F480358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 325 | 766 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10304044|Ga0075364_103040442 |
| Length | 176 |
| Sequence | MSARRRPRVRIAARDERGPERAGSRGDEHWDIEIRPHLTPYFAYGAAALILAVHIAVGALLKISSTGVIFQTADQVAIALLGAVIACAVLLFARPRLRVGAAGVSVRNLFGYKLIPWTDVVDVSFPRGARWARVDLPDDEYIPVMAIQAVDKERAVDAMDRVRALLDRYRPDINSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 3 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 4 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 9 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 10 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 11 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 12 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 228 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 231 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 316 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 321 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 323 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.7 |
| Nodule | 0.13 |
| Rhizoplane | 12.87 |
| Rhizosphere | 64.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1016072 | 3300000546 | Bacteria | 797 |
| 2 | JGI24746J21847_1006043 | 3300001977 | Bacteria | 1882 |
| 3 | JGI24739J22299_10064480 | 3300001989 | Bacteria | 1151 |
| 4 | JGI24737J22298_10090771 | 3300001990 | Bacteria | 906 |
| 5 | JGI24743J22301_10021518 | 3300001991 | Bacteria | 1233 |
| 6 | JGI24735J21928_10083349 | 3300002067 | Bacteria | 916 |
| 7 | JGI24749J21850_1018715 | 3300002076 | Bacteria | 978 |
| 8 | JGI24749J21850_1044622 | 3300002076 | Bacteria | 653 |
| 9 | JGI24744J21845_10004357 | 3300002077 | Bacteria | 2924 |
| 10 | JGI24744J21845_10007935 | 3300002077 | Bacteria | 2191 |
| 11 | JGI24744J21845_10015062 | 3300002077 | Bacteria | 1548 |
| 12 | JGI24034J26672_10010318 | 3300002239 | Bacteria | 1386 |
| 13 | JGI24742J22300_10002543 | 3300002244 | Bacteria | 2911 |
| 14 | Ga0055540_1001444 | 3300003792 | Bacteria | 14165 |
| 15 | Ga0055540_1005035 | 3300003792 | Bacteria | 5732 |
| 16 | Ga0055540_1012894 | 3300003792 | Bacteria | 2593 |
| 17 | Ga0055540_1056085 | 3300003792 | Bacteria | 799 |
| 18 | Ga0070676_10538825 | 3300005328 | Bacteria | 834 |
| 19 | Ga0070683_100621571 | 3300005329 | Bacteria | 1034 |
| 20 | Ga0070690_100047180 | 3300005330 | Bacteria | 2740 |
| 21 | Ga0068869_100014192 | 3300005334 | Bacteria | 5318 |
| 22 | Ga0068869_100021458 | 3300005334 | Bacteria | 4443 |
| 23 | Ga0070666_10017351 | 3300005335 | Bacteria | 4615 |
| 24 | Ga0070666_10839131 | 3300005335 | Bacteria | 678 |
| 25 | Ga0070680_100571885 | 3300005336 | Bacteria | 969 |
| 26 | Ga0070682_100015100 | 3300005337 | Bacteria | 4471 |
| 27 | Ga0070682_100028988 | 3300005337 | Bacteria | 3332 |
| 28 | Ga0070682_100403360 | 3300005337 | Bacteria | 1035 |
| 29 | Ga0070682_101232325 | 3300005337 | Bacteria | 633 |
| 30 | Ga0068868_100084285 | 3300005338 | Bacteria | 2552 |
| 31 | Ga0068868_100319478 | 3300005338 | Bacteria | 1322 |
| 32 | Ga0068868_100605980 | 3300005338 | Bacteria | 971 |
| 33 | Ga0070660_100202387 | 3300005339 | Bacteria | 1611 |
| 34 | Ga0070660_100642937 | 3300005339 | Bacteria | 888 |
| 35 | Ga0070689_100015826 | 3300005340 | Bacteria | 5510 |
| 36 | Ga0070689_100255938 | 3300005340 | Bacteria | 1446 |
| 37 | Ga0070691_10010731 | 3300005341 | Bacteria | 4181 |
| 38 | Ga0070691_10260552 | 3300005341 | Bacteria | 933 |
