3300049577 | Bacteria | 885 |
| 520 | Ga0501042_0017959 | 3300049578 | Bacteria | 4892 |
| 521 | Ga0501042_0022883 | 3300049578 | Bacteria | 4366 |
| 522 | Ga0501043_0002344 | 3300049579 | Bacteria | 16056 |
| 523 | Ga0501043_0010624 | 3300049579 | Bacteria | 7210 |
| 524 | Ga0501043_0012301 | 3300049579 | Bacteria | 6689 |
| 525 | Ga0501043_0016441 | 3300049579 | Bacteria | 5801 |
| 526 | Ga0501043_0025533 | 3300049579 | Bacteria | 4636 |
| 527 | Ga0501043_0037522 | 3300049579 | Bacteria | 3811 |
| 528 | Ga0501043_0506340 | 3300049579 | Bacteria | 901 |
| 529 | Ga0501046_0000434 | 3300049580 | Bacteria | 41950 |
| 530 | Ga0501046_0003718 | 3300049580 | Bacteria | 13966 |
| 531 | Ga0501046_0084320 | 3300049580 | Bacteria | 2451 |
| 532 | Ga0501046_0369567 | 3300049580 | Bacteria | 1039 |
| 533 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 534 | Ga0501047_0003496 | 3300049581 | Bacteria | 14841 |
| 535 | Ga0501047_0341175 | 3300049581 | Bacteria | 1335 |
| 536 | Ga0501047_0362177 | 3300049581 | Bacteria | 1286 |
| 537 | Ga0501047_0777833 | 3300049581 | Bacteria | 772 |
| 538 | Ga0501047_0924465 | 3300049581 | Bacteria | 686 |
| 539 | Ga0501048_0016159 | 3300049582 | Bacteria | 5502 |
| 540 | Ga0501048_0021902 | 3300049582 | Bacteria | 4677 |
| 541 | Ga0501048_0418465 | 3300049582 | Bacteria | 958 |
| 542 | Ga0501067_0000628 | 3300049583 | Bacteria | 18974 |
| 543 | Ga0501067_0024682 | 3300049583 | Bacteria | 3334 |
| 544 | Ga0501067_0029214 | 3300049583 | Bacteria | 3055 |
| 545 | Ga0501067_0260860 | 3300049583 | Bacteria | 965 |
| 546 | Ga0501067_0316837 | 3300049583 | Bacteria | 869 |
| 547 | Ga0501068_0000080 | 3300049584 | Bacteria | 39376 |
| 548 | Ga0501068_0001483 | 3300049584 | Bacteria | 12485 |
| 549 | Ga0501068_0029036 | 3300049584 | Bacteria | 3273 |
| 550 | Ga0501068_0044449 | 3300049584 | Bacteria | 2674 |
| 551 | Ga0501068_0285192 | 3300049584 | Bacteria | 1056 |
| 552 | Ga0501069_0003537 | 3300049585 | Bacteria | 8040 |
| 553 | Ga0501069_0010836 | 3300049585 | Bacteria | 4831 |
| 554 | Ga0501069_0059172 | 3300049585 | Bacteria | 2138 |
| 555 | Ga0501069_0252377 | 3300049585 | Bacteria | 1029 |
| 556 | Ga0501070_0005971 | 3300049586 | Bacteria | 10376 |
| 557 | Ga0501070_0006615 | 3300049586 | Bacteria | 9864 |
| 558 | Ga0501070_0013417 | 3300049586 | Bacteria | 6907 |
| 559 | Ga0501070_0115926 | 3300049586 | Bacteria | 2212 |
| 560 | Ga0501070_0147120 | 3300049586 | Bacteria | 1944 |
| 561 | Ga0501070_0264699 | 3300049586 | Bacteria | 1405 |
| 562 | Ga0501070_0285270 | 3300049586 | Bacteria | 1347 |
| 563 | Ga0501070_0351724 | 3300049586 | Bacteria | 1196 |
| 564 | Ga0501070_0671273 | 3300049586 | Bacteria | 821 |
| 565 | Ga0501071_0030772 | 3300049587 | Bacteria | 3798 |
| 566 | Ga0501071_0172399 | 3300049587 | Bacteria | 1620 |
| 567 | Ga0501071_0474463 | 3300049587 | Bacteria | 958 |
| 568 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 569 | Ga0501072_0022570 | 3300049588 | Bacteria | 4880 |
| 570 | Ga0501072_0050010 | 3300049588 | Bacteria | 3291 |
| 571 | Ga0501073_0000062 | 3300049589 | Bacteria | 66884 |
| 572 | Ga0501073_0022730 | 3300049589 | Bacteria | 4511 |
| 573 | Ga0501073_0057522 | 3300049589 | Bacteria | 2718 |
| 574 | Ga0501073_0584866 | 3300049589 | Bacteria | 771 |
| 575 | Ga0501074_0003814 | 3300049590 | Bacteria | 10720 |
| 576 | Ga0501074_0004173 | 3300049590 | Bacteria | 10321 |
| 577 | Ga0501074_0025611 | 3300049590 | Bacteria | 4281 |
| 578 | Ga0501076_0188450 | 3300049592 | Bacteria | 1683 |
| 579 | Ga0501076_0214263 | 3300049592 | Bacteria | 1574 |
| 580 | Ga0501076_0247394 | 3300049592 | Bacteria | 1459 |
| 581 | Ga0501077_0358836 | 3300049593 | Bacteria | 930 |
| 582 | Ga0501079_0001399 | 3300049741 | Bacteria | 17010 |
| 583 | Ga0501079_0042008 | 3300049741 | Bacteria | 3531 |
| 584 | Ga0501079_0084642 | 3300049741 | Bacteria | 2453 |
| 585 | Ga0501080_0004990 | 3300049742 | Bacteria | 11818 |
| 586 | Ga0501080_0009398 | 3300049742 | Bacteria | 8917 |
| 587 | Ga0501080_0009556 | 3300049742 | Bacteria | 8853 |
| 588 | Ga0501080_0151709 | 3300049742 | Bacteria | 2141 |
| 589 | Ga0501080_0475164 | 3300049742 | Bacteria | 1119 |
| 590 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 591 | Ga0501083_0011859 | 3300049744 | Bacteria | 6109 |
| 592 | Ga0501083_0065375 | 3300049744 | Bacteria | 2422 |
| 593 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 594 | Ga0501035_0000197 | 3300049822 | Bacteria | 73618 |
| 595 | Ga0501035_0001311 | 3300049822 | Bacteria | 25709 |
| 596 | Ga0501035_0005159 | 3300049822 | Bacteria | 12356 |
| 597 | Ga0501035_0009884 | 3300049822 | Bacteria | 8856 |
| 598 | Ga0501035_0268205 | 3300049822 | Bacteria | 1445 |
| 599 | Ga0501035_0453789 | 3300049822 | Bacteria | 1060 |
| 600 | Ga0501035_0532077 | 3300049822 | Bacteria | 964 |
| 601 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 602 | Ga0501044_0010966 | 3300049823 | Bacteria | 9837 |
| 603 | Ga0501044_0047956 | 3300049823 | Bacteria | 4416 |
| 604 | Ga0501044_0093934 | 3300049823 | Bacteria | 3024 |
| 605 | Ga0501044_0161710 | 3300049823 | Bacteria | 2215 |
| 606 | Ga0501044_0439541 | 3300049823 | Bacteria | 1212 |
| 607 | Ga0501044_0545981 | 3300049823 | Bacteria | 1056 |
| 608 | Ga0501045_0028538 | 3300049824 | Bacteria | 4026 |
| 609 | Ga0501045_0032643 | 3300049824 | Bacteria | 3774 |
| 610 | Ga0501045_0033294 | 3300049824 | Bacteria | 3737 |
| 611 | nmdc:mga03n38_50653_c1 | 3300050490 | Bacteria | 1852 |
| 612 | nmdc:mga00v17_146280_c1 | 3300050491 | Bacteria | 1517 |
| 613 | nmdc:mga0yw44_320719_c1 | 3300050492 | Bacteria | 1040 |
| 614 | nmdc:mga0k408_135533_c1 | 3300050493 | Bacteria | 1463 |
| 615 | nmdc:mga0k408_65144_c1 | 3300050493 | Bacteria | 2121 |
| 616 | nmdc:mga06z11_171815_c1 | 3300050494 | Bacteria | 1245 |
| 617 | nmdc:mga06z11_1933_c1 | 3300050494 | Bacteria | 7817 |
| 618 | nmdc:mga06z11_95515_c1 | 3300050494 | Bacteria | 1622 |
| 619 | nmdc:mga07m45_184104_c1 | 3300050496 | Bacteria | 1214 |
| 620 | nmdc:mga07m45_26620_c1 | 3300050496 | Bacteria | 3180 |
| 621 | nmdc:mga08y16_16805_c1 | 3300050511 | Bacteria | 7702 |
| 622 | nmdc:mga0rr50_17740_c1 | 3300050513 | Bacteria | 4761 |
| 623 | nmdc:mga0a205_44919_c1 | 3300050515 | Bacteria | 4260 |
| 624 | nmdc:mga0sz30_137670_c1 | 3300050516 | Bacteria | 1077 |
| 625 | Ga0495601_0016272 | 3300053077 | Bacteria | 4506 |
| 626 | Ga0495612_0040175 | 3300053078 | Bacteria | 1905 |
| 627 | Ga0495612_0112864 | 3300053078 | Bacteria | 1165 |
| 628 | Ga0495595_0001339 | 3300053084 | Bacteria | 9565 |
| 629 | Ga0495595_0122709 | 3300053084 | Bacteria | 1266 |
| 630 | Ga0495619_0008552 | 3300053085 | Bacteria | 6477 |
| 631 | Ga0500644_0208111 | 3300053088 | Bacteria | 811 |
| 632 | Ga0500581_017345 | 3300053089 | Bacteria | 3615 |
| 633 | Ga0500646_0011859 | 3300053090 | Bacteria | 2245 |
| 634 | Ga0500651_0005151 | 3300053093 | Bacteria | 7440 |
| 635 | Ga0500651_0060867 | 3300053093 | Bacteria | 2359 |
| 636 | Ga0500566_0000055 | 3300053094 | Bacteria | 54414 |
| 637 | Ga0500566_0009687 | 3300053094 | Bacteria | 5690 |
| 638 | Ga0500566_0258279 | 3300053094 | Bacteria | 843 |
| 639 | Ga0500640_055730 | 3300053095 | Bacteria | 1721 |
| 640 | Ga0500641_0037674 | 3300053096 | Bacteria | 1939 |
| 641 | Ga0500641_0053395 | 3300053096 | Bacteria | 1668 |
| 642 | Ga0500641_0054122 | 3300053096 | Bacteria | 1658 |
| 643 | Ga0500554_003107 | 3300053102 | Bacteria | 3354 |
| 644 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 645 | Ga0500569_014566 | 3300053109 | Bacteria | 1949 |
| 646 | Ga0500569_029003 | 3300053109 | Bacteria | 1538 |
| 647 | Ga0500592_001901 | 3300053116 | Bacteria | 3356 |
| 648 | Ga0500594_0002190 | 3300053118 | Bacteria | 4235 |
| 649 | Ga0500594_0019380 | 3300053118 | Bacteria | 1686 |
| 650 | Ga0500595_002686 | 3300053119 | Bacteria | 8636 |
| 651 | Ga0500595_022569 | 3300053119 | Bacteria | 2225 |
| 652 | Ga0500608_000604 | 3300053122 | Bacteria | 13230 |
| 653 | Ga0500621_097013 | 3300053126 | Bacteria | 1167 |
| 654 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 655 | Ga0500642_0074059 | 3300053130 | Bacteria | 1553 |
| 656 | Ga0500652_000294 | 3300053131 | Bacteria | 18164 |
| 657 | Ga0500655_013714 | 3300053133 | Bacteria | 1480 |
| 658 | Ga0500655_020799 | 3300053133 | Bacteria | 1227 |
| 659 | Ga0500658_0133942 | 3300053134 | Bacteria | 1107 |
| 660 | Ga0500658_0169034 | 3300053134 | Bacteria | 992 |
| 661 | Ga0500559_0108750 | 3300053136 | Bacteria | 1283 |
| 662 | Ga0500559_0176928 | 3300053136 | Bacteria | 1004 |
| 663 | Ga0500559_0177906 | 3300053136 | Bacteria | 1001 |
| 664 | Ga0500577_0000231 | 3300053142 | Bacteria | 14865 |
| 665 | Ga0500577_0029729 | 3300053142 | Bacteria | 1895 |
| 666 | Ga0500577_0177281 | 3300053142 | Bacteria | 913 |
| 667 | Ga0500586_001899 | 3300053145 | Bacteria | 4547 |
| 668 | Ga0500588_0112784 | 3300053146 | Bacteria | 950 |
| 669 | Ga0500589_163581 | 3300053147 | Bacteria | 892 |
| 670 | Ga0500590_029568 | 3300053148 | Bacteria | 2843 |
| 671 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 672 | Ga0500627_0024687 | 3300053158 | Bacteria | 2463 |
| 673 | Ga0500633_0053286 | 3300053160 | Bacteria | 1403 |
| 674 | Ga0500634_0088705 | 3300053161 | Bacteria | 1575 |
| 675 | Ga0500634_0187453 | 3300053161 | Bacteria | 923 |
| 676 | Ga0500638_000160 | 3300053162 | Bacteria | 13163 |
| 677 | Ga0500638_078954 | 3300053162 | Bacteria | 1565 |
| 678 | Ga0500636_0001777 | 3300053177 | Bacteria | 11806 |
| 679 | Ga0500636_0063338 | 3300053177 | Bacteria | 2155 |
| 680 | Ga0500636_0185513 | 3300053177 | Bacteria | 1113 |
| 681 | Ga0500637_0000180 | 3300053178 | Bacteria | 23612 |
| 682 | Ga0500611_067017 | 3300053727 | Bacteria | 865 |
| 683 | Ga0500645_081552 | 3300053730 | Bacteria | 922 |
| 684 | Ga0501084_0024607 | 3300054114 | Bacteria | 5024 |
| 685 | Ga0501084_0033906 | 3300054114 | Bacteria | 4269 |
| 686 | Ga0501084_0128645 | 3300054114 | Bacteria | 2132 |
| 687 | Ga0501084_0150011 | 3300054114 | Bacteria | 1965 |
| 688 | Ga0500661_001366 | 3300055283 | Bacteria | 4549 |
| 689 | Ga0500661_009115 | 3300055283 | Bacteria | 1821 |
| 690 | Ga0501082_0025085 | 3300060353 | Bacteria | 5136 |
| 691 | Ga0501082_0039442 | 3300060353 | Bacteria | 4073 |
| 692 | Ga0501082_0796919 | 3300060353 | Bacteria | 826 |
| 693 | Ga0501082_1233134 | 3300060353 | Bacteria | 653 |
| 694 | Ga0501082_1350852 | 3300060353 | Bacteria | 622 |
| 695 | Ga0530510_0187090 | 3300061734 | Bacteria | 1537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0128730 | Ga0501031_0128730_1055_1600 | 162 |
| 2 | 3300049569 | Ga0501032_0092620 | Ga0501032_0092620_490_1035 | 162 |
| 3 | 3300049570 | Ga0501033_0044297 | Ga0501033_0044297_1798_2343 | 162 |
| 4 | 3300049571 | Ga0501034_0091436 | Ga0501034_0091436_1650_2195 | 162 |
| 5 | 3300049573 | Ga0501037_0084767 | Ga0501037_0084767_1696_2241 | 162 |
| 6 | 3300049575 | Ga0501039_0039725 | Ga0501039_0039725_1438_1983 | 162 |
| 7 | 3300049576 | Ga0501040_0020499 | Ga0501040_0020499_3170_3715 | 162 |
| 8 | 3300049577 | Ga0501041_0386923 | Ga0501041_0386923_117_662 | 162 |
| 9 | 3300049581 | Ga0501047_0341175 | Ga0501047_0341175_490_1035 | 162 |
| 10 | 3300049582 | Ga0501048_0418465 | Ga0501048_0418465_138_683 | 162 |
| 11 | 3300049583 | Ga0501067_0029214 | Ga0501067_0029214_1884_2429 | 162 |
| 12 | 3300049584 | Ga0501068_0029036 | Ga0501068_0029036_910_1455 | 162 |
| 13 | 3300049585 | Ga0501069_0059172 | Ga0501069_0059172_1199_1744 | 162 |
| 14 | 3300049586 | Ga0501070_0115926 | Ga0501070_0115926_756_1301 | 162 |
| 15 | 3300049589 | Ga0501073_0057522 | Ga0501073_0057522_745_1290 | 162 |
| 16 | 3300049590 | Ga0501074_0025611 | Ga0501074_0025611_883_1428 | 162 |
| 17 | 3300049741 | Ga0501079_0084642 | Ga0501079_0084642_611_1156 | 162 |
| 18 | 3300049742 | Ga0501080_0151709 | Ga0501080_0151709_920_1465 | 162 |
| 19 | 3300049744 | Ga0501083_0065375 | Ga0501083_0065375_47_592 | 162 |
| 20 | 3300054114 | Ga0501084_0150011 | Ga0501084_0150011_938_1483 | 162 |
| 21 | 3300060353 | Ga0501082_0796919 | Ga0501082_0796919_135_680 | 162 |
| 22 | 3300061734 | Ga0530510_0187090 | Ga0530510_0187090_590_1135 | 162 |
| 23 | 3300048905 | Ga0496102_1003362 | Ga0496102_1003362_115_717 | 165 |
| 24 | 3300048908 | Ga0496105_0589020 | Ga0496105_0589020_64_666 | 165 |
| 25 | 3300053078 | Ga0495612_0112864 | Ga0495612_0112864_123_722 | 165 |
| 26 | 3300046507 | Ga0495606_0167353 | Ga0495606_0167353_312_869 | 167 |
| 27 | 3300046691 | Ga0495670_0253334 | Ga0495670_0253334_365_919 | 167 |
| 28 | 3300049569 | Ga0501032_0115315 | Ga0501032_0115315_1195_1755 | 169 |
| 29 | 3300049574 | Ga0501038_0003724 | Ga0501038_0003724_6909_7469 | 169 |
| 30 | 3300049579 | Ga0501043_0010624 | Ga0501043_0010624_1826_2386 | 169 |
| 31 | 3300049581 | Ga0501047_0924465 | Ga0501047_0924465_41_601 | 169 |
| 32 | 3300046558 | Ga0495633_0256683 | Ga0495633_0256683_272_784 | 170 |
| 33 | 3300025900 | Ga0207710_10301007 | Ga0207710_103010072 | 172 |
| 34 | 3300049575 | Ga0501039_0349500 | Ga0501039_0349500_14_547 | 174 |
| 35 | 3300049587 | Ga0501071_0474463 | Ga0501071_0474463_68_601 | 174 |
| 36 | 3300060353 | Ga0501082_1350852 | Ga0501082_1350852_68_601 | 174 |
| 37 | 3300049569 | Ga0501032_0010617 | Ga0501032_0010617_3122_3658 | 175 |
| 38 | 3300049570 | Ga0501033_0002710 | Ga0501033_0002710_5666_6202 | 175 |
| 39 | 3300049571 | Ga0501034_0391780 | Ga0501034_0391780_418_954 | 175 |
| 40 | 3300049573 | Ga0501037_0000618 | Ga0501037_0000618_26573_27109 | 175 |
| 41 | 3300049574 | Ga0501038_0809905 | Ga0501038_0809905_24_560 | 175 |
| 42 | 3300049575 | Ga0501039_0220929 | Ga0501039_0220929_839_1375 | 175 |
| 43 | 3300049578 | Ga0501042_0017959 | Ga0501042_0017959_3522_4058 | 175 |
| 44 | 3300049579 | Ga0501043_0037522 | Ga0501043_0037522_397_933 | 175 |
| 45 | 3300049581 | Ga0501047_0362177 | Ga0501047_0362177_604_1140 | 175 |
| 46 | 3300049822 | Ga0501035_0001311 | Ga0501035_0001311_663_1199 | 175 |
| 47 | 3300049823 | Ga0501044_0439541 | Ga0501044_0439541_397_933 | 175 |
| 48 | iso_pu_bacteria | 2874604998 | 2874607900 | 179 |
| 49 | iso_pu_bacteria | 2513237101 | 2513695274 | 180 |
| 50 | iso_pu_bacteria | 2791355199 | 2793078318 | 180 |
| 51 | iso_pu_bacteria | 2922361189 | 2922363193 | 180 |
| 52 | iso_pu_bacteria | 8006964411 | 8006967622 | 180 |
| 53 | 3300005327 | Ga0070658_10486872 | Ga0070658_104868722 | 181 |
| 54 | 3300025909 | Ga0207705_10383306 | Ga0207705_103833062 | 181 |
| 55 | 3300048088 | Ga0495602_0390876 | Ga0495602_0390876_54_701 | 181 |
| 56 | 3300048903 | Ga0496100_0168494 | Ga0496100_0168494_400_1050 | 181 |
| 57 | 3300048906 | Ga0496103_0397891 | Ga0496103_0397891_107_757 | 181 |
| 58 | 3300048907 | Ga0496104_0083684 | Ga0496104_0083684_897_1547 | 181 |
| 59 | 3300048909 | Ga0496106_0001943 | Ga0496106_0001943_10022_10672 | 181 |
| 60 | 3300048910 | Ga0496107_0007455 | Ga0496107_0007455_1157_1807 | 181 |
| 61 | 3300048911 | Ga0496108_0000927 | Ga0496108_0000927_5493_6143 | 181 |
| 62 | 3300048912 | Ga0496109_0000229 | Ga0496109_0000229_2012_2662 | 181 |
| 63 | 3300048915 | Ga0496112_0001343 | Ga0496112_0001343_871_1521 | 181 |
| 64 | 3300049571 | Ga0501034_0390619 | Ga0501034_0390619_357_911 | 181 |
| 65 | 3300003659 | JGI25404J52841_10009666 | JGI25404J52841_100096662 | 182 |
| 66 | 3300005983 | Ga0081540_1003488 | Ga0081540_10034881 | 182 |
| 67 | 3300005937 | Ga0081455_10007381 | Ga0081455_100073812 | 183 |
| 68 | 3300005333 | Ga0070677_10264150 | Ga0070677_102641501 | 184 |
| 69 | 3300005937 | Ga0081455_10050780 | Ga0081455_100507802 | 184 |
| 70 | 3300006038 | Ga0075365_10249056 | Ga0075365_102490561 | 184 |
| 71 | 3300006237 | Ga0097621_100717010 | Ga0097621_1007170102 | 184 |
| 72 | 3300013297 | Ga0157378_10444907 | Ga0157378_104449072 | 184 |
| 73 | 3300013308 | Ga0157375_10541565 | Ga0157375_105415651 | 184 |
| 74 | 3300031344 | Ga0265316_10239997 | Ga0265316_102399972 | 184 |
| 75 | 3300035086 | Ga0373934_0155506 | Ga0373934_0155506_146_712 | 184 |
| 76 | 3300035111 | Ga0373923_0057623 | Ga0373923_0057623_932_1498 | 184 |
| 77 | 3300035117 | Ga0373953_0009823 | Ga0373953_0009823_618_1184 | 184 |
| 78 | 3300035118 | Ga0373954_0001251 | Ga0373954_0001251_8334_8900 | 184 |
| 79 | 3300035119 | Ga0373956_0002392 | Ga0373956_0002392_5429_5995 | 184 |
| 80 | 3300035120 | Ga0373957_0034018 | Ga0373957_0034018_578_1144 | 184 |
| 81 | 3300035172 | Ga0373955_0002799 | Ga0373955_0002799_2684_3250 | 184 |
| 82 | 3300035410 | Ga0373924_0008694 | Ga0373924_0008694_2313_2879 | 184 |
| 83 | 3300036401 | Ga0373937_0019726 | Ga0373937_0019726_3799_4365 | 184 |
| 84 | 3300046454 | Ga0495592_0004510 | Ga0495592_0004510_8887_9453 | 184 |
| 85 | 3300046459 | Ga0495629_0017285 | Ga0495629_0017285_1802_2368 | 184 |
| 86 | 3300046462 | Ga0495651_0144593 | Ga0495651_0144593_574_1140 | 184 |
| 87 | 3300046463 | Ga0495653_0011881 | Ga0495653_0011881_2021_2587 | 184 |
| 88 | 3300046471 | Ga0495650_0111712 | Ga0495650_0111712_47_601 | 184 |
| 89 | 3300046492 | Ga0495585_0445845 | Ga0495585_0445845_26_580 | 184 |
| 90 | 3300046511 | Ga0495608_0004196 | Ga0495608_0004196_9533_10099 | 184 |
| 91 | 3300046514 | Ga0495618_0014329 | Ga0495618_0014329_193_759 | 184 |
| 92 | 3300046516 | Ga0495628_0017593 | Ga0495628_0017593_1283_1849 | 184 |
| 93 | 3300046517 | Ga0495630_1001900 | Ga0495630_1001900_19_573 | 184 |
| 94 | 3300046524 | Ga0495648_0209335 | Ga0495648_0209335_33_587 | 184 |
| 95 | 3300046529 | Ga0495652_0021450 | Ga0495652_0021450_574_1140 | 184 |
| 96 | 3300046533 | Ga0495640_0018260 | Ga0495640_0018260_1917_2483 | 184 |
| 97 | 3300046536 | Ga0495587_0009714 | Ga0495587_0009714_3150_3716 | 184 |
| 98 | 3300046559 | Ga0495667_0003525 | Ga0495667_0003525_2297_2863 | 184 |
| 99 | 3300046616 | Ga0495668_0311076 | Ga0495668_0311076_26_580 | 184 |
| 100 | 3300046642 | Ga0495634_0515185 | Ga0495634_0515185_38_592 | 184 |
| 101 | 3300046663 | Ga0495635_0007981 | Ga0495635_0007981_3278_3844 | 184 |
| 102 | 3300046664 | Ga0495659_0027918 | Ga0495659_0027918_31_585 | 184 |
| 103 | 3300046675 | Ga0495657_0004913 | Ga0495657_0004913_2427_2993 | 184 |
| 104 | 3300046678 | Ga0495599_0011722 | Ga0495599_0011722_818_1384 | 184 |
| 105 | 3300046679 | Ga0495623_0016409 | Ga0495623_0016409_581_1147 | 184 |
| 106 | 3300046689 | Ga0495613_0087361 | Ga0495613_0087361_867_1433 | 184 |
| 107 | 3300046809 | Ga0495600_0086940 | Ga0495600_0086940_1297_1863 | 184 |
| 108 | 3300047317 | Ga0495604_0002900 | Ga0495604_0002900_3042_3608 | 184 |
| 109 | 3300047322 | Ga0495680_0025446 | Ga0495680_0025446_446_1012 | 184 |
| 110 | 3300047444 | Ga0495675_0016233 | Ga0495675_0016233_4045_4611 | 184 |
| 111 | 3300047470 | Ga0495681_0080380 | Ga0495681_0080380_709_1266 | 184 |
| 112 | 3300047471 | Ga0495684_0019011 | Ga0495684_0019011_3561_4127 | 184 |
| 113 | 3300047673 | Ga0495593_0003761 | Ga0495593_0003761_8107_8673 | 184 |
| 114 | 3300048088 | Ga0495602_0031219 | Ga0495602_0031219_3766_4332 | 184 |
| 115 | 3300048905 | Ga0496102_0521133 | Ga0496102_0521133_511_1065 | 184 |
| 116 | 3300048915 | Ga0496112_0072258 | Ga0496112_0072258_2823_3377 | 184 |
| 117 | 3300048924 | Ga0496121_0389309 | Ga0496121_0389309_24_578 | 184 |
| 118 | 3300049823 | Ga0501044_0161710 | Ga0501044_0161710_1261_1815 | 184 |
| 119 | 3300050494 | nmdc:mga06z11_171815_c1 | nmdc:mga06z11_171815_c1_671_1225 | 184 |
| 120 | 3300053077 | Ga0495601_0016272 | Ga0495601_0016272_491_1057 | 184 |
| 121 | 3300053084 | Ga0495595_0001339 | Ga0495595_0001339_7071_7637 | 184 |
| 122 | 3300053085 | Ga0495619_0008552 | Ga0495619_0008552_5338_5904 | 184 |
| 123 | 3300007265 | Ga0099794_10079544 | Ga0099794_100795442 | 185 |
| 124 | 3300027671 | Ga0209588_1140868 | Ga0209588_11408681 | 185 |
| 125 | 3300031235 | Ga0265330_10020800 | Ga0265330_100208002 | 185 |
| 126 | 3300049588 | Ga0501072_0022570 | Ga0501072_0022570_1011_1625 | 185 |
| 127 | 3300049592 | Ga0501076_0247394 | Ga0501076_0247394_32_646 | 185 |
| 128 | 3300049822 | Ga0501035_0532077 | Ga0501035_0532077_271_879 | 185 |
| 129 | 3300049823 | Ga0501044_0010966 | Ga0501044_0010966_2279_2887 | 185 |
| 130 | 3300049571 | Ga0501034_0101586 | Ga0501034_0101586_1528_2142 | 187 |
| 131 | 3300049572 | Ga0501036_0062524 | Ga0501036_0062524_947_1561 | 187 |
| 132 | 3300049572 | Ga0501036_0343167 | Ga0501036_0343167_597_1169 | 187 |
| 133 | 3300049572 | Ga0501036_0518562 | Ga0501036_0518562_230_844 | 187 |
| 134 | 3300049574 | Ga0501038_0016712 | Ga0501038_0016712_2555_3169 | 187 |
| 135 | 3300049579 | Ga0501043_0506340 | Ga0501043_0506340_165_779 | 187 |
| 136 | 3300049583 | Ga0501067_0024682 | Ga0501067_0024682_1722_2297 | 187 |
| 137 | 3300049583 | Ga0501067_0316837 | Ga0501067_0316837_67_681 | 187 |
| 138 | 3300049823 | Ga0501044_0545981 | Ga0501044_0545981_335_949 | 187 |
| 139 | 3300005548 | Ga0070665_100181509 | Ga0070665_1001815092 | 189 |
| 140 | 3300049589 | Ga0501073_0584866 | Ga0501073_0584866_68_664 | 189 |
| 141 | 3300049742 | Ga0501080_0009556 | Ga0501080_0009556_6692_7288 | 189 |
| 142 | 3300060353 | Ga0501082_1233134 | Ga0501082_1233134_38_634 | 189 |
| 143 | 3300005983 | Ga0081540_1057059 | Ga0081540_10570593 | 190 |
| 144 | 3300046476 | Ga0495662_0173379 | Ga0495662_0173379_286_870 | 190 |
| 145 | 3300046477 | Ga0495664_0100410 | Ga0495664_0100410_717_1301 | 190 |
| 146 | 3300046680 | Ga0495646_0007134 | Ga0495646_0007134_667_1251 | 190 |
| 147 | 3300048915 | Ga0496112_0334827 | Ga0496112_0334827_407_979 | 190 |
| 148 | 3300007076 | Ga0075435_100022340 | Ga0075435_1000223403 | 192 |
| 149 | 3300009094 | Ga0111539_10027367 | Ga0111539_100273678 | 192 |
| 150 | 3300009147 | Ga0114129_11668549 | Ga0114129_116685491 | 192 |
| 151 | 3300027907 | Ga0207428_10040827 | Ga0207428_100408272 | 192 |
| 152 | 3300050511 | nmdc:mga08y16_16805_c1 | nmdc:mga08y16_16805_c1_5109_5780 | 192 |
| 153 | 3300050513 | nmdc:mga0rr50_17740_c1 | nmdc:mga0rr50_17740_c1_2875_3546 | 192 |
| 154 | 3300050515 | nmdc:mga0a205_44919_c1 | nmdc:mga0a205_44919_c1_1467_2138 | 192 |
| 155 | 3300006353 | Ga0075370_10234127 | Ga0075370_102341272 | 195 |
| 156 | 3300049569 | Ga0501032_0042888 | Ga0501032_0042888_183_779 | 195 |
| 157 | 3300049573 | Ga0501037_0003059 | Ga0501037_0003059_6444_7040 | 195 |
| 158 | 3300049579 | Ga0501043_0012301 | Ga0501043_0012301_3976_4572 | 195 |
| 159 | 3300049584 | Ga0501068_0044449 | Ga0501068_0044449_1988_2584 | 195 |
| 160 | 3300049588 | Ga0501072_0050010 | Ga0501072_0050010_2046_2642 | 195 |
| 161 | 3300049822 | Ga0501035_0009884 | Ga0501035_0009884_1577_2173 | 195 |
| 162 | 3300050496 | nmdc:mga07m45_184104_c1 | nmdc:mga07m45_184104_c1_549_1148 | 195 |
| 163 | 3300005340 | Ga0070689_100359825 | Ga0070689_1003598251 | 196 |
| 164 | 3300005365 | Ga0070688_100124953 | Ga0070688_1001249532 | 196 |
| 165 | 3300025936 | Ga0207670_10288939 | Ga0207670_102889392 | 196 |
| 166 | 3300048913 | Ga0496110_0175183 | Ga0496110_0175183_416_1015 | 196 |
| 167 | iso_pu_bacteria | 2508501009 | 2508539322 | 196 |
| 168 | iso_pu_bacteria | 2508501042 | 2508695649 | 196 |
| 169 | iso_pu_bacteria | 2515154112 | 2515627632 | 196 |
| 170 | iso_pu_bacteria | 2524023205 | 2524441428 | 196 |
| 171 | iso_pu_bacteria | 2643221651 | 2644291080 | 196 |
| 172 | iso_pu_bacteria | 2721755755 | 2723841808 | 196 |
| 173 | iso_pu_bacteria | 2744054633 | 2745077562 | 196 |
| 174 | iso_pu_bacteria | 2857524615 | 2857526241 | 196 |
| 175 | iso_pu_bacteria | 2874590934 | 2874592563 | 196 |
| 176 | iso_pu_bacteria | 2874628541 | 2874628616 | 196 |
| 177 | iso_pu_bacteria | 2874645413 | 2874647182 | 196 |
| 178 | iso_pu_bacteria | 2876771140 | 2876772566 | 196 |
| 179 | iso_pu_bacteria | 2876808645 | 2876814202 | 196 |
| 180 | iso_pu_bacteria | 2876818435 | 2876819827 | 196 |
| 181 | iso_pu_bacteria | 2879074833 | 2879076333 | 196 |
| 182 | iso_pu_bacteria | 2879083081 | 2879083755 | 196 |
| 183 | iso_pu_bacteria | 2879110137 | 2879113327 | 196 |
| 184 | iso_pu_bacteria | 2879127579 | 2879128817 | 196 |
| 185 | iso_pu_bacteria | 2879142872 | 2879143638 | 196 |
| 186 | iso_pu_bacteria | 2919073203 | 2919073908 | 196 |
| 187 | iso_pu_bacteria | 2922386360 | 2922388502 | 196 |
| 188 | iso_pu_bacteria | 2935608549 | 2935615535 | 196 |
| 189 | iso_pu_bacteria | 2935648319 | 2935654465 | 196 |
| 190 | iso_pu_bacteria | 2935656913 | 2935663345 | 196 |
| 191 | iso_pu_bacteria | 2935819856 | 2935825664 | 196 |
| 192 | iso_pu_bacteria | 2935847175 | 2935853428 | 196 |
| 193 | iso_pu_bacteria | 2935908558 | 2935915030 | 196 |
| 194 | iso_pu_bacteria | 2935916978 | 2935918878 | 196 |
| 195 | iso_pu_bacteria | 2935926038 | 2935931405 | 196 |
| 196 | iso_pu_bacteria | 2935934488 | 2935940002 | 196 |
| 197 | iso_pu_bacteria | 2935942939 | 2935947651 | 196 |
| 198 | iso_pu_bacteria | 2935951376 | 2935956422 | 196 |
| 199 | iso_pu_bacteria | 2935967501 | 2935973216 | 196 |
| 200 | iso_pu_bacteria | 2935975950 | 2935980540 | 196 |
| 201 | iso_pu_bacteria | 2935984226 | 2935990108 | 196 |
| 202 | iso_pu_bacteria | 2936011229 | 2936017496 | 196 |
| 203 | iso_pu_bacteria | 2936019824 | 2936026003 | 196 |
| 204 | iso_pu_bacteria | 2936028420 | 2936034845 | 196 |
| 205 | iso_pu_bacteria | 2936046547 | 2936052897 | 196 |
| 206 | iso_pu_bacteria | 2936055302 | 2936060244 | 196 |
| 207 | iso_pu_bacteria | 8006984368 | 8006991092 | 196 |
| 208 | iso_pu_bacteria | 8019619141 | 8019623149 | 196 |
| 209 | iso_pu_bacteria | 8019629233 | 8019629950 | 196 |
| 210 | iso_pu_bacteria | 8019659431 | 8019666791 | 196 |
| 211 | iso_pu_bacteria | 8019668869 | 8019676548 | 196 |
| 212 | iso_pu_bacteria | 8019687851 | 8019696064 | 196 |
| 213 | iso_pu_bacteria | 8056673599 | 8056676126 | 196 |
| 214 | 3300005335 | Ga0070666_10499889 | Ga0070666_104998891 | 197 |
| 215 | 3300005367 | Ga0070667_100342219 | Ga0070667_1003422192 | 197 |
| 216 | 3300005455 | Ga0070663_100845261 | Ga0070663_1008452611 | 197 |
| 217 | 3300025903 | Ga0207680_10229433 | Ga0207680_102294332 | 197 |
| 218 | 3300049585 | Ga0501069_0252377 | Ga0501069_0252377_214_900 | 197 |
| 219 | 3300049586 | Ga0501070_0013417 | Ga0501070_0013417_3997_4683 | 197 |
| 220 | 3300049586 | Ga0501070_0147120 | Ga0501070_0147120_670_1266 | 197 |
| 221 | 3300049592 | Ga0501076_0188450 | Ga0501076_0188450_804_1418 | 197 |
| 222 | 3300049742 | Ga0501080_0475164 | Ga0501080_0475164_261_857 | 197 |
| 223 | 3300049822 | Ga0501035_0000197 | Ga0501035_0000197_14533_15129 | 197 |
| 224 | 3300005536 | Ga0070697_100494583 | Ga0070697_1004945831 | 198 |
| 225 | 3300049573 | Ga0501037_0342966 | Ga0501037_0342966_261_878 | 198 |
| 226 | 3300049576 | Ga0501040_0202117 | Ga0501040_0202117_569_1186 | 198 |
| 227 | 3300049577 | Ga0501041_0201110 | Ga0501041_0201110_432_1049 | 198 |
| 228 | 3300049586 | Ga0501070_0285270 | Ga0501070_0285270_117_734 | 198 |
| 229 | 3300049593 | Ga0501077_0358836 | Ga0501077_0358836_181_798 | 198 |
| 230 | 3300049822 | Ga0501035_0453789 | Ga0501035_0453789_180_797 | 198 |
| 231 | 3300049824 | Ga0501045_0032643 | Ga0501045_0032643_687_1304 | 198 |
| 232 | 3300005333 | Ga0070677_10015940 | Ga0070677_100159402 | 199 |
| 233 | 3300005340 | Ga0070689_100004675 | Ga0070689_1000046752 | 199 |
| 234 | 3300005354 | Ga0070675_100269430 | Ga0070675_1002694302 | 199 |
| 235 | 3300005355 | Ga0070671_100117043 | Ga0070671_1001170432 | 199 |
| 236 | 3300005365 | Ga0070688_100055270 | Ga0070688_1000552701 | 199 |
| 237 | 3300005367 | Ga0070667_100068086 | Ga0070667_1000680862 | 199 |
| 238 | 3300005544 | Ga0070686_100170052 | Ga0070686_1001700522 | 199 |
| 239 | 3300005617 | Ga0068859_100042524 | Ga0068859_1000425247 | 199 |
| 240 | 3300005843 | Ga0068860_100359235 | Ga0068860_1003592352 | 199 |
| 241 | 3300005983 | Ga0081540_1043025 | Ga0081540_10430253 | 199 |
| 242 | 3300006931 | Ga0097620_100042524 | Ga0097620_1000425242 | 199 |
| 243 | 3300009148 | Ga0105243_10279153 | Ga0105243_102791533 | 199 |
| 244 | 3300010159 | Ga0099796_10080818 | Ga0099796_100808181 | 199 |
| 245 | 3300011119 | Ga0105246_10189923 | Ga0105246_101899232 | 199 |
| 246 | 3300013306 | Ga0163162_10246129 | Ga0163162_102461291 | 199 |
| 247 | 3300013308 | Ga0157375_10094489 | Ga0157375_100944892 | 199 |
| 248 | 3300014325 | Ga0163163_10123792 | Ga0163163_101237923 | 199 |
| 249 | 3300025893 | Ga0207682_10094612 | Ga0207682_100946121 | 199 |
| 250 | 3300025899 | Ga0207642_10204044 | Ga0207642_102040441 | 199 |
| 251 | 3300025926 | Ga0207659_10139481 | Ga0207659_101394812 | 199 |
| 252 | 3300025931 | Ga0207644_10083124 | Ga0207644_100831242 | 199 |
| 253 | 3300025937 | Ga0207669_10127763 | Ga0207669_101277632 | 199 |
| 254 | 3300025938 | Ga0207704_10055671 | Ga0207704_100556714 | 199 |
| 255 | 3300025960 | Ga0207651_10373036 | Ga0207651_103730362 | 199 |
| 256 | 3300026089 | Ga0207648_10130555 | Ga0207648_101305553 | 199 |
| 257 | 3300028381 | Ga0268264_10508080 | Ga0268264_105080802 | 199 |
| 258 | 3300031241 | Ga0265325_10046397 | Ga0265325_100463972 | 199 |
| 259 | 3300031247 | Ga0265340_10014378 | Ga0265340_100143787 | 199 |
| 260 | 3300031995 | Ga0307409_100644211 | Ga0307409_1006442112 | 199 |
| 261 | 3300032002 | Ga0307416_100452416 | Ga0307416_1004524162 | 199 |
| 262 | 3300035114 | Ga0373939_0032740 | Ga0373939_0032740_360_962 | 199 |
| 263 | 3300035692 | Ga0373935_0425496 | Ga0373935_0425496_253_855 | 199 |
| 264 | 3300037068 | Ga0373925_0602642 | Ga0373925_0602642_210_812 | 199 |
| 265 | 3300046516 | Ga0495628_0288579 | Ga0495628_0288579_58_660 | 199 |
| 266 | 3300047322 | Ga0495680_0161446 | Ga0495680_0161446_313_915 | 199 |
| 267 | 3300048908 | Ga0496105_0650616 | Ga0496105_0650616_52_654 | 199 |
| 268 | 3300048912 | Ga0496109_0433336 | Ga0496109_0433336_70_672 | 199 |
| 269 | 3300048915 | Ga0496112_1134706 | Ga0496112_1134706_24_626 | 199 |
| 270 | 3300048916 | Ga0496113_0115029 | Ga0496113_0115029_820_1422 | 199 |
| 271 | 3300049568 | Ga0501031_0010399 | Ga0501031_0010399_4477_5079 | 199 |
| 272 | 3300049569 | Ga0501032_0006386 | Ga0501032_0006386_1733_2335 | 199 |
| 273 | 3300049570 | Ga0501033_0015402 | Ga0501033_0015402_186_788 | 199 |
| 274 | 3300049571 | Ga0501034_0003727 | Ga0501034_0003727_5774_6376 | 199 |
| 275 | 3300049572 | Ga0501036_0001268 | Ga0501036_0001268_17006_17608 | 199 |
| 276 | 3300049573 | Ga0501037_0002956 | Ga0501037_0002956_491_1093 | 199 |
| 277 | 3300049574 | Ga0501038_0006827 | Ga0501038_0006827_8969_9571 | 199 |
| 278 | 3300049575 | Ga0501039_0001032 | Ga0501039_0001032_8972_9574 | 199 |
| 279 | 3300049576 | Ga0501040_0310652 | Ga0501040_0310652_122_724 | 199 |
| 280 | 3300049578 | Ga0501042_0022883 | Ga0501042_0022883_3343_3945 | 199 |
| 281 | 3300049579 | Ga0501043_0016441 | Ga0501043_0016441_186_788 | 199 |
| 282 | 3300049580 | Ga0501046_0003718 | Ga0501046_0003718_12253_12855 | 199 |
| 283 | 3300049581 | Ga0501047_0003496 | Ga0501047_0003496_3847_4449 | 199 |
| 284 | 3300049582 | Ga0501048_0021902 | Ga0501048_0021902_3330_3932 | 199 |
| 285 | 3300049584 | Ga0501068_0001483 | Ga0501068_0001483_10990_11592 | 199 |
| 286 | 3300049585 | Ga0501069_0010836 | Ga0501069_0010836_894_1496 | 199 |
| 287 | 3300049586 | Ga0501070_0006615 | Ga0501070_0006615_8772_9374 | 199 |
| 288 | 3300049587 | Ga0501071_0030772 | Ga0501071_0030772_2706_3308 | 199 |
| 289 | 3300049589 | Ga0501073_0022730 | Ga0501073_0022730_1370_1972 | 199 |
| 290 | 3300049590 | Ga0501074_0004173 | Ga0501074_0004173_186_788 | 199 |
| 291 | 3300049592 | Ga0501076_0214263 | Ga0501076_0214263_132_734 | 199 |
| 292 | 3300049741 | Ga0501079_0042008 | Ga0501079_0042008_852_1454 | 199 |
| 293 | 3300049742 | Ga0501080_0004990 | Ga0501080_0004990_491_1093 | 199 |
| 294 | 3300049744 | Ga0501083_0011859 | Ga0501083_0011859_4319_4921 | 199 |
| 295 | 3300049822 | Ga0501035_0005159 | Ga0501035_0005159_6946_7548 | 199 |
| 296 | 3300049823 | Ga0501044_0047956 | Ga0501044_0047956_2512_3114 | 199 |
| 297 | 3300049824 | Ga0501045_0028538 | Ga0501045_0028538_876_1478 | 199 |
| 298 | 3300053078 | Ga0495612_0040175 | Ga0495612_0040175_926_1528 | 199 |
| 299 | 3300053084 | Ga0495595_0122709 | Ga0495595_0122709_438_1040 | 199 |
| 300 | 3300054114 | Ga0501084_0024607 | Ga0501084_0024607_2884_3486 | 199 |
| 301 | 3300054114 | Ga0501084_0128645 | Ga0501084_0128645_444_1046 | 199 |
| 302 | 3300060353 | Ga0501082_0025085 | Ga0501082_0025085_3278_3880 | 199 |
| 303 | 3300003203 | JGI25406J46586_10001038 | JGI25406J46586_1000103810 | 200 |
| 304 | 3300003203 | JGI25406J46586_10002413 | JGI25406J46586_100024135 | 200 |
| 305 | 3300003215 | JGI25153J46596_10001456 | JGI25153J46596_100014562 | 200 |
| 306 | 3300003354 | JGI25160J50197_1035435 | JGI25160J50197_10354352 | 200 |
| 307 | 3300003659 | JGI25404J52841_10066849 | JGI25404J52841_100668491 | 200 |
| 308 | 3300005327 | Ga0070658_10185537 | Ga0070658_101855372 | 200 |
| 309 | 3300005327 | Ga0070658_10242526 | Ga0070658_102425262 | 200 |
| 310 | 3300005328 | Ga0070676_10432815 | Ga0070676_104328151 | 200 |
| 311 | 3300005329 | Ga0070683_100816987 | Ga0070683_1008169871 | 200 |
| 312 | 3300005330 | Ga0070690_100216613 | Ga0070690_1002166132 | 200 |
| 313 | 3300005334 | Ga0068869_100312880 | Ga0068869_1003128802 | 200 |
| 314 | 3300005334 | Ga0068869_100582355 | Ga0068869_1005823551 | 200 |
| 315 | 3300005335 | Ga0070666_10419588 | Ga0070666_104195881 | 200 |
| 316 | 3300005336 | Ga0070680_100022680 | Ga0070680_1000226808 | 200 |
| 317 | 3300005338 | Ga0068868_100064772 | Ga0068868_1000647725 | 200 |
| 318 | 3300005338 | Ga0068868_100651456 | Ga0068868_1006514562 | 200 |
| 319 | 3300005339 | Ga0070660_100368233 | Ga0070660_1003682332 | 200 |
| 320 | 3300005340 | Ga0070689_100766489 | Ga0070689_1007664891 | 200 |
| 321 | 3300005345 | Ga0070692_10232270 | Ga0070692_102322702 | 200 |
| 322 | 3300005347 | Ga0070668_100055932 | Ga0070668_1000559324 | 200 |
| 323 | 3300005347 | Ga0070668_100350373 | Ga0070668_1003503732 | 200 |
| 324 | 3300005347 | Ga0070668_100611407 | Ga0070668_1006114071 | 200 |
| 325 | 3300005347 | Ga0070668_101039032 | Ga0070668_1010390321 | 200 |
| 326 | 3300005354 | Ga0070675_100505271 | Ga0070675_1005052711 | 200 |
| 327 | 3300005356 | Ga0070674_100042830 | Ga0070674_1000428302 | 200 |
| 328 | 3300005365 | Ga0070688_100162897 | Ga0070688_1001628972 | 200 |
| 329 | 3300005366 | Ga0070659_100060958 | Ga0070659_1000609581 | 200 |
| 330 | 3300005366 | Ga0070659_100427619 | Ga0070659_1004276191 | 200 |
| 331 | 3300005367 | Ga0070667_100328876 | Ga0070667_1003288762 | 200 |
| 332 | 3300005367 | Ga0070667_100378511 | Ga0070667_1003785112 | 200 |
| 333 | 3300005435 | Ga0070714_100094125 | Ga0070714_1000941252 | 200 |
| 334 | 3300005436 | Ga0070713_100335420 | Ga0070713_1003354202 | 200 |
| 335 | 3300005438 | Ga0070701_10303906 | Ga0070701_103039062 | 200 |
| 336 | 3300005440 | Ga0070705_100274329 | Ga0070705_1002743291 | 200 |
| 337 | 3300005441 | Ga0070700_100545849 | Ga0070700_1005458491 | 200 |
| 338 | 3300005444 | Ga0070694_100272091 | Ga0070694_1002720912 | 200 |
| 339 | 3300005455 | Ga0070663_100072771 | Ga0070663_1000727713 | 200 |
| 340 | 3300005455 | Ga0070663_100112170 | Ga0070663_1001121702 | 200 |
| 341 | 3300005455 | Ga0070663_100285004 | Ga0070663_1002850042 | 200 |
| 342 | 3300005455 | Ga0070663_100307214 | Ga0070663_1003072142 | 200 |
| 343 | 3300005455 | Ga0070663_100757614 | Ga0070663_1007576141 | 200 |
| 344 | 3300005456 | Ga0070678_100060031 | Ga0070678_1000600311 | 200 |
| 345 | 3300005456 | Ga0070678_100382070 | Ga0070678_1003820701 | 200 |
| 346 | 3300005457 | Ga0070662_100136564 | Ga0070662_1001365642 | 200 |
| 347 | 3300005459 | Ga0068867_100133168 | Ga0068867_1001331682 | 200 |
| 348 | 3300005466 | Ga0070685_10175005 | Ga0070685_101750052 | 200 |
| 349 | 3300005467 | Ga0070706_100208739 | Ga0070706_1002087392 | 200 |
| 350 | 3300005471 | Ga0070698_100349788 | Ga0070698_1003497882 | 200 |
| 351 | 3300005518 | Ga0070699_100248271 | Ga0070699_1002482712 | 200 |
| 352 | 3300005539 | Ga0068853_100709790 | Ga0068853_1007097902 | 200 |
| 353 | 3300005543 | Ga0070672_100155551 | Ga0070672_1001555512 | 200 |
| 354 | 3300005543 | Ga0070672_100339121 | Ga0070672_1003391212 | 200 |
| 355 | 3300005548 | Ga0070665_100250653 | Ga0070665_1002506533 | 200 |
| 356 | 3300005548 | Ga0070665_100294329 | Ga0070665_1002943292 | 200 |
| 357 | 3300005548 | Ga0070665_100326553 | Ga0070665_1003265532 | 200 |
| 358 | 3300005548 | Ga0070665_100339711 | Ga0070665_1003397112 | 200 |
| 359 | 3300005563 | Ga0068855_100186751 | Ga0068855_1001867513 | 200 |
| 360 | 3300005577 | Ga0068857_100872843 | Ga0068857_1008728432 | 200 |
| 361 | 3300005578 | Ga0068854_100181925 | Ga0068854_1001819252 | 200 |
| 362 | 3300005578 | Ga0068854_100416746 | Ga0068854_1004167462 | 200 |
| 363 | 3300005614 | Ga0068856_100266367 | Ga0068856_1002663672 | 200 |
| 364 | 3300005615 | Ga0070702_100048893 | Ga0070702_1000488933 | 200 |
| 365 | 3300005615 | Ga0070702_100108554 | Ga0070702_1001085541 | 200 |
| 366 | 3300005616 | Ga0068852_100037900 | Ga0068852_1000379003 | 200 |
| 367 | 3300005616 | Ga0068852_100230708 | Ga0068852_1002307082 | 200 |
| 368 | 3300005617 | Ga0068859_100116665 | Ga0068859_1001166651 | 200 |
| 369 | 3300005618 | Ga0068864_100156690 | Ga0068864_1001566903 | 200 |
| 370 | 3300005718 | Ga0068866_10077367 | Ga0068866_100773673 | 200 |
| 371 | 3300005718 | Ga0068866_10115469 | Ga0068866_101154692 | 200 |
| 372 | 3300005719 | Ga0068861_100054773 | Ga0068861_1000547735 | 200 |
| 373 | 3300005719 | Ga0068861_100056139 | Ga0068861_1000561395 | 200 |
| 374 | 3300005719 | Ga0068861_100352492 | Ga0068861_1003524922 | 200 |
| 375 | 3300005840 | Ga0068870_10102585 | Ga0068870_101025852 | 200 |
| 376 | 3300005841 | Ga0068863_100554902 | Ga0068863_1005549022 | 200 |
| 377 | 3300005842 | Ga0068858_100038802 | Ga0068858_1000388022 | 200 |
| 378 | 3300005842 | Ga0068858_100509174 | Ga0068858_1005091741 | 200 |
| 379 | 3300005842 | Ga0068858_100858520 | Ga0068858_1008585201 | 200 |
| 380 | 3300005843 | Ga0068860_100135420 | Ga0068860_1001354201 | 200 |
| 381 | 3300005843 | Ga0068860_101480190 | Ga0068860_1014801901 | 200 |
| 382 | 3300005844 | Ga0068862_100220883 | Ga0068862_1002208832 | 200 |
| 383 | 3300005844 | Ga0068862_100441921 | Ga0068862_1004419212 | 200 |
| 384 | 3300005844 | Ga0068862_100914051 | Ga0068862_1009140511 | 200 |
| 385 | 3300005983 | Ga0081540_1005580 | Ga0081540_10055803 | 200 |
| 386 | 3300005983 | Ga0081540_1034639 | Ga0081540_10346392 | 200 |
| 387 | 3300005983 | Ga0081540_1125650 | Ga0081540_11256502 | 200 |
| 388 | 3300005985 | Ga0081539_10000371 | Ga0081539_1000037134 | 200 |
| 389 | 3300006028 | Ga0070717_10112306 | Ga0070717_101123062 | 200 |
| 390 | 3300006038 | Ga0075365_10078749 | Ga0075365_100787492 | 200 |
| 391 | 3300006038 | Ga0075365_10341134 | Ga0075365_103411342 | 200 |
| 392 | 3300006038 | Ga0075365_10388110 | Ga0075365_103881101 | 200 |
| 393 | 3300006042 | Ga0075368_10052409 | Ga0075368_100524092 | 200 |
| 394 | 3300006173 | Ga0070716_100447190 | Ga0070716_1004471902 | 200 |
| 395 | 3300006175 | Ga0070712_100138553 | Ga0070712_1001385532 | 200 |
| 396 | 3300006177 | Ga0075362_10234520 | Ga0075362_102345201 | 200 |
| 397 | 3300006178 | Ga0075367_10004142 | Ga0075367_100041422 | 200 |
| 398 | 3300006178 | Ga0075367_10206293 | Ga0075367_102062932 | 200 |
| 399 | 3300006178 | Ga0075367_10296083 | Ga0075367_102960831 | 200 |
| 400 | 3300006186 | Ga0075369_10209849 | Ga0075369_102098491 | 200 |
| 401 | 3300006195 | Ga0075366_10169439 | Ga0075366_101694391 | 200 |
| 402 | 3300006195 | Ga0075366_10405279 | Ga0075366_104052792 | 200 |
| 403 | 3300006353 | Ga0075370_10334385 | Ga0075370_103343851 | 200 |
| 404 | 3300006881 | Ga0068865_100187859 | Ga0068865_1001878592 | 200 |
| 405 | 3300006931 | Ga0097620_100116665 | Ga0097620_1001166651 | 200 |
| 406 | 3300009094 | Ga0111539_10479383 | Ga0111539_104793832 | 200 |
| 407 | 3300009098 | Ga0105245_10065652 | Ga0105245_100656525 | 200 |
| 408 | 3300009098 | Ga0105245_11360462 | Ga0105245_113604621 | 200 |
| 409 | 3300009148 | Ga0105243_10017286 | Ga0105243_100172863 | 200 |
| 410 | 3300009148 | Ga0105243_10287471 | Ga0105243_102874712 | 200 |
| 411 | 3300009176 | Ga0105242_10408322 | Ga0105242_104083222 | 200 |
| 412 | 3300009177 | Ga0105248_10870614 | Ga0105248_108706141 | 200 |
| 413 | 3300009545 | Ga0105237_10240406 | Ga0105237_102404063 | 200 |
| 414 | 3300009553 | Ga0105249_10404182 | Ga0105249_104041822 | 200 |
| 415 | 3300009553 | Ga0105249_11263706 | Ga0105249_112637061 | 200 |
| 416 | 3300010375 | Ga0105239_10891805 | Ga0105239_108918051 | 200 |
| 417 | 3300011119 | Ga0105246_10178652 | Ga0105246_101786521 | 200 |
| 418 | 3300011119 | Ga0105246_10529514 | Ga0105246_105295142 | 200 |
| 419 | 3300013102 | Ga0157371_10029898 | Ga0157371_100298982 | 200 |
| 420 | 3300013104 | Ga0157370_10219374 | Ga0157370_102193742 | 200 |
| 421 | 3300013297 | Ga0157378_10128247 | Ga0157378_101282473 | 200 |
| 422 | 3300013297 | Ga0157378_10143352 | Ga0157378_101433523 | 200 |
| 423 | 3300013306 | Ga0163162_10096952 | Ga0163162_100969525 | 200 |
| 424 | 3300013306 | Ga0163162_10446030 | Ga0163162_104460303 | 200 |
| 425 | 3300013308 | Ga0157375_10188592 | Ga0157375_101885921 | 200 |
| 426 | 3300013308 | Ga0157375_11717602 | Ga0157375_117176021 | 200 |
| 427 | 3300014325 | Ga0163163_10021994 | Ga0163163_100219948 | 200 |
| 428 | 3300014325 | Ga0163163_10167803 | Ga0163163_101678031 | 200 |
| 429 | 3300014326 | Ga0157380_10127438 | Ga0157380_101274383 | 200 |
| 430 | 3300014326 | Ga0157380_10541571 | Ga0157380_105415712 | 200 |
| 431 | 3300014969 | Ga0157376_10285393 | Ga0157376_102853932 | 200 |
| 432 | 3300014969 | Ga0157376_10325397 | Ga0157376_103253972 | 200 |
| 433 | 3300017792 | Ga0163161_10087055 | Ga0163161_100870551 | 200 |
| 434 | 3300025273 | Ga0209673_1035657 | Ga0209673_10356572 | 200 |
| 435 | 3300025297 | Ga0209758_1003254 | Ga0209758_10032547 | 200 |
| 436 | 3300025297 | Ga0209758_1005533 | Ga0209758_10055336 | 200 |
| 437 | 3300025297 | Ga0209758_1033834 | Ga0209758_10338342 | 200 |
| 438 | 3300025297 | Ga0209758_1060491 | Ga0209758_10604912 | 200 |
| 439 | 3300025901 | Ga0207688_10055213 | Ga0207688_100552133 | 200 |
| 440 | 3300025901 | Ga0207688_10234211 | Ga0207688_102342112 | 200 |
| 441 | 3300025901 | Ga0207688_10330408 | Ga0207688_103304081 | 200 |
| 442 | 3300025901 | Ga0207688_10507983 | Ga0207688_105079831 | 200 |
| 443 | 3300025907 | Ga0207645_10378032 | Ga0207645_103780321 | 200 |
| 444 | 3300025908 | Ga0207643_10027901 | Ga0207643_100279013 | 200 |
| 445 | 3300025908 | Ga0207643_10506996 | Ga0207643_105069961 | 200 |
| 446 | 3300025910 | Ga0207684_10516367 | Ga0207684_105163672 | 200 |
| 447 | 3300025911 | Ga0207654_10400552 | Ga0207654_104005521 | 200 |
| 448 | 3300025914 | Ga0207671_10041905 | Ga0207671_100419052 | 200 |
| 449 | 3300025918 | Ga0207662_10072853 | Ga0207662_100728532 | 200 |
| 450 | 3300025919 | Ga0207657_10184324 | Ga0207657_101843241 | 200 |
| 451 | 3300025924 | Ga0207694_10465023 | Ga0207694_104650232 | 200 |
| 452 | 3300025925 | Ga0207650_10257832 | Ga0207650_102578322 | 200 |
| 453 | 3300025926 | Ga0207659_10182571 | Ga0207659_101825712 | 200 |
| 454 | 3300025927 | Ga0207687_10047519 | Ga0207687_100475195 | 200 |
| 455 | 3300025929 | Ga0207664_10642554 | Ga0207664_106425541 | 200 |
| 456 | 3300025931 | Ga0207644_10137677 | Ga0207644_101376772 | 200 |
| 457 | 3300025933 | Ga0207706_10467405 | Ga0207706_104674051 | 200 |
| 458 | 3300025936 | Ga0207670_10350627 | Ga0207670_103506272 | 200 |
| 459 | 3300025936 | Ga0207670_10446006 | Ga0207670_104460062 | 200 |
| 460 | 3300025938 | Ga0207704_10191077 | Ga0207704_101910772 | 200 |
| 461 | 3300025939 | Ga0207665_10028702 | Ga0207665_100287021 | 200 |
| 462 | 3300025940 | Ga0207691_10264783 | Ga0207691_102647832 | 200 |
| 463 | 3300025940 | Ga0207691_10469031 | Ga0207691_104690311 | 200 |
| 464 | 3300025940 | Ga0207691_10596346 | Ga0207691_105963461 | 200 |
| 465 | 3300025941 | Ga0207711_10339804 | Ga0207711_103398042 | 200 |
| 466 | 3300025942 | Ga0207689_10125055 | Ga0207689_101250553 | 200 |
| 467 | 3300025942 | Ga0207689_10569751 | Ga0207689_105697511 | 200 |
| 468 | 3300025945 | Ga0207679_10514915 | Ga0207679_105149152 | 200 |
| 469 | 3300025949 | Ga0207667_11420070 | Ga0207667_114200701 | 200 |
| 470 | 3300025961 | Ga0207712_10092594 | Ga0207712_100925942 | 200 |
| 471 | 3300025961 | Ga0207712_10367141 | Ga0207712_103671412 | 200 |
| 472 | 3300025972 | Ga0207668_10083672 | Ga0207668_100836723 | 200 |
| 473 | 3300025972 | Ga0207668_10274960 | Ga0207668_102749602 | 200 |
| 474 | 3300025972 | Ga0207668_10391492 | Ga0207668_103914922 | 200 |
| 475 | 3300025981 | Ga0207640_10206208 | Ga0207640_102062082 | 200 |
| 476 | 3300025981 | Ga0207640_10865327 | Ga0207640_108653271 | 200 |
| 477 | 3300025986 | Ga0207658_10226107 | Ga0207658_102261071 | 200 |
| 478 | 3300025986 | Ga0207658_10561494 | Ga0207658_105614941 | 200 |
| 479 | 3300026023 | Ga0207677_10212664 | Ga0207677_102126642 | 200 |
| 480 | 3300026035 | Ga0207703_10037725 | Ga0207703_100377252 | 200 |
| 481 | 3300026035 | Ga0207703_10089355 | Ga0207703_100893551 | 200 |
| 482 | 3300026041 | Ga0207639_10919523 | Ga0207639_109195231 | 200 |
| 483 | 3300026067 | Ga0207678_10004213 | Ga0207678_1000421310 | 200 |
| 484 | 3300026067 | Ga0207678_10359713 | Ga0207678_103597132 | 200 |
| 485 | 3300026067 | Ga0207678_10370903 | Ga0207678_103709032 | 200 |
| 486 | 3300026067 | Ga0207678_10483861 | Ga0207678_104838612 | 200 |
| 487 | 3300026067 | Ga0207678_10628902 | Ga0207678_106289022 | 200 |
| 488 | 3300026075 | Ga0207708_10066280 | Ga0207708_100662802 | 200 |
| 489 | 3300026078 | Ga0207702_10156027 | Ga0207702_101560272 | 200 |
| 490 | 3300026078 | Ga0207702_10753079 | Ga0207702_107530791 | 200 |
| 491 | 3300026088 | Ga0207641_11038456 | Ga0207641_110384561 | 200 |
| 492 | 3300026089 | Ga0207648_10034157 | Ga0207648_100341577 | 200 |
| 493 | 3300026089 | Ga0207648_10074297 | Ga0207648_100742972 | 200 |
| 494 | 3300026095 | Ga0207676_10133659 | Ga0207676_101336593 | 200 |
| 495 | 3300026116 | Ga0207674_10378676 | Ga0207674_103786762 | 200 |
| 496 | 3300026118 | Ga0207675_100069784 | Ga0207675_1000697842 | 200 |
| 497 | 3300026118 | Ga0207675_100102602 | Ga0207675_1001026022 | 200 |
| 498 | 3300026121 | Ga0207683_10130438 | Ga0207683_101304383 | 200 |
| 499 | 3300026121 | Ga0207683_10441975 | Ga0207683_104419752 | 200 |
| 500 | 3300026142 | Ga0207698_10129535 | Ga0207698_101295352 | 200 |
| 501 | 3300026142 | Ga0207698_10170561 | Ga0207698_101705612 | 200 |
| 502 | 3300028379 | Ga0268266_10001906 | Ga0268266_1000190611 | 200 |
| 503 | 3300028379 | Ga0268266_10039111 | Ga0268266_100391112 | 200 |
| 504 | 3300028379 | Ga0268266_10892597 | Ga0268266_108925972 | 200 |
| 505 | 3300028381 | Ga0268264_10586467 | Ga0268264_105864671 | 200 |
| 506 | 3300028786 | Ga0307517_10000232 | Ga0307517_100002329 | 200 |
| 507 | 3300030522 | Ga0307512_10178733 | Ga0307512_101787332 | 200 |
| 508 | 3300031239 | Ga0265328_10151576 | Ga0265328_101515761 | 200 |
| 509 | 3300031250 | Ga0265331_10012035 | Ga0265331_100120352 | 200 |
| 510 | 3300031507 | Ga0307509_10473816 | Ga0307509_104738161 | 200 |
| 511 | 3300031711 | Ga0265314_10178567 | Ga0265314_101785672 | 200 |
| 512 | 3300031712 | Ga0265342_10016250 | Ga0265342_100162502 | 200 |
| 513 | 3300031730 | Ga0307516_10601117 | Ga0307516_106011172 | 200 |
| 514 | 3300031824 | Ga0307413_10165625 | Ga0307413_101656251 | 200 |
| 515 | 3300031911 | Ga0307412_10375761 | Ga0307412_103757612 | 200 |
| 516 | 3300032002 | Ga0307416_101234116 | Ga0307416_1012341161 | 200 |
| 517 | 3300032126 | Ga0307415_100576864 | Ga0307415_1005768642 | 200 |
| 518 | 3300033180 | Ga0307510_10065796 | Ga0307510_100657962 | 200 |
| 519 | 3300034818 | Ga0373950_0021747 | Ga0373950_0021747_116_718 | 200 |
| 520 | 3300035692 | Ga0373935_0194184 | Ga0373935_0194184_18_632 | 200 |
| 521 | 3300037312 | Ga0395899_0203479 | Ga0395899_0203479_558_1160 | 200 |
| 522 | 3300037418 | Ga0395900_0013190 | Ga0395900_0013190_6572_7174 | 200 |
| 523 | 3300037466 | Ga0395898_0384830 | Ga0395898_0384830_696_1328 | 200 |
| 524 | 3300037471 | Ga0395905_0406929 | Ga0395905_0406929_327_929 | 200 |
| 525 | 3300038443 | Ga0395901_0031964 | Ga0395901_0031964_2727_3329 | 200 |
| 526 | 3300041443 | Ga0451789_0036013 | Ga0451789_0036013_83_685 | 200 |
| 527 | 3300041997 | Ga0439431_0148455 | Ga0439431_0148455_47_649 | 200 |
| 528 | 3300042157 | Ga0439458_0024859 | Ga0439458_0024859_658_1260 | 200 |
| 529 | 3300042439 | Ga0439464_0066430 | Ga0439464_0066430_371_973 | 200 |
| 530 | 3300044656 | Ga0466969_0060548 | Ga0466969_0060548_110_712 | 200 |
| 531 | 3300045049 | Ga0466959_0216260 | Ga0466959_0216260_528_1130 | 200 |
| 532 | 3300046454 | Ga0495592_0518573 | Ga0495592_0518573_14_616 | 200 |
| 533 | 3300046455 | Ga0495603_0031230 | Ga0495603_0031230_693_1295 | 200 |
| 534 | 3300046455 | Ga0495603_0326583 | Ga0495603_0326583_252_854 | 200 |
| 535 | 3300046457 | Ga0495590_0142800 | Ga0495590_0142800_252_854 | 200 |
| 536 | 3300046459 | Ga0495629_0004360 | Ga0495629_0004360_3406_4008 | 200 |
| 537 | 3300046459 | Ga0495629_0432694 | Ga0495629_0432694_18_620 | 200 |
| 538 | 3300046459 | Ga0495629_0537582 | Ga0495629_0537582_80_682 | 200 |
| 539 | 3300046460 | Ga0495638_0063557 | Ga0495638_0063557_241_843 | 200 |
| 540 | 3300046461 | Ga0495641_0155872 | Ga0495641_0155872_287_889 | 200 |
| 541 | 3300046462 | Ga0495651_0049620 | Ga0495651_0049620_1433_2035 | 200 |
| 542 | 3300046462 | Ga0495651_0149658 | Ga0495651_0149658_885_1487 | 200 |
| 543 | 3300046471 | Ga0495650_0155653 | Ga0495650_0155653_131_733 | 200 |
| 544 | 3300046499 | Ga0495594_0066233 | Ga0495594_0066233_569_1171 | 200 |
| 545 | 3300046499 | Ga0495594_0099816 | Ga0495594_0099816_852_1466 | 200 |
| 546 | 3300046500 | Ga0495596_0093990 | Ga0495596_0093990_146_748 | 200 |
| 547 | 3300046501 | Ga0495607_0014122 | Ga0495607_0014122_4576_5178 | 200 |
| 548 | 3300046501 | Ga0495607_0152782 | Ga0495607_0152782_465_1067 | 200 |
| 549 | 3300046507 | Ga0495606_0005524 | Ga0495606_0005524_5851_6453 | 200 |
| 550 | 3300046507 | Ga0495606_0116238 | Ga0495606_0116238_322_924 | 200 |
| 551 | 3300046512 | Ga0495610_0080001 | Ga0495610_0080001_573_1235 | 200 |
| 552 | 3300046513 | Ga0495616_0110214 | Ga0495616_0110214_42_644 | 200 |
| 553 | 3300046515 | Ga0495620_0028200 | Ga0495620_0028200_113_715 | 200 |
| 554 | 3300046516 | Ga0495628_0487783 | Ga0495628_0487783_175_777 | 200 |
| 555 | 3300046518 | Ga0495631_0005921 | Ga0495631_0005921_90_692 | 200 |
| 556 | 3300046518 | Ga0495631_0090814 | Ga0495631_0090814_179_781 | 200 |
| 557 | 3300046518 | Ga0495631_0185321 | Ga0495631_0185321_16_618 | 200 |
| 558 | 3300046522 | Ga0495643_0054634 | Ga0495643_0054634_444_1106 | 200 |
| 559 | 3300046523 | Ga0495644_0057738 | Ga0495644_0057738_142_744 | 200 |
| 560 | 3300046524 | Ga0495648_0153781 | Ga0495648_0153781_500_1102 | 200 |
| 561 | 3300046526 | Ga0495666_0059085 | Ga0495666_0059085_804_1406 | 200 |
| 562 | 3300046529 | Ga0495652_0082023 | Ga0495652_0082023_142_744 | 200 |
| 563 | 3300046530 | Ga0495654_0016517 | Ga0495654_0016517_1845_2447 | 200 |
| 564 | 3300046533 | Ga0495640_0017203 | Ga0495640_0017203_3858_4460 | 200 |
| 565 | 3300046542 | Ga0495597_0038307 | Ga0495597_0038307_496_1098 | 200 |
| 566 | 3300046543 | Ga0495645_0201305 | Ga0495645_0201305_572_1177 | 200 |
| 567 | 3300046557 | Ga0495622_0089265 | Ga0495622_0089265_166_768 | 200 |
| 568 | 3300046557 | Ga0495622_0198980 | Ga0495622_0198980_27_629 | 200 |
| 569 | 3300046558 | Ga0495633_0106235 | Ga0495633_0106235_473_1075 | 200 |
| 570 | 3300046615 | Ga0495656_0064515 | Ga0495656_0064515_455_1057 | 200 |
| 571 | 3300046616 | Ga0495668_0121514 | Ga0495668_0121514_92_694 | 200 |
| 572 | 3300046616 | Ga0495668_0186912 | Ga0495668_0186912_506_1108 | 200 |
| 573 | 3300046616 | Ga0495668_0280332 | Ga0495668_0280332_296_898 | 200 |
| 574 | 3300046648 | Ga0495611_0065013 | Ga0495611_0065013_50_652 | 200 |
| 575 | 3300046660 | Ga0495625_0051205 | Ga0495625_0051205_139_741 | 200 |
| 576 | 3300046660 | Ga0495625_0279783 | Ga0495625_0279783_124_726 | 200 |
| 577 | 3300046663 | Ga0495635_0003646 | Ga0495635_0003646_275_877 | 200 |
| 578 | 3300046665 | Ga0495661_0052161 | Ga0495661_0052161_504_1106 | 200 |
| 579 | 3300046674 | Ga0495588_0167095 | Ga0495588_0167095_65_667 | 200 |
| 580 | 3300046675 | Ga0495657_0282008 | Ga0495657_0282008_216_818 | 200 |
| 581 | 3300046684 | Ga0495669_0049163 | Ga0495669_0049163_782_1384 | 200 |
| 582 | 3300046690 | Ga0495624_0070244 | Ga0495624_0070244_666_1268 | 200 |
| 583 | 3300046691 | Ga0495670_0004607 | Ga0495670_0004607_691_1293 | 200 |
| 584 | 3300046691 | Ga0495670_0109527 | Ga0495670_0109527_131_733 | 200 |
| 585 | 3300046794 | Ga0495589_0149912 | Ga0495589_0149912_332_934 | 200 |
| 586 | 3300046809 | Ga0495600_0203956 | Ga0495600_0203956_73_675 | 200 |
| 587 | 3300046810 | Ga0495660_0316707 | Ga0495660_0316707_15_617 | 200 |
| 588 | 3300047315 | Ga0495581_0027362 | Ga0495581_0027362_2657_3259 | 200 |
| 589 | 3300047315 | Ga0495581_0110234 | Ga0495581_0110234_203_805 | 200 |
| 590 | 3300047317 | Ga0495604_0040985 | Ga0495604_0040985_2955_3557 | 200 |
| 591 | 3300047321 | Ga0495676_0155589 | Ga0495676_0155589_684_1286 | 200 |
| 592 | 3300047443 | Ga0495687_053686 | Ga0495687_053686_727_1344 | 200 |
| 593 | 3300047445 | Ga0495677_0014886 | Ga0495677_0014886_1636_2238 | 200 |
| 594 | 3300047469 | Ga0495673_0162680 | Ga0495673_0162680_211_813 | 200 |
| 595 | 3300047472 | Ga0495686_0113872 | Ga0495686_0113872_664_1266 | 200 |
| 596 | 3300047472 | Ga0495686_0214948 | Ga0495686_0214948_87_689 | 200 |
| 597 | 3300048088 | Ga0495602_0173091 | Ga0495602_0173091_343_945 | 200 |
| 598 | 3300048904 | Ga0496101_0474026 | Ga0496101_0474026_164_766 | 200 |
| 599 | 3300048906 | Ga0496103_0443226 | Ga0496103_0443226_203_805 | 200 |
| 600 | 3300048907 | Ga0496104_0005504 | Ga0496104_0005504_318_920 | 200 |
| 601 | 3300048907 | Ga0496104_0486541 | Ga0496104_0486541_168_770 | 200 |
| 602 | 3300048907 | Ga0496104_0942968 | Ga0496104_0942968_115_717 | 200 |
| 603 | 3300048909 | Ga0496106_0338567 | Ga0496106_0338567_478_1080 | 200 |
| 604 | 3300048909 | Ga0496106_0521282 | Ga0496106_0521282_225_827 | 200 |
| 605 | 3300048911 | Ga0496108_0096970 | Ga0496108_0096970_22_624 | 200 |
| 606 | 3300048911 | Ga0496108_0361334 | Ga0496108_0361334_230_832 | 200 |
| 607 | 3300048912 | Ga0496109_0035650 | Ga0496109_0035650_211_813 | 200 |
| 608 | 3300048912 | Ga0496109_0473021 | Ga0496109_0473021_425_1027 | 200 |
| 609 | 3300048913 | Ga0496110_0054510 | Ga0496110_0054510_1414_2016 | 200 |
| 610 | 3300048915 | Ga0496112_0000018 | Ga0496112_0000018_83621_84241 | 200 |
| 611 | 3300048915 | Ga0496112_0476361 | Ga0496112_0476361_445_1047 | 200 |
| 612 | 3300048915 | Ga0496112_0641583 | Ga0496112_0641583_155_772 | 200 |
| 613 | 3300048916 | Ga0496113_0265274 | Ga0496113_0265274_411_1013 | 200 |
| 614 | 3300048917 | Ga0496114_0451408 | Ga0496114_0451408_197_799 | 200 |
| 615 | 3300048917 | Ga0496114_1164105 | Ga0496114_1164105_34_636 | 200 |
| 616 | 3300048918 | Ga0496115_0463331 | Ga0496115_0463331_292_894 | 200 |
| 617 | 3300048919 | Ga0496116_0219226 | Ga0496116_0219226_172_774 | 200 |
| 618 | 3300048920 | Ga0496117_0221736 | Ga0496117_0221736_69_671 | 200 |
| 619 | 3300048922 | Ga0496119_0035028 | Ga0496119_0035028_261_923 | 200 |
| 620 | 3300048922 | Ga0496119_0341273 | Ga0496119_0341273_46_648 | 200 |
| 621 | 3300048923 | Ga0496120_0012939 | Ga0496120_0012939_3773_4375 | 200 |
| 622 | 3300048923 | Ga0496120_0064399 | Ga0496120_0064399_509_1171 | 200 |
| 623 | 3300048924 | Ga0496121_0095221 | Ga0496121_0095221_1037_1639 | 200 |
| 624 | 3300048924 | Ga0496121_0237799 | Ga0496121_0237799_404_1006 | 200 |
| 625 | 3300048924 | Ga0496121_0388794 | Ga0496121_0388794_206_811 | 200 |
| 626 | 3300048925 | Ga0496122_0012751 | Ga0496122_0012751_6141_6743 | 200 |
| 627 | 3300048925 | Ga0496122_0326670 | Ga0496122_0326670_196_798 | 200 |
| 628 | 3300048926 | Ga0496123_0009028 | Ga0496123_0009028_4232_4834 | 200 |
| 629 | 3300048927 | Ga0496124_0229037 | Ga0496124_0229037_535_1137 | 200 |
| 630 | 3300048927 | Ga0496124_0456659 | Ga0496124_0456659_148_750 | 200 |
| 631 | 3300048928 | Ga0496125_0000843 | Ga0496125_0000843_48484_49146 | 200 |
| 632 | 3300048928 | Ga0496125_0091066 | Ga0496125_0091066_928_1533 | 200 |
| 633 | 3300048929 | Ga0496126_0006001 | Ga0496126_0006001_10750_11355 | 200 |
| 634 | 3300048929 | Ga0496126_0011123 | Ga0496126_0011123_5317_5919 | 200 |
| 635 | 3300048929 | Ga0496126_0154742 | Ga0496126_0154742_657_1259 | 200 |
| 636 | 3300048929 | Ga0496126_0587014 | Ga0496126_0587014_46_648 | 200 |
| 637 | 3300048929 | Ga0496126_0663484 | Ga0496126_0663484_198_800 | 200 |
| 638 | 3300048929 | Ga0496126_0804901 | Ga0496126_0804901_34_636 | 200 |
| 639 | 3300049460 | Ga0495682_0159325 | Ga0495682_0159325_144_773 | 200 |
| 640 | 3300049568 | Ga0501031_0000207 | Ga0501031_0000207_13838_14446 | 200 |
| 641 | 3300049569 | Ga0501032_0000252 | Ga0501032_0000252_33739_34347 | 200 |
| 642 | 3300049570 | Ga0501033_0000082 | Ga0501033_0000082_33544_34152 | 200 |
| 643 | 3300049570 | Ga0501033_0023648 | Ga0501033_0023648_3877_4479 | 200 |
| 644 | 3300049571 | Ga0501034_0000198 | Ga0501034_0000198_8621_9229 | 200 |
| 645 | 3300049571 | Ga0501034_0046721 | Ga0501034_0046721_2202_2804 | 200 |
| 646 | 3300049572 | Ga0501036_0001281 | Ga0501036_0001281_8411_9019 | 200 |
| 647 | 3300049572 | Ga0501036_0100597 | Ga0501036_0100597_729_1331 | 200 |
| 648 | 3300049573 | Ga0501037_0000050 | Ga0501037_0000050_10138_10746 | 200 |
| 649 | 3300049573 | Ga0501037_0257493 | Ga0501037_0257493_22_624 | 200 |
| 650 | 3300049574 | Ga0501038_0000538 | Ga0501038_0000538_8621_9229 | 200 |
| 651 | 3300049574 | Ga0501038_0131534 | Ga0501038_0131534_222_824 | 200 |
| 652 | 3300049575 | Ga0501039_0000123 | Ga0501039_0000123_52498_53106 | 200 |
| 653 | 3300049579 | Ga0501043_0002344 | Ga0501043_0002344_4520_5128 | 200 |
| 654 | 3300049579 | Ga0501043_0025533 | Ga0501043_0025533_1766_2368 | 200 |
| 655 | 3300049580 | Ga0501046_0000434 | Ga0501046_0000434_9185_9793 | 200 |
| 656 | 3300049580 | Ga0501046_0084320 | Ga0501046_0084320_666_1268 | 200 |
| 657 | 3300049580 | Ga0501046_0369567 | Ga0501046_0369567_58_672 | 200 |
| 658 | 3300049581 | Ga0501047_0000131 | Ga0501047_0000131_41216_41824 | 200 |
| 659 | 3300049581 | Ga0501047_0777833 | Ga0501047_0777833_94_702 | 200 |
| 660 | 3300049582 | Ga0501048_0016159 | Ga0501048_0016159_335_943 | 200 |
| 661 | 3300049583 | Ga0501067_0000628 | Ga0501067_0000628_8004_8612 | 200 |
| 662 | 3300049583 | Ga0501067_0260860 | Ga0501067_0260860_62_664 | 200 |
| 663 | 3300049584 | Ga0501068_0000080 | Ga0501068_0000080_32750_33358 | 200 |
| 664 | 3300049584 | Ga0501068_0285192 | Ga0501068_0285192_435_1037 | 200 |
| 665 | 3300049585 | Ga0501069_0003537 | Ga0501069_0003537_6221_6829 | 200 |
| 666 | 3300049586 | Ga0501070_0005971 | Ga0501070_0005971_353_961 | 200 |
| 667 | 3300049586 | Ga0501070_0264699 | Ga0501070_0264699_50_664 | 200 |
| 668 | 3300049586 | Ga0501070_0351724 | Ga0501070_0351724_368_970 | 200 |
| 669 | 3300049586 | Ga0501070_0671273 | Ga0501070_0671273_105_746 | 200 |
| 670 | 3300049587 | Ga0501071_0172399 | Ga0501071_0172399_984_1586 | 200 |
| 671 | 3300049588 | Ga0501072_0000378 | Ga0501072_0000378_19296_19904 | 200 |
| 672 | 3300049589 | Ga0501073_0000062 | Ga0501073_0000062_60004_60612 | 200 |
| 673 | 3300049590 | Ga0501074_0003814 | Ga0501074_0003814_2779_3387 | 200 |
| 674 | 3300049741 | Ga0501079_0001399 | Ga0501079_0001399_7713_8321 | 200 |
| 675 | 3300049742 | Ga0501080_0009398 | Ga0501080_0009398_131_739 | 200 |
| 676 | 3300049744 | Ga0501083_0000341 | Ga0501083_0000341_26573_27181 | 200 |
| 677 | 3300049822 | Ga0501035_0000123 | Ga0501035_0000123_74664_75272 | 200 |
| 678 | 3300049822 | Ga0501035_0268205 | Ga0501035_0268205_379_981 | 200 |
| 679 | 3300049823 | Ga0501044_0000100 | Ga0501044_0000100_74978_75586 | 200 |
| 680 | 3300049823 | Ga0501044_0093934 | Ga0501044_0093934_975_1577 | 200 |
| 681 | 3300049824 | Ga0501045_0033294 | Ga0501045_0033294_1619_2227 | 200 |
| 682 | 3300050490 | nmdc:mga03n38_50653_c1 | nmdc:mga03n38_50653_c1_467_1069 | 200 |
| 683 | 3300050491 | nmdc:mga00v17_146280_c1 | nmdc:mga00v17_146280_c1_48_650 | 200 |
| 684 | 3300050492 | nmdc:mga0yw44_320719_c1 | nmdc:mga0yw44_320719_c1_78_680 | 200 |
| 685 | 3300050493 | nmdc:mga0k408_135533_c1 | nmdc:mga0k408_135533_c1_848_1450 | 200 |
| 686 | 3300050493 | nmdc:mga0k408_65144_c1 | nmdc:mga0k408_65144_c1_23_625 | 200 |
| 687 | 3300050494 | nmdc:mga06z11_1933_c1 | nmdc:mga06z11_1933_c1_6834_7475 | 200 |
| 688 | 3300050494 | nmdc:mga06z11_95515_c1 | nmdc:mga06z11_95515_c1_27_629 | 200 |
| 689 | 3300050496 | nmdc:mga07m45_26620_c1 | nmdc:mga07m45_26620_c1_1162_1764 | 200 |
| 690 | 3300050516 | nmdc:mga0sz30_137670_c1 | nmdc:mga0sz30_137670_c1_450_1052 | 200 |
| 691 | 3300053088 | Ga0500644_0208111 | Ga0500644_0208111_188_790 | 200 |
| 692 | 3300053089 | Ga0500581_017345 | Ga0500581_017345_1771_2373 | 200 |
| 693 | 3300053090 | Ga0500646_0011859 | Ga0500646_0011859_957_1559 | 200 |
| 694 | 3300053093 | Ga0500651_0005151 | Ga0500651_0005151_5606_6208 | 200 |
| 695 | 3300053093 | Ga0500651_0060867 | Ga0500651_0060867_1460_2062 | 200 |
| 696 | 3300053094 | Ga0500566_0000055 | Ga0500566_0000055_39401_40003 | 200 |
| 697 | 3300053094 | Ga0500566_0009687 | Ga0500566_0009687_3632_4246 | 200 |
| 698 | 3300053094 | Ga0500566_0258279 | Ga0500566_0258279_196_798 | 200 |
| 699 | 3300053095 | Ga0500640_055730 | Ga0500640_055730_281_907 | 200 |
| 700 | 3300053096 | Ga0500641_0037674 | Ga0500641_0037674_382_984 | 200 |
| 701 | 3300053096 | Ga0500641_0053395 | Ga0500641_0053395_895_1497 | 200 |
| 702 | 3300053096 | Ga0500641_0054122 | Ga0500641_0054122_565_1227 | 200 |
| 703 | 3300053102 | Ga0500554_003107 | Ga0500554_003107_2006_2620 | 200 |
| 704 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_218139_218840 | 200 |
| 705 | 3300053109 | Ga0500569_014566 | Ga0500569_014566_191_793 | 200 |
| 706 | 3300053109 | Ga0500569_029003 | Ga0500569_029003_656_1258 | 200 |
| 707 | 3300053116 | Ga0500592_001901 | Ga0500592_001901_1796_2398 | 200 |
| 708 | 3300053118 | Ga0500594_0002190 | Ga0500594_0002190_81_683 | 200 |
| 709 | 3300053118 | Ga0500594_0019380 | Ga0500594_0019380_471_1073 | 200 |
| 710 | 3300053119 | Ga0500595_002686 | Ga0500595_002686_7366_7980 | 200 |
| 711 | 3300053119 | Ga0500595_022569 | Ga0500595_022569_368_970 | 200 |
| 712 | 3300053122 | Ga0500608_000604 | Ga0500608_000604_11700_12302 | 200 |
| 713 | 3300053126 | Ga0500621_097013 | Ga0500621_097013_186_788 | 200 |
| 714 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_264518_265120 | 200 |
| 715 | 3300053130 | Ga0500642_0074059 | Ga0500642_0074059_543_1169 | 200 |
| 716 | 3300053131 | Ga0500652_000294 | Ga0500652_000294_4161_4763 | 200 |
| 717 | 3300053133 | Ga0500655_013714 | Ga0500655_013714_34_651 | 200 |
| 718 | 3300053133 | Ga0500655_020799 | Ga0500655_020799_278_895 | 200 |
| 719 | 3300053134 | Ga0500658_0133942 | Ga0500658_0133942_463_1065 | 200 |
| 720 | 3300053134 | Ga0500658_0169034 | Ga0500658_0169034_43_645 | 200 |
| 721 | 3300053136 | Ga0500559_0108750 | Ga0500559_0108750_373_987 | 200 |
| 722 | 3300053136 | Ga0500559_0176928 | Ga0500559_0176928_107_709 | 200 |
| 723 | 3300053136 | Ga0500559_0177906 | Ga0500559_0177906_224_829 | 200 |
| 724 | 3300053142 | Ga0500577_0000231 | Ga0500577_0000231_14085_14687 | 200 |
| 725 | 3300053142 | Ga0500577_0029729 | Ga0500577_0029729_1144_1746 | 200 |
| 726 | 3300053142 | Ga0500577_0177281 | Ga0500577_0177281_284_886 | 200 |
| 727 | 3300053145 | Ga0500586_001899 | Ga0500586_001899_2235_2837 | 200 |
| 728 | 3300053146 | Ga0500588_0112784 | Ga0500588_0112784_71_688 | 200 |
| 729 | 3300053147 | Ga0500589_163581 | Ga0500589_163581_145_747 | 200 |
| 730 | 3300053148 | Ga0500590_029568 | Ga0500590_029568_1038_1640 | 200 |
| 731 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_216556_217158 | 200 |
| 732 | 3300053158 | Ga0500627_0024687 | Ga0500627_0024687_99_761 | 200 |
| 733 | 3300053160 | Ga0500633_0053286 | Ga0500633_0053286_518_1120 | 200 |
| 734 | 3300053161 | Ga0500634_0088705 | Ga0500634_0088705_340_942 | 200 |
| 735 | 3300053161 | Ga0500634_0187453 | Ga0500634_0187453_159_761 | 200 |
| 736 | 3300053162 | Ga0500638_000160 | Ga0500638_000160_1140_1754 | 200 |
| 737 | 3300053162 | Ga0500638_078954 | Ga0500638_078954_840_1442 | 200 |
| 738 | 3300053177 | Ga0500636_0001777 | Ga0500636_0001777_960_1562 | 200 |
| 739 | 3300053177 | Ga0500636_0063338 | Ga0500636_0063338_796_1413 | 200 |
| 740 | 3300053177 | Ga0500636_0185513 | Ga0500636_0185513_393_1007 | 200 |
| 741 | 3300053178 | Ga0500637_0000180 | Ga0500637_0000180_16029_16643 | 200 |
| 742 | 3300053727 | Ga0500611_067017 | Ga0500611_067017_18_620 | 200 |
| 743 | 3300053730 | Ga0500645_081552 | Ga0500645_081552_270_872 | 200 |
| 744 | 3300054114 | Ga0501084_0033906 | Ga0501084_0033906_1723_2331 | 200 |
| 745 | 3300055283 | Ga0500661_001366 | Ga0500661_001366_834_1448 | 200 |
| 746 | 3300055283 | Ga0500661_009115 | Ga0500661_009115_296_922 | 200 |
| 747 | 3300060353 | Ga0501082_0039442 | Ga0501082_0039442_2053_2661 | 200 |
| 748 | iso_pu_bacteria | 2824661429 | 2824670002 | 200 |
| 749 | iso_pu_bacteria | 2888419890 | 2888420137 | 200 |
| 750 | iso_pu_bacteria | 2932784394 | 2932790951 | 200 |
| 751 | iso_pu_bacteria | 2932828146 | 2932833667 | 200 |
| 752 | iso_pu_bacteria | 2935616580 | 2935623193 | 200 |
| 753 | iso_pu_bacteria | 2935638405 | 2935644268 | 200 |
| 754 | iso_pu_bacteria | 2935665750 | 2935672150 | 200 |
| 755 | iso_pu_bacteria | 2935675223 | 2935679329 | 200 |
| 756 | iso_pu_bacteria | 2935684952 | 2935686571 | 200 |
| 757 | iso_pu_bacteria | 2935694250 | 2935700353 | 200 |
| 758 | iso_pu_bacteria | 2935703347 | 2935710301 | 200 |
| 759 | iso_pu_bacteria | 2935713505 | 2935716259 | 200 |
| 760 | iso_pu_bacteria | 2935722832 | 2935723617 | 200 |
| 761 | iso_pu_bacteria | 2935732158 | 2935735172 | 200 |
| 762 | iso_pu_bacteria | 2935741537 | 2935744037 | 200 |
| 763 | iso_pu_bacteria | 2935750917 | 2935752537 | 200 |
| 764 | iso_pu_bacteria | 2935801545 | 2935808292 | 200 |
| 765 | iso_pu_bacteria | 2935827899 | 2935833488 | 200 |
| 766 | iso_pu_bacteria | 2935855204 | 2935861441 | 200 |
| 767 | iso_pu_bacteria | 2935864058 | 2935869560 | 200 |
| 768 | iso_pu_bacteria | 2935873716 | 2935879889 | 200 |
| 769 | iso_pu_bacteria | 2935992306 | 2935997888 | 200 |
| 770 | iso_pu_bacteria | 2936002035 | 2936008847 | 200 |
| 771 | iso_pu_bacteria | 2940556831 | 2940558450 | 200 |
| 772 | iso_pu_bacteria | 2941531003 | 2941535357 | 200 |
| 773 | iso_pu_bacteria | 8016511872 | 8016518007 | 200 |
| 774 | iso_pu_bacteria | 8017057580 | 8017058635 | 200 |
| 775 | iso_pu_bacteria | 8019586578 | 8019595091 | 200 |
| 776 | iso_pu_bacteria | 8019597564 | 8019606650 | 200 |
| 777 | iso_pu_bacteria | 8019608314 | 8019611861 | 200 |
| 778 | iso_pu_bacteria | 8019648815 | 8019652297 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ee6-assembly1.cif.gz_A | cryo-em structure of human abca7 in pe/ch nanodiscs | 0.8916 | 3 | 185 |
| 7o17-assembly1.cif.gz_B | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.8902 | 1 | 186 |
| 7f04-assembly1.cif.gz_A | cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. | 0.8897 | 3 | 197 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8888 | 1 | 184 |
| 7e7q-assembly1.cif.gz_A | cryo-em structure of human abca4 in atp-bound state | 0.888 | 3 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6DXP2_296_452_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9489 | 72 | 189 | 3.40.50.300 |
| af_A0A096TX75_2_202_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9255 | 3 | 194 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9223 | 2 | 61 | 3.40.50.300 |
| af_Q2FVB4_1_230_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9159 | 1 | 184 | 3.40.50.300 |
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9149 | 3 | 185 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0SMG6-F1-model_v4 | Heme ABC transporter (Heme exporter protein A), ATP-binding protein (Cytochrome c-type biogenesis) (EC 3.6.3.41) | 0.981 | 18 | 197 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-A0A4Q3FFN0-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9736 | 2 | 197 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-H0SMG6-F1-model_v4 | Heme ABC transporter (Heme exporter protein A), ATP-binding protein (Cytochrome c-type biogenesis) (EC 3.6.3.41) | 0.9599 | 18 | 197 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-A0A4V3DAE4-F1-model_v4 | Heme exporter protein A | 0.9516 | 2 | 196 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-V5SBK6-F1-model_v4 | Cytochrome C biogenesis protein | 0.9505 | 2 | 197 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar