F480391

General Info

Members Datasets Scaffolds Average Seq Length
777 504 481 447

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2516143018|2516206331
Length 490
Sequence PWEVCQRGPTQAQPPPSRRGPHRKTFAKADSMESPIALNRLAENNVFRKGDVFVLFGELFGRGYATGLVEEARRAGMEIVGITVGRRDENNALRPLNAEELSAAEARLGGRIINIPLMAGFDLDAPAGGPTPTDLLATMTLESWQHDRLDWDYIGLCRDIATARFTNSLSQVMAVLDGMIADGRNVFFAHTMAGGIPKAKVFLVVANRIYKGVGPRHMSSQTLIDSDMGKLILQNFDEVSAITFRHLIDFSAAIRERVEASGGQVRYTAYGYHGTAILIDGSYRWQTYTNYTQGYAKMRXEGIAEDAWAAGVKATVYNCPEIRTNSSDVFTGIELPLIPLLLALRKENGGQWAEEQWRDCQQLLADGFTMKDVFQKITDMQANEVMHPFYDFSAWPMANSQAQADLTIGTSIEITQMHRDSKAMISDLLSALVVEATGQLIFGASSDPXGPIRWLNHDIVARRLNASHLQRESPAPLIAQGAKASHLEMA

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
13 2516143018 Ensifer sp. BR816 Isolate Nodule
14 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
15 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
16 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
17 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
18 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
19 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
20 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
21 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
22 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
23 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
24 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
25 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
26 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
27 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
28 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
29 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
30 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
31 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
32 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
33 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
34 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
35 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
36 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
37 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
38 2643221556 Massilia sp. Root1485 Isolate Unclassified
39 2643221557 Ensifer sp. Root558 Isolate Unclassified
40 2643221568 Rhizobium sp. Root564 Isolate Unclassified
41 2643221582 Rhizobium sp. Root651 Isolate Unclassified
42 2643221610 Ensifer sp. Root74 Isolate Unclassified
43 2643221618 Ensifer sp. Root231 Isolate Unclassified
44 2643221626 Ensifer sp. Root31 Isolate Unclassified
45 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
46 2643221655 Ensifer sp. Root1252 Isolate Unclassified
47 2643221659 Ensifer sp. Root127 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221675 Ensifer sp. Root1298 Isolate Unclassified
50 2643221680 Ensifer sp. Root1312 Isolate Unclassified
51 2643221684 Massilia sp. Root133 Isolate Unclassified
52 2643221688 Rhizobium sp. Root482 Isolate Unclassified
53 2643221693 Rhizobium sp. Root491 Isolate Unclassified
54 2643221698 Ensifer sp. Root142 Isolate Unclassified
55 2643221712 Ensifer sp. Root258 Isolate Unclassified
56 2643221719 Rhizobium sp. Root274 Isolate Unclassified
57 2643221723 Ensifer sp. Root278 Isolate Unclassified
58 2643221726 Ensifer sp. Root954 Isolate Unclassified
59 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
60 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
61 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
62 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
63 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
64 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
65 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
66 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
67 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
68 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
69 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
70 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
71 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
72 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
73 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
74 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
75 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
76 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
77 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
78 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
79 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
80 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
81 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
82 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
83 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
84 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
85 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
86 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
87 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
88 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
89 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
90 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
91 2844163670 Ensifer sp. 1H6 Isolate Unclassified
92 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
93 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
94 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
95 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
96 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
97 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
98 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
99 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
100 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
101 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
102 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
103 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
104 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
105 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
106 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
107 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
108 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
109 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
110 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
111 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
112 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
113 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
114 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
115 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
116 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
117 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
118 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
119 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
120 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
121 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
122 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
123 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
124 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
125 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
126 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
127 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
128 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
129 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
130 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
131 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
132 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
133 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
134 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
135 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
136 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
137 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
138 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
139 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
140 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
141 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
142 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
143 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
144 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
145 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
146 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
147 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
148 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
149 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
150 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
151 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
152 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
153 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
154 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
155 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
156 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
157 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
158 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
159 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
160 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
161 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
162 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
163 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
164 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
165 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
166 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
167 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
168 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
169 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
170 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
171 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
172 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
173 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
174 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
175 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
176 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
177 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
178 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
179 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
180 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
181 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
182 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
183 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
184 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
185 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
186 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
187 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
188 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
189 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
190 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
191 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
192 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
193 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
194 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
195 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
196 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
197 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
198 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
199 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
200 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
201 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
202 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
203 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
204 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
205 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
206 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
207 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
208 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
209 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
210 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
211 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
212 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
213 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
214 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
215 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
216 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
217 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
218 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
219 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
220 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
221 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
222 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
223 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
224 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
225 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
226 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
227 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
228 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
229 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
230 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
231 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
232 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
233 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
234 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
235 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
236 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
237 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
238 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
239 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
240 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
241 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
242 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
243 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
244 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
245 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
246 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
247 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
248 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
249 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
250 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
251 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
252 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
253 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
254 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
255 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
256 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
257 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
258 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
259 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
260 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
261 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
262 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
263 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
264 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
265 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
266 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
267 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
268 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
269 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
270 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
271 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
272 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
273 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
274 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
275 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
276 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
277 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
278 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
279 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
280 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
281 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
282 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
283 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
284 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
285 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
286 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
287 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
288 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
289 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
290 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
291 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
292 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
293 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
294 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
295 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
296 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
297 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
298 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
299 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
300 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
301 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
302 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
303 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
304 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
305 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
306 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
307 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
308 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
309 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
313 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
314 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
315 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
316 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
317 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
318 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
319 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
320 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
321 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
324 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
326 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
330 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
340 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
342 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
343 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
344 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
345 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
346 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
347 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
348 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
349 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
350 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
351 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
352 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
353 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
354 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
355 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
356 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
357 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
358 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
359 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
360 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
361 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
362 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
363 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
364 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
365 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
366 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
367 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
368 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
369 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
370 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
371 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
372 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
373 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
374 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
375 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
376 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
377 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
378 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
379 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
380 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
381 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
382 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
383 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
384 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
385 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
386 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
387 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
388 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
389 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
390 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
391 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
392 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
393 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
394 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
395 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
396 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
397 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
398 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
399 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
400 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
404 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
405 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
406 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
407 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
408 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
409 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
410 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
411 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
412 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
413 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
414 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
415 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
416 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
417 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
424 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
425 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
426 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
427 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
428 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
429 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
430 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
431 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
432 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
433 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
434 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
435 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
436 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
437 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
438 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
439 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
440 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
441 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
442 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
443 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
444 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
445 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
446 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
447 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
448 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
449 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
450 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
451 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
452 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
453 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
456 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
457 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
458 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
459 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
460 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
461 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
462 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
463 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
464 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
465 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
466 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
467 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
468 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
469 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
470 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
471 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
472 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
473 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
474 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
476 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
477 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
479 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
480 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
485 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
486 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
487 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
490 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
491 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
492 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
493 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
494 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
495 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
496 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
497 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
498 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
499 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
500 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
501 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
502 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
503 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
504 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 61.78
Metatranscriptomes 0.13
Isolates 38.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 6.56
Nodule 29.47
Rhizoplane 2.83
Rhizosphere 48.91
Stem 0
Stem Tuber 0
Unclassified 11.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000024 3300002987 Bacteria 116245
2 rootL2_10028561 3300003322 Bacteria 2520
3 rootL2_10092725 3300003322 Bacteria 1889
4 rootH1_10280334 3300003323 Bacteria 3028
5 JGI25160J50197_1000063 3300003354 Bacteria 116245
6 JGI25161J50226_1000358 3300003374 Bacteria 23639
7 Ga0055525_1000001 3300003759 Bacteria 1016948
8 Ga0055526_1003144 3300003771 Bacteria 10697
9 Ga0055543_1000197 3300004625 Bacteria 49269
10 Ga0065165_1000163 3300005262 Bacteria 116283
11 Ga0065165_1003015 3300005262 Bacteria 12716
12 Ga0070670_100000147 3300005331 Bacteria 65190
13 Ga0068869_100156676 3300005334 Bacteria 1770
14 Ga0070661_100019074 3300005344 Bacteria 4883
15 Ga0070665_100004381 3300005548 Bacteria 14846
16 Ga0070664_100025699 3300005564 Bacteria 4883
17 Ga0075365_10115171 3300006038 Unclassified 1850
18 Ga0075368_10002071 3300006042 Bacteria 6482
19 Ga0075363_100003862 3300006048 Bacteria 6462
20 Ga0075364_10000015 3300006051 Bacteria 57651
21 Ga0075364_10096877 3300006051 Bacteria 1962
22 Ga0075369_10010085 3300006186 Bacteria 3690
23 Ga0075366_10074424 3300006195 Bacteria 2025
24 Ga0075370_10005086 3300006353 Bacteria 6482
25 Ga0068865_100111980 3300006881 Bacteria 2015
26 Ga0079104_1000063 3300006946 Bacteria 159519
27 Ga0099826_10000042 3300006948 Bacteria 92895
28 Ga0099826_10016476 3300006948 Bacteria 5582
29 Ga0105244_10079072 3300009036 Bacteria 1630
30 Ga0105250_10040531 3300009092 Bacteria 1868
31 Ga0105241_10078393 3300009174 Bacteria 2581
32 Ga0105237_10132619 3300009545 Bacteria 2486
33 Ga0157373_10007223 3300013100 Bacteria 8284
34 Ga0157373_10095013 3300013100 Bacteria 2098
35 Ga0157371_10000078 3300013102 Bacteria 154095
36 Ga0157371_10000295 3300013102 Bacteria 66319
37 Ga0157369_10017861 3300013105 Bacteria 7962
38 Ga0171463_1005 3300013249 Bacteria 358236
39 Ga0182006_1000010 3300015261 Bacteria 413414
40 Ga0182007_10000030 3300015262 Bacteria 156866
41 Ga0182005_1000009 3300015265 Bacteria 455334
42 Ga0183363_1026 3300015690 Bacteria 53052
43 Ga0228711_1005616 3300022739 Bacteria 19035
44 Ga0228710_1003183 3300022740 Bacteria 26184
45 Ga0209436_100188 3300025208 Bacteria 28869
46 Ga0209563_100007 3300025230 Bacteria 1579402
47 Ga0209563_105479 3300025230 Bacteria 2294
48 Ga0209148_1000360 3300025254 Bacteria 57908
49 Ga0209130_1000138 3300025284 Bacteria 116297
50 Ga0209676_1017779 3300025292 Bacteria 2503
51 Ga0209025_1000602 3300025294 Bacteria 64825
52 Ga0209564_1000250 3300025295 Bacteria 114790
53 Ga0209050_1006059 3300025298 Bacteria 7318
54 Ga0209256_1000623 3300025299 Bacteria 48795
55 Ga0207426_1000255 3300025302 Bacteria 116297
56 Ga0209257_1009054 3300025304 Bacteria 5449
57 Ga0209257_1019456 3300025304 Bacteria 2556
58 Ga0207705_10009135 3300025909 Bacteria 7226
59 Ga0207654_10017823 3300025911 Bacteria 3720
60 Ga0207657_10016079 3300025919 Bacteria 7222
61 Ga0207650_10000958 3300025925 Bacteria 21723
62 Ga0207706_10070925 3300025933 Bacteria 3064
63 Ga0207709_10014320 3300025935 Bacteria 4378
64 Ga0207709_10071287 3300025935 Bacteria 2206
65 Ga0207689_10214942 3300025942 Bacteria 1589
66 Ga0207667_10047456 3300025949 Bacteria 4546
67 Ga0209281_1000110 3300027111 Bacteria 215631
68 Ga0209281_1000640 3300027111 Bacteria 38244
69 Ga0209281_1000934 3300027111 Bacteria 24031
70 Ga0209371_1000003 3300027312 Bacteria 1122971
71 Ga0209282_1000049 3300027666 Bacteria 109875
72 Ga0209282_1000065 3300027666 Bacteria 91676
73 Ga0209813_10011799 3300027866 Bacteria 2293
74 Ga0307515_10007595 3300028794 Bacteria 21407
75 Ga0265324_10000002 3300029957 Bacteria 382754
76 Ga0265324_10011442 3300029957 Bacteria 3380
77 Ga0265324_10029404 3300029957 Bacteria 1932
78 Ga0268256_1000004 3300030500 Bacteria 1122967
79 Ga0316177_1061589 3300030731 Bacteria 3499
80 Ga0316180_1070198 3300030736 Bacteria 7367
81 Ga0316181_1099231 3300030744 Bacteria 4075
82 Ga0265330_10014461 3300031235 Bacteria 3662
83 Ga0265332_10000083 3300031238 Bacteria 83040
84 Ga0265325_10002420 3300031241 Bacteria 12605
85 Ga0265331_10001280 3300031250 Bacteria 18739
86 Ga0265331_10036760 3300031250 Bacteria 2402
87 Ga0265327_10000308 3300031251 Bacteria 94808
88 Ga0265327_10027045 3300031251 Bacteria 3309
89 Ga0307513_10008185 3300031456 Bacteria 13407
90 Ga0316575_10000193 3300031665 Bacteria 16106
91 Ga0265314_10012713 3300031711 Bacteria 6843
92 Ga0265314_10041955 3300031711 Bacteria 3269
93 Ga0307410_10183478 3300031852 Bacteria 1586
94 Ga0315914_1000005 3300031967 Bacteria 242195
95 Ga0315913_1001476 3300033430 Bacteria 26019
96 Ga0315915_1000004 3300033464 Bacteria 403083
97 Ga0395899_0091948 3300037312 Bacteria 2197
98 Ga0395899_0163293 3300037312 Bacteria 1572
99 Ga0395900_0000393 3300037418 Bacteria 63296
100 Ga0395900_0004592 3300037418 Bacteria 14575
101 Ga0395900_0022206 3300037418 Bacteria 6491
102 Ga0395900_0179936 3300037418 Bacteria 2149
103 Ga0395898_0123255 3300037466 Bacteria 2483
104 Ga0395905_0081853 3300037471 Bacteria 3025
105 Ga0395905_0272155 3300037471 Bacteria 1579
106 Ga0395901_0000054 3300038443 Bacteria 160505
107 Ga0395901_0044933 3300038443 Bacteria 4582
108 Ga0395901_0117491 3300038443 Bacteria 2794
109 Ga0395901_0311696 3300038443 Bacteria 1629
110 Ga0439433_0021500 3300041999 Bacteria 1444
111 Ga0439448_0000525 3300042005 Bacteria 8907
112 Ga0439449_0019438 3300042007 Bacteria 2546
113 Ga0450904_000737 3300042139 Bacteria 5692
114 Ga0451577_0000002 3300042876 Bacteria 1731375
115 Ga0451577_0000186 3300042876 Bacteria 131630
116 Ga0451577_0004547 3300042876 Bacteria 14597
117 Ga0451577_0009735 3300042876 Bacteria 9215
118 Ga0453683_0000003 3300044673 Bacteria 942572
119 Ga0466965_0033102 3300044683 Bacteria 2525
120 Ga0466966_0050421 3300044684 Bacteria 2647
121 Ga0466964_0000091 3300044706 Bacteria 21332
122 Ga0466964_0001048 3300044706 Bacteria 9221
123 Ga0453684_0000002 3300044712 Bacteria 1731375
124 Ga0453684_0000121 3300044712 Bacteria 341067
125 Ga0453684_0000671 3300044712 Bacteria 122605
126 Ga0453684_0094025 3300044712 Bacteria 3690
127 Ga0453684_0106376 3300044712 Bacteria 3419
128 Ga0466968_0000777 3300044735 Bacteria 11090
129 Ga0466957_0000064 3300044842 Bacteria 40442
130 Ga0451576_0000004 3300045051 Bacteria 1312238
131 Ga0451576_0000029 3300045051 Bacteria 404449
132 Ga0451576_0001359 3300045051 Bacteria 42151
133 Ga0451576_0001448 3300045051 Bacteria 40341
134 Ga0451576_0002532 3300045051 Bacteria 27073
135 Ga0466967_0046796 3300045976 Bacteria 3768
136 Ga0495617_000057 3300046452 Bacteria 100673
137 Ga0495627_001004 3300046453 Bacteria 18981
138 Ga0495627_006353 3300046453 Bacteria 4639
139 Ga0495590_0000018 3300046457 Bacteria 216375
140 Ga0495590_0000251 3300046457 Bacteria 29217
141 Ga0495591_009423 3300046458 Bacteria 3886
142 Ga0495629_0012542 3300046459 Bacteria 6137
143 Ga0495638_0002966 3300046460 Bacteria 13544
144 Ga0495653_0017058 3300046463 Bacteria 5907
145 Ga0495653_0022552 3300046463 Bacteria 5092
146 Ga0495653_0047458 3300046463 Bacteria 3321
147 Ga0495650_0000108 3300046471 Bacteria 200369
148 Ga0495650_0000140 3300046471 Bacteria 169317
149 Ga0495580_0012103 3300046472 Bacteria 6639
150 Ga0495582_0003828 3300046473 Bacteria 8471
151 Ga0495582_0029620 3300046473 Bacteria 3004
152 Ga0495605_0001736 3300046474 Bacteria 13967
153 Ga0495605_0004622 3300046474 Bacteria 8049
154 Ga0495605_0010846 3300046474 Bacteria 5089
155 Ga0495605_0024015 3300046474 Bacteria 3195
156 Ga0495605_0026784 3300046474 Bacteria 2993
157 Ga0495605_0033370 3300046474 Bacteria 2612
158 Ga0495605_0045798 3300046474 Bacteria 2153
159 Ga0495584_0000006 3300046491 Bacteria 301775
160 Ga0495584_0001835 3300046491 Bacteria 12335
161 Ga0495584_0001841 3300046491 Bacteria 12302
162 Ga0495584_0002247 3300046491 Bacteria 11024
163 Ga0495584_0003129 3300046491 Bacteria 9193
164 Ga0495584_0013323 3300046491 Bacteria 4198
165 Ga0495584_0015640 3300046491 Bacteria 3869
166 Ga0495585_0000282 3300046492 Bacteria 50936
167 Ga0495585_0000926 3300046492 Bacteria 24849
168 Ga0495585_0003548 3300046492 Bacteria 10477
169 Ga0495585_0004128 3300046492 Bacteria 9503
170 Ga0495585_0015998 3300046492 Bacteria 4349
171 Ga0495585_0016685 3300046492 Bacteria 4254
172 Ga0495585_0019085 3300046492 Bacteria 3956
173 Ga0495585_0022737 3300046492 Bacteria 3599
174 Ga0495585_0026321 3300046492 Bacteria 3322
175 Ga0495585_0030642 3300046492 Bacteria 3058
176 Ga0495585_0070315 3300046492 Bacteria 1909
177 Ga0495594_0012257 3300046499 Bacteria 4464
178 Ga0495594_0014904 3300046499 Bacteria 4080
179 Ga0495594_0027573 3300046499 Bacteria 3061
180 Ga0495594_0065339 3300046499 Bacteria 2018
181 Ga0495594_0068029 3300046499 Bacteria 1977
182 Ga0495596_0000236 3300046500 Bacteria 37630
183 Ga0495596_0001429 3300046500 Bacteria 13705
184 Ga0495596_0003685 3300046500 Bacteria 7661
185 Ga0495596_0004853 3300046500 Bacteria 6459
186 Ga0495596_0004975 3300046500 Bacteria 6367
187 Ga0495596_0005735 3300046500 Bacteria 5828
188 Ga0495596_0008161 3300046500 Bacteria 4675
189 Ga0495607_0002952 3300046501 Bacteria 13366
190 Ga0495607_0003634 3300046501 Bacteria 11712
191 Ga0495607_0012015 3300046501 Bacteria 5730
192 Ga0495607_0018606 3300046501 Bacteria 4426
193 Ga0495607_0023386 3300046501 Bacteria 3869
194 Ga0495607_0040184 3300046501 Bacteria 2787
195 Ga0495607_0086821 3300046501 Bacteria 1704
196 Ga0495583_0000525 3300046506 Bacteria 54370
197 Ga0495583_0000608 3300046506 Bacteria 48449
198 Ga0495583_0001445 3300046506 Bacteria 24126
199 Ga0495583_0002759 3300046506 Bacteria 14503
200 Ga0495583_0004051 3300046506 Bacteria 10773
201 Ga0495583_0004346 3300046506 Bacteria 10215
202 Ga0495583_0021769 3300046506 Bacteria 3289
203 Ga0495583_0026390 3300046506 Bacteria 2881
204 Ga0495583_0034605 3300046506 Bacteria 2418
205 Ga0495606_0008706 3300046507 Bacteria 8739
206 Ga0495606_0020392 3300046507 Bacteria 4889
207 Ga0495606_0027660 3300046507 Bacteria 4015
208 Ga0495606_0060853 3300046507 Bacteria 2417
209 Ga0495610_0001162 3300046512 Bacteria 23954
210 Ga0495616_0000343 3300046513 Bacteria 36983
211 Ga0495616_0000680 3300046513 Bacteria 25142
212 Ga0495616_0001661 3300046513 Bacteria 15228
213 Ga0495616_0002034 3300046513 Bacteria 13597
214 Ga0495616_0004092 3300046513 Bacteria 9255
215 Ga0495616_0007916 3300046513 Bacteria 6335
216 Ga0495616_0008070 3300046513 Bacteria 6269
217 Ga0495616_0021589 3300046513 Bacteria 3482
218 Ga0495616_0029476 3300046513 Bacteria 2897
219 Ga0495616_0034327 3300046513 Bacteria 2635
220 Ga0495616_0097257 3300046513 Bacteria 1385
221 Ga0495620_0007596 3300046515 Bacteria 5874
222 Ga0495631_0001685 3300046518 Bacteria 13139
223 Ga0495631_0002105 3300046518 Bacteria 11552
224 Ga0495631_0010589 3300046518 Bacteria 4560
225 Ga0495631_0012359 3300046518 Bacteria 4172
226 Ga0495631_0014148 3300046518 Bacteria 3856
227 Ga0495631_0014540 3300046518 Bacteria 3795
228 Ga0495631_0038282 3300046518 Bacteria 2132
229 Ga0495631_0053968 3300046518 Bacteria 1753
230 Ga0495632_0000062 3300046519 Bacteria 118205
231 Ga0495632_0000235 3300046519 Bacteria 55317
232 Ga0495632_0000901 3300046519 Bacteria 26017
233 Ga0495632_0002631 3300046519 Bacteria 13521
234 Ga0495632_0003209 3300046519 Bacteria 11766
235 Ga0495637_0000004 3300046520 Bacteria 589740
236 Ga0495643_0000648 3300046522 Bacteria 41187
237 Ga0495643_0009797 3300046522 Bacteria 5927
238 Ga0495643_0022182 3300046522 Bacteria 3627
239 Ga0495643_0025078 3300046522 Bacteria 3377
240 Ga0495643_0028822 3300046522 Bacteria 3109
241 Ga0495643_0037842 3300046522 Bacteria 2644
242 Ga0495644_0003759 3300046523 Bacteria 5974
243 Ga0495644_0010904 3300046523 Bacteria 3502
244 Ga0495644_0015469 3300046523 Bacteria 2921
245 Ga0495648_0000109 3300046524 Bacteria 101519
246 Ga0495648_0002349 3300046524 Bacteria 17563
247 Ga0495648_0003866 3300046524 Bacteria 12989
248 Ga0495648_0028952 3300046524 Bacteria 3682
249 Ga0495648_0030560 3300046524 Bacteria 3559
250 Ga0495648_0081248 3300046524 Bacteria 1844
251 Ga0495663_0003044 3300046525 Bacteria 4911
252 Ga0495666_0012630 3300046526 Bacteria 4209
253 Ga0495666_0019304 3300046526 Bacteria 3384
254 Ga0495666_0027785 3300046526 Bacteria 2785
255 Ga0495642_0000196 3300046528 Bacteria 35510
256 Ga0495642_0007659 3300046528 Bacteria 4138
257 Ga0495642_0018362 3300046528 Bacteria 2737
258 Ga0495642_0022002 3300046528 Bacteria 2509
259 Ga0495642_0116420 3300046528 Bacteria 1145
260 Ga0495652_0034667 3300046529 Bacteria 4398
261 Ga0495654_0007827 3300046530 Bacteria 5941
262 Ga0495654_0031073 3300046530 Bacteria 2712
263 Ga0495665_0016501 3300046531 Bacteria 3978
264 Ga0495665_0034983 3300046531 Bacteria 2685
265 Ga0495586_0002686 3300046535 Bacteria 9618
266 Ga0495586_0007801 3300046535 Bacteria 5706
267 Ga0495586_0023565 3300046535 Bacteria 3288
268 Ga0495587_0014029 3300046536 Bacteria 5030
269 Ga0495609_0000009 3300046538 Bacteria 354860
270 Ga0495609_0002695 3300046538 Bacteria 10719
271 Ga0495609_0003510 3300046538 Bacteria 8955
272 Ga0495609_0010793 3300046538 Bacteria 4369
273 Ga0495609_0013432 3300046538 Bacteria 3866
274 Ga0495597_0001393 3300046542 Bacteria 17466
275 Ga0495597_0001796 3300046542 Bacteria 14723
276 Ga0495597_0003920 3300046542 Bacteria 8402
277 Ga0495597_0009770 3300046542 Bacteria 4723
278 Ga0495597_0016794 3300046542 Bacteria 3453
279 Ga0495645_0074946 3300046543 Bacteria 2436
280 Ga0495645_0105229 3300046543 Bacteria 2002
281 Ga0495622_0012031 3300046557 Bacteria 4000
282 Ga0495622_0029887 3300046557 Bacteria 2545
283 Ga0495633_0008068 3300046558 Bacteria 5982
284 Ga0495633_0011835 3300046558 Bacteria 4677
285 Ga0495633_0014994 3300046558 Bacteria 4028
286 Ga0495633_0034597 3300046558 Bacteria 2429
287 Ga0495656_0004998 3300046615 Bacteria 4568
288 Ga0495668_0000805 3300046616 Bacteria 36034
289 Ga0495668_0002455 3300046616 Bacteria 15251
290 Ga0495668_0002669 3300046616 Bacteria 14315
291 Ga0495668_0010820 3300046616 Bacteria 5500
292 Ga0495668_0031535 3300046616 Bacteria 2986
293 Ga0495668_0045336 3300046616 Bacteria 2444
294 Ga0495668_0055741 3300046616 Bacteria 2182
295 Ga0495634_0033244 3300046642 Bacteria 3544
296 Ga0495611_0000861 3300046648 Bacteria 16634
297 Ga0495611_0011073 3300046648 Bacteria 3819
298 Ga0495611_0014360 3300046648 Bacteria 3382
299 Ga0495625_0009819 3300046660 Bacteria 7965
300 Ga0495625_0027108 3300046660 Bacteria 4319
301 Ga0495625_0045996 3300046660 Bacteria 3151
302 Ga0495625_0080676 3300046660 Bacteria 2265
303 Ga0495625_0131297 3300046660 Bacteria 1696
304 Ga0495661_0000368 3300046665 Bacteria 48926
305 Ga0495661_0001167 3300046665 Bacteria 22911
306 Ga0495661_0002320 3300046665 Bacteria 14679
307 Ga0495661_0002363 3300046665 Bacteria 14562
308 Ga0495661_0017362 3300046665 Bacteria 4754
309 Ga0495661_0022436 3300046665 Bacteria 4106
310 Ga0495661_0024071 3300046665 Bacteria 3943
311 Ga0495661_0024473 3300046665 Bacteria 3907
312 Ga0495661_0036897 3300046665 Bacteria 3055
313 Ga0495661_0050603 3300046665 Bacteria 2514
314 Ga0495661_0069884 3300046665 Bacteria 2056
315 Ga0495588_0000077 3300046674 Bacteria 215338
316 Ga0495588_0004598 3300046674 Bacteria 6098
317 Ga0495588_0013800 3300046674 Bacteria 3854
318 Ga0495588_0022764 3300046674 Bacteria 3098
319 Ga0495623_0029147 3300046679 Bacteria 3553
320 Ga0495623_0047237 3300046679 Bacteria 2732
321 Ga0495669_0000217 3300046684 Bacteria 34603
322 Ga0495669_0016969 3300046684 Bacteria 3122
323 Ga0495669_0049513 3300046684 Bacteria 1881
324 Ga0495669_0067517 3300046684 Bacteria 1625
325 Ga0495624_0018758 3300046690 Bacteria 4623
326 Ga0495670_0000391 3300046691 Bacteria 20872
327 Ga0495670_0009281 3300046691 Bacteria 4839
328 Ga0495670_0016326 3300046691 Bacteria 3648
329 Ga0495670_0021313 3300046691 Bacteria 3195
330 Ga0495670_0037325 3300046691 Bacteria 2421
331 Ga0495671_0000848 3300046692 Bacteria 21841
332 Ga0495671_0003909 3300046692 Bacteria 9038
333 Ga0495671_0018278 3300046692 Bacteria 3721
334 Ga0495649_0001146 3300046694 Bacteria 20628
335 Ga0495649_0004293 3300046694 Bacteria 9357
336 Ga0495589_0000037 3300046794 Bacteria 150603
337 Ga0495589_0001177 3300046794 Bacteria 15597
338 Ga0495589_0001412 3300046794 Bacteria 13925
339 Ga0495589_0013696 3300046794 Bacteria 4182
340 Ga0495589_0043769 3300046794 Bacteria 2227
341 Ga0495660_0000178 3300046810 Bacteria 68956
342 Ga0495660_0022967 3300046810 Bacteria 3559
343 Ga0495581_0009512 3300047315 Bacteria 5625
344 Ga0495604_0003606 3300047317 Bacteria 12337
345 Ga0495604_0059718 3300047317 Bacteria 2922
346 Ga0495674_0003699 3300047319 Bacteria 14870
347 Ga0495672_0000424 3300047320 Bacteria 50607
348 Ga0495672_0000590 3300047320 Bacteria 41027
349 Ga0495672_0002152 3300047320 Bacteria 18417
350 Ga0495672_0066230 3300047320 Bacteria 2062
351 Ga0495672_0104919 3300047320 Bacteria 1526
352 Ga0495676_0000342 3300047321 Bacteria 38031
353 Ga0495680_0015839 3300047322 Bacteria 6490
354 Ga0495680_0048605 3300047322 Bacteria 3330
355 Ga0495683_0000144 3300047323 Bacteria 69959
356 Ga0495683_0001039 3300047323 Bacteria 19287
357 Ga0495683_0004193 3300047323 Bacteria 8238
358 Ga0495683_0009068 3300047323 Bacteria 5300
359 Ga0495683_0022173 3300047323 Bacteria 3267
360 Ga0495687_000002 3300047443 Bacteria 1085770
361 Ga0495687_000017 3300047443 Bacteria 350429
362 Ga0495687_000024 3300047443 Bacteria 316676
363 Ga0495687_001539 3300047443 Bacteria 20979
364 Ga0495687_010589 3300047443 Bacteria 5047
365 Ga0495675_0008085 3300047444 Bacteria 6511
366 Ga0495677_0000011 3300047445 Bacteria 149837
367 Ga0495677_0001358 3300047445 Bacteria 9771
368 Ga0495677_0001586 3300047445 Bacteria 9165
369 Ga0495677_0002619 3300047445 Bacteria 7039
370 Ga0495677_0010720 3300047445 Bacteria 3358
371 Ga0495679_003113 3300047446 Bacteria 8123
372 Ga0495679_003713 3300047446 Bacteria 7264
373 Ga0495679_011569 3300047446 Bacteria 3398
374 Ga0495685_012525 3300047447 Bacteria 2873
375 Ga0495681_0002294 3300047470 Bacteria 13753
376 Ga0495681_0007392 3300047470 Bacteria 7027
377 Ga0495681_0009181 3300047470 Bacteria 6115
378 Ga0495681_0011982 3300047470 Bacteria 5120
379 Ga0495681_0027321 3300047470 Bacteria 2954
380 Ga0495681_0053496 3300047470 Bacteria 1889
381 Ga0495686_0130207 3300047472 Bacteria 1492
382 Ga0495593_0006706 3300047673 Bacteria 6742
383 Ga0495593_0015080 3300047673 Bacteria 4389
384 Ga0495593_0040184 3300047673 Bacteria 2519
385 Ga0495602_0157696 3300048088 Bacteria 1775
386 Ga0495614_0006251 3300048089 Bacteria 5354
387 Ga0495614_0010600 3300048089 Bacteria 4063
388 Ga0495615_0001140 3300048090 Bacteria 3823
389 Ga0495626_0000004 3300048091 Bacteria 356599
390 Ga0495626_0000016 3300048091 Bacteria 232214
391 Ga0495626_0002550 3300048091 Bacteria 12494
392 Ga0495626_0003138 3300048091 Bacteria 10816
393 Ga0495626_0016542 3300048091 Bacteria 3743
394 Ga0495626_0025701 3300048091 Bacteria 2876
395 Ga0495626_0033369 3300048091 Bacteria 2467
396 Ga0496102_0000340 3300048905 Bacteria 57233
397 Ga0496102_0000461 3300048905 Bacteria 45293
398 Ga0496102_0031308 3300048905 Bacteria 4771
399 Ga0496102_0056486 3300048905 Bacteria 3581
400 Ga0496103_0038605 3300048906 Bacteria 2931
401 Ga0496103_0039131 3300048906 Bacteria 2913
402 Ga0496106_0000336 3300048909 Bacteria 32967
403 Ga0496106_0018536 3300048909 Bacteria 5148
404 Ga0496107_0027743 3300048910 Bacteria 4022
405 Ga0496109_0063011 3300048912 Bacteria 3391
406 Ga0496110_0000019 3300048913 Bacteria 79137
407 Ga0496110_0158452 3300048913 Bacteria 2051
408 Ga0496110_0234656 3300048913 Bacteria 1669
409 Ga0496111_0003186 3300048914 Bacteria 10114
410 Ga0496113_0055353 3300048916 Bacteria 2973
411 Ga0496113_0069951 3300048916 Bacteria 2666
412 Ga0496115_0097165 3300048918 Bacteria 2412
413 Ga0496116_0000042 3300048919 Bacteria 330516
414 Ga0496116_0030397 3300048919 Bacteria 3881
415 Ga0496117_0000010 3300048920 Bacteria 611954
416 Ga0496117_0000033 3300048920 Bacteria 345605
417 Ga0496117_0054884 3300048920 Bacteria 2788
418 Ga0496117_0125634 3300048920 Bacteria 1566
419 Ga0496118_0000009 3300048921 Bacteria 611954
420 Ga0496118_0012983 3300048921 Bacteria 7930
421 Ga0496118_0043993 3300048921 Bacteria 3502
422 Ga0496118_0045925 3300048921 Bacteria 3402
423 Ga0496119_0029172 3300048922 Bacteria 3748
424 Ga0496120_0001142 3300048923 Bacteria 34112
425 Ga0496120_0066610 3300048923 Bacteria 1991
426 Ga0496121_0000001 3300048924 Bacteria 1830318
427 Ga0496121_0004353 3300048924 Bacteria 19143
428 Ga0496121_0145848 3300048924 Bacteria 1749
429 Ga0496122_0000835 3300048925 Bacteria 58311
430 Ga0496122_0002798 3300048925 Bacteria 23968
431 Ga0496122_0004501 3300048925 Bacteria 17220
432 Ga0496122_0050889 3300048925 Bacteria 3154
433 Ga0496122_0052373 3300048925 Bacteria 3090
434 Ga0496123_0000338 3300048926 Bacteria 88635
435 Ga0496123_0001003 3300048926 Bacteria 43216
436 Ga0496123_0004574 3300048926 Bacteria 14422
437 Ga0496124_0000080 3300048927 Bacteria 210439
438 Ga0496124_0002249 3300048927 Bacteria 25656
439 Ga0496124_0008260 3300048927 Bacteria 10916
440 Ga0496124_0061412 3300048927 Bacteria 3150
441 Ga0496124_0072866 3300048927 Bacteria 2843
442 Ga0496124_0114032 3300048927 Bacteria 2171
443 Ga0496124_0167740 3300048927 Bacteria 1704
444 Ga0496125_0000001 3300048928 Bacteria 1766138
445 Ga0496125_0001280 3300048928 Bacteria 37321
446 Ga0496125_0008739 3300048928 Bacteria 10538
447 Ga0496125_0053573 3300048928 Bacteria 3305
448 Ga0496126_0000053 3300048929 Bacteria 311989
449 Ga0496126_0062520 3300048929 Bacteria 3340
450 Ga0496126_0099547 3300048929 Bacteria 2546
451 Ga0501308_000138 3300049128 Bacteria 3699
452 Ga0495678_000515 3300049459 Bacteria 37716
453 Ga0495678_000866 3300049459 Bacteria 26949
454 Ga0495678_002343 3300049459 Bacteria 13026
455 Ga0495678_005217 3300049459 Bacteria 7260
456 Ga0495678_014253 3300049459 Bacteria 3702
457 Ga0495682_0001115 3300049460 Bacteria 15630
458 Ga0501033_0000050 3300049570 Bacteria 111819
459 Ga0501035_0000965 3300049822 Bacteria 30391
460 Ga0501035_0011491 3300049822 Bacteria 8205
461 nmdc:mga00v17_33_c1 3300050491 Bacteria 87180
462 nmdc:mga00v17_81_c1 3300050491 Bacteria 57650
463 nmdc:mga0yw44_57688_c1 3300050492 Unclassified 2369
464 nmdc:mga06z11_2959_c1 3300050494 Bacteria 6544
465 nmdc:mga07m45_5127_c1 3300050496 Bacteria 6489
466 nmdc:mga0sz30_21286_c1 3300050516 Bacteria 2623
467 nmdc:mga0sz30_28667_c1 3300050516 Bacteria 2292
468 nmdc:mga0sz30_3772_c1 3300050516 Bacteria 5458
469 Ga0500560_002138 3300053107 Bacteria 3693
470 Ga0500658_0003054 3300053134 Bacteria 6406
471 Ga0500561_0000165 3300053137 Bacteria 12340
472 Ga0500568_0000230 3300053139 Bacteria 48007
473 Ga0500616_0000134 3300053153 Bacteria 129376
474 Ga0500616_0000564 3300053153 Bacteria 45665
475 Ga0500624_001152 3300053157 Bacteria 4843
476 Ga0500633_0001107 3300053160 Bacteria 4850
477 Ga0500634_0065545 3300053161 Bacteria 1916
478 Ga0500636_0000038 3300053177 Bacteria 70653
479 Ga0500636_0000186 3300053177 Bacteria 33515
480 Ga0500637_0001211 3300053178 Bacteria 10774
481 Ga0500625_009093 3300053729 Bacteria 4418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0116420 Ga0495642_0116420_57_1127 352
2 3300046648 Ga0495611_0014360 Ga0495611_0014360_1819_3093 424
3 3300046665 Ga0495661_0022436 Ga0495661_0022436_2317_3591 424
4 3300047323 Ga0495683_0022173 Ga0495683_0022173_448_1722 424
5 iso_pu_bacteria 2843690924 2843692402 431
6 3300046615 Ga0495656_0004998 Ga0495656_0004998_1253_2551 432
7 3300048090 Ga0495615_0001140 Ga0495615_0001140_1891_3189 432
8 iso_pu_bacteria 2643221556 2643802323 434
9 iso_pu_bacteria 2643221684 2644475831 434
10 iso_pu_bacteria 2808606418 2809145368 434
11 iso_pu_bacteria 2846033681 2846036288 434
12 iso_pu_bacteria 2846037992 2846038150 434
13 iso_pu_bacteria 2885080285 2885085541 434
14 iso_pu_bacteria 2998344455 2998345975 434
15 iso_pu_bacteria 8047673197 8047673819 434
16 iso_pu_bacteria 2643221653 2644297253 435
17 iso_pu_bacteria 2643221719 2644655506 435
18 iso_pu_bacteria 2818991272 2819242923 435
19 iso_pu_bacteria 2989776772 2989777808 435
20 iso_pu_bacteria 8005246636 8005247006 435
21 3300006038 Ga0075365_10115171 Ga0075365_101151712 437
22 3300006042 Ga0075368_10002071 Ga0075368_100020711 437
23 3300006048 Ga0075363_100003862 Ga0075363_1000038624 437
24 3300006353 Ga0075370_10005086 Ga0075370_100050863 437
25 3300050492 nmdc:mga0yw44_57688_c1 nmdc:mga0yw44_57688_c1_76_1437 437
26 3300050494 nmdc:mga06z11_2959_c1 nmdc:mga06z11_2959_c1_761_2122 437
27 3300050496 nmdc:mga07m45_5127_c1 nmdc:mga07m45_5127_c1_462_1823 437
28 3300003322 rootL2_10092725 rootL2_100927251 438
29 3300005262 Ga0065165_1003015 Ga0065165_10030155 438
30 3300005334 Ga0068869_100156676 Ga0068869_1001566762 438
31 3300005344 Ga0070661_100019074 Ga0070661_1000190745 438
32 3300005564 Ga0070664_100025699 Ga0070664_1000256995 438
33 3300006881 Ga0068865_100111980 Ga0068865_1001119803 438
34 3300009036 Ga0105244_10079072 Ga0105244_100790721 438
35 3300009174 Ga0105241_10078393 Ga0105241_100783933 438
36 3300009545 Ga0105237_10132619 Ga0105237_101326192 438
37 3300013102 Ga0157371_10000078 Ga0157371_10000078114 438
38 3300015261 Ga0182006_1000010 Ga0182006_100001092 438
39 3300015262 Ga0182007_10000030 Ga0182007_1000003097 438
40 3300015265 Ga0182005_1000009 Ga0182005_1000009334 438
41 3300025254 Ga0209148_1000360 Ga0209148_100036011 438
42 3300025909 Ga0207705_10009135 Ga0207705_100091356 438
43 3300025911 Ga0207654_10017823 Ga0207654_100178232 438
44 3300025919 Ga0207657_10016079 Ga0207657_100160792 438
45 3300025933 Ga0207706_10070925 Ga0207706_100709253 438
46 3300025935 Ga0207709_10071287 Ga0207709_100712872 438
47 3300025942 Ga0207689_10214942 Ga0207689_102149422 438
48 3300025949 Ga0207667_10047456 Ga0207667_100474562 438
49 3300029957 Ga0265324_10000002 Ga0265324_10000002365 438
50 3300029957 Ga0265324_10029404 Ga0265324_100294041 438
51 3300031235 Ga0265330_10014461 Ga0265330_100144612 438
52 3300031238 Ga0265332_10000083 Ga0265332_1000008392 438
53 3300031241 Ga0265325_10002420 Ga0265325_100024203 438
54 3300031250 Ga0265331_10001280 Ga0265331_100012807 438
55 3300031250 Ga0265331_10036760 Ga0265331_100367602 438
56 3300031251 Ga0265327_10000308 Ga0265327_1000030882 438
57 3300031251 Ga0265327_10027045 Ga0265327_100270453 438
58 3300031711 Ga0265314_10012713 Ga0265314_100127135 438
59 3300037312 Ga0395899_0091948 Ga0395899_0091948_871_2187 438
60 3300037418 Ga0395900_0004592 Ga0395900_0004592_8387_9703 438
61 3300037418 Ga0395900_0022206 Ga0395900_0022206_3308_4624 438
62 3300037418 Ga0395900_0179936 Ga0395900_0179936_104_1420 438
63 3300037466 Ga0395898_0123255 Ga0395898_0123255_130_1446 438
64 3300037471 Ga0395905_0081853 Ga0395905_0081853_1376_2692 438
65 3300037471 Ga0395905_0272155 Ga0395905_0272155_148_1476 438
66 3300038443 Ga0395901_0000054 Ga0395901_0000054_61287_62615 438
67 3300038443 Ga0395901_0044933 Ga0395901_0044933_158_1474 438
68 3300038443 Ga0395901_0117491 Ga0395901_0117491_165_1481 438
69 3300038443 Ga0395901_0311696 Ga0395901_0311696_126_1442 438
70 3300041999 Ga0439433_0021500 Ga0439433_0021500_78_1406 438
71 3300042005 Ga0439448_0000525 Ga0439448_0000525_5237_6553 438
72 3300042007 Ga0439449_0019438 Ga0439449_0019438_798_2126 438
73 3300042139 Ga0450904_000737 Ga0450904_000737_3158_4474 438
74 3300042876 Ga0451577_0000002 Ga0451577_0000002_563176_564492 438
75 3300042876 Ga0451577_0000186 Ga0451577_0000186_55119_56444 438
76 3300042876 Ga0451577_0004547 Ga0451577_0004547_24_1340 438
77 3300042876 Ga0451577_0009735 Ga0451577_0009735_2739_4055 438
78 3300044673 Ga0453683_0000003 Ga0453683_0000003_563176_564492 438
79 3300044683 Ga0466965_0033102 Ga0466965_0033102_992_2308 438
80 3300044684 Ga0466966_0050421 Ga0466966_0050421_695_2011 438
81 3300044706 Ga0466964_0000091 Ga0466964_0000091_17420_18736 438
82 3300044706 Ga0466964_0001048 Ga0466964_0001048_3818_5134 438
83 3300044712 Ga0453684_0000002 Ga0453684_0000002_1166884_1168200 438
84 3300044712 Ga0453684_0000121 Ga0453684_0000121_200077_201402 438
85 3300044712 Ga0453684_0000671 Ga0453684_0000671_35496_36812 438
86 3300044712 Ga0453684_0094025 Ga0453684_0094025_1786_3102 438
87 3300044712 Ga0453684_0106376 Ga0453684_0106376_1594_2910 438
88 3300044735 Ga0466968_0000777 Ga0466968_0000777_2211_3527 438
89 3300044842 Ga0466957_0000064 Ga0466957_0000064_34294_35610 438
90 3300045051 Ga0451576_0000004 Ga0451576_0000004_793524_794840 438
91 3300045051 Ga0451576_0001448 Ga0451576_0001448_4817_6133 438
92 3300045051 Ga0451576_0002532 Ga0451576_0002532_13320_14645 438
93 3300045976 Ga0466967_0046796 Ga0466967_0046796_466_1782 438
94 3300046452 Ga0495617_000057 Ga0495617_000057_76931_78247 438
95 3300046453 Ga0495627_001004 Ga0495627_001004_15521_16837 438
96 3300046453 Ga0495627_006353 Ga0495627_006353_1482_2798 438
97 3300046457 Ga0495590_0000018 Ga0495590_0000018_156952_158268 438
98 3300046457 Ga0495590_0000251 Ga0495590_0000251_10913_12229 438
99 3300046458 Ga0495591_009423 Ga0495591_009423_1285_2601 438
100 3300046459 Ga0495629_0012542 Ga0495629_0012542_4150_5466 438
101 3300046460 Ga0495638_0002966 Ga0495638_0002966_9023_10339 438
102 3300046463 Ga0495653_0017058 Ga0495653_0017058_3713_5029 438
103 3300046463 Ga0495653_0022552 Ga0495653_0022552_12_1328 438
104 3300046463 Ga0495653_0047458 Ga0495653_0047458_69_1385 438
105 3300046471 Ga0495650_0000108 Ga0495650_0000108_14958_16280 438
106 3300046471 Ga0495650_0000140 Ga0495650_0000140_21860_23176 438
107 3300046472 Ga0495580_0012103 Ga0495580_0012103_2241_3557 438
108 3300046473 Ga0495582_0003828 Ga0495582_0003828_4496_5812 438
109 3300046473 Ga0495582_0029620 Ga0495582_0029620_657_1973 438
110 3300046474 Ga0495605_0001736 Ga0495605_0001736_4107_5423 438
111 3300046474 Ga0495605_0004622 Ga0495605_0004622_4572_5888 438
112 3300046474 Ga0495605_0010846 Ga0495605_0010846_2660_3988 438
113 3300046474 Ga0495605_0033370 Ga0495605_0033370_583_1905 438
114 3300046474 Ga0495605_0045798 Ga0495605_0045798_288_1604 438
115 3300046491 Ga0495584_0000006 Ga0495584_0000006_148240_149556 438
116 3300046491 Ga0495584_0001835 Ga0495584_0001835_9638_10954 438
117 3300046491 Ga0495584_0001841 Ga0495584_0001841_1290_2606 438
118 3300046491 Ga0495584_0002247 Ga0495584_0002247_6774_8090 438
119 3300046491 Ga0495584_0013323 Ga0495584_0013323_2300_3628 438
120 3300046491 Ga0495584_0015640 Ga0495584_0015640_1412_2728 438
121 3300046492 Ga0495585_0000282 Ga0495585_0000282_27604_28920 438
122 3300046492 Ga0495585_0000926 Ga0495585_0000926_4123_5439 438
123 3300046492 Ga0495585_0003548 Ga0495585_0003548_7063_8379 438
124 3300046492 Ga0495585_0004128 Ga0495585_0004128_6741_8057 438
125 3300046492 Ga0495585_0015998 Ga0495585_0015998_2661_3977 438
126 3300046492 Ga0495585_0019085 Ga0495585_0019085_1436_2752 438
127 3300046492 Ga0495585_0022737 Ga0495585_0022737_1774_3090 438
128 3300046492 Ga0495585_0026321 Ga0495585_0026321_1301_2617 438
129 3300046492 Ga0495585_0030642 Ga0495585_0030642_1193_2509 438
130 3300046492 Ga0495585_0070315 Ga0495585_0070315_470_1786 438
131 3300046499 Ga0495594_0012257 Ga0495594_0012257_1012_2328 438
132 3300046499 Ga0495594_0014904 Ga0495594_0014904_1374_2690 438
133 3300046499 Ga0495594_0027573 Ga0495594_0027573_1374_2690 438
134 3300046499 Ga0495594_0065339 Ga0495594_0065339_226_1542 438
135 3300046499 Ga0495594_0068029 Ga0495594_0068029_289_1605 438
136 3300046500 Ga0495596_0000236 Ga0495596_0000236_34154_35470 438
137 3300046500 Ga0495596_0001429 Ga0495596_0001429_4162_5484 438
138 3300046500 Ga0495596_0003685 Ga0495596_0003685_6242_7558 438
139 3300046500 Ga0495596_0004853 Ga0495596_0004853_2166_3482 438
140 3300046500 Ga0495596_0005735 Ga0495596_0005735_4368_5684 438
141 3300046500 Ga0495596_0008161 Ga0495596_0008161_48_1364 438
142 3300046501 Ga0495607_0002952 Ga0495607_0002952_8028_9344 438
143 3300046501 Ga0495607_0003634 Ga0495607_0003634_8245_9561 438
144 3300046501 Ga0495607_0018606 Ga0495607_0018606_686_2014 438
145 3300046501 Ga0495607_0023386 Ga0495607_0023386_1653_2969 438
146 3300046501 Ga0495607_0040184 Ga0495607_0040184_427_1743 438
147 3300046501 Ga0495607_0086821 Ga0495607_0086821_295_1611 438
148 3300046506 Ga0495583_0000525 Ga0495583_0000525_6790_8106 438
149 3300046506 Ga0495583_0000608 Ga0495583_0000608_25261_26577 438
150 3300046506 Ga0495583_0001445 Ga0495583_0001445_1289_2605 438
151 3300046506 Ga0495583_0002759 Ga0495583_0002759_5098_6414 438
152 3300046506 Ga0495583_0004051 Ga0495583_0004051_6781_8097 438
153 3300046506 Ga0495583_0021769 Ga0495583_0021769_1701_3017 438
154 3300046506 Ga0495583_0026390 Ga0495583_0026390_139_1455 438
155 3300046506 Ga0495583_0034605 Ga0495583_0034605_326_1642 438
156 3300046507 Ga0495606_0008706 Ga0495606_0008706_4903_6219 438
157 3300046507 Ga0495606_0020392 Ga0495606_0020392_280_1596 438
158 3300046507 Ga0495606_0027660 Ga0495606_0027660_2669_3997 438
159 3300046507 Ga0495606_0060853 Ga0495606_0060853_499_1815 438
160 3300046512 Ga0495610_0001162 Ga0495610_0001162_13777_15093 438
161 3300046513 Ga0495616_0000343 Ga0495616_0000343_14267_15583 438
162 3300046513 Ga0495616_0000680 Ga0495616_0000680_2602_3918 438
163 3300046513 Ga0495616_0001661 Ga0495616_0001661_1156_2472 438
164 3300046513 Ga0495616_0002034 Ga0495616_0002034_4450_5766 438
165 3300046513 Ga0495616_0008070 Ga0495616_0008070_1440_2756 438
166 3300046513 Ga0495616_0021589 Ga0495616_0021589_49_1377 438
167 3300046513 Ga0495616_0029476 Ga0495616_0029476_1034_2350 438
168 3300046513 Ga0495616_0034327 Ga0495616_0034327_746_2062 438
169 3300046513 Ga0495616_0097257 Ga0495616_0097257_19_1335 438
170 3300046515 Ga0495620_0007596 Ga0495620_0007596_82_1398 438
171 3300046518 Ga0495631_0001685 Ga0495631_0001685_8973_10289 438
172 3300046518 Ga0495631_0002105 Ga0495631_0002105_9573_10889 438
173 3300046518 Ga0495631_0010589 Ga0495631_0010589_2707_4023 438
174 3300046518 Ga0495631_0012359 Ga0495631_0012359_2146_3462 438
175 3300046518 Ga0495631_0014148 Ga0495631_0014148_1118_2434 438
176 3300046518 Ga0495631_0038282 Ga0495631_0038282_68_1396 438
177 3300046518 Ga0495631_0053968 Ga0495631_0053968_257_1573 438
178 3300046519 Ga0495632_0000062 Ga0495632_0000062_6782_8098 438
179 3300046519 Ga0495632_0000235 Ga0495632_0000235_46100_47416 438
180 3300046519 Ga0495632_0000901 Ga0495632_0000901_21062_22378 438
181 3300046519 Ga0495632_0003209 Ga0495632_0003209_8907_10223 438
182 3300046520 Ga0495637_0000004 Ga0495637_0000004_551356_552672 438
183 3300046522 Ga0495643_0000648 Ga0495643_0000648_1775_3091 438
184 3300046522 Ga0495643_0009797 Ga0495643_0009797_3129_4445 438
185 3300046522 Ga0495643_0022182 Ga0495643_0022182_626_1942 438
186 3300046522 Ga0495643_0025078 Ga0495643_0025078_389_1705 438
187 3300046522 Ga0495643_0028822 Ga0495643_0028822_1189_2505 438
188 3300046523 Ga0495644_0003759 Ga0495644_0003759_2739_4055 438
189 3300046523 Ga0495644_0010904 Ga0495644_0010904_1775_3103 438
190 3300046523 Ga0495644_0015469 Ga0495644_0015469_369_1685 438
191 3300046524 Ga0495648_0000109 Ga0495648_0000109_20054_21370 438
192 3300046524 Ga0495648_0002349 Ga0495648_0002349_8343_9659 438
193 3300046524 Ga0495648_0003866 Ga0495648_0003866_4259_5581 438
194 3300046524 Ga0495648_0028952 Ga0495648_0028952_1758_3074 438
195 3300046524 Ga0495648_0030560 Ga0495648_0030560_443_1759 438
196 3300046524 Ga0495648_0081248 Ga0495648_0081248_67_1395 438
197 3300046525 Ga0495663_0003044 Ga0495663_0003044_57_1373 438
198 3300046526 Ga0495666_0012630 Ga0495666_0012630_2212_3528 438
199 3300046526 Ga0495666_0027785 Ga0495666_0027785_864_2192 438
200 3300046528 Ga0495642_0000196 Ga0495642_0000196_11926_13242 438
201 3300046528 Ga0495642_0007659 Ga0495642_0007659_1400_2716 438
202 3300046528 Ga0495642_0018362 Ga0495642_0018362_391_1719 438
203 3300046528 Ga0495642_0022002 Ga0495642_0022002_1114_2430 438
204 3300046529 Ga0495652_0034667 Ga0495652_0034667_1412_2728 438
205 3300046530 Ga0495654_0007827 Ga0495654_0007827_1958_3274 438
206 3300046530 Ga0495654_0031073 Ga0495654_0031073_148_1464 438
207 3300046531 Ga0495665_0016501 Ga0495665_0016501_2360_3676 438
208 3300046531 Ga0495665_0034983 Ga0495665_0034983_938_2254 438
209 3300046535 Ga0495586_0002686 Ga0495586_0002686_1577_2893 438
210 3300046535 Ga0495586_0007801 Ga0495586_0007801_3850_5166 438
211 3300046535 Ga0495586_0023565 Ga0495586_0023565_1397_2713 438
212 3300046536 Ga0495587_0014029 Ga0495587_0014029_3339_4655 438
213 3300046538 Ga0495609_0002695 Ga0495609_0002695_3429_4751 438
214 3300046538 Ga0495609_0003510 Ga0495609_0003510_5886_7214 438
215 3300046538 Ga0495609_0010793 Ga0495609_0010793_468_1784 438
216 3300046538 Ga0495609_0013432 Ga0495609_0013432_749_2065 438
217 3300046542 Ga0495597_0001393 Ga0495597_0001393_7761_9077 438
218 3300046542 Ga0495597_0001796 Ga0495597_0001796_7321_8637 438
219 3300046542 Ga0495597_0003920 Ga0495597_0003920_6685_8001 438
220 3300046542 Ga0495597_0009770 Ga0495597_0009770_3250_4566 438
221 3300046542 Ga0495597_0016794 Ga0495597_0016794_270_1586 438
222 3300046543 Ga0495645_0074946 Ga0495645_0074946_470_1786 438
223 3300046543 Ga0495645_0105229 Ga0495645_0105229_191_1507 438
224 3300046557 Ga0495622_0012031 Ga0495622_0012031_1524_2840 438
225 3300046557 Ga0495622_0029887 Ga0495622_0029887_668_1984 438
226 3300046558 Ga0495633_0008068 Ga0495633_0008068_58_1374 438
227 3300046558 Ga0495633_0011835 Ga0495633_0011835_573_1889 438
228 3300046558 Ga0495633_0014994 Ga0495633_0014994_373_1689 438
229 3300046616 Ga0495668_0000805 Ga0495668_0000805_33909_35225 438
230 3300046616 Ga0495668_0002455 Ga0495668_0002455_2153_3469 438
231 3300046616 Ga0495668_0002669 Ga0495668_0002669_10360_11676 438
232 3300046616 Ga0495668_0010820 Ga0495668_0010820_2578_3894 438
233 3300046616 Ga0495668_0031535 Ga0495668_0031535_1087_2415 438
234 3300046616 Ga0495668_0045336 Ga0495668_0045336_698_2014 438
235 3300046642 Ga0495634_0033244 Ga0495634_0033244_837_2153 438
236 3300046648 Ga0495611_0000861 Ga0495611_0000861_14163_15479 438
237 3300046648 Ga0495611_0011073 Ga0495611_0011073_1798_3114 438
238 3300046660 Ga0495625_0009819 Ga0495625_0009819_5247_6563 438
239 3300046660 Ga0495625_0027108 Ga0495625_0027108_1998_3314 438
240 3300046660 Ga0495625_0080676 Ga0495625_0080676_831_2147 438
241 3300046660 Ga0495625_0131297 Ga0495625_0131297_277_1593 438
242 3300046665 Ga0495661_0001167 Ga0495661_0001167_11722_13038 438
243 3300046665 Ga0495661_0002320 Ga0495661_0002320_6615_7931 438
244 3300046665 Ga0495661_0002363 Ga0495661_0002363_4087_5403 438
245 3300046665 Ga0495661_0017362 Ga0495661_0017362_1604_2920 438
246 3300046665 Ga0495661_0024071 Ga0495661_0024071_2548_3876 438
247 3300046665 Ga0495661_0024473 Ga0495661_0024473_433_1749 438
248 3300046665 Ga0495661_0036897 Ga0495661_0036897_583_1899 438
249 3300046665 Ga0495661_0050603 Ga0495661_0050603_530_1846 438
250 3300046665 Ga0495661_0069884 Ga0495661_0069884_481_1797 438
251 3300046674 Ga0495588_0000077 Ga0495588_0000077_122610_123926 438
252 3300046674 Ga0495588_0013800 Ga0495588_0013800_1992_3308 438
253 3300046674 Ga0495588_0022764 Ga0495588_0022764_1104_2420 438
254 3300046679 Ga0495623_0029147 Ga0495623_0029147_1429_2745 438
255 3300046679 Ga0495623_0047237 Ga0495623_0047237_1348_2664 438
256 3300046684 Ga0495669_0000217 Ga0495669_0000217_5554_6870 438
257 3300046684 Ga0495669_0016969 Ga0495669_0016969_517_1845 438
258 3300046684 Ga0495669_0049513 Ga0495669_0049513_179_1495 438
259 3300046684 Ga0495669_0067517 Ga0495669_0067517_173_1489 438
260 3300046690 Ga0495624_0018758 Ga0495624_0018758_1985_3301 438
261 3300046691 Ga0495670_0000391 Ga0495670_0000391_15469_16785 438
262 3300046691 Ga0495670_0009281 Ga0495670_0009281_3310_4626 438
263 3300046691 Ga0495670_0016326 Ga0495670_0016326_1848_3164 438
264 3300046691 Ga0495670_0021313 Ga0495670_0021313_107_1423 438
265 3300046691 Ga0495670_0037325 Ga0495670_0037325_1015_2331 438
266 3300046692 Ga0495671_0000848 Ga0495671_0000848_18360_19676 438
267 3300046692 Ga0495671_0003909 Ga0495671_0003909_5890_7206 438
268 3300046692 Ga0495671_0018278 Ga0495671_0018278_1833_3149 438
269 3300046694 Ga0495649_0001146 Ga0495649_0001146_5187_6503 438
270 3300046694 Ga0495649_0004293 Ga0495649_0004293_6486_7802 438
271 3300046794 Ga0495589_0001177 Ga0495589_0001177_6053_7369 438
272 3300046794 Ga0495589_0001412 Ga0495589_0001412_3919_5235 438
273 3300046794 Ga0495589_0043769 Ga0495589_0043769_237_1553 438
274 3300046810 Ga0495660_0000178 Ga0495660_0000178_9723_11039 438
275 3300046810 Ga0495660_0022967 Ga0495660_0022967_403_1731 438
276 3300047315 Ga0495581_0009512 Ga0495581_0009512_3987_5303 438
277 3300047317 Ga0495604_0003606 Ga0495604_0003606_10065_11381 438
278 3300047317 Ga0495604_0059718 Ga0495604_0059718_944_2260 438
279 3300047319 Ga0495674_0003699 Ga0495674_0003699_12166_13482 438
280 3300047320 Ga0495672_0000424 Ga0495672_0000424_38469_39785 438
281 3300047320 Ga0495672_0000590 Ga0495672_0000590_2580_3896 438
282 3300047320 Ga0495672_0002152 Ga0495672_0002152_10887_12203 438
283 3300047320 Ga0495672_0066230 Ga0495672_0066230_43_1359 438
284 3300047320 Ga0495672_0104919 Ga0495672_0104919_64_1380 438
285 3300047321 Ga0495676_0000342 Ga0495676_0000342_13933_15249 438
286 3300047322 Ga0495680_0015839 Ga0495680_0015839_4531_5847 438
287 3300047322 Ga0495680_0048605 Ga0495680_0048605_1321_2637 438
288 3300047323 Ga0495683_0000144 Ga0495683_0000144_21614_22930 438
289 3300047323 Ga0495683_0001039 Ga0495683_0001039_9099_10415 438
290 3300047323 Ga0495683_0004193 Ga0495683_0004193_4192_5520 438
291 3300047443 Ga0495687_000002 Ga0495687_000002_925805_927121 438
292 3300047443 Ga0495687_000017 Ga0495687_000017_125277_126593 438
293 3300047443 Ga0495687_001539 Ga0495687_001539_10753_12069 438
294 3300047443 Ga0495687_010589 Ga0495687_010589_1477_2793 438
295 3300047444 Ga0495675_0008085 Ga0495675_0008085_3112_4428 438
296 3300047445 Ga0495677_0001586 Ga0495677_0001586_7784_9100 438
297 3300047445 Ga0495677_0002619 Ga0495677_0002619_1269_2585 438
298 3300047446 Ga0495679_003113 Ga0495679_003113_6147_7463 438
299 3300047446 Ga0495679_011569 Ga0495679_011569_1429_2745 438
300 3300047447 Ga0495685_012525 Ga0495685_012525_182_1510 438
301 3300047470 Ga0495681_0002294 Ga0495681_0002294_11609_12925 438
302 3300047470 Ga0495681_0011982 Ga0495681_0011982_563_1879 438
303 3300047470 Ga0495681_0027321 Ga0495681_0027321_299_1615 438
304 3300047470 Ga0495681_0053496 Ga0495681_0053496_538_1854 438
305 3300047673 Ga0495593_0006706 Ga0495593_0006706_1567_2883 438
306 3300047673 Ga0495593_0015080 Ga0495593_0015080_1322_2638 438
307 3300047673 Ga0495593_0040184 Ga0495593_0040184_509_1825 438
308 3300048088 Ga0495602_0157696 Ga0495602_0157696_401_1717 438
309 3300048089 Ga0495614_0006251 Ga0495614_0006251_323_1639 438
310 3300048089 Ga0495614_0010600 Ga0495614_0010600_1359_2675 438
311 3300048091 Ga0495626_0000004 Ga0495626_0000004_344114_345430 438
312 3300048091 Ga0495626_0000016 Ga0495626_0000016_72809_74125 438
313 3300048091 Ga0495626_0002550 Ga0495626_0002550_67_1383 438
314 3300048091 Ga0495626_0016542 Ga0495626_0016542_1342_2658 438
315 3300048091 Ga0495626_0025701 Ga0495626_0025701_232_1548 438
316 3300048091 Ga0495626_0033369 Ga0495626_0033369_263_1579 438
317 3300048905 Ga0496102_0000340 Ga0496102_0000340_3059_4387 438
318 3300048905 Ga0496102_0000461 Ga0496102_0000461_23058_24374 438
319 3300048905 Ga0496102_0056486 Ga0496102_0056486_1892_3208 438
320 3300048906 Ga0496103_0038605 Ga0496103_0038605_1324_2640 438
321 3300048906 Ga0496103_0039131 Ga0496103_0039131_1095_2411 438
322 3300048912 Ga0496109_0063011 Ga0496109_0063011_379_1695 438
323 3300048913 Ga0496110_0000019 Ga0496110_0000019_40580_41896 438
324 3300048913 Ga0496110_0158452 Ga0496110_0158452_289_1605 438
325 3300048916 Ga0496113_0055353 Ga0496113_0055353_524_1840 438
326 3300048920 Ga0496117_0000010 Ga0496117_0000010_289080_290396 438
327 3300048921 Ga0496118_0000009 Ga0496118_0000009_321559_322875 438
328 3300048924 Ga0496121_0004353 Ga0496121_0004353_10697_12013 438
329 3300048925 Ga0496122_0000835 Ga0496122_0000835_39104_40420 438
330 3300048925 Ga0496122_0004501 Ga0496122_0004501_7230_8546 438
331 3300048925 Ga0496122_0052373 Ga0496122_0052373_1592_2908 438
332 3300048926 Ga0496123_0001003 Ga0496123_0001003_20886_22202 438
333 3300048926 Ga0496123_0004574 Ga0496123_0004574_7797_9113 438
334 3300048927 Ga0496124_0002249 Ga0496124_0002249_13227_14543 438
335 3300048927 Ga0496124_0072866 Ga0496124_0072866_1492_2820 438
336 3300048928 Ga0496125_0001280 Ga0496125_0001280_29070_30386 438
337 3300049128 Ga0501308_000138 Ga0501308_000138_1887_3203 438
338 3300049459 Ga0495678_000515 Ga0495678_000515_3603_4919 438
339 3300049459 Ga0495678_000866 Ga0495678_000866_22167_23483 438
340 3300049459 Ga0495678_005217 Ga0495678_005217_2411_3727 438
341 3300049459 Ga0495678_014253 Ga0495678_014253_2245_3561 438
342 3300049460 Ga0495682_0001115 Ga0495682_0001115_6631_7947 438
343 3300049822 Ga0501035_0000965 Ga0501035_0000965_6356_7672 438
344 3300053177 Ga0500636_0000186 Ga0500636_0000186_27649_28965 438
345 3300053178 Ga0500637_0001211 Ga0500637_0001211_760_2076 438
346 3300053729 Ga0500625_009093 Ga0500625_009093_1951_3282 438
347 3300029957 Ga0265324_10011442 Ga0265324_100114422 439
348 3300030731 Ga0316177_1061589 Ga0316177_10615893 439
349 3300030736 Ga0316180_1070198 Ga0316180_10701984 439
350 3300031665 Ga0316575_10000193 Ga0316575_1000019314 439
351 3300031711 Ga0265314_10041955 Ga0265314_100419551 439
352 3300045051 Ga0451576_0000029 Ga0451576_0000029_57726_59045 439
353 3300045051 Ga0451576_0001359 Ga0451576_0001359_27259_28578 439
354 3300048918 Ga0496115_0097165 Ga0496115_0097165_594_1913 439
355 3300049459 Ga0495678_002343 Ga0495678_002343_6785_8104 439
356 iso_pu_bacteria 2841859092 2841863057 439
357 iso_pu_bacteria 2842515876 2842519426 439
358 iso_pu_bacteria 2933011516 2933016631 439
359 3300003322 rootL2_10028561 rootL2_100285613 440
360 3300003759 Ga0055525_1000001 Ga0055525_1000001510 440
361 3300025230 Ga0209563_100007 Ga0209563_100007586 440
362 3300037312 Ga0395899_0163293 Ga0395899_0163293_185_1507 440
363 3300037418 Ga0395900_0000393 Ga0395900_0000393_2942_4264 440
364 3300046513 Ga0495616_0007916 Ga0495616_0007916_4277_5599 440
365 3300046526 Ga0495666_0019304 Ga0495666_0019304_1544_2866 440
366 3300046538 Ga0495609_0000009 Ga0495609_0000009_212608_213930 440
367 3300046665 Ga0495661_0000368 Ga0495661_0000368_43786_45108 440
368 3300046794 Ga0495589_0000037 Ga0495589_0000037_140933_142255 440
369 3300047443 Ga0495687_000024 Ga0495687_000024_299659_300981 440
370 3300047445 Ga0495677_0000011 Ga0495677_0000011_7583_8905 440
371 3300047472 Ga0495686_0130207 Ga0495686_0130207_131_1453 440
372 3300048905 Ga0496102_0031308 Ga0496102_0031308_523_1845 440
373 3300048909 Ga0496106_0018536 Ga0496106_0018536_2300_3634 440
374 3300048910 Ga0496107_0027743 Ga0496107_0027743_1122_2456 440
375 3300048916 Ga0496113_0069951 Ga0496113_0069951_394_1716 440
376 3300048925 Ga0496122_0050889 Ga0496122_0050889_315_1637 440
377 3300048927 Ga0496124_0114032 Ga0496124_0114032_697_2019 440
378 iso_pu_bacteria 2821123053 2821126326 440
379 iso_pu_bacteria 2838736955 2838737198 440
380 iso_pu_bacteria 2841840854 2841842433 440
381 iso_pu_bacteria 2842140634 2842142213 440
382 iso_pu_bacteria 2857531043 2857532887 440
383 3300046474 Ga0495605_0024015 Ga0495605_0024015_198_1535 441
384 3300046474 Ga0495605_0026784 Ga0495605_0026784_535_1872 441
385 3300046491 Ga0495584_0003129 Ga0495584_0003129_4320_5657 441
386 3300046492 Ga0495585_0016685 Ga0495585_0016685_379_1716 441
387 3300046500 Ga0495596_0004975 Ga0495596_0004975_3182_4519 441
388 3300046501 Ga0495607_0012015 Ga0495607_0012015_2866_4203 441
389 3300046506 Ga0495583_0004346 Ga0495583_0004346_796_2133 441
390 3300046513 Ga0495616_0004092 Ga0495616_0004092_4309_5646 441
391 3300046518 Ga0495631_0014540 Ga0495631_0014540_1024_2361 441
392 3300046519 Ga0495632_0002631 Ga0495632_0002631_22_1359 441
393 3300046616 Ga0495668_0055741 Ga0495668_0055741_298_1635 441
394 3300046794 Ga0495589_0013696 Ga0495589_0013696_976_2313 441
395 3300047323 Ga0495683_0009068 Ga0495683_0009068_3191_4528 441
396 3300047445 Ga0495677_0001358 Ga0495677_0001358_6933_8270 441
397 3300047445 Ga0495677_0010720 Ga0495677_0010720_1520_2845 441
398 3300047446 Ga0495679_003713 Ga0495679_003713_3856_5193 441
399 3300047470 Ga0495681_0009181 Ga0495681_0009181_1690_3027 441
400 3300048091 Ga0495626_0003138 Ga0495626_0003138_3712_5037 441
401 iso_pu_bacteria 2643221582 2643917916 442
402 iso_pu_bacteria 2929138655 2929140281 442
403 iso_pu_bacteria 8003570095 8003573580 442
404 iso_pu_bacteria 2643221557 2643808733 443
405 iso_pu_bacteria 2643221610 2644064185 443
406 iso_pu_bacteria 2643221668 2644376352 443
407 iso_pu_bacteria 2643221675 2644416016 443
408 iso_pu_bacteria 2643221680 2644449057 443
409 iso_pu_bacteria 2643221726 2644692118 443
410 iso_pu_bacteria 2989349275 2989349821 443
411 3300006051 Ga0075364_10096877 Ga0075364_100968772 444
412 3300006946 Ga0079104_1000063 Ga0079104_100006371 444
413 3300027111 Ga0209281_1000110 Ga0209281_100011072 444
414 3300048927 Ga0496124_0061412 Ga0496124_0061412_599_1939 444
415 iso_pu_bacteria 2600254933 2600374018 445
416 3300046558 Ga0495633_0034597 Ga0495633_0034597_19_1386 446
417 3300048920 Ga0496117_0125634 Ga0496117_0125634_68_1432 446
418 3300048923 Ga0496120_0066610 Ga0496120_0066610_210_1574 446
419 3300048924 Ga0496121_0000001 Ga0496121_0000001_1586499_1587863 446
420 3300048928 Ga0496125_0000001 Ga0496125_0000001_1744018_1745382 446
421 3300005331 Ga0070670_100000147 Ga0070670_10000014757 447
422 3300025925 Ga0207650_10000958 Ga0207650_1000095821 447
423 iso_pu_bacteria 8054460903 8054464906 447
424 3300048927 Ga0496124_0000080 Ga0496124_0000080_175879_177237 448
425 3300053177 Ga0500636_0000038 Ga0500636_0000038_42730_44085 448
426 3300013100 Ga0157373_10095013 Ga0157373_100950132 449
427 3300013105 Ga0157369_10017861 Ga0157369_100178618 449
428 3300049570 Ga0501033_0000050 Ga0501033_0000050_18126_19481 449
429 3300049822 Ga0501035_0011491 Ga0501035_0011491_43_1398 449
430 iso_pu_bacteria 2554235003 2554249569 449
431 iso_pu_bacteria 2558860242 2559298082 449
432 iso_pu_bacteria 2585427634 2586004395 449
433 iso_pu_bacteria 2643221693 2644519997 449
434 iso_pu_bacteria 2841840854 2841845780 449
435 iso_pu_bacteria 2842140634 2842145484 449
436 iso_pu_bacteria 2899845264 2899846204 449
437 iso_pu_bacteria 2979089926 2979095250 449
438 iso_pu_bacteria 2979095461 2979097502 449
439 iso_pu_bacteria 650716007 650741850 449
440 iso_pu_bacteria 8005658619 8005659480 449
441 3300006051 Ga0075364_10000015 Ga0075364_1000001528 451
442 3300050491 nmdc:mga00v17_81_c1 nmdc:mga00v17_81_c1_31252_32622 451
443 iso_pu_bacteria 2582581866 2585396954 451
444 iso_pu_bacteria 2643221618 2644106257 451
445 iso_pu_bacteria 2643221626 2644146755 451
446 iso_pu_bacteria 2643221655 2644310868 451
447 iso_pu_bacteria 2643221659 2644334329 451
448 iso_pu_bacteria 2643221698 2644545458 451
449 iso_pu_bacteria 2643221712 2644616702 451
450 iso_pu_bacteria 2844163670 2844166034 451
451 3300025230 Ga0209563_105479 Ga0209563_1054791 452
452 3300005548 Ga0070665_100004381 Ga0070665_10000438113 453
453 3300006195 Ga0075366_10074424 Ga0075366_100744241 453
454 3300013100 Ga0157373_10007223 Ga0157373_100072234 453
455 3300013102 Ga0157371_10000295 Ga0157371_100002956 453
456 3300027866 Ga0209813_10011799 Ga0209813_100117992 453
457 3300048919 Ga0496116_0030397 Ga0496116_0030397_1300_2667 453
458 3300048921 Ga0496118_0045925 Ga0496118_0045925_1225_2592 453
459 3300048922 Ga0496119_0029172 Ga0496119_0029172_427_1794 453
460 3300048923 Ga0496120_0001142 Ga0496120_0001142_13697_15064 453
461 3300048925 Ga0496122_0002798 Ga0496122_0002798_4281_5648 453
462 3300048926 Ga0496123_0000338 Ga0496123_0000338_18321_19688 453
463 3300048928 Ga0496125_0053573 Ga0496125_0053573_625_1992 453
464 3300048929 Ga0496126_0099547 Ga0496126_0099547_1051_2421 453
465 3300050491 nmdc:mga00v17_33_c1 nmdc:mga00v17_33_c1_8352_9719 453
466 3300050516 nmdc:mga0sz30_21286_c1 nmdc:mga0sz30_21286_c1_775_2142 453
467 3300050516 nmdc:mga0sz30_3772_c1 nmdc:mga0sz30_3772_c1_1905_3272 453
468 3300053137 Ga0500561_0000165 Ga0500561_0000165_10470_11837 453
469 iso_pu_bacteria 2510065057 2510306868 453
470 iso_pu_bacteria 2510917026 2511170357 453
471 iso_pu_bacteria 2511231052 2511500023 453
472 iso_pu_bacteria 2512875026 2512974935 453
473 iso_pu_bacteria 2513237086 2513586314 453
474 iso_pu_bacteria 2513237089 2513603730 453
475 iso_pu_bacteria 2513237091 2513618905 453
476 iso_pu_bacteria 2513237140 2513883203 453
477 iso_pu_bacteria 2513237143 2513904217 453
478 iso_pu_bacteria 2513237156 2513987724 453
479 iso_pu_bacteria 2513237160 2514004312 453
480 iso_pu_bacteria 2515154107 2515612525 453
481 iso_pu_bacteria 2516143018 2516206991 453
482 iso_pu_bacteria 2516653046 2516897562 453
483 iso_pu_bacteria 2517487022 2517567582 453
484 iso_pu_bacteria 2524023207 2524449813 453
485 iso_pu_bacteria 2551306084 2551674405 453
486 iso_pu_bacteria 2551306085 2551686853 453
487 iso_pu_bacteria 2551306086 2551690932 453
488 iso_pu_bacteria 2551306087 2551702479 453
489 iso_pu_bacteria 2551306089 2551714479 453
490 iso_pu_bacteria 2551306090 2551715752 453
491 iso_pu_bacteria 2551306091 2551730860 453
492 iso_pu_bacteria 2551306092 2551732705 453
493 iso_pu_bacteria 2551306092 2551735918 453
494 iso_pu_bacteria 2551306093 2551740702 453
495 iso_pu_bacteria 2582581299 2585233718 453
496 iso_pu_bacteria 2582581306 2585266529 453
497 iso_pu_bacteria 2582581865 2585387545 453
498 iso_pu_bacteria 2582581865 2585390589 453
499 iso_pu_bacteria 2599185352 2600196241 453
500 iso_pu_bacteria 2600255279 2601612556 453
501 iso_pu_bacteria 2600255308 2601749327 453
502 iso_pu_bacteria 2643221568 2643856898 453
503 iso_pu_bacteria 2643221688 2644492844 453
504 iso_pu_bacteria 2643221723 2644673371 453
505 iso_pu_bacteria 2751185821 2753461925 453
506 iso_pu_bacteria 2791355091 2792624761 453
507 iso_pu_bacteria 2791355092 2792629683 453
508 iso_pu_bacteria 2791355094 2792643977 453
509 iso_pu_bacteria 2802428858 2802718224 453
510 iso_pu_bacteria 2802428859 2802725981 453
511 iso_pu_bacteria 2802428860 2802731307 453
512 iso_pu_bacteria 2802428861 2802736499 453
513 iso_pu_bacteria 2802428862 2802744474 453
514 iso_pu_bacteria 2802428863 2802749937 453
515 iso_pu_bacteria 2802429268 2804754362 453
516 iso_pu_bacteria 2808606387 2808989390 453
517 iso_pu_bacteria 2818991439 2819557031 453
518 iso_pu_bacteria 2838074704 2838079200 453
519 iso_pu_bacteria 2838714209 2838718624 453
520 iso_pu_bacteria 2838719591 2838723622 453
521 iso_pu_bacteria 2841846520 2841851516 453
522 iso_pu_bacteria 2842124991 2842129484 453
523 iso_pu_bacteria 2842170452 2842174779 453
524 iso_pu_bacteria 2842187318 2842191261 453
525 iso_pu_bacteria 2842211629 2842215666 453
526 iso_pu_bacteria 2842224351 2842228387 453
527 iso_pu_bacteria 2842922631 2842927101 453
528 iso_pu_bacteria 2855825444 2855830531 453
529 iso_pu_bacteria 2855839649 2855845695 453
530 iso_pu_bacteria 2858800743 2858805558 453
531 iso_pu_bacteria 2913295892 2913300717 453
532 iso_pu_bacteria 2915980308 2915986880 453
533 iso_pu_bacteria 2915986958 2915987077 453
534 iso_pu_bacteria 2915993759 2915997751 453
535 iso_pu_bacteria 2916000859 2916001507 453
536 iso_pu_bacteria 2916007675 2916011360 453
537 iso_pu_bacteria 2916014648 2916014756 453
538 iso_pu_bacteria 2916021584 2916025223 453
539 iso_pu_bacteria 2916028427 2916032263 453
540 iso_pu_bacteria 2916035215 2916039118 453
541 iso_pu_bacteria 2916041962 2916045433 453
542 iso_pu_bacteria 2916048683 2916051289 453
543 iso_pu_bacteria 2916055098 2916059057 453
544 iso_pu_bacteria 2916061851 2916063783 453
545 iso_pu_bacteria 2916068649 2916069550 453
546 iso_pu_bacteria 2916076590 2916081921 453
547 iso_pu_bacteria 2919100787 2919104884 453
548 iso_pu_bacteria 2919114240 2919119001 453
549 iso_pu_bacteria 2919166419 2919170017 453
550 iso_pu_bacteria 2920760137 2920761969 453
551 iso_pu_bacteria 2920822456 2920822663 453
552 iso_pu_bacteria 2921201388 2921203241 453
553 iso_pu_bacteria 2921208531 2921209362 453
554 iso_pu_bacteria 2921237296 2921239626 453
555 iso_pu_bacteria 2921244191 2921244972 453
556 iso_pu_bacteria 2921250672 2921253465 453
557 iso_pu_bacteria 2921257292 2921263804 453
558 iso_pu_bacteria 2921263974 2921269965 453
559 iso_pu_bacteria 2921282425 2921283283 453
560 iso_pu_bacteria 2921289301 2921294386 453
561 iso_pu_bacteria 2921296804 2921304022 453
562 iso_pu_bacteria 2924144063 2924146253 453
563 iso_pu_bacteria 2924150972 2924155568 453
564 iso_pu_bacteria 2924158325 2924162095 453
565 iso_pu_bacteria 2924165586 2924170049 453
566 iso_pu_bacteria 2924172951 2924176607 453
567 iso_pu_bacteria 2924179722 2924180095 453
568 iso_pu_bacteria 2924193448 2924199102 453
569 iso_pu_bacteria 2924200457 2924202880 453
570 iso_pu_bacteria 2924207177 2924209833 453
571 iso_pu_bacteria 2924214083 2924216897 453
572 iso_pu_bacteria 2924221636 2924227566 453
573 iso_pu_bacteria 2924228884 2924230598 453
574 iso_pu_bacteria 2926754445 2926759516 453
575 iso_pu_bacteria 2926760298 2926765508 453
576 iso_pu_bacteria 2933594066 2933598762 453
577 iso_pu_bacteria 2936996657 2937001911 453
578 iso_pu_bacteria 2937002841 2937004198 453
579 iso_pu_bacteria 2937009748 2937011651 453
580 iso_pu_bacteria 2937016420 2937017853 453
581 iso_pu_bacteria 2937023124 2937028740 453
582 iso_pu_bacteria 2937029754 2937035322 453
583 iso_pu_bacteria 2937036028 2937040091 453
584 iso_pu_bacteria 2937042894 2937046523 453
585 iso_pu_bacteria 2937049772 2937052011 453
586 iso_pu_bacteria 2937056579 2937057640 453
587 iso_pu_bacteria 2937063883 2937065881 453
588 iso_pu_bacteria 2937071275 2937077864 453
589 iso_pu_bacteria 2937078374 2937079115 453
590 iso_pu_bacteria 2937084907 2937085032 453
591 iso_pu_bacteria 2937091812 2937097184 453
592 iso_pu_bacteria 2937098957 2937102182 453
593 iso_pu_bacteria 2937106411 2937107492 453
594 iso_pu_bacteria 2937113482 2937116749 453
595 iso_pu_bacteria 2937119839 2937125092 453
596 iso_pu_bacteria 2937126314 2937132134 453
597 iso_pu_bacteria 2941499720 2941505350 453
598 iso_pu_bacteria 2957375807 2957376162 453
599 iso_pu_bacteria 2957382221 2957385287 453
600 iso_pu_bacteria 2957388812 2957394403 453
601 iso_pu_bacteria 2957395598 2957402293 453
602 iso_pu_bacteria 2957402308 2957405709 453
603 iso_pu_bacteria 2957408893 2957410419 453
604 iso_pu_bacteria 2957415311 2957415321 453
605 iso_pu_bacteria 2957422303 2957423374 453
606 iso_pu_bacteria 2957430029 2957434971 453
607 iso_pu_bacteria 2957437181 2957440884 453
608 iso_pu_bacteria 2957450854 2957453573 453
609 iso_pu_bacteria 2957457609 2957459284 453
610 iso_pu_bacteria 2957464669 2957465858 453
611 iso_pu_bacteria 2957471148 2957471736 453
612 iso_pu_bacteria 2957478035 2957482119 453
613 iso_pu_bacteria 2957484790 2957484962 453
614 iso_pu_bacteria 2957491536 2957495688 453
615 iso_pu_bacteria 2957498199 2957502739 453
616 iso_pu_bacteria 2957505466 2957510466 453
617 iso_pu_bacteria 2960584000 2960588520 453
618 iso_pu_bacteria 2960591022 2960597543 453
619 iso_pu_bacteria 2960597568 2960601495 453
620 iso_pu_bacteria 2960603979 2960605111 453
621 iso_pu_bacteria 2960610863 2960614531 453
622 iso_pu_bacteria 2960624210 2960628421 453
623 iso_pu_bacteria 2960631154 2960636737 453
624 iso_pu_bacteria 2960637947 2960639972 453
625 iso_pu_bacteria 2960645483 2960650666 453
626 iso_pu_bacteria 2960652885 2960654049 453
627 iso_pu_bacteria 2960667422 2960670557 453
628 iso_pu_bacteria 2960680706 2960686241 453
629 iso_pu_bacteria 2960687367 2960690175 453
630 iso_pu_bacteria 2960693952 2960696997 453
631 iso_pu_bacteria 2964607997 2964609173 453
632 iso_pu_bacteria 2964615318 2964621889 453
633 iso_pu_bacteria 2964621998 2964628555 453
634 iso_pu_bacteria 2964628898 2964634609 453
635 iso_pu_bacteria 2964636051 2964641500 453
636 iso_pu_bacteria 2964643177 2964645802 453
637 iso_pu_bacteria 2964649959 2964654339 453
638 iso_pu_bacteria 2964656573 2964658405 453
639 iso_pu_bacteria 2964663802 2964666461 453
640 iso_pu_bacteria 2964670856 2964673013 453
641 iso_pu_bacteria 2964678106 2964682581 453
642 iso_pu_bacteria 2964685014 2964691433 453
643 iso_pu_bacteria 2964691889 2964697423 453
644 iso_pu_bacteria 2964698721 2964703089 453
645 iso_pu_bacteria 2964705432 2964711590 453
646 iso_pu_bacteria 2964712639 2964715867 453
647 iso_pu_bacteria 2964719344 2964721389 453
648 iso_pu_bacteria 2967664464 2967665895 453
649 iso_pu_bacteria 2967671571 2967672693 453
650 iso_pu_bacteria 2967678726 2967682291 453
651 iso_pu_bacteria 2967686174 2967689854 453
652 iso_pu_bacteria 2967693043 2967697712 453
653 iso_pu_bacteria 2967699805 2967702315 453
654 iso_pu_bacteria 2967706974 2967707366 453
655 iso_pu_bacteria 2967714385 2967718460 453
656 iso_pu_bacteria 2967721400 2967727791 453
657 iso_pu_bacteria 2967728569 2967733262 453
658 iso_pu_bacteria 2967735183 2967740779 453
659 iso_pu_bacteria 2967742019 2967748414 453
660 iso_pu_bacteria 2967748971 2967751376 453
661 iso_pu_bacteria 2967755722 2967761555 453
662 iso_pu_bacteria 2967762386 2967764822 453
663 iso_pu_bacteria 2967769361 2967771726 453
664 iso_pu_bacteria 2967775926 2967778865 453
665 iso_pu_bacteria 2970019648 2970023153 453
666 iso_pu_bacteria 2970026789 2970031432 453
667 iso_pu_bacteria 2970033650 2970035288 453
668 iso_pu_bacteria 2970040964 2970044643 453
669 iso_pu_bacteria 2970047711 2970050383 453
670 iso_pu_bacteria 2970054988 2970060478 453
671 iso_pu_bacteria 2970061556 2970068391 453
672 iso_pu_bacteria 2970068827 2970070427 453
673 iso_pu_bacteria 2970076120 2970079018 453
674 iso_pu_bacteria 2970088815 2970094450 453
675 iso_pu_bacteria 2970095765 2970102034 453
676 iso_pu_bacteria 2970102677 2970108245 453
677 iso_pu_bacteria 2970109326 2970114942 453
678 iso_pu_bacteria 2970116247 2970119794 453
679 iso_pu_bacteria 2970122695 2970127880 453
680 iso_pu_bacteria 2970129317 2970133902 453
681 iso_pu_bacteria 2970136068 2970142552 453
682 iso_pu_bacteria 2970143518 2970147876 453
683 iso_pu_bacteria 2970149975 2970155330 453
684 iso_pu_bacteria 2970156795 2970161994 453
685 iso_pu_bacteria 2970164137 2970168586 453
686 iso_pu_bacteria 2970170962 2970176352 453
687 iso_pu_bacteria 2970177841 2970181636 453
688 iso_pu_bacteria 2970184632 2970184659 453
689 iso_pu_bacteria 2970191845 2970197248 453
690 iso_pu_bacteria 2977516862 2977522369 453
691 iso_pu_bacteria 2977530762 2977536595 453
692 iso_pu_bacteria 2977537788 2977542514 453
693 iso_pu_bacteria 2977544691 2977548698 453
694 iso_pu_bacteria 2977551784 2977554967 453
695 iso_pu_bacteria 2977558990 2977559818 453
696 iso_pu_bacteria 2977565890 2977568565 453
697 iso_pu_bacteria 2977572785 2977577741 453
698 iso_pu_bacteria 2977579622 2977583816 453
699 iso_pu_bacteria 2978969890 2978970161 453
700 iso_pu_bacteria 2984587000 2984587188 453
701 iso_pu_bacteria 648276728 648739277 453
702 iso_pu_bacteria 8003992118 8003998381 453
703 iso_pu_bacteria 8003999396 8004005123 453
704 iso_pu_bacteria 8049293176 8049297708 453
705 3300048913 Ga0496110_0234656 Ga0496110_0234656_209_1573 454
706 3300048914 Ga0496111_0003186 Ga0496111_0003186_2562_3926 454
707 3300048927 Ga0496124_0167740 Ga0496124_0167740_241_1605 454
708 iso_pu_bacteria 2599185156 2599335276 455
709 3300002987 JGI25159J45721_1000024 JGI25159J45721_100002443 457
710 3300003323 rootH1_10280334 rootH1_102803342 457
711 3300003354 JGI25160J50197_1000063 JGI25160J50197_100006373 457
712 3300003374 JGI25161J50226_1000358 JGI25161J50226_100035810 457
713 3300003771 Ga0055526_1003144 Ga0055526_10031445 457
714 3300004625 Ga0055543_1000197 Ga0055543_100019715 457
715 3300005262 Ga0065165_1000163 Ga0065165_100016342 457
716 3300006186 Ga0075369_10010085 Ga0075369_100100854 457
717 3300006948 Ga0099826_10000042 Ga0099826_1000004222 457
718 3300006948 Ga0099826_10016476 Ga0099826_100164763 457
719 3300009092 Ga0105250_10040531 Ga0105250_100405312 457
720 3300013249 Ga0171463_1005 Ga0171463_1005220 457
721 3300015690 Ga0183363_1026 Ga0183363_102612 457
722 3300022739 Ga0228711_1005616 Ga0228711_100561621 457
723 3300022740 Ga0228710_1003183 Ga0228710_100318326 457
724 3300025208 Ga0209436_100188 Ga0209436_10018823 457
725 3300025284 Ga0209130_1000138 Ga0209130_100013838 457
726 3300025292 Ga0209676_1017779 Ga0209676_10177792 457
727 3300025294 Ga0209025_1000602 Ga0209025_100060219 457
728 3300025295 Ga0209564_1000250 Ga0209564_100025068 457
729 3300025298 Ga0209050_1006059 Ga0209050_10060599 457
730 3300025299 Ga0209256_1000623 Ga0209256_100062322 457
731 3300025302 Ga0207426_1000255 Ga0207426_100025538 457
732 3300025304 Ga0209257_1009054 Ga0209257_10090542 457
733 3300025304 Ga0209257_1019456 Ga0209257_10194562 457
734 3300025935 Ga0207709_10014320 Ga0207709_100143203 457
735 3300027111 Ga0209281_1000640 Ga0209281_100064012 457
736 3300027111 Ga0209281_1000934 Ga0209281_10009348 457
737 3300027312 Ga0209371_1000003 Ga0209371_1000003992 457
738 3300027666 Ga0209282_1000049 Ga0209282_100004967 457
739 3300027666 Ga0209282_1000065 Ga0209282_100006578 457
740 3300028794 Ga0307515_10007595 Ga0307515_1000759514 457
741 3300030500 Ga0268256_1000004 Ga0268256_100000461 457
742 3300030744 Ga0316181_1099231 Ga0316181_10992313 457
743 3300031456 Ga0307513_10008185 Ga0307513_1000818511 457
744 3300031852 Ga0307410_10183478 Ga0307410_101834781 457
745 3300031967 Ga0315914_1000005 Ga0315914_1000005150 457
746 3300033430 Ga0315913_1001476 Ga0315913_100147626 457
747 3300033464 Ga0315915_1000004 Ga0315915_1000004180 457
748 3300046522 Ga0495643_0037842 Ga0495643_0037842_493_1881 457
749 3300046660 Ga0495625_0045996 Ga0495625_0045996_1726_3105 457
750 3300046674 Ga0495588_0004598 Ga0495588_0004598_780_2159 457
751 3300047470 Ga0495681_0007392 Ga0495681_0007392_3858_5237 457
752 3300048909 Ga0496106_0000336 Ga0496106_0000336_12263_13717 457
753 3300048919 Ga0496116_0000042 Ga0496116_0000042_312098_313477 457
754 3300048920 Ga0496117_0000033 Ga0496117_0000033_151021_152400 457
755 3300048920 Ga0496117_0054884 Ga0496117_0054884_606_1985 457
756 3300048921 Ga0496118_0012983 Ga0496118_0012983_949_2403 457
757 3300048921 Ga0496118_0043993 Ga0496118_0043993_1100_2479 457
758 3300048924 Ga0496121_0145848 Ga0496121_0145848_354_1733 457
759 3300048927 Ga0496124_0008260 Ga0496124_0008260_830_2209 457
760 3300048928 Ga0496125_0008739 Ga0496125_0008739_8550_9938 457
761 3300048929 Ga0496126_0000053 Ga0496126_0000053_8407_9786 457
762 3300048929 Ga0496126_0062520 Ga0496126_0062520_1810_3189 457
763 3300050516 nmdc:mga0sz30_28667_c1 nmdc:mga0sz30_28667_c1_587_1975 457
764 3300053107 Ga0500560_002138 Ga0500560_002138_2090_3490 457
765 3300053134 Ga0500658_0003054 Ga0500658_0003054_2846_4300 457
766 3300053139 Ga0500568_0000230 Ga0500568_0000230_33884_35338 457
767 3300053153 Ga0500616_0000134 Ga0500616_0000134_127533_128912 457
768 3300053153 Ga0500616_0000564 Ga0500616_0000564_7719_9098 457
769 3300053157 Ga0500624_001152 Ga0500624_001152_503_1903 457
770 3300053160 Ga0500633_0001107 Ga0500633_0001107_1742_3196 457
771 3300053161 Ga0500634_0065545 Ga0500634_0065545_328_1728 457
772 iso_pu_bacteria 2516143018 2516206331 457
773 iso_pu_bacteria 2979100975 2979102025 457
774 iso_pu_bacteria 2984509177 2984510028 457
775 iso_pu_bacteria 2984518228 2984519271 457
776 iso_pu_bacteria 2984537506 2984538369 457
777 iso_pu_bacteria 2984601300 2984605094 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22046

DUF6936

Family of unknown function (DUF6936)

34

464

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kia-assembly2.cif.gz_B nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9832 1 439
6ki9-assembly2.cif.gz_B apo structure of fabmg, novel types of enoyl-acyl carrier protein reductase 0.9826 1 441
6kia-assembly2.cif.gz_B nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9788 1 439
6kia-assembly3.cif.gz_C nadh bound structure of fabmg, novel type of enoyl-acyl carrier protein reductase 0.9734 1 437
6ki9-assembly3.cif.gz_C apo structure of fabmg, novel types of enoyl-acyl carrier protein reductase 0.9717 1 437
ID Description Score Start End Superfamily
1vivB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.7728 14 54 3.40.50.10490
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7387 16 83 3.40.50.720
af_I1MXX4_25_354_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7357 16 51 3.40.1190.20
4bjhB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.7258 16 82 3.40.50.1370
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.694 18 310 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2QY24-F1-model_v4 Uncharacterized protein 0.9912 1 439
AF-A0A7X7LWX0-F1-model_v4 Uncharacterized protein 0.989 95 437
AF-A0A1J5R7I7-F1-model_v4 Uncharacterized protein 0.9876 1 437
AF-H4F2C2-F1-model_v4 Uncharacterized protein 0.9873 1 386
AF-A0A498F7X6-F1-model_v4 deleted 0.9859 262 437

Feature Viewer

pLDDT pTM Quality
90.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map