| 39 | Ga0070687_100099851 | 3300005343 | Bacteria | 1623 |
| 40 | Ga0070668_100005011 | 3300005347 | Bacteria | 9812 |
| 41 | Ga0070668_100009916 | 3300005347 | Bacteria | 7054 |
| 42 | Ga0070668_100390653 | 3300005347 | Bacteria | 1186 |
| 43 | Ga0070669_100089039 | 3300005353 | Bacteria | 2311 |
| 44 | Ga0070669_100103632 | 3300005353 | Bacteria | 2150 |
| 45 | Ga0070671_100187674 | 3300005355 | Bacteria | 1752 |
| 46 | Ga0070671_100597002 | 3300005355 | Bacteria | 954 |
| 47 | Ga0070674_100001944 | 3300005356 | Bacteria | 11278 |
| 48 | Ga0070673_100021193 | 3300005364 | Bacteria | 4704 |
| 49 | Ga0070673_100054699 | 3300005364 | Bacteria | 3141 |
| 50 | Ga0070688_100145899 | 3300005365 | Bacteria | 1612 |
| 51 | Ga0070688_101180909 | 3300005365 | Bacteria | 614 |
| 52 | Ga0070659_100093615 | 3300005366 | Bacteria | 2411 |
| 53 | Ga0070659_100932193 | 3300005366 | Bacteria | 760 |
| 54 | Ga0070659_101517014 | 3300005366 | Bacteria | 597 |
| 55 | Ga0070667_100000034 | 3300005367 | Bacteria | 173652 |
| 56 | Ga0070667_100126662 | 3300005367 | Bacteria | 2226 |
| 57 | Ga0070667_100220122 | 3300005367 | Bacteria | 1690 |
| 58 | Ga0070667_100298323 | 3300005367 | Bacteria | 1451 |
| 59 | Ga0070667_100328445 | 3300005367 | Bacteria | 1381 |
| 60 | Ga0070703_10019787 | 3300005406 | Bacteria | 1954 |
| 61 | Ga0070709_10056517 | 3300005434 | Bacteria | 2482 |
| 62 | Ga0070714_100172700 | 3300005435 | Bacteria | 1962 |
| 63 | Ga0070713_100713552 | 3300005436 | Bacteria | 958 |
| 64 | Ga0070710_10011300 | 3300005437 | Bacteria | 4409 |
| 65 | Ga0070710_10167820 | 3300005437 | Bacteria | 1366 |
| 66 | Ga0070701_10002180 | 3300005438 | Bacteria | 7459 |
| 67 | Ga0070711_100007630 | 3300005439 | Bacteria | 6585 |
| 68 | Ga0070711_100025360 | 3300005439 | Bacteria | 3878 |
| 69 | Ga0070705_100024507 | 3300005440 | Bacteria | 3258 |
| 70 | Ga0070705_100079075 | 3300005440 | Bacteria | 2013 |
| 71 | Ga0070700_100002262 | 3300005441 | Bacteria | 9793 |
| 72 | Ga0070700_100146862 | 3300005441 | Bacteria | 1608 |
| 73 | Ga0070694_100056180 | 3300005444 | Bacteria | 2673 |
| 74 | Ga0070708_100759264 | 3300005445 | Bacteria | 912 |
| 75 | Ga0070663_100011976 | 3300005455 | Bacteria | 5471 |
| 76 | Ga0070663_100014779 | 3300005455 | Bacteria | 5018 |
| 77 | Ga0070663_100057979 | 3300005455 | Bacteria | 2779 |
| 78 | Ga0070663_100118814 | 3300005455 | Bacteria | 1994 |
| 79 | Ga0070678_100024985 | 3300005456 | Bacteria | 4010 |
| 80 | Ga0070678_100375048 | 3300005456 | Bacteria | 1229 |
| 81 | Ga0070662_100004152 | 3300005457 | Bacteria | 9112 |
| 82 | Ga0070662_100059388 | 3300005457 | Bacteria | 2785 |
| 83 | Ga0068867_100009518 | 3300005459 | Bacteria | 6854 |
| 84 | Ga0070685_10020941 | 3300005466 | Bacteria | 3546 |
| 85 | Ga0070685_10266754 | 3300005466 | Bacteria | 1141 |
| 86 | Ga0070707_100293042 | 3300005468 | Bacteria | 1581 |
| 87 | Ga0068853_100006384 | 3300005539 | Bacteria | 9365 |
| 88 | Ga0068853_100402088 | 3300005539 | Bacteria | 1282 |
| 89 | Ga0070672_100137072 | 3300005543 | Bacteria | 2016 |
| 90 | Ga0070672_100522179 | 3300005543 | Bacteria | 1029 |
| 91 | Ga0070686_100024436 | 3300005544 | Bacteria | 3622 |
| 92 | Ga0070686_100103057 | 3300005544 | Bacteria | 1931 |
| 93 | Ga0070695_100024070 | 3300005545 | Bacteria | 3749 |
| 94 | Ga0070696_100011765 | 3300005546 | Bacteria | 5864 |
| 95 | Ga0070696_100133650 | 3300005546 | Bacteria | 1808 |
| 96 | Ga0070693_100006684 | 3300005547 | Bacