F480436

General Info

Members Datasets Scaffolds Average Seq Length
778 452 695 197

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0252377|Ga0501069_0252377_214_900
Length 228
Sequence MGELIVVLRRSISRLCNNQIIAFGTDDAFPMKLVADTLACTRGGREVFAGLSFSVAAGEALLVTGRNGAGKSSLLRAIAGLVRLTAGTLALDPDRETSLAEQVHYLGHHDAVKSALSVGENLRFWTAYLGGSGNTGDALTAVGLDAIGHLPAGTLSAGQKRRLSIARLLSVKRPVWLLDEPTASLDAPAQSALAGIMDRHLHGGGIVIAATHADIGLKSARSLRLGPA

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2643221651 Afipia sp. Root123D2 Isolate Unclassified
7 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2791355199
10 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
11 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
12 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
13 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
14 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
15 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
16 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
17 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
18 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
19 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
20 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
21 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
22 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
23 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
24 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
25 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
26 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
27 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
28 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
29 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
30 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
31 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
32 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
33 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
34 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
35 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
36 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
37 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
38 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
39 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
40 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
41 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
42 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
43 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
44 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
45 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
46 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
47 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
48 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
49 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
50 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
51 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
52 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
53 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
54 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
55 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
56 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
57 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
58 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
59 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
60 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
61 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
62 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
63 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
64 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
65 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
66 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
67 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
68 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
69 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
70 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
96 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
110 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
123 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
128 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
131 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
132 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
402 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
403 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
404 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
405 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
406 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
407 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
408 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
409 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
410 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
411 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
412 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
413 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
414 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
415 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
416 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
417 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
418 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
422 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
423 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
424 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
425 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
433 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
439 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
440 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
441 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
442 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
443 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
444 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
445 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
446 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
447 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
448 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
449 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
450 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
451 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
452 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.45
Metatranscriptomes 0
Isolates 10.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.18
Nodule 9.25
Rhizoplane 4.88
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 5.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001038 3300003203 Bacteria 12982
2 JGI25406J46586_10002413 3300003203 Bacteria 8830
3 JGI25153J46596_10001456 3300003215 Bacteria 14140
4 JGI25160J50197_1035435 3300003354 Bacteria 1224
5 JGI25404J52841_10009666 3300003659 Bacteria 2065
6 JGI25404J52841_10066849 3300003659 Bacteria 752
7 Ga0070658_10185537 3300005327 Bacteria 1751
8 Ga0070658_10242526 3300005327 Bacteria 1528
9 Ga0070658_10486872 3300005327 Bacteria 1065
10 Ga0070676_10432815 3300005328 Bacteria 921
11 Ga0070683_100816987 3300005329 Bacteria 894
12 Ga0070690_100216613 3300005330 Bacteria 1339
13 Ga0070677_10015940 3300005333 Bacteria 2669
14 Ga0070677_10264150 3300005333 Bacteria 860
15 Ga0068869_100312880 3300005334 Bacteria 1271
16 Ga0068869_100582355 3300005334 Bacteria 943
17 Ga0070666_10419588 3300005335 Bacteria 964
18 Ga0070666_10499889 3300005335 Unclassified 881
19 Ga0070680_100022680 3300005336 Bacteria 5003
20 Ga0068868_100064772 3300005338 Bacteria 2902
21 Ga0068868_100651456 3300005338 Bacteria 938
22 Ga0070660_100368233 3300005339 Bacteria 1185
23 Ga0070689_100004675 3300005340 Bacteria 9278
24 Ga0070689_100359825 3300005340 Bacteria 1222
25 Ga0070689_100766489 3300005340 Bacteria 846
26 Ga0070692_10232270 3300005345 Bacteria 1095
27 Ga0070668_100055932 3300005347 Bacteria 3046
28 Ga0070668_100350373 3300005347 Bacteria 1249
29 Ga0070668_100611407 3300005347 Bacteria 954
30 Ga0070668_101039032 3300005347 Bacteria 737
31 Ga0070675_100269430 3300005354 Bacteria 1494
32 Ga0070675_100505271 3300005354 Bacteria 1089
33 Ga0070671_100117043 3300005355 Bacteria 2241
34 Ga0070674_100042830 3300005356 Bacteria 3077
35 Ga0070688_100055270 3300005365 Bacteria 2489
36 Ga0070688_100124953 3300005365 Bacteria 1728
37 Ga0070688_100162897 3300005365 Bacteria 1533
38 Ga0070659_100060958 3300005366 Bacteria 2981
39 Ga0070659_100427619 3300005366 Bacteria 1121
40 Ga0070667_100068086 3300005367 Bacteria 3029
41 Ga0070667_100328876 3300005367 Bacteria 1380
42 Ga0070667_100342219 3300005367 Bacteria 1353
43 Ga0070667_100378511 3300005367 Bacteria 1285
44 Ga0070714_100094125 3300005435 Bacteria 2629
45 Ga0070713_100335420 3300005436 Bacteria 1400
46 Ga0070701_10303906 3300005438 Bacteria 982
47 Ga0070705_100274329 3300005440 Bacteria 1196
48 Ga0070700_100545849 3300005441 Bacteria 900
49 Ga0070694_100272091 3300005444 Bacteria 1288
50 Ga0070663_100072771 3300005455 Bacteria 2505
51 Ga0070663_100112170 3300005455 Bacteria 2050
52 Ga0070663_100285004 3300005455 Bacteria 1317
53 Ga0070663_100307214 3300005455 Bacteria 1271
54 Ga0070663_100757614 3300005455 Bacteria 829
55 Ga0070663_100845261 3300005455 Bacteria 787
56 Ga0070678_100060031 3300005456 Bacteria 2797
57 Ga0070678_100382070 3300005456 Bacteria 1219
58 Ga0070662_100136564 3300005457 Bacteria 1896
59 Ga0068867_100133168 3300005459 Bacteria 1934
60 Ga0070685_10175005 3300005466 Bacteria 1377
61 Ga0070706_100208739 3300005467 Bacteria 1824
62 Ga0070698_100349788 3300005471 Bacteria 1409
63 Ga0070699_100248271 3300005518 Bacteria 1589
64 Ga0070697_100494583 3300005536 Bacteria 1069
65 Ga0068853_100709790 3300005539 Bacteria 960
66 Ga0070672_100155551 3300005543 Bacteria 1893
67 Ga0070672_100339121 3300005543 Bacteria 1280
68 Ga0070686_100170052 3300005544 Bacteria 1541
69 Ga0070665_100181509 3300005548 Bacteria 2105
70 Ga0070665_100250653 3300005548 Bacteria 1771
71 Ga0070665_100294329 3300005548 Bacteria 1626
72 Ga0070665_100326553 3300005548 Bacteria 1538
73 Ga0070665_100339711 3300005548 Bacteria 1506
74 Ga0068855_100186751 3300005563 Bacteria 2340
75 Ga0068857_100872843 3300005577 Bacteria 862
76 Ga0068854_100181925 3300005578 Bacteria 1642
77 Ga0068854_100416746 3300005578 Bacteria 1115
78 Ga0068856_100266367 3300005614 Bacteria 1729
79 Ga0070702_100048893 3300005615 Bacteria 2409
80 Ga0070702_100108554 3300005615 Bacteria 1716
81 Ga0068852_100037900 3300005616 Bacteria 4047
82 Ga0068852_100230708 3300005616 Bacteria 1764
83 Ga0068859_100042524 3300005617 Bacteria 4565
84 Ga0068859_100116665 3300005617 Bacteria 2734
85 Ga0068864_100156690 3300005618 Bacteria 2067
86 Ga0068866_10077367 3300005718 Bacteria 1777
87 Ga0068866_10115469 3300005718 Bacteria 1504
88 Ga0068861_100054773 3300005719 Bacteria 3039
89 Ga0068861_100056139 3300005719 Bacteria 3005
90 Ga0068861_100352492 3300005719 Bacteria 1291
91 Ga0068870_10102585 3300005840 Bacteria 1619
92 Ga0068863_100554902 3300005841 Bacteria 1134
93 Ga0068858_100038802 3300005842 Bacteria 4418
94 Ga0068858_100509174 3300005842 Bacteria 1163
95 Ga0068858_100858520 3300005842 Bacteria 887
96 Ga0068860_100135420 3300005843 Bacteria 2365
97 Ga0068860_100359235 3300005843 Bacteria 1435
98 Ga0068860_101480190 3300005843 Bacteria 701
99 Ga0068862_100220883 3300005844 Bacteria 1715
100 Ga0068862_100441921 3300005844 Bacteria 1224
101 Ga0068862_100914051 3300005844 Bacteria 863
102 Ga0081455_10007381 3300005937 Bacteria 11587
103 Ga0081455_10050780 3300005937 Bacteria 3563
104 Ga0081540_1003488 3300005983 Bacteria 12411
105 Ga0081540_1005580 3300005983 Bacteria 9369
106 Ga0081540_1034639 3300005983 Bacteria 2718
107 Ga0081540_1043025 3300005983 Bacteria 2322
108 Ga0081540_1057059 3300005983 Bacteria 1891
109 Ga0081540_1125650 3300005983 Bacteria 1056
110 Ga0081539_10000371 3300005985 Bacteria 98455
111 Ga0070717_10112306 3300006028 Bacteria 2325
112 Ga0075365_10078749 3300006038 Bacteria 2229
113 Ga0075365_10249056 3300006038 Bacteria 1248
114 Ga0075365_10341134 3300006038 Bacteria 1056
115 Ga0075365_10388110 3300006038 Bacteria 985
116 Ga0075368_10052409 3300006042 Bacteria 1623
117 Ga0070716_100447190 3300006173 Bacteria 941
118 Ga0070712_100138553 3300006175 Bacteria 1854
119 Ga0075362_10234520 3300006177 Bacteria 899
120 Ga0075367_10004142 3300006178 Bacteria 7034
121 Ga0075367_10206293 3300006178 Bacteria 1228
122 Ga0075367_10296083 3300006178 Bacteria 1018
123 Ga0075369_10209849 3300006186 Bacteria 900
124 Ga0075366_10169439 3300006195 Bacteria 1325
125 Ga0075366_10405279 3300006195 Bacteria 839
126 Ga0097621_100717010 3300006237 Bacteria 922
127 Ga0075370_10234127 3300006353 Bacteria 1087
128 Ga0075370_10334385 3300006353 Bacteria 903
129 Ga0068865_100187859 3300006881 Bacteria 1595
130 Ga0097620_100042524 3300006931 Bacteria 4565
131 Ga0097620_100116665 3300006931 Bacteria 2734
132 Ga0075435_100022340 3300007076 Bacteria 4882
133 Ga0099794_10079544 3300007265 Bacteria 1615
134 Ga0111539_10027367 3300009094 Bacteria 6964
135 Ga0111539_10479383 3300009094 Bacteria 1449
136 Ga0105245_10065652 3300009098 Bacteria 3282
137 Ga0105245_11360462 3300009098 Bacteria 759
138 Ga0114129_11668549 3300009147 Bacteria 778
139 Ga0105243_10017286 3300009148 Bacteria 5453
140 Ga0105243_10279153 3300009148 Bacteria 1504
141 Ga0105243_10287471 3300009148 Bacteria 1484
142 Ga0105242_10408322 3300009176 Bacteria 1269
143 Ga0105248_10870614 3300009177 Bacteria 1017
144 Ga0105237_10240406 3300009545 Bacteria 1812
145 Ga0105249_10404182 3300009553 Bacteria 1396
146 Ga0105249_11263706 3300009553 Bacteria 810
147 Ga0099796_10080818 3300010159 Bacteria 1191
148 Ga0105239_10891805 3300010375 Bacteria 1021
149 Ga0105246_10178652 3300011119 Bacteria 1632
150 Ga0105246_10189923 3300011119 Bacteria 1589
151 Ga0105246_10529514 3300011119 Bacteria 1006
152 Ga0157371_10029898 3300013102 Bacteria 3933
153 Ga0157370_10219374 3300013104 Bacteria 1762
154 Ga0157378_10128247 3300013297 Bacteria 2345
155 Ga0157378_10143352 3300013297 Bacteria 2220
156 Ga0157378_10444907 3300013297 Bacteria 1285
157 Ga0163162_10096952 3300013306 Bacteria 3037
158 Ga0163162_10246129 3300013306 Bacteria 1920
159 Ga0163162_10446030 3300013306 Bacteria 1426
160 Ga0157375_10094489 3300013308 Bacteria 3059
161 Ga0157375_10188592 3300013308 Bacteria 2216
162 Ga0157375_10541565 3300013308 Bacteria 1326
163 Ga0157375_11717602 3300013308 Bacteria 743
164 Ga0163163_10021994 3300014325 Bacteria 6029
165 Ga0163163_10123792 3300014325 Bacteria 2621
166 Ga0163163_10167803 3300014325 Bacteria 2241
167 Ga0157380_10127438 3300014326 Bacteria 2166
168 Ga0157380_10541571 3300014326 Bacteria 1140
169 Ga0157376_10285393 3300014969 Bacteria 1556
170 Ga0157376_10325397 3300014969 Bacteria 1463
171 Ga0163161_10087055 3300017792 Bacteria 2307
172 Ga0209673_1035657 3300025273 Bacteria 1486
173 Ga0209758_1003254 3300025297 Bacteria 15064
174 Ga0209758_1005533 3300025297 Bacteria 9644
175 Ga0209758_1033834 3300025297 Bacteria 2045
176 Ga0209758_1060491 3300025297 Bacteria 1253
177 Ga0207682_10094612 3300025893 Bacteria 1300
178 Ga0207642_10204044 3300025899 Bacteria 1094
179 Ga0207710_10301007 3300025900 Bacteria 810
180 Ga0207688_10055213 3300025901 Bacteria 2229
181 Ga0207688_10234211 3300025901 Bacteria 1109
182 Ga0207688_10330408 3300025901 Bacteria 937
183 Ga0207688_10507983 3300025901 Bacteria 755
184 Ga0207680_10229433 3300025903 Bacteria 1276
185 Ga0207645_10378032 3300025907 Bacteria 950
186 Ga0207643_10027901 3300025908 Bacteria 3133
187 Ga0207643_10506996 3300025908 Bacteria 772
188 Ga0207705_10383306 3300025909 Bacteria 1086
189 Ga0207684_10516367 3300025910 Bacteria 1023
190 Ga0207654_10400552 3300025911 Bacteria 954
191 Ga0207671_10041905 3300025914 Bacteria 3389
192 Ga0207662_10072853 3300025918 Bacteria 2083
193 Ga0207657_10184324 3300025919 Bacteria 1686
194 Ga0207694_10465023 3300025924 Bacteria 1057
195 Ga0207650_10257832 3300025925 Bacteria 1414
196 Ga0207659_10139481 3300025926 Bacteria 1881
197 Ga0207659_10182571 3300025926 Bacteria 1663
198 Ga0207687_10047519 3300025927 Bacteria 2976
199 Ga0207664_10642554 3300025929 Bacteria 953
200 Ga0207644_10083124 3300025931 Bacteria 2370
201 Ga0207644_10137677 3300025931 Bacteria 1876
202 Ga0207706_10467405 3300025933 Bacteria 1090
203 Ga0207670_10288939 3300025936 Bacteria 1280
204 Ga0207670_10350627 3300025936 Bacteria 1169
205 Ga0207670_10446006 3300025936 Bacteria 1042
206 Ga0207669_10127763 3300025937 Bacteria 1740
207 Ga0207704_10055671 3300025938 Bacteria 2418
208 Ga0207704_10191077 3300025938 Bacteria 1489
209 Ga0207665_10028702 3300025939 Bacteria 3677
210 Ga0207691_10264783 3300025940 Bacteria 1481
211 Ga0207691_10469031 3300025940 Bacteria 1070
212 Ga0207691_10596346 3300025940 Bacteria 935
213 Ga0207711_10339804 3300025941 Bacteria 1389
214 Ga0207689_10125055 3300025942 Bacteria 2116
215 Ga0207689_10569751 3300025942 Bacteria 952
216 Ga0207679_10514915 3300025945 Bacteria 1069
217 Ga0207667_11420070 3300025949 Bacteria 667
218 Ga0207651_10373036 3300025960 Bacteria 1207
219 Ga0207712_10092594 3300025961 Bacteria 2229
220 Ga0207712_10367141 3300025961 Bacteria 1201
221 Ga0207668_10083672 3300025972 Bacteria 2322
222 Ga0207668_10274960 3300025972 Bacteria 1378
223 Ga0207668_10391492 3300025972 Bacteria 1172
224 Ga0207640_10206208 3300025981 Bacteria 1494
225 Ga0207640_10865327 3300025981 Bacteria 787
226 Ga0207658_10226107 3300025986 Bacteria 1577
227 Ga0207658_10561494 3300025986 Bacteria 1022
228 Ga0207677_10212664 3300026023 Bacteria 1545
229 Ga0207703_10037725 3300026035 Bacteria 3851
230 Ga0207703_10089355 3300026035 Bacteria 2587
231 Ga0207639_10919523 3300026041 Bacteria 818
232 Ga0207678_10004213 3300026067 Bacteria 12909
233 Ga0207678_10359713 3300026067 Bacteria 1256
234 Ga0207678_10370903 3300026067 Bacteria 1236
235 Ga0207678_10483861 3300026067 Bacteria 1078
236 Ga0207678_10628902 3300026067 Bacteria 942
237 Ga0207708_10066280 3300026075 Bacteria 2761
238 Ga0207702_10156027 3300026078 Bacteria 2081
239 Ga0207702_10753079 3300026078 Bacteria 962
240 Ga0207641_11038456 3300026088 Bacteria 817
241 Ga0207648_10034157 3300026089 Bacteria 4485
242 Ga0207648_10074297 3300026089 Bacteria 2963
243 Ga0207648_10130555 3300026089 Bacteria 2212
244 Ga0207676_10133659 3300026095 Bacteria 2113
245 Ga0207674_10378676 3300026116 Bacteria 1368
246 Ga0207675_100069784 3300026118 Bacteria 3284
247 Ga0207675_100102602 3300026118 Bacteria 2695
248 Ga0207683_10130438 3300026121 Bacteria 2261
249 Ga0207683_10441975 3300026121 Bacteria 1199
250 Ga0207698_10129535 3300026142 Bacteria 2153
251 Ga0207698_10170561 3300026142 Bacteria 1915
252 Ga0209588_1140868 3300027671 Bacteria 766
253 Ga0207428_10040827 3300027907 Bacteria 3759
254 Ga0268266_10001906 3300028379 Bacteria 23472
255 Ga0268266_10039111 3300028379 Bacteria 4039
256 Ga0268266_10892597 3300028379 Bacteria 859
257 Ga0268264_10508080 3300028381 Bacteria 1176
258 Ga0268264_10586467 3300028381 Bacteria 1097
259 Ga0307517_10000232 3300028786 Bacteria 94332
260 Ga0307512_10178733 3300030522 Bacteria 1198
261 Ga0265330_10020800 3300031235 Bacteria 2998
262 Ga0265328_10151576 3300031239 Bacteria 872
263 Ga0265325_10046397 3300031241 Bacteria 2254
264 Ga0265340_10014378 3300031247 Bacteria 4135
265 Ga0265331_10012035 3300031250 Bacteria 4711
266 Ga0265316_10239997 3300031344 Bacteria 1333
267 Ga0307509_10473816 3300031507 Bacteria 941
268 Ga0265314_10178567 3300031711 Bacteria 1274
269 Ga0265342_10016250 3300031712 Bacteria 4868
270 Ga0307516_10601117 3300031730 Bacteria 754
271 Ga0307413_10165625 3300031824 Bacteria 1558
272 Ga0307412_10375761 3300031911 Bacteria 1149
273 Ga0307409_100644211 3300031995 Bacteria 1053
274 Ga0307416_100452416 3300032002 Bacteria 1337
275 Ga0307416_101234116 3300032002 Bacteria 853
276 Ga0307415_100576864 3300032126 Bacteria 997
277 Ga0307510_10065796 3300033180 Bacteria 3666
278 Ga0373950_0021747 3300034818 Bacteria 1137
279 Ga0373934_0155506 3300035086 Bacteria 937
280 Ga0373923_0057623 3300035111 Bacteria 1643
281 Ga0373939_0032740 3300035114 Bacteria 1513
282 Ga0373953_0009823 3300035117 Bacteria 3309
283 Ga0373954_0001251 3300035118 Bacteria 10243
284 Ga0373956_0002392 3300035119 Bacteria 7665
285 Ga0373957_0034018 3300035120 Bacteria 1884
286 Ga0373955_0002799 3300035172 Bacteria 7662
287 Ga0373924_0008694 3300035410 Bacteria 3701
288 Ga0373935_0194184 3300035692 Bacteria 1400
289 Ga0373935_0425496 3300035692 Bacteria 956
290 Ga0373937_0019726 3300036401 Bacteria 6038
291 Ga0373925_0602642 3300037068 Bacteria 905
292 Ga0395899_0203479 3300037312 Bacteria 1379
293 Ga0395900_0013190 3300037418 Bacteria 8447
294 Ga0395898_0384830 3300037466 Bacteria 1338
295 Ga0395905_0406929 3300037471 Bacteria 1256
296 Ga0395901_0031964 3300038443 Bacteria 5429
297 Ga0451789_0036013 3300041443 Bacteria 1226
298 Ga0439431_0148455 3300041997 Bacteria 665
299 Ga0439458_0024859 3300042157 Bacteria 1402
300 Ga0439464_0066430 3300042439 Bacteria 1062
301 Ga0466969_0060548 3300044656 Bacteria 1840
302 Ga0466959_0216260 3300045049 Bacteria 1330
303 Ga0495592_0004510 3300046454 Bacteria 10194
304 Ga0495592_0518573 3300046454 Bacteria 737
305 Ga0495603_0031230 3300046455 Bacteria 3206
306 Ga0495603_0326583 3300046455 Bacteria 881
307 Ga0495590_0142800 3300046457 Bacteria 865
308 Ga0495629_0004360 3300046459 Bacteria 10610
309 Ga0495629_0017285 3300046459 Bacteria 5171
310 Ga0495629_0432694 3300046459 Bacteria 892
311 Ga0495629_0537582 3300046459 Bacteria 785
312 Ga0495638_0063557 3300046460 Bacteria 2275
313 Ga0495641_0155872 3300046461 Bacteria 1021
314 Ga0495651_0049620 3300046462 Bacteria 3240
315 Ga0495651_0144593 3300046462 Bacteria 1720
316 Ga0495651_0149658 3300046462 Bacteria 1684
317 Ga0495653_0011881 3300046463 Bacteria 7112
318 Ga0495650_0111712 3300046471 Bacteria 1014
319 Ga0495650_0155653 3300046471 Bacteria 818
320 Ga0495662_0173379 3300046476 Bacteria 1063
321 Ga0495664_0100410 3300046477 Bacteria 1743
322 Ga0495585_0445845 3300046492 Bacteria 619
323 Ga0495594_0066233 3300046499 Bacteria 2004
324 Ga0495594_0099816 3300046499 Bacteria 1633
325 Ga0495596_0093990 3300046500 Bacteria 1164
326 Ga0495607_0014122 3300046501 Bacteria 5212
327 Ga0495607_0152782 3300046501 Bacteria 1180
328 Ga0495606_0005524 3300046507 Bacteria 12067
329 Ga0495606_0116238 3300046507 Bacteria 1607
330 Ga0495606_0167353 3300046507 Bacteria 1278
331 Ga0495608_0004196 3300046511 Bacteria 10325
332 Ga0495610_0080001 3300046512 Bacteria 1503
333 Ga0495616_0110214 3300046513 Bacteria 1279
334 Ga0495618_0014329 3300046514 Bacteria 4830
335 Ga0495620_0028200 3300046515 Bacteria 2614
336 Ga0495628_0017593 3300046516 Bacteria 5945
337 Ga0495628_0288579 3300046516 Bacteria 1217
338 Ga0495628_0487783 3300046516 Bacteria 891
339 Ga0495630_1001900 3300046517 Bacteria 635
340 Ga0495631_0005921 3300046518 Bacteria 6363
341 Ga0495631_0090814 3300046518 Bacteria 1315
342 Ga0495631_0185321 3300046518 Bacteria 891
343 Ga0495643_0054634 3300046522 Bacteria 2137
344 Ga0495644_0057738 3300046523 Bacteria 1459
345 Ga0495648_0153781 3300046524 Bacteria 1197
346 Ga0495648_0209335 3300046524 Bacteria 970
347 Ga0495666_0059085 3300046526 Bacteria 1834
348 Ga0495652_0021450 3300046529 Bacteria 5742
349 Ga0495652_0082023 3300046529 Bacteria 2659
350 Ga0495654_0016517 3300046530 Bacteria 3900
351 Ga0495640_0017203 3300046533 Bacteria 5394
352 Ga0495640_0018260 3300046533 Bacteria 5208
353 Ga0495587_0009714 3300046536 Bacteria 6152
354 Ga0495597_0038307 3300046542 Bacteria 2149
355 Ga0495645_0201305 3300046543 Bacteria 1351
356 Ga0495622_0089265 3300046557 Bacteria 1416
357 Ga0495622_0198980 3300046557 Bacteria 893
358 Ga0495633_0106235 3300046558 Bacteria 1302
359 Ga0495633_0256683 3300046558 Bacteria 797
360 Ga0495667_0003525 3300046559 Bacteria 10504
361 Ga0495656_0064515 3300046615 Bacteria 1608
362 Ga0495668_0121514 3300046616 Bacteria 1429
363 Ga0495668_0186912 3300046616 Bacteria 1135
364 Ga0495668_0280332 3300046616 Bacteria 913
365 Ga0495668_0311076 3300046616 Bacteria 864
366 Ga0495634_0515185 3300046642 Bacteria 700
367 Ga0495611_0065013 3300046648 Bacteria 1662
368 Ga0495625_0051205 3300046660 Bacteria 2960
369 Ga0495625_0279783 3300046660 Bacteria 1074
370 Ga0495635_0003646 3300046663 Bacteria 10680
371 Ga0495635_0007981 3300046663 Bacteria 7400
372 Ga0495659_0027918 3300046664 Bacteria 1950
373 Ga0495661_0052161 3300046665 Bacteria 2465
374 Ga0495588_0167095 3300046674 Bacteria 1163
375 Ga0495657_0004913 3300046675 Bacteria 10635
376 Ga0495657_0282008 3300046675 Bacteria 994
377 Ga0495599_0011722 3300046678 Bacteria 5388
378 Ga0495623_0016409 3300046679 Bacteria 4784
379 Ga0495646_0007134 3300046680 Bacteria 7098
380 Ga0495669_0049163 3300046684 Bacteria 1887
381 Ga0495613_0087361 3300046689 Bacteria 2260
382 Ga0495624_0070244 3300046690 Bacteria 2180
383 Ga0495670_0004607 3300046691 Bacteria 6763
384 Ga0495670_0109527 3300046691 Bacteria 1428
385 Ga0495670_0253334 3300046691 Bacteria 939
386 Ga0495589_0149912 3300046794 Bacteria 1114
387 Ga0495600_0086940 3300046809 Bacteria 2039
388 Ga0495600_0203956 3300046809 Bacteria 1269
389 Ga0495660_0316707 3300046810 Bacteria 702
390 Ga0495581_0027362 3300047315 Bacteria 3307
391 Ga0495581_0110234 3300047315 Bacteria 1600
392 Ga0495604_0002900 3300047317 Bacteria 13743
393 Ga0495604_0040985 3300047317 Bacteria 3633
394 Ga0495676_0155589 3300047321 Bacteria 1622
395 Ga0495680_0025446 3300047322 Bacteria 4897
396 Ga0495680_0161446 3300047322 Bacteria 1627
397 Ga0495687_053686 3300047443 Bacteria 1696
398 Ga0495675_0016233 3300047444 Bacteria 4709
399 Ga0495677_0014886 3300047445 Bacteria 2829
400 Ga0495673_0162680 3300047469 Bacteria 856
401 Ga0495681_0080380 3300047470 Bacteria 1456
402 Ga0495684_0019011 3300047471 Bacteria 5289
403 Ga0495686_0113872 3300047472 Bacteria 1619
404 Ga0495686_0214948 3300047472 Bacteria 1096
405 Ga0495593_0003761 3300047673 Bacteria 9064
406 Ga0495602_0031219 3300048088 Bacteria 5040
407 Ga0495602_0173091 3300048088 Bacteria 1674
408 Ga0495602_0390876 3300048088 Bacteria 994
409 Ga0496100_0168494 3300048903 Bacteria 1575
410 Ga0496101_0474026 3300048904 Bacteria 988
411 Ga0496102_0521133 3300048905 Bacteria 1111
412 Ga0496102_1003362 3300048905 Bacteria 755
413 Ga0496103_0397891 3300048906 Bacteria 885
414 Ga0496103_0443226 3300048906 Bacteria 833
415 Ga0496104_0005504 3300048907 Bacteria 11092
416 Ga0496104_0083684 3300048907 Bacteria 3043
417 Ga0496104_0486541 3300048907 Bacteria 1145
418 Ga0496104_0942968 3300048907 Bacteria 768
419 Ga0496105_0589020 3300048908 Bacteria 864
420 Ga0496105_0650616 3300048908 Bacteria 813
421 Ga0496106_0001943 3300048909 Bacteria 15501
422 Ga0496106_0338567 3300048909 Bacteria 1208
423 Ga0496106_0521282 3300048909 Bacteria 954
424 Ga0496107_0007455 3300048910 Bacteria 7542
425 Ga0496108_0000927 3300048911 Bacteria 22857
426 Ga0496108_0096970 3300048911 Bacteria 2512
427 Ga0496108_0361334 3300048911 Bacteria 1267
428 Ga0496109_0000229 3300048912 Bacteria 54733
429 Ga0496109_0035650 3300048912 Bacteria 4489
430 Ga0496109_0433336 3300048912 Bacteria 1242
431 Ga0496109_0473021 3300048912 Bacteria 1183
432 Ga0496110_0054510 3300048913 Bacteria 3517
433 Ga0496110_0175183 3300048913 Bacteria 1947
434 Ga0496112_0000018 3300048915 Bacteria 188820
435 Ga0496112_0001343 3300048915 Bacteria 18708
436 Ga0496112_0072258 3300048915 Bacteria 3410
437 Ga0496112_0334827 3300048915 Bacteria 1457
438 Ga0496112_0476361 3300048915 Bacteria 1185
439 Ga0496112_0641583 3300048915 Bacteria 992
440 Ga0496112_1134706 3300048915 Bacteria 699
441 Ga0496113_0115029 3300048916 Bacteria 2098
442 Ga0496113_0265274 3300048916 Bacteria 1372
443 Ga0496114_0451408 3300048917 Bacteria 1139
444 Ga0496114_1164105 3300048917 Bacteria 657
445 Ga0496115_0463331 3300048918 Bacteria 1022
446 Ga0496116_0219226 3300048919 Bacteria 977
447 Ga0496117_0221736 3300048920 Bacteria 1052
448 Ga0496119_0035028 3300048922 Bacteria 3295
449 Ga0496119_0341273 3300048922 Bacteria 728
450 Ga0496120_0012939 3300048923 Bacteria 5648
451 Ga0496120_0064399 3300048923 Bacteria 2035
452 Ga0496121_0095221 3300048924 Bacteria 2314
453 Ga0496121_0237799 3300048924 Bacteria 1271
454 Ga0496121_0388794 3300048924 Bacteria 917
455 Ga0496121_0389309 3300048924 Bacteria 917
456 Ga0496122_0012751 3300048925 Bacteria 8318
457 Ga0496122_0326670 3300048925 Bacteria 813
458 Ga0496123_0009028 3300048926 Bacteria 9040
459 Ga0496124_0229037 3300048927 Bacteria 1391
460 Ga0496124_0456659 3300048927 Bacteria 869
461 Ga0496125_0000843 3300048928 Bacteria 49244
462 Ga0496125_0091066 3300048928 Bacteria 2286
463 Ga0496126_0006001 3300048929 Bacteria 13646
464 Ga0496126_0011123 3300048929 Bacteria 9346
465 Ga0496126_0154742 3300048929 Bacteria 1963
466 Ga0496126_0587014 3300048929 Bacteria 879
467 Ga0496126_0663484 3300048929 Bacteria 814
468 Ga0496126_0804901 3300048929 Bacteria 721
469 Ga0495682_0159325 3300049460 Bacteria 804
470 Ga0501031_0000207 3300049568 Bacteria 33573
471 Ga0501031_0010399 3300049568 Bacteria 6059
472 Ga0501031_0128730 3300049568 Bacteria 1653
473 Ga0501032_0000252 3300049569 Bacteria 44619
474 Ga0501032_0006386 3300049569 Bacteria 8683
475 Ga0501032_0010617 3300049569 Bacteria 6631
476 Ga0501032_0042888 3300049569 Bacteria 3067
477 Ga0501032_0092620 3300049569 Bacteria 2004
478 Ga0501032_0115315 3300049569 Bacteria 1776
479 Ga0501033_0000082 3300049570 Bacteria 89837
480 Ga0501033_0002710 3300049570 Bacteria 14858
481 Ga0501033_0015402 3300049570 Bacteria 5801
482 Ga0501033_0023648 3300049570 Bacteria 4634
483 Ga0501033_0044297 3300049570 Bacteria 3312
484 Ga0501034_0000198 3300049571 Bacteria 113672
485 Ga0501034_0003727 3300049571 Bacteria 17214
486 Ga0501034_0046721 3300049571 Bacteria 4374
487 Ga0501034_0091436 3300049571 Bacteria 3040
488 Ga0501034_0101586 3300049571 Bacteria 2869
489 Ga0501034_0390619 3300049571 Bacteria 1315
490 Ga0501034_0391780 3300049571 Bacteria 1313
491 Ga0501036_0001268 3300049572 Bacteria 19351
492 Ga0501036_0001281 3300049572 Bacteria 19291
493 Ga0501036_0062524 3300049572 Bacteria 3153
494 Ga0501036_0100597 3300049572 Bacteria 2445
495 Ga0501036_0343167 3300049572 Bacteria 1247
496 Ga0501036_0518562 3300049572 Bacteria 991
497 Ga0501037_0000050 3300049573 Bacteria 112824
498 Ga0501037_0000618 3300049573 Bacteria 27557
499 Ga0501037_0002956 3300049573 Bacteria 12324
500 Ga0501037_0003059 3300049573 Bacteria 12126
501 Ga0501037_0084767 3300049573 Bacteria 2294
502 Ga0501037_0257493 3300049573 Bacteria 1220
503 Ga0501037_0342966 3300049573 Bacteria 1032
504 Ga0501038_0000538 3300049574 Bacteria 33271
505 Ga0501038_0003724 3300049574 Bacteria 14201
506 Ga0501038_0006827 3300049574 Bacteria 10543
507 Ga0501038_0016712 3300049574 Bacteria 6647
508 Ga0501038_0131534 3300049574 Bacteria 2054
509 Ga0501038_0809905 3300049574 Bacteria 695
510 Ga0501039_0000123 3300049575 Bacteria 53579
511 Ga0501039_0001032 3300049575 Bacteria 20355
512 Ga0501039_0039725 3300049575 Bacteria 3633
513 Ga0501039_0220929 3300049575 Bacteria 1489
514 Ga0501039_0349500 3300049575 Bacteria 1162
515 Ga0501040_0020499 3300049576 Bacteria 4406
516 Ga0501040_0202117 3300049576 Bacteria 1411
517 Ga0501040_0310652 3300049576 Bacteria 1127
518 Ga0501041_0201110 3300049577 Bacteria 1249
519 Ga0501041_0386923 3300049577 Bacteria 885
520 Ga0501042_0017959 3300049578 Bacteria 4892
521 Ga0501042_0022883 3300049578 Bacteria 4366
522 Ga0501043_0002344 3300049579 Bacteria 16056
523 Ga0501043_0010624 3300049579 Bacteria 7210
524 Ga0501043_0012301 3300049579 Bacteria 6689
525 Ga0501043_0016441 3300049579 Bacteria 5801
526 Ga0501043_0025533 3300049579 Bacteria 4636
527 Ga0501043_0037522 3300049579 Bacteria 3811
528 Ga0501043_0506340 3300049579 Bacteria 901
529 Ga0501046_0000434 3300049580 Bacteria 41950
530 Ga0501046_0003718 3300049580 Bacteria 13966
531 Ga0501046_0084320 3300049580 Bacteria 2451
532 Ga0501046_0369567 3300049580 Bacteria 1039
533 Ga0501047_0000131 3300049581 Bacteria 91079
534 Ga0501047_0003496 3300049581 Bacteria 14841
535 Ga0501047_0341175 3300049581 Bacteria 1335
536 Ga0501047_0362177 3300049581 Bacteria 1286
537 Ga0501047_0777833 3300049581 Bacteria 772
538 Ga0501047_0924465 3300049581 Bacteria 686
539 Ga0501048_0016159 3300049582 Bacteria 5502
540 Ga0501048_0021902 3300049582 Bacteria 4677
541 Ga0501048_0418465 3300049582 Bacteria 958
542 Ga0501067_0000628 3300049583 Bacteria 18974
543 Ga0501067_0024682 3300049583 Bacteria 3334
544 Ga0501067_0029214 3300049583 Bacteria 3055
545 Ga0501067_0260860 3300049583 Bacteria 965
546 Ga0501067_0316837 3300049583 Bacteria 869
547 Ga0501068_0000080 3300049584 Bacteria 39376
548 Ga0501068_0001483 3300049584 Bacteria 12485
549 Ga0501068_0029036 3300049584 Bacteria 3273
550 Ga0501068_0044449 3300049584 Bacteria 2674
551 Ga0501068_0285192 3300049584 Bacteria 1056
552 Ga0501069_0003537 3300049585 Bacteria 8040
553 Ga0501069_0010836 3300049585 Bacteria 4831
554 Ga0501069_0059172 3300049585 Bacteria 2138
555 Ga0501069_0252377 3300049585 Bacteria 1029
556 Ga0501070_0005971 3300049586 Bacteria 10376
557 Ga0501070_0006615 3300049586 Bacteria 9864
558 Ga0501070_0013417 3300049586 Bacteria 6907
559 Ga0501070_0115926 3300049586 Bacteria 2212
560 Ga0501070_0147120 3300049586 Bacteria 1944
561 Ga0501070_0264699 3300049586 Bacteria 1405
562 Ga0501070_0285270 3300049586 Bacteria 1347
563 Ga0501070_0351724 3300049586 Bacteria 1196
564 Ga0501070_0671273 3300049586 Bacteria 821
565 Ga0501071_0030772 3300049587 Bacteria 3798
566 Ga0501071_0172399 3300049587 Bacteria 1620
567 Ga0501071_0474463 3300049587 Bacteria 958
568 Ga0501072_0000378 3300049588 Bacteria 31856
569 Ga0501072_0022570 3300049588 Bacteria 4880
570 Ga0501072_0050010 3300049588 Bacteria 3291
571 Ga0501073_0000062 3300049589 Bacteria 66884
572 Ga0501073_0022730 3300049589 Bacteria 4511
573 Ga0501073_0057522 3300049589 Bacteria 2718
574 Ga0501073_0584866 3300049589 Bacteria 771
575 Ga0501074_0003814 3300049590 Bacteria 10720
576 Ga0501074_0004173 3300049590 Bacteria 10321
577 Ga0501074_0025611 3300049590 Bacteria 4281
578 Ga0501076_0188450 3300049592 Bacteria 1683
579 Ga0501076_0214263 3300049592 Bacteria 1574
580 Ga0501076_0247394 3300049592 Bacteria 1459
581 Ga0501077_0358836 3300049593 Bacteria 930
582 Ga0501079_0001399 3300049741 Bacteria 17010
583 Ga0501079_0042008 3300049741 Bacteria 3531
584 Ga0501079_0084642 3300049741 Bacteria 2453
585 Ga0501080_0004990 3300049742 Bacteria 11818
586 Ga0501080_0009398 3300049742 Bacteria 8917
587 Ga0501080_0009556 3300049742 Bacteria 8853
588 Ga0501080_0151709 3300049742 Bacteria 2141
589 Ga0501080_0475164 3300049742 Bacteria 1119
590 Ga0501083_0000341 3300049744 Bacteria 29641
591 Ga0501083_0011859 3300049744 Bacteria 6109
592 Ga0501083_0065375 3300049744 Bacteria 2422
593 Ga0501035_0000123 3300049822 Bacteria 93734
594 Ga0501035_0000197 3300049822 Bacteria 73618
595 Ga0501035_0001311 3300049822 Bacteria 25709
596 Ga0501035_0005159 3300049822 Bacteria 12356
597 Ga0501035_0009884 3300049822 Bacteria 8856
598 Ga0501035_0268205 3300049822 Bacteria 1445
599 Ga0501035_0453789 3300049822 Bacteria 1060
600 Ga0501035_0532077 3300049822 Bacteria 964
601 Ga0501044_0000100 3300049823 Bacteria 106729
602 Ga0501044_0010966 3300049823 Bacteria 9837
603 Ga0501044_0047956 3300049823 Bacteria 4416
604 Ga0501044_0093934 3300049823 Bacteria 3024
605 Ga0501044_0161710 3300049823 Bacteria 2215
606 Ga0501044_0439541 3300049823 Bacteria 1212
607 Ga0501044_0545981 3300049823 Bacteria 1056
608 Ga0501045_0028538 3300049824 Bacteria 4026
609 Ga0501045_0032643 3300049824 Bacteria 3774
610 Ga0501045_0033294 3300049824 Bacteria 3737
611 nmdc:mga03n38_50653_c1 3300050490 Bacteria 1852
612 nmdc:mga00v17_146280_c1 3300050491 Bacteria 1517
613 nmdc:mga0yw44_320719_c1 3300050492 Bacteria 1040
614 nmdc:mga0k408_135533_c1 3300050493 Bacteria 1463
615 nmdc:mga0k408_65144_c1 3300050493 Bacteria 2121
616 nmdc:mga06z11_171815_c1 3300050494 Bacteria 1245
617 nmdc:mga06z11_1933_c1 3300050494 Bacteria 7817
618 nmdc:mga06z11_95515_c1 3300050494 Bacteria 1622
619 nmdc:mga07m45_184104_c1 3300050496 Bacteria 1214
620 nmdc:mga07m45_26620_c1 3300050496 Bacteria 3180
621 nmdc:mga08y16_16805_c1 3300050511 Bacteria 7702
622 nmdc:mga0rr50_17740_c1 3300050513 Bacteria 4761
623 nmdc:mga0a205_44919_c1 3300050515 Bacteria 4260
624 nmdc:mga0sz30_137670_c1 3300050516 Bacteria 1077
625 Ga0495601_0016272 3300053077 Bacteria 4506
626 Ga0495612_0040175 3300053078 Bacteria 1905
627 Ga0495612_0112864 3300053078 Bacteria 1165
628 Ga0495595_0001339 3300053084 Bacteria 9565
629 Ga0495595_0122709 3300053084 Bacteria 1266
630 Ga0495619_0008552 3300053085 Bacteria 6477
631 Ga0500644_0208111 3300053088 Bacteria 811
632 Ga0500581_017345 3300053089 Bacteria 3615
633 Ga0500646_0011859 3300053090 Bacteria 2245
634 Ga0500651_0005151 3300053093 Bacteria 7440
635 Ga0500651_0060867 3300053093 Bacteria 2359
636 Ga0500566_0000055 3300053094 Bacteria 54414
637 Ga0500566_0009687 3300053094 Bacteria 5690
638 Ga0500566_0258279 3300053094 Bacteria 843
639 Ga0500640_055730 3300053095 Bacteria 1721
640 Ga0500641_0037674 3300053096 Bacteria 1939
641 Ga0500641_0053395 3300053096 Bacteria 1668
642 Ga0500641_0054122 3300053096 Bacteria 1658
643 Ga0500554_003107 3300053102 Bacteria 3354
644 Ga0500556_0000006 3300053104 Bacteria 453982
645 Ga0500569_014566 3300053109 Bacteria 1949
646 Ga0500569_029003 3300053109 Bacteria 1538
647 Ga0500592_001901 3300053116 Bacteria 3356
648 Ga0500594_0002190 3300053118 Bacteria 4235
649 Ga0500594_0019380 3300053118 Bacteria 1686
650 Ga0500595_002686 3300053119 Bacteria 8636
651 Ga0500595_022569 3300053119 Bacteria 2225
652 Ga0500608_000604 3300053122 Bacteria 13230
653 Ga0500621_097013 3300053126 Bacteria 1167
654 Ga0500642_0000004 3300053130 Bacteria 433122
655 Ga0500642_0074059 3300053130 Bacteria 1553
656 Ga0500652_000294 3300053131 Bacteria 18164
657 Ga0500655_013714 3300053133 Bacteria 1480
658 Ga0500655_020799 3300053133 Bacteria 1227
659 Ga0500658_0133942 3300053134 Bacteria 1107
660 Ga0500658_0169034 3300053134 Bacteria 992
661 Ga0500559_0108750 3300053136 Bacteria 1283
662 Ga0500559_0176928 3300053136 Bacteria 1004
663 Ga0500559_0177906 3300053136 Bacteria 1001
664 Ga0500577_0000231 3300053142 Bacteria 14865
665 Ga0500577_0029729 3300053142 Bacteria 1895
666 Ga0500577_0177281 3300053142 Bacteria 913
667 Ga0500586_001899 3300053145 Bacteria 4547
668 Ga0500588_0112784 3300053146 Bacteria 950
669 Ga0500589_163581 3300053147 Bacteria 892
670 Ga0500590_029568 3300053148 Bacteria 2843
671 Ga0500616_0000022 3300053153 Bacteria 460463
672 Ga0500627_0024687 3300053158 Bacteria 2463
673 Ga0500633_0053286 3300053160 Bacteria 1403
674 Ga0500634_0088705 3300053161 Bacteria 1575
675 Ga0500634_0187453 3300053161 Bacteria 923
676 Ga0500638_000160 3300053162 Bacteria 13163
677 Ga0500638_078954 3300053162 Bacteria 1565
678 Ga0500636_0001777 3300053177 Bacteria 11806
679 Ga0500636_0063338 3300053177 Bacteria 2155
680 Ga0500636_0185513 3300053177 Bacteria 1113
681 Ga0500637_0000180 3300053178 Bacteria 23612
682 Ga0500611_067017 3300053727 Bacteria 865
683 Ga0500645_081552 3300053730 Bacteria 922
684 Ga0501084_0024607 3300054114 Bacteria 5024
685 Ga0501084_0033906 3300054114 Bacteria 4269
686 Ga0501084_0128645 3300054114 Bacteria 2132
687 Ga0501084_0150011 3300054114 Bacteria 1965
688 Ga0500661_001366 3300055283 Bacteria 4549
689 Ga0500661_009115 3300055283 Bacteria 1821
690 Ga0501082_0025085 3300060353 Bacteria 5136
691 Ga0501082_0039442 3300060353 Bacteria 4073
692 Ga0501082_0796919 3300060353 Bacteria 826
693 Ga0501082_1233134 3300060353 Bacteria 653
694 Ga0501082_1350852 3300060353 Bacteria 622
695 Ga0530510_0187090 3300061734 Bacteria 1537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0128730 Ga0501031_0128730_1055_1600 162
2 3300049569 Ga0501032_0092620 Ga0501032_0092620_490_1035 162
3 3300049570 Ga0501033_0044297 Ga0501033_0044297_1798_2343 162
4 3300049571 Ga0501034_0091436 Ga0501034_0091436_1650_2195 162
5 3300049573 Ga0501037_0084767 Ga0501037_0084767_1696_2241 162
6 3300049575 Ga0501039_0039725 Ga0501039_0039725_1438_1983 162
7 3300049576 Ga0501040_0020499 Ga0501040_0020499_3170_3715 162
8 3300049577 Ga0501041_0386923 Ga0501041_0386923_117_662 162
9 3300049581 Ga0501047_0341175 Ga0501047_0341175_490_1035 162
10 3300049582 Ga0501048_0418465 Ga0501048_0418465_138_683 162
11 3300049583 Ga0501067_0029214 Ga0501067_0029214_1884_2429 162
12 3300049584 Ga0501068_0029036 Ga0501068_0029036_910_1455 162
13 3300049585 Ga0501069_0059172 Ga0501069_0059172_1199_1744 162
14 3300049586 Ga0501070_0115926 Ga0501070_0115926_756_1301 162
15 3300049589 Ga0501073_0057522 Ga0501073_0057522_745_1290 162
16 3300049590 Ga0501074_0025611 Ga0501074_0025611_883_1428 162
17 3300049741 Ga0501079_0084642 Ga0501079_0084642_611_1156 162
18 3300049742 Ga0501080_0151709 Ga0501080_0151709_920_1465 162
19 3300049744 Ga0501083_0065375 Ga0501083_0065375_47_592 162
20 3300054114 Ga0501084_0150011 Ga0501084_0150011_938_1483 162
21 3300060353 Ga0501082_0796919 Ga0501082_0796919_135_680 162
22 3300061734 Ga0530510_0187090 Ga0530510_0187090_590_1135 162
23 3300048905 Ga0496102_1003362 Ga0496102_1003362_115_717 165
24 3300048908 Ga0496105_0589020 Ga0496105_0589020_64_666 165
25 3300053078 Ga0495612_0112864 Ga0495612_0112864_123_722 165
26 3300046507 Ga0495606_0167353 Ga0495606_0167353_312_869 167
27 3300046691 Ga0495670_0253334 Ga0495670_0253334_365_919 167
28 3300049569 Ga0501032_0115315 Ga0501032_0115315_1195_1755 169
29 3300049574 Ga0501038_0003724 Ga0501038_0003724_6909_7469 169
30 3300049579 Ga0501043_0010624 Ga0501043_0010624_1826_2386 169
31 3300049581 Ga0501047_0924465 Ga0501047_0924465_41_601 169
32 3300046558 Ga0495633_0256683 Ga0495633_0256683_272_784 170
33 3300025900 Ga0207710_10301007 Ga0207710_103010072 172
34 3300049575 Ga0501039_0349500 Ga0501039_0349500_14_547 174
35 3300049587 Ga0501071_0474463 Ga0501071_0474463_68_601 174
36 3300060353 Ga0501082_1350852 Ga0501082_1350852_68_601 174
37 3300049569 Ga0501032_0010617 Ga0501032_0010617_3122_3658 175
38 3300049570 Ga0501033_0002710 Ga0501033_0002710_5666_6202 175
39 3300049571 Ga0501034_0391780 Ga0501034_0391780_418_954 175
40 3300049573 Ga0501037_0000618 Ga0501037_0000618_26573_27109 175
41 3300049574 Ga0501038_0809905 Ga0501038_0809905_24_560 175
42 3300049575 Ga0501039_0220929 Ga0501039_0220929_839_1375 175
43 3300049578 Ga0501042_0017959 Ga0501042_0017959_3522_4058 175
44 3300049579 Ga0501043_0037522 Ga0501043_0037522_397_933 175
45 3300049581 Ga0501047_0362177 Ga0501047_0362177_604_1140 175
46 3300049822 Ga0501035_0001311 Ga0501035_0001311_663_1199 175
47 3300049823 Ga0501044_0439541 Ga0501044_0439541_397_933 175
48 iso_pu_bacteria 2874604998 2874607900 179
49 iso_pu_bacteria 2513237101 2513695274 180
50 iso_pu_bacteria 2791355199 2793078318 180
51 iso_pu_bacteria 2922361189 2922363193 180
52 iso_pu_bacteria 8006964411 8006967622 180
53 3300005327 Ga0070658_10486872 Ga0070658_104868722 181
54 3300025909 Ga0207705_10383306 Ga0207705_103833062 181
55 3300048088 Ga0495602_0390876 Ga0495602_0390876_54_701 181
56 3300048903 Ga0496100_0168494 Ga0496100_0168494_400_1050 181
57 3300048906 Ga0496103_0397891 Ga0496103_0397891_107_757 181
58 3300048907 Ga0496104_0083684 Ga0496104_0083684_897_1547 181
59 3300048909 Ga0496106_0001943 Ga0496106_0001943_10022_10672 181
60 3300048910 Ga0496107_0007455 Ga0496107_0007455_1157_1807 181
61 3300048911 Ga0496108_0000927 Ga0496108_0000927_5493_6143 181
62 3300048912 Ga0496109_0000229 Ga0496109_0000229_2012_2662 181
63 3300048915 Ga0496112_0001343 Ga0496112_0001343_871_1521 181
64 3300049571 Ga0501034_0390619 Ga0501034_0390619_357_911 181
65 3300003659 JGI25404J52841_10009666 JGI25404J52841_100096662 182
66 3300005983 Ga0081540_1003488 Ga0081540_10034881 182
67 3300005937 Ga0081455_10007381 Ga0081455_100073812 183
68 3300005333 Ga0070677_10264150 Ga0070677_102641501 184
69 3300005937 Ga0081455_10050780 Ga0081455_100507802 184
70 3300006038 Ga0075365_10249056 Ga0075365_102490561 184
71 3300006237 Ga0097621_100717010 Ga0097621_1007170102 184
72 3300013297 Ga0157378_10444907 Ga0157378_104449072 184
73 3300013308 Ga0157375_10541565 Ga0157375_105415651 184
74 3300031344 Ga0265316_10239997 Ga0265316_102399972 184
75 3300035086 Ga0373934_0155506 Ga0373934_0155506_146_712 184
76 3300035111 Ga0373923_0057623 Ga0373923_0057623_932_1498 184
77 3300035117 Ga0373953_0009823 Ga0373953_0009823_618_1184 184
78 3300035118 Ga0373954_0001251 Ga0373954_0001251_8334_8900 184
79 3300035119 Ga0373956_0002392 Ga0373956_0002392_5429_5995 184
80 3300035120 Ga0373957_0034018 Ga0373957_0034018_578_1144 184
81 3300035172 Ga0373955_0002799 Ga0373955_0002799_2684_3250 184
82 3300035410 Ga0373924_0008694 Ga0373924_0008694_2313_2879 184
83 3300036401 Ga0373937_0019726 Ga0373937_0019726_3799_4365 184
84 3300046454 Ga0495592_0004510 Ga0495592_0004510_8887_9453 184
85 3300046459 Ga0495629_0017285 Ga0495629_0017285_1802_2368 184
86 3300046462 Ga0495651_0144593 Ga0495651_0144593_574_1140 184
87 3300046463 Ga0495653_0011881 Ga0495653_0011881_2021_2587 184
88 3300046471 Ga0495650_0111712 Ga0495650_0111712_47_601 184
89 3300046492 Ga0495585_0445845 Ga0495585_0445845_26_580 184
90 3300046511 Ga0495608_0004196 Ga0495608_0004196_9533_10099 184
91 3300046514 Ga0495618_0014329 Ga0495618_0014329_193_759 184
92 3300046516 Ga0495628_0017593 Ga0495628_0017593_1283_1849 184
93 3300046517 Ga0495630_1001900 Ga0495630_1001900_19_573 184
94 3300046524 Ga0495648_0209335 Ga0495648_0209335_33_587 184
95 3300046529 Ga0495652_0021450 Ga0495652_0021450_574_1140 184
96 3300046533 Ga0495640_0018260 Ga0495640_0018260_1917_2483 184
97 3300046536 Ga0495587_0009714 Ga0495587_0009714_3150_3716 184
98 3300046559 Ga0495667_0003525 Ga0495667_0003525_2297_2863 184
99 3300046616 Ga0495668_0311076 Ga0495668_0311076_26_580 184
100 3300046642 Ga0495634_0515185 Ga0495634_0515185_38_592 184
101 3300046663 Ga0495635_0007981 Ga0495635_0007981_3278_3844 184
102 3300046664 Ga0495659_0027918 Ga0495659_0027918_31_585 184
103 3300046675 Ga0495657_0004913 Ga0495657_0004913_2427_2993 184
104 3300046678 Ga0495599_0011722 Ga0495599_0011722_818_1384 184
105 3300046679 Ga0495623_0016409 Ga0495623_0016409_581_1147 184
106 3300046689 Ga0495613_0087361 Ga0495613_0087361_867_1433 184
107 3300046809 Ga0495600_0086940 Ga0495600_0086940_1297_1863 184
108 3300047317 Ga0495604_0002900 Ga0495604_0002900_3042_3608 184
109 3300047322 Ga0495680_0025446 Ga0495680_0025446_446_1012 184
110 3300047444 Ga0495675_0016233 Ga0495675_0016233_4045_4611 184
111 3300047470 Ga0495681_0080380 Ga0495681_0080380_709_1266 184
112 3300047471 Ga0495684_0019011 Ga0495684_0019011_3561_4127 184
113 3300047673 Ga0495593_0003761 Ga0495593_0003761_8107_8673 184
114 3300048088 Ga0495602_0031219 Ga0495602_0031219_3766_4332 184
115 3300048905 Ga0496102_0521133 Ga0496102_0521133_511_1065 184
116 3300048915 Ga0496112_0072258 Ga0496112_0072258_2823_3377 184
117 3300048924 Ga0496121_0389309 Ga0496121_0389309_24_578 184
118 3300049823 Ga0501044_0161710 Ga0501044_0161710_1261_1815 184
119 3300050494 nmdc:mga06z11_171815_c1 nmdc:mga06z11_171815_c1_671_1225 184
120 3300053077 Ga0495601_0016272 Ga0495601_0016272_491_1057 184
121 3300053084 Ga0495595_0001339 Ga0495595_0001339_7071_7637 184
122 3300053085 Ga0495619_0008552 Ga0495619_0008552_5338_5904 184
123 3300007265 Ga0099794_10079544 Ga0099794_100795442 185
124 3300027671 Ga0209588_1140868 Ga0209588_11408681 185
125 3300031235 Ga0265330_10020800 Ga0265330_100208002 185
126 3300049588 Ga0501072_0022570 Ga0501072_0022570_1011_1625 185
127 3300049592 Ga0501076_0247394 Ga0501076_0247394_32_646 185
128 3300049822 Ga0501035_0532077 Ga0501035_0532077_271_879 185
129 3300049823 Ga0501044_0010966 Ga0501044_0010966_2279_2887 185
130 3300049571 Ga0501034_0101586 Ga0501034_0101586_1528_2142 187
131 3300049572 Ga0501036_0062524 Ga0501036_0062524_947_1561 187
132 3300049572 Ga0501036_0343167 Ga0501036_0343167_597_1169 187
133 3300049572 Ga0501036_0518562 Ga0501036_0518562_230_844 187
134 3300049574 Ga0501038_0016712 Ga0501038_0016712_2555_3169 187
135 3300049579 Ga0501043_0506340 Ga0501043_0506340_165_779 187
136 3300049583 Ga0501067_0024682 Ga0501067_0024682_1722_2297 187
137 3300049583 Ga0501067_0316837 Ga0501067_0316837_67_681 187
138 3300049823 Ga0501044_0545981 Ga0501044_0545981_335_949 187
139 3300005548 Ga0070665_100181509 Ga0070665_1001815092 189
140 3300049589 Ga0501073_0584866 Ga0501073_0584866_68_664 189
141 3300049742 Ga0501080_0009556 Ga0501080_0009556_6692_7288 189
142 3300060353 Ga0501082_1233134 Ga0501082_1233134_38_634 189
143 3300005983 Ga0081540_1057059 Ga0081540_10570593 190
144 3300046476 Ga0495662_0173379 Ga0495662_0173379_286_870 190
145 3300046477 Ga0495664_0100410 Ga0495664_0100410_717_1301 190
146 3300046680 Ga0495646_0007134 Ga0495646_0007134_667_1251 190
147 3300048915 Ga0496112_0334827 Ga0496112_0334827_407_979 190
148 3300007076 Ga0075435_100022340 Ga0075435_1000223403 192
149 3300009094 Ga0111539_10027367 Ga0111539_100273678 192
150 3300009147 Ga0114129_11668549 Ga0114129_116685491 192
151 3300027907 Ga0207428_10040827 Ga0207428_100408272 192
152 3300050511 nmdc:mga08y16_16805_c1 nmdc:mga08y16_16805_c1_5109_5780 192
153 3300050513 nmdc:mga0rr50_17740_c1 nmdc:mga0rr50_17740_c1_2875_3546 192
154 3300050515 nmdc:mga0a205_44919_c1 nmdc:mga0a205_44919_c1_1467_2138 192
155 3300006353 Ga0075370_10234127 Ga0075370_102341272 195
156 3300049569 Ga0501032_0042888 Ga0501032_0042888_183_779 195
157 3300049573 Ga0501037_0003059 Ga0501037_0003059_6444_7040 195
158 3300049579 Ga0501043_0012301 Ga0501043_0012301_3976_4572 195
159 3300049584 Ga0501068_0044449 Ga0501068_0044449_1988_2584 195
160 3300049588 Ga0501072_0050010 Ga0501072_0050010_2046_2642 195
161 3300049822 Ga0501035_0009884 Ga0501035_0009884_1577_2173 195
162 3300050496 nmdc:mga07m45_184104_c1 nmdc:mga07m45_184104_c1_549_1148 195
163 3300005340 Ga0070689_100359825 Ga0070689_1003598251 196
164 3300005365 Ga0070688_100124953 Ga0070688_1001249532 196
165 3300025936 Ga0207670_10288939 Ga0207670_102889392 196
166 3300048913 Ga0496110_0175183 Ga0496110_0175183_416_1015 196
167 iso_pu_bacteria 2508501009 2508539322 196
168 iso_pu_bacteria 2508501042 2508695649 196
169 iso_pu_bacteria 2515154112 2515627632 196
170 iso_pu_bacteria 2524023205 2524441428 196
171 iso_pu_bacteria 2643221651 2644291080 196
172 iso_pu_bacteria 2721755755 2723841808 196
173 iso_pu_bacteria 2744054633 2745077562 196
174 iso_pu_bacteria 2857524615 2857526241 196
175 iso_pu_bacteria 2874590934 2874592563 196
176 iso_pu_bacteria 2874628541 2874628616 196
177 iso_pu_bacteria 2874645413 2874647182 196
178 iso_pu_bacteria 2876771140 2876772566 196
179 iso_pu_bacteria 2876808645 2876814202 196
180 iso_pu_bacteria 2876818435 2876819827 196
181 iso_pu_bacteria 2879074833 2879076333 196
182 iso_pu_bacteria 2879083081 2879083755 196
183 iso_pu_bacteria 2879110137 2879113327 196
184 iso_pu_bacteria 2879127579 2879128817 196
185 iso_pu_bacteria 2879142872 2879143638 196
186 iso_pu_bacteria 2919073203 2919073908 196
187 iso_pu_bacteria 2922386360 2922388502 196
188 iso_pu_bacteria 2935608549 2935615535 196
189 iso_pu_bacteria 2935648319 2935654465 196
190 iso_pu_bacteria 2935656913 2935663345 196
191 iso_pu_bacteria 2935819856 2935825664 196
192 iso_pu_bacteria 2935847175 2935853428 196
193 iso_pu_bacteria 2935908558 2935915030 196
194 iso_pu_bacteria 2935916978 2935918878 196
195 iso_pu_bacteria 2935926038 2935931405 196
196 iso_pu_bacteria 2935934488 2935940002 196
197 iso_pu_bacteria 2935942939 2935947651 196
198 iso_pu_bacteria 2935951376 2935956422 196
199 iso_pu_bacteria 2935967501 2935973216 196
200 iso_pu_bacteria 2935975950 2935980540 196
201 iso_pu_bacteria 2935984226 2935990108 196
202 iso_pu_bacteria 2936011229 2936017496 196
203 iso_pu_bacteria 2936019824 2936026003 196
204 iso_pu_bacteria 2936028420 2936034845 196
205 iso_pu_bacteria 2936046547 2936052897 196
206 iso_pu_bacteria 2936055302 2936060244 196
207 iso_pu_bacteria 8006984368 8006991092 196
208 iso_pu_bacteria 8019619141 8019623149 196
209 iso_pu_bacteria 8019629233 8019629950 196
210 iso_pu_bacteria 8019659431 8019666791 196
211 iso_pu_bacteria 8019668869 8019676548 196
212 iso_pu_bacteria 8019687851 8019696064 196
213 iso_pu_bacteria 8056673599 8056676126 196
214 3300005335 Ga0070666_10499889 Ga0070666_104998891 197
215 3300005367 Ga0070667_100342219 Ga0070667_1003422192 197
216 3300005455 Ga0070663_100845261 Ga0070663_1008452611 197
217 3300025903 Ga0207680_10229433 Ga0207680_102294332 197
218 3300049585 Ga0501069_0252377 Ga0501069_0252377_214_900 197
219 3300049586 Ga0501070_0013417 Ga0501070_0013417_3997_4683 197
220 3300049586 Ga0501070_0147120 Ga0501070_0147120_670_1266 197
221 3300049592 Ga0501076_0188450 Ga0501076_0188450_804_1418 197
222 3300049742 Ga0501080_0475164 Ga0501080_0475164_261_857 197
223 3300049822 Ga0501035_0000197 Ga0501035_0000197_14533_15129 197
224 3300005536 Ga0070697_100494583 Ga0070697_1004945831 198
225 3300049573 Ga0501037_0342966 Ga0501037_0342966_261_878 198
226 3300049576 Ga0501040_0202117 Ga0501040_0202117_569_1186 198
227 3300049577 Ga0501041_0201110 Ga0501041_0201110_432_1049 198
228 3300049586 Ga0501070_0285270 Ga0501070_0285270_117_734 198
229 3300049593 Ga0501077_0358836 Ga0501077_0358836_181_798 198
230 3300049822 Ga0501035_0453789 Ga0501035_0453789_180_797 198
231 3300049824 Ga0501045_0032643 Ga0501045_0032643_687_1304 198
232 3300005333 Ga0070677_10015940 Ga0070677_100159402 199
233 3300005340 Ga0070689_100004675 Ga0070689_1000046752 199
234 3300005354 Ga0070675_100269430 Ga0070675_1002694302 199
235 3300005355 Ga0070671_100117043 Ga0070671_1001170432 199
236 3300005365 Ga0070688_100055270 Ga0070688_1000552701 199
237 3300005367 Ga0070667_100068086 Ga0070667_1000680862 199
238 3300005544 Ga0070686_100170052 Ga0070686_1001700522 199
239 3300005617 Ga0068859_100042524 Ga0068859_1000425247 199
240 3300005843 Ga0068860_100359235 Ga0068860_1003592352 199
241 3300005983 Ga0081540_1043025 Ga0081540_10430253 199
242 3300006931 Ga0097620_100042524 Ga0097620_1000425242 199
243 3300009148 Ga0105243_10279153 Ga0105243_102791533 199
244 3300010159 Ga0099796_10080818 Ga0099796_100808181 199
245 3300011119 Ga0105246_10189923 Ga0105246_101899232 199
246 3300013306 Ga0163162_10246129 Ga0163162_102461291 199
247 3300013308 Ga0157375_10094489 Ga0157375_100944892 199
248 3300014325 Ga0163163_10123792 Ga0163163_101237923 199
249 3300025893 Ga0207682_10094612 Ga0207682_100946121 199
250 3300025899 Ga0207642_10204044 Ga0207642_102040441 199
251 3300025926 Ga0207659_10139481 Ga0207659_101394812 199
252 3300025931 Ga0207644_10083124 Ga0207644_100831242 199
253 3300025937 Ga0207669_10127763 Ga0207669_101277632 199
254 3300025938 Ga0207704_10055671 Ga0207704_100556714 199
255 3300025960 Ga0207651_10373036 Ga0207651_103730362 199
256 3300026089 Ga0207648_10130555 Ga0207648_101305553 199
257 3300028381 Ga0268264_10508080 Ga0268264_105080802 199
258 3300031241 Ga0265325_10046397 Ga0265325_100463972 199
259 3300031247 Ga0265340_10014378 Ga0265340_100143787 199
260 3300031995 Ga0307409_100644211 Ga0307409_1006442112 199
261 3300032002 Ga0307416_100452416 Ga0307416_1004524162 199
262 3300035114 Ga0373939_0032740 Ga0373939_0032740_360_962 199
263 3300035692 Ga0373935_0425496 Ga0373935_0425496_253_855 199
264 3300037068 Ga0373925_0602642 Ga0373925_0602642_210_812 199
265 3300046516 Ga0495628_0288579 Ga0495628_0288579_58_660 199
266 3300047322 Ga0495680_0161446 Ga0495680_0161446_313_915 199
267 3300048908 Ga0496105_0650616 Ga0496105_0650616_52_654 199
268 3300048912 Ga0496109_0433336 Ga0496109_0433336_70_672 199
269 3300048915 Ga0496112_1134706 Ga0496112_1134706_24_626 199
270 3300048916 Ga0496113_0115029 Ga0496113_0115029_820_1422 199
271 3300049568 Ga0501031_0010399 Ga0501031_0010399_4477_5079 199
272 3300049569 Ga0501032_0006386 Ga0501032_0006386_1733_2335 199
273 3300049570 Ga0501033_0015402 Ga0501033_0015402_186_788 199
274 3300049571 Ga0501034_0003727 Ga0501034_0003727_5774_6376 199
275 3300049572 Ga0501036_0001268 Ga0501036_0001268_17006_17608 199
276 3300049573 Ga0501037_0002956 Ga0501037_0002956_491_1093 199
277 3300049574 Ga0501038_0006827 Ga0501038_0006827_8969_9571 199
278 3300049575 Ga0501039_0001032 Ga0501039_0001032_8972_9574 199
279 3300049576 Ga0501040_0310652 Ga0501040_0310652_122_724 199
280 3300049578 Ga0501042_0022883 Ga0501042_0022883_3343_3945 199
281 3300049579 Ga0501043_0016441 Ga0501043_0016441_186_788 199
282 3300049580 Ga0501046_0003718 Ga0501046_0003718_12253_12855 199
283 3300049581 Ga0501047_0003496 Ga0501047_0003496_3847_4449 199
284 3300049582 Ga0501048_0021902 Ga0501048_0021902_3330_3932 199
285 3300049584 Ga0501068_0001483 Ga0501068_0001483_10990_11592 199
286 3300049585 Ga0501069_0010836 Ga0501069_0010836_894_1496 199
287 3300049586 Ga0501070_0006615 Ga0501070_0006615_8772_9374 199
288 3300049587 Ga0501071_0030772 Ga0501071_0030772_2706_3308 199
289 3300049589 Ga0501073_0022730 Ga0501073_0022730_1370_1972 199
290 3300049590 Ga0501074_0004173 Ga0501074_0004173_186_788 199
291 3300049592 Ga0501076_0214263 Ga0501076_0214263_132_734 199
292 3300049741 Ga0501079_0042008 Ga0501079_0042008_852_1454 199
293 3300049742 Ga0501080_0004990 Ga0501080_0004990_491_1093 199
294 3300049744 Ga0501083_0011859 Ga0501083_0011859_4319_4921 199
295 3300049822 Ga0501035_0005159 Ga0501035_0005159_6946_7548 199
296 3300049823 Ga0501044_0047956 Ga0501044_0047956_2512_3114 199
297 3300049824 Ga0501045_0028538 Ga0501045_0028538_876_1478 199
298 3300053078 Ga0495612_0040175 Ga0495612_0040175_926_1528 199
299 3300053084 Ga0495595_0122709 Ga0495595_0122709_438_1040 199
300 3300054114 Ga0501084_0024607 Ga0501084_0024607_2884_3486 199
301 3300054114 Ga0501084_0128645 Ga0501084_0128645_444_1046 199
302 3300060353 Ga0501082_0025085 Ga0501082_0025085_3278_3880 199
303 3300003203 JGI25406J46586_10001038 JGI25406J46586_1000103810 200
304 3300003203 JGI25406J46586_10002413 JGI25406J46586_100024135 200
305 3300003215 JGI25153J46596_10001456 JGI25153J46596_100014562 200
306 3300003354 JGI25160J50197_1035435 JGI25160J50197_10354352 200
307 3300003659 JGI25404J52841_10066849 JGI25404J52841_100668491 200
308 3300005327 Ga0070658_10185537 Ga0070658_101855372 200
309 3300005327 Ga0070658_10242526 Ga0070658_102425262 200
310 3300005328 Ga0070676_10432815 Ga0070676_104328151 200
311 3300005329 Ga0070683_100816987 Ga0070683_1008169871 200
312 3300005330 Ga0070690_100216613 Ga0070690_1002166132 200
313 3300005334 Ga0068869_100312880 Ga0068869_1003128802 200
314 3300005334 Ga0068869_100582355 Ga0068869_1005823551 200
315 3300005335 Ga0070666_10419588 Ga0070666_104195881 200
316 3300005336 Ga0070680_100022680 Ga0070680_1000226808 200
317 3300005338 Ga0068868_100064772 Ga0068868_1000647725 200
318 3300005338 Ga0068868_100651456 Ga0068868_1006514562 200
319 3300005339 Ga0070660_100368233 Ga0070660_1003682332 200
320 3300005340 Ga0070689_100766489 Ga0070689_1007664891 200
321 3300005345 Ga0070692_10232270 Ga0070692_102322702 200
322 3300005347 Ga0070668_100055932 Ga0070668_1000559324 200
323 3300005347 Ga0070668_100350373 Ga0070668_1003503732 200
324 3300005347 Ga0070668_100611407 Ga0070668_1006114071 200
325 3300005347 Ga0070668_101039032 Ga0070668_1010390321 200
326 3300005354 Ga0070675_100505271 Ga0070675_1005052711 200
327 3300005356 Ga0070674_100042830 Ga0070674_1000428302 200
328 3300005365 Ga0070688_100162897 Ga0070688_1001628972 200
329 3300005366 Ga0070659_100060958 Ga0070659_1000609581 200
330 3300005366 Ga0070659_100427619 Ga0070659_1004276191 200
331 3300005367 Ga0070667_100328876 Ga0070667_1003288762 200
332 3300005367 Ga0070667_100378511 Ga0070667_1003785112 200
333 3300005435 Ga0070714_100094125 Ga0070714_1000941252 200
334 3300005436 Ga0070713_100335420 Ga0070713_1003354202 200
335 3300005438 Ga0070701_10303906 Ga0070701_103039062 200
336 3300005440 Ga0070705_100274329 Ga0070705_1002743291 200
337 3300005441 Ga0070700_100545849 Ga0070700_1005458491 200
338 3300005444 Ga0070694_100272091 Ga0070694_1002720912 200
339 3300005455 Ga0070663_100072771 Ga0070663_1000727713 200
340 3300005455 Ga0070663_100112170 Ga0070663_1001121702 200
341 3300005455 Ga0070663_100285004 Ga0070663_1002850042 200
342 3300005455 Ga0070663_100307214 Ga0070663_1003072142 200
343 3300005455 Ga0070663_100757614 Ga0070663_1007576141 200
344 3300005456 Ga0070678_100060031 Ga0070678_1000600311 200
345 3300005456 Ga0070678_100382070 Ga0070678_1003820701 200
346 3300005457 Ga0070662_100136564 Ga0070662_1001365642 200
347 3300005459 Ga0068867_100133168 Ga0068867_1001331682 200
348 3300005466 Ga0070685_10175005 Ga0070685_101750052 200
349 3300005467 Ga0070706_100208739 Ga0070706_1002087392 200
350 3300005471 Ga0070698_100349788 Ga0070698_1003497882 200
351 3300005518 Ga0070699_100248271 Ga0070699_1002482712 200
352 3300005539 Ga0068853_100709790 Ga0068853_1007097902 200
353 3300005543 Ga0070672_100155551 Ga0070672_1001555512 200
354 3300005543 Ga0070672_100339121 Ga0070672_1003391212 200
355 3300005548 Ga0070665_100250653 Ga0070665_1002506533 200
356 3300005548 Ga0070665_100294329 Ga0070665_1002943292 200
357 3300005548 Ga0070665_100326553 Ga0070665_1003265532 200
358 3300005548 Ga0070665_100339711 Ga0070665_1003397112 200
359 3300005563 Ga0068855_100186751 Ga0068855_1001867513 200
360 3300005577 Ga0068857_100872843 Ga0068857_1008728432 200
361 3300005578 Ga0068854_100181925 Ga0068854_1001819252 200
362 3300005578 Ga0068854_100416746 Ga0068854_1004167462 200
363 3300005614 Ga0068856_100266367 Ga0068856_1002663672 200
364 3300005615 Ga0070702_100048893 Ga0070702_1000488933 200
365 3300005615 Ga0070702_100108554 Ga0070702_1001085541 200
366 3300005616 Ga0068852_100037900 Ga0068852_1000379003 200
367 3300005616 Ga0068852_100230708 Ga0068852_1002307082 200
368 3300005617 Ga0068859_100116665 Ga0068859_1001166651 200
369 3300005618 Ga0068864_100156690 Ga0068864_1001566903 200
370 3300005718 Ga0068866_10077367 Ga0068866_100773673 200
371 3300005718 Ga0068866_10115469 Ga0068866_101154692 200
372 3300005719 Ga0068861_100054773 Ga0068861_1000547735 200
373 3300005719 Ga0068861_100056139 Ga0068861_1000561395 200
374 3300005719 Ga0068861_100352492 Ga0068861_1003524922 200
375 3300005840 Ga0068870_10102585 Ga0068870_101025852 200
376 3300005841 Ga0068863_100554902 Ga0068863_1005549022 200
377 3300005842 Ga0068858_100038802 Ga0068858_1000388022 200
378 3300005842 Ga0068858_100509174 Ga0068858_1005091741 200
379 3300005842 Ga0068858_100858520 Ga0068858_1008585201 200
380 3300005843 Ga0068860_100135420 Ga0068860_1001354201 200
381 3300005843 Ga0068860_101480190 Ga0068860_1014801901 200
382 3300005844 Ga0068862_100220883 Ga0068862_1002208832 200
383 3300005844 Ga0068862_100441921 Ga0068862_1004419212 200
384 3300005844 Ga0068862_100914051 Ga0068862_1009140511 200
385 3300005983 Ga0081540_1005580 Ga0081540_10055803 200
386 3300005983 Ga0081540_1034639 Ga0081540_10346392 200
387 3300005983 Ga0081540_1125650 Ga0081540_11256502 200
388 3300005985 Ga0081539_10000371 Ga0081539_1000037134 200
389 3300006028 Ga0070717_10112306 Ga0070717_101123062 200
390 3300006038 Ga0075365_10078749 Ga0075365_100787492 200
391 3300006038 Ga0075365_10341134 Ga0075365_103411342 200
392 3300006038 Ga0075365_10388110 Ga0075365_103881101 200
393 3300006042 Ga0075368_10052409 Ga0075368_100524092 200
394 3300006173 Ga0070716_100447190 Ga0070716_1004471902 200
395 3300006175 Ga0070712_100138553 Ga0070712_1001385532 200
396 3300006177 Ga0075362_10234520 Ga0075362_102345201 200
397 3300006178 Ga0075367_10004142 Ga0075367_100041422 200
398 3300006178 Ga0075367_10206293 Ga0075367_102062932 200
399 3300006178 Ga0075367_10296083 Ga0075367_102960831 200
400 3300006186 Ga0075369_10209849 Ga0075369_102098491 200
401 3300006195 Ga0075366_10169439 Ga0075366_101694391 200
402 3300006195 Ga0075366_10405279 Ga0075366_104052792 200
403 3300006353 Ga0075370_10334385 Ga0075370_103343851 200
404 3300006881 Ga0068865_100187859 Ga0068865_1001878592 200
405 3300006931 Ga0097620_100116665 Ga0097620_1001166651 200
406 3300009094 Ga0111539_10479383 Ga0111539_104793832 200
407 3300009098 Ga0105245_10065652 Ga0105245_100656525 200
408 3300009098 Ga0105245_11360462 Ga0105245_113604621 200
409 3300009148 Ga0105243_10017286 Ga0105243_100172863 200
410 3300009148 Ga0105243_10287471 Ga0105243_102874712 200
411 3300009176 Ga0105242_10408322 Ga0105242_104083222 200
412 3300009177 Ga0105248_10870614 Ga0105248_108706141 200
413 3300009545 Ga0105237_10240406 Ga0105237_102404063 200
414 3300009553 Ga0105249_10404182 Ga0105249_104041822 200
415 3300009553 Ga0105249_11263706 Ga0105249_112637061 200
416 3300010375 Ga0105239_10891805 Ga0105239_108918051 200
417 3300011119 Ga0105246_10178652 Ga0105246_101786521 200
418 3300011119 Ga0105246_10529514 Ga0105246_105295142 200
419 3300013102 Ga0157371_10029898 Ga0157371_100298982 200
420 3300013104 Ga0157370_10219374 Ga0157370_102193742 200
421 3300013297 Ga0157378_10128247 Ga0157378_101282473 200
422 3300013297 Ga0157378_10143352 Ga0157378_101433523 200
423 3300013306 Ga0163162_10096952 Ga0163162_100969525 200
424 3300013306 Ga0163162_10446030 Ga0163162_104460303 200
425 3300013308 Ga0157375_10188592 Ga0157375_101885921 200
426 3300013308 Ga0157375_11717602 Ga0157375_117176021 200
427 3300014325 Ga0163163_10021994 Ga0163163_100219948 200
428 3300014325 Ga0163163_10167803 Ga0163163_101678031 200
429 3300014326 Ga0157380_10127438 Ga0157380_101274383 200
430 3300014326 Ga0157380_10541571 Ga0157380_105415712 200
431 3300014969 Ga0157376_10285393 Ga0157376_102853932 200
432 3300014969 Ga0157376_10325397 Ga0157376_103253972 200
433 3300017792 Ga0163161_10087055 Ga0163161_100870551 200
434 3300025273 Ga0209673_1035657 Ga0209673_10356572 200
435 3300025297 Ga0209758_1003254 Ga0209758_10032547 200
436 3300025297 Ga0209758_1005533 Ga0209758_10055336 200
437 3300025297 Ga0209758_1033834 Ga0209758_10338342 200
438 3300025297 Ga0209758_1060491 Ga0209758_10604912 200
439 3300025901 Ga0207688_10055213 Ga0207688_100552133 200
440 3300025901 Ga0207688_10234211 Ga0207688_102342112 200
441 3300025901 Ga0207688_10330408 Ga0207688_103304081 200
442 3300025901 Ga0207688_10507983 Ga0207688_105079831 200
443 3300025907 Ga0207645_10378032 Ga0207645_103780321 200
444 3300025908 Ga0207643_10027901 Ga0207643_100279013 200
445 3300025908 Ga0207643_10506996 Ga0207643_105069961 200
446 3300025910 Ga0207684_10516367 Ga0207684_105163672 200
447 3300025911 Ga0207654_10400552 Ga0207654_104005521 200
448 3300025914 Ga0207671_10041905 Ga0207671_100419052 200
449 3300025918 Ga0207662_10072853 Ga0207662_100728532 200
450 3300025919 Ga0207657_10184324 Ga0207657_101843241 200
451 3300025924 Ga0207694_10465023 Ga0207694_104650232 200
452 3300025925 Ga0207650_10257832 Ga0207650_102578322 200
453 3300025926 Ga0207659_10182571 Ga0207659_101825712 200
454 3300025927 Ga0207687_10047519 Ga0207687_100475195 200
455 3300025929 Ga0207664_10642554 Ga0207664_106425541 200
456 3300025931 Ga0207644_10137677 Ga0207644_101376772 200
457 3300025933 Ga0207706_10467405 Ga0207706_104674051 200
458 3300025936 Ga0207670_10350627 Ga0207670_103506272 200
459 3300025936 Ga0207670_10446006 Ga0207670_104460062 200
460 3300025938 Ga0207704_10191077 Ga0207704_101910772 200
461 3300025939 Ga0207665_10028702 Ga0207665_100287021 200
462 3300025940 Ga0207691_10264783 Ga0207691_102647832 200
463 3300025940 Ga0207691_10469031 Ga0207691_104690311 200
464 3300025940 Ga0207691_10596346 Ga0207691_105963461 200
465 3300025941 Ga0207711_10339804 Ga0207711_103398042 200
466 3300025942 Ga0207689_10125055 Ga0207689_101250553 200
467 3300025942 Ga0207689_10569751 Ga0207689_105697511 200
468 3300025945 Ga0207679_10514915 Ga0207679_105149152 200
469 3300025949 Ga0207667_11420070 Ga0207667_114200701 200
470 3300025961 Ga0207712_10092594 Ga0207712_100925942 200
471 3300025961 Ga0207712_10367141 Ga0207712_103671412 200
472 3300025972 Ga0207668_10083672 Ga0207668_100836723 200
473 3300025972 Ga0207668_10274960 Ga0207668_102749602 200
474 3300025972 Ga0207668_10391492 Ga0207668_103914922 200
475 3300025981 Ga0207640_10206208 Ga0207640_102062082 200
476 3300025981 Ga0207640_10865327 Ga0207640_108653271 200
477 3300025986 Ga0207658_10226107 Ga0207658_102261071 200
478 3300025986 Ga0207658_10561494 Ga0207658_105614941 200
479 3300026023 Ga0207677_10212664 Ga0207677_102126642 200
480 3300026035 Ga0207703_10037725 Ga0207703_100377252 200
481 3300026035 Ga0207703_10089355 Ga0207703_100893551 200
482 3300026041 Ga0207639_10919523 Ga0207639_109195231 200
483 3300026067 Ga0207678_10004213 Ga0207678_1000421310 200
484 3300026067 Ga0207678_10359713 Ga0207678_103597132 200
485 3300026067 Ga0207678_10370903 Ga0207678_103709032 200
486 3300026067 Ga0207678_10483861 Ga0207678_104838612 200
487 3300026067 Ga0207678_10628902 Ga0207678_106289022 200
488 3300026075 Ga0207708_10066280 Ga0207708_100662802 200
489 3300026078 Ga0207702_10156027 Ga0207702_101560272 200
490 3300026078 Ga0207702_10753079 Ga0207702_107530791 200
491 3300026088 Ga0207641_11038456 Ga0207641_110384561 200
492 3300026089 Ga0207648_10034157 Ga0207648_100341577 200
493 3300026089 Ga0207648_10074297 Ga0207648_100742972 200
494 3300026095 Ga0207676_10133659 Ga0207676_101336593 200
495 3300026116 Ga0207674_10378676 Ga0207674_103786762 200
496 3300026118 Ga0207675_100069784 Ga0207675_1000697842 200
497 3300026118 Ga0207675_100102602 Ga0207675_1001026022 200
498 3300026121 Ga0207683_10130438 Ga0207683_101304383 200
499 3300026121 Ga0207683_10441975 Ga0207683_104419752 200
500 3300026142 Ga0207698_10129535 Ga0207698_101295352 200
501 3300026142 Ga0207698_10170561 Ga0207698_101705612 200
502 3300028379 Ga0268266_10001906 Ga0268266_1000190611 200
503 3300028379 Ga0268266_10039111 Ga0268266_100391112 200
504 3300028379 Ga0268266_10892597 Ga0268266_108925972 200
505 3300028381 Ga0268264_10586467 Ga0268264_105864671 200
506 3300028786 Ga0307517_10000232 Ga0307517_100002329 200
507 3300030522 Ga0307512_10178733 Ga0307512_101787332 200
508 3300031239 Ga0265328_10151576 Ga0265328_101515761 200
509 3300031250 Ga0265331_10012035 Ga0265331_100120352 200
510 3300031507 Ga0307509_10473816 Ga0307509_104738161 200
511 3300031711 Ga0265314_10178567 Ga0265314_101785672 200
512 3300031712 Ga0265342_10016250 Ga0265342_100162502 200
513 3300031730 Ga0307516_10601117 Ga0307516_106011172 200
514 3300031824 Ga0307413_10165625 Ga0307413_101656251 200
515 3300031911 Ga0307412_10375761 Ga0307412_103757612 200
516 3300032002 Ga0307416_101234116 Ga0307416_1012341161 200
517 3300032126 Ga0307415_100576864 Ga0307415_1005768642 200
518 3300033180 Ga0307510_10065796 Ga0307510_100657962 200
519 3300034818 Ga0373950_0021747 Ga0373950_0021747_116_718 200
520 3300035692 Ga0373935_0194184 Ga0373935_0194184_18_632 200
521 3300037312 Ga0395899_0203479 Ga0395899_0203479_558_1160 200
522 3300037418 Ga0395900_0013190 Ga0395900_0013190_6572_7174 200
523 3300037466 Ga0395898_0384830 Ga0395898_0384830_696_1328 200
524 3300037471 Ga0395905_0406929 Ga0395905_0406929_327_929 200
525 3300038443 Ga0395901_0031964 Ga0395901_0031964_2727_3329 200
526 3300041443 Ga0451789_0036013 Ga0451789_0036013_83_685 200
527 3300041997 Ga0439431_0148455 Ga0439431_0148455_47_649 200
528 3300042157 Ga0439458_0024859 Ga0439458_0024859_658_1260 200
529 3300042439 Ga0439464_0066430 Ga0439464_0066430_371_973 200
530 3300044656 Ga0466969_0060548 Ga0466969_0060548_110_712 200
531 3300045049 Ga0466959_0216260 Ga0466959_0216260_528_1130 200
532 3300046454 Ga0495592_0518573 Ga0495592_0518573_14_616 200
533 3300046455 Ga0495603_0031230 Ga0495603_0031230_693_1295 200
534 3300046455 Ga0495603_0326583 Ga0495603_0326583_252_854 200
535 3300046457 Ga0495590_0142800 Ga0495590_0142800_252_854 200
536 3300046459 Ga0495629_0004360 Ga0495629_0004360_3406_4008 200
537 3300046459 Ga0495629_0432694 Ga0495629_0432694_18_620 200
538 3300046459 Ga0495629_0537582 Ga0495629_0537582_80_682 200
539 3300046460 Ga0495638_0063557 Ga0495638_0063557_241_843 200
540 3300046461 Ga0495641_0155872 Ga0495641_0155872_287_889 200
541 3300046462 Ga0495651_0049620 Ga0495651_0049620_1433_2035 200
542 3300046462 Ga0495651_0149658 Ga0495651_0149658_885_1487 200
543 3300046471 Ga0495650_0155653 Ga0495650_0155653_131_733 200
544 3300046499 Ga0495594_0066233 Ga0495594_0066233_569_1171 200
545 3300046499 Ga0495594_0099816 Ga0495594_0099816_852_1466 200
546 3300046500 Ga0495596_0093990 Ga0495596_0093990_146_748 200
547 3300046501 Ga0495607_0014122 Ga0495607_0014122_4576_5178 200
548 3300046501 Ga0495607_0152782 Ga0495607_0152782_465_1067 200
549 3300046507 Ga0495606_0005524 Ga0495606_0005524_5851_6453 200
550 3300046507 Ga0495606_0116238 Ga0495606_0116238_322_924 200
551 3300046512 Ga0495610_0080001 Ga0495610_0080001_573_1235 200
552 3300046513 Ga0495616_0110214 Ga0495616_0110214_42_644 200
553 3300046515 Ga0495620_0028200 Ga0495620_0028200_113_715 200
554 3300046516 Ga0495628_0487783 Ga0495628_0487783_175_777 200
555 3300046518 Ga0495631_0005921 Ga0495631_0005921_90_692 200
556 3300046518 Ga0495631_0090814 Ga0495631_0090814_179_781 200
557 3300046518 Ga0495631_0185321 Ga0495631_0185321_16_618 200
558 3300046522 Ga0495643_0054634 Ga0495643_0054634_444_1106 200
559 3300046523 Ga0495644_0057738 Ga0495644_0057738_142_744 200
560 3300046524 Ga0495648_0153781 Ga0495648_0153781_500_1102 200
561 3300046526 Ga0495666_0059085 Ga0495666_0059085_804_1406 200
562 3300046529 Ga0495652_0082023 Ga0495652_0082023_142_744 200
563 3300046530 Ga0495654_0016517 Ga0495654_0016517_1845_2447 200
564 3300046533 Ga0495640_0017203 Ga0495640_0017203_3858_4460 200
565 3300046542 Ga0495597_0038307 Ga0495597_0038307_496_1098 200
566 3300046543 Ga0495645_0201305 Ga0495645_0201305_572_1177 200
567 3300046557 Ga0495622_0089265 Ga0495622_0089265_166_768 200
568 3300046557 Ga0495622_0198980 Ga0495622_0198980_27_629 200
569 3300046558 Ga0495633_0106235 Ga0495633_0106235_473_1075 200
570 3300046615 Ga0495656_0064515 Ga0495656_0064515_455_1057 200
571 3300046616 Ga0495668_0121514 Ga0495668_0121514_92_694 200
572 3300046616 Ga0495668_0186912 Ga0495668_0186912_506_1108 200
573 3300046616 Ga0495668_0280332 Ga0495668_0280332_296_898 200
574 3300046648 Ga0495611_0065013 Ga0495611_0065013_50_652 200
575 3300046660 Ga0495625_0051205 Ga0495625_0051205_139_741 200
576 3300046660 Ga0495625_0279783 Ga0495625_0279783_124_726 200
577 3300046663 Ga0495635_0003646 Ga0495635_0003646_275_877 200
578 3300046665 Ga0495661_0052161 Ga0495661_0052161_504_1106 200
579 3300046674 Ga0495588_0167095 Ga0495588_0167095_65_667 200
580 3300046675 Ga0495657_0282008 Ga0495657_0282008_216_818 200
581 3300046684 Ga0495669_0049163 Ga0495669_0049163_782_1384 200
582 3300046690 Ga0495624_0070244 Ga0495624_0070244_666_1268 200
583 3300046691 Ga0495670_0004607 Ga0495670_0004607_691_1293 200
584 3300046691 Ga0495670_0109527 Ga0495670_0109527_131_733 200
585 3300046794 Ga0495589_0149912 Ga0495589_0149912_332_934 200
586 3300046809 Ga0495600_0203956 Ga0495600_0203956_73_675 200
587 3300046810 Ga0495660_0316707 Ga0495660_0316707_15_617 200
588 3300047315 Ga0495581_0027362 Ga0495581_0027362_2657_3259 200
589 3300047315 Ga0495581_0110234 Ga0495581_0110234_203_805 200
590 3300047317 Ga0495604_0040985 Ga0495604_0040985_2955_3557 200
591 3300047321 Ga0495676_0155589 Ga0495676_0155589_684_1286 200
592 3300047443 Ga0495687_053686 Ga0495687_053686_727_1344 200
593 3300047445 Ga0495677_0014886 Ga0495677_0014886_1636_2238 200
594 3300047469 Ga0495673_0162680 Ga0495673_0162680_211_813 200
595 3300047472 Ga0495686_0113872 Ga0495686_0113872_664_1266 200
596 3300047472 Ga0495686_0214948 Ga0495686_0214948_87_689 200
597 3300048088 Ga0495602_0173091 Ga0495602_0173091_343_945 200
598 3300048904 Ga0496101_0474026 Ga0496101_0474026_164_766 200
599 3300048906 Ga0496103_0443226 Ga0496103_0443226_203_805 200
600 3300048907 Ga0496104_0005504 Ga0496104_0005504_318_920 200
601 3300048907 Ga0496104_0486541 Ga0496104_0486541_168_770 200
602 3300048907 Ga0496104_0942968 Ga0496104_0942968_115_717 200
603 3300048909 Ga0496106_0338567 Ga0496106_0338567_478_1080 200
604 3300048909 Ga0496106_0521282 Ga0496106_0521282_225_827 200
605 3300048911 Ga0496108_0096970 Ga0496108_0096970_22_624 200
606 3300048911 Ga0496108_0361334 Ga0496108_0361334_230_832 200
607 3300048912 Ga0496109_0035650 Ga0496109_0035650_211_813 200
608 3300048912 Ga0496109_0473021 Ga0496109_0473021_425_1027 200
609 3300048913 Ga0496110_0054510 Ga0496110_0054510_1414_2016 200
610 3300048915 Ga0496112_0000018 Ga0496112_0000018_83621_84241 200
611 3300048915 Ga0496112_0476361 Ga0496112_0476361_445_1047 200
612 3300048915 Ga0496112_0641583 Ga0496112_0641583_155_772 200
613 3300048916 Ga0496113_0265274 Ga0496113_0265274_411_1013 200
614 3300048917 Ga0496114_0451408 Ga0496114_0451408_197_799 200
615 3300048917 Ga0496114_1164105 Ga0496114_1164105_34_636 200
616 3300048918 Ga0496115_0463331 Ga0496115_0463331_292_894 200
617 3300048919 Ga0496116_0219226 Ga0496116_0219226_172_774 200
618 3300048920 Ga0496117_0221736 Ga0496117_0221736_69_671 200
619 3300048922 Ga0496119_0035028 Ga0496119_0035028_261_923 200
620 3300048922 Ga0496119_0341273 Ga0496119_0341273_46_648 200
621 3300048923 Ga0496120_0012939 Ga0496120_0012939_3773_4375 200
622 3300048923 Ga0496120_0064399 Ga0496120_0064399_509_1171 200
623 3300048924 Ga0496121_0095221 Ga0496121_0095221_1037_1639 200
624 3300048924 Ga0496121_0237799 Ga0496121_0237799_404_1006 200
625 3300048924 Ga0496121_0388794 Ga0496121_0388794_206_811 200
626 3300048925 Ga0496122_0012751 Ga0496122_0012751_6141_6743 200
627 3300048925 Ga0496122_0326670 Ga0496122_0326670_196_798 200
628 3300048926 Ga0496123_0009028 Ga0496123_0009028_4232_4834 200
629 3300048927 Ga0496124_0229037 Ga0496124_0229037_535_1137 200
630 3300048927 Ga0496124_0456659 Ga0496124_0456659_148_750 200
631 3300048928 Ga0496125_0000843 Ga0496125_0000843_48484_49146 200
632 3300048928 Ga0496125_0091066 Ga0496125_0091066_928_1533 200
633 3300048929 Ga0496126_0006001 Ga0496126_0006001_10750_11355 200
634 3300048929 Ga0496126_0011123 Ga0496126_0011123_5317_5919 200
635 3300048929 Ga0496126_0154742 Ga0496126_0154742_657_1259 200
636 3300048929 Ga0496126_0587014 Ga0496126_0587014_46_648 200
637 3300048929 Ga0496126_0663484 Ga0496126_0663484_198_800 200
638 3300048929 Ga0496126_0804901 Ga0496126_0804901_34_636 200
639 3300049460 Ga0495682_0159325 Ga0495682_0159325_144_773 200
640 3300049568 Ga0501031_0000207 Ga0501031_0000207_13838_14446 200
641 3300049569 Ga0501032_0000252 Ga0501032_0000252_33739_34347 200
642 3300049570 Ga0501033_0000082 Ga0501033_0000082_33544_34152 200
643 3300049570 Ga0501033_0023648 Ga0501033_0023648_3877_4479 200
644 3300049571 Ga0501034_0000198 Ga0501034_0000198_8621_9229 200
645 3300049571 Ga0501034_0046721 Ga0501034_0046721_2202_2804 200
646 3300049572 Ga0501036_0001281 Ga0501036_0001281_8411_9019 200
647 3300049572 Ga0501036_0100597 Ga0501036_0100597_729_1331 200
648 3300049573 Ga0501037_0000050 Ga0501037_0000050_10138_10746 200
649 3300049573 Ga0501037_0257493 Ga0501037_0257493_22_624 200
650 3300049574 Ga0501038_0000538 Ga0501038_0000538_8621_9229 200
651 3300049574 Ga0501038_0131534 Ga0501038_0131534_222_824 200
652 3300049575 Ga0501039_0000123 Ga0501039_0000123_52498_53106 200
653 3300049579 Ga0501043_0002344 Ga0501043_0002344_4520_5128 200
654 3300049579 Ga0501043_0025533 Ga0501043_0025533_1766_2368 200
655 3300049580 Ga0501046_0000434 Ga0501046_0000434_9185_9793 200
656 3300049580 Ga0501046_0084320 Ga0501046_0084320_666_1268 200
657 3300049580 Ga0501046_0369567 Ga0501046_0369567_58_672 200
658 3300049581 Ga0501047_0000131 Ga0501047_0000131_41216_41824 200
659 3300049581 Ga0501047_0777833 Ga0501047_0777833_94_702 200
660 3300049582 Ga0501048_0016159 Ga0501048_0016159_335_943 200
661 3300049583 Ga0501067_0000628 Ga0501067_0000628_8004_8612 200
662 3300049583 Ga0501067_0260860 Ga0501067_0260860_62_664 200
663 3300049584 Ga0501068_0000080 Ga0501068_0000080_32750_33358 200
664 3300049584 Ga0501068_0285192 Ga0501068_0285192_435_1037 200
665 3300049585 Ga0501069_0003537 Ga0501069_0003537_6221_6829 200
666 3300049586 Ga0501070_0005971 Ga0501070_0005971_353_961 200
667 3300049586 Ga0501070_0264699 Ga0501070_0264699_50_664 200
668 3300049586 Ga0501070_0351724 Ga0501070_0351724_368_970 200
669 3300049586 Ga0501070_0671273 Ga0501070_0671273_105_746 200
670 3300049587 Ga0501071_0172399 Ga0501071_0172399_984_1586 200
671 3300049588 Ga0501072_0000378 Ga0501072_0000378_19296_19904 200
672 3300049589 Ga0501073_0000062 Ga0501073_0000062_60004_60612 200
673 3300049590 Ga0501074_0003814 Ga0501074_0003814_2779_3387 200
674 3300049741 Ga0501079_0001399 Ga0501079_0001399_7713_8321 200
675 3300049742 Ga0501080_0009398 Ga0501080_0009398_131_739 200
676 3300049744 Ga0501083_0000341 Ga0501083_0000341_26573_27181 200
677 3300049822 Ga0501035_0000123 Ga0501035_0000123_74664_75272 200
678 3300049822 Ga0501035_0268205 Ga0501035_0268205_379_981 200
679 3300049823 Ga0501044_0000100 Ga0501044_0000100_74978_75586 200
680 3300049823 Ga0501044_0093934 Ga0501044_0093934_975_1577 200
681 3300049824 Ga0501045_0033294 Ga0501045_0033294_1619_2227 200
682 3300050490 nmdc:mga03n38_50653_c1 nmdc:mga03n38_50653_c1_467_1069 200
683 3300050491 nmdc:mga00v17_146280_c1 nmdc:mga00v17_146280_c1_48_650 200
684 3300050492 nmdc:mga0yw44_320719_c1 nmdc:mga0yw44_320719_c1_78_680 200
685 3300050493 nmdc:mga0k408_135533_c1 nmdc:mga0k408_135533_c1_848_1450 200
686 3300050493 nmdc:mga0k408_65144_c1 nmdc:mga0k408_65144_c1_23_625 200
687 3300050494 nmdc:mga06z11_1933_c1 nmdc:mga06z11_1933_c1_6834_7475 200
688 3300050494 nmdc:mga06z11_95515_c1 nmdc:mga06z11_95515_c1_27_629 200
689 3300050496 nmdc:mga07m45_26620_c1 nmdc:mga07m45_26620_c1_1162_1764 200
690 3300050516 nmdc:mga0sz30_137670_c1 nmdc:mga0sz30_137670_c1_450_1052 200
691 3300053088 Ga0500644_0208111 Ga0500644_0208111_188_790 200
692 3300053089 Ga0500581_017345 Ga0500581_017345_1771_2373 200
693 3300053090 Ga0500646_0011859 Ga0500646_0011859_957_1559 200
694 3300053093 Ga0500651_0005151 Ga0500651_0005151_5606_6208 200
695 3300053093 Ga0500651_0060867 Ga0500651_0060867_1460_2062 200
696 3300053094 Ga0500566_0000055 Ga0500566_0000055_39401_40003 200
697 3300053094 Ga0500566_0009687 Ga0500566_0009687_3632_4246 200
698 3300053094 Ga0500566_0258279 Ga0500566_0258279_196_798 200
699 3300053095 Ga0500640_055730 Ga0500640_055730_281_907 200
700 3300053096 Ga0500641_0037674 Ga0500641_0037674_382_984 200
701 3300053096 Ga0500641_0053395 Ga0500641_0053395_895_1497 200
702 3300053096 Ga0500641_0054122 Ga0500641_0054122_565_1227 200
703 3300053102 Ga0500554_003107 Ga0500554_003107_2006_2620 200
704 3300053104 Ga0500556_0000006 Ga0500556_0000006_218139_218840 200
705 3300053109 Ga0500569_014566 Ga0500569_014566_191_793 200
706 3300053109 Ga0500569_029003 Ga0500569_029003_656_1258 200
707 3300053116 Ga0500592_001901 Ga0500592_001901_1796_2398 200
708 3300053118 Ga0500594_0002190 Ga0500594_0002190_81_683 200
709 3300053118 Ga0500594_0019380 Ga0500594_0019380_471_1073 200
710 3300053119 Ga0500595_002686 Ga0500595_002686_7366_7980 200
711 3300053119 Ga0500595_022569 Ga0500595_022569_368_970 200
712 3300053122 Ga0500608_000604 Ga0500608_000604_11700_12302 200
713 3300053126 Ga0500621_097013 Ga0500621_097013_186_788 200
714 3300053130 Ga0500642_0000004 Ga0500642_0000004_264518_265120 200
715 3300053130 Ga0500642_0074059 Ga0500642_0074059_543_1169 200
716 3300053131 Ga0500652_000294 Ga0500652_000294_4161_4763 200
717 3300053133 Ga0500655_013714 Ga0500655_013714_34_651 200
718 3300053133 Ga0500655_020799 Ga0500655_020799_278_895 200
719 3300053134 Ga0500658_0133942 Ga0500658_0133942_463_1065 200
720 3300053134 Ga0500658_0169034 Ga0500658_0169034_43_645 200
721 3300053136 Ga0500559_0108750 Ga0500559_0108750_373_987 200
722 3300053136 Ga0500559_0176928 Ga0500559_0176928_107_709 200
723 3300053136 Ga0500559_0177906 Ga0500559_0177906_224_829 200
724 3300053142 Ga0500577_0000231 Ga0500577_0000231_14085_14687 200
725 3300053142 Ga0500577_0029729 Ga0500577_0029729_1144_1746 200
726 3300053142 Ga0500577_0177281 Ga0500577_0177281_284_886 200
727 3300053145 Ga0500586_001899 Ga0500586_001899_2235_2837 200
728 3300053146 Ga0500588_0112784 Ga0500588_0112784_71_688 200
729 3300053147 Ga0500589_163581 Ga0500589_163581_145_747 200
730 3300053148 Ga0500590_029568 Ga0500590_029568_1038_1640 200
731 3300053153 Ga0500616_0000022 Ga0500616_0000022_216556_217158 200
732 3300053158 Ga0500627_0024687 Ga0500627_0024687_99_761 200
733 3300053160 Ga0500633_0053286 Ga0500633_0053286_518_1120 200
734 3300053161 Ga0500634_0088705 Ga0500634_0088705_340_942 200
735 3300053161 Ga0500634_0187453 Ga0500634_0187453_159_761 200
736 3300053162 Ga0500638_000160 Ga0500638_000160_1140_1754 200
737 3300053162 Ga0500638_078954 Ga0500638_078954_840_1442 200
738 3300053177 Ga0500636_0001777 Ga0500636_0001777_960_1562 200
739 3300053177 Ga0500636_0063338 Ga0500636_0063338_796_1413 200
740 3300053177 Ga0500636_0185513 Ga0500636_0185513_393_1007 200
741 3300053178 Ga0500637_0000180 Ga0500637_0000180_16029_16643 200
742 3300053727 Ga0500611_067017 Ga0500611_067017_18_620 200
743 3300053730 Ga0500645_081552 Ga0500645_081552_270_872 200
744 3300054114 Ga0501084_0033906 Ga0501084_0033906_1723_2331 200
745 3300055283 Ga0500661_001366 Ga0500661_001366_834_1448 200
746 3300055283 Ga0500661_009115 Ga0500661_009115_296_922 200
747 3300060353 Ga0501082_0039442 Ga0501082_0039442_2053_2661 200
748 iso_pu_bacteria 2824661429 2824670002 200
749 iso_pu_bacteria 2888419890 2888420137 200
750 iso_pu_bacteria 2932784394 2932790951 200
751 iso_pu_bacteria 2932828146 2932833667 200
752 iso_pu_bacteria 2935616580 2935623193 200
753 iso_pu_bacteria 2935638405 2935644268 200
754 iso_pu_bacteria 2935665750 2935672150 200
755 iso_pu_bacteria 2935675223 2935679329 200
756 iso_pu_bacteria 2935684952 2935686571 200
757 iso_pu_bacteria 2935694250 2935700353 200
758 iso_pu_bacteria 2935703347 2935710301 200
759 iso_pu_bacteria 2935713505 2935716259 200
760 iso_pu_bacteria 2935722832 2935723617 200
761 iso_pu_bacteria 2935732158 2935735172 200
762 iso_pu_bacteria 2935741537 2935744037 200
763 iso_pu_bacteria 2935750917 2935752537 200
764 iso_pu_bacteria 2935801545 2935808292 200
765 iso_pu_bacteria 2935827899 2935833488 200
766 iso_pu_bacteria 2935855204 2935861441 200
767 iso_pu_bacteria 2935864058 2935869560 200
768 iso_pu_bacteria 2935873716 2935879889 200
769 iso_pu_bacteria 2935992306 2935997888 200
770 iso_pu_bacteria 2936002035 2936008847 200
771 iso_pu_bacteria 2940556831 2940558450 200
772 iso_pu_bacteria 2941531003 2941535357 200
773 iso_pu_bacteria 8016511872 8016518007 200
774 iso_pu_bacteria 8017057580 8017058635 200
775 iso_pu_bacteria 8019586578 8019595091 200
776 iso_pu_bacteria 8019597564 8019606650 200
777 iso_pu_bacteria 8019608314 8019611861 200
778 iso_pu_bacteria 8019648815 8019652297 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

183

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.8916 3 185
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.8902 1 186
7f04-assembly1.cif.gz_A cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. 0.8897 3 197
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8888 1 184
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.888 3 197
ID Description Score Start End Superfamily
af_A0A1D6DXP2_296_452_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9489 72 189 3.40.50.300
af_A0A096TX75_2_202_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9255 3 194 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9223 2 61 3.40.50.300
af_Q2FVB4_1_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9159 1 184 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9149 3 185 3.40.50.300
ID Description Score Start End GO Terms
AF-H0SMG6-F1-model_v4 Heme ABC transporter (Heme exporter protein A), ATP-binding protein (Cytochrome c-type biogenesis) (EC 3.6.3.41) 0.981 18 197 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A4Q3FFN0-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9736 2 197 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-H0SMG6-F1-model_v4 Heme ABC transporter (Heme exporter protein A), ATP-binding protein (Cytochrome c-type biogenesis) (EC 3.6.3.41) 0.9599 18 197 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A4V3DAE4-F1-model_v4 Heme exporter protein A 0.9516 2 196 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-V5SBK6-F1-model_v4 Cytochrome C biogenesis protein 0.9505 2 197 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004

Feature Viewer

pLDDT pTM Quality
93.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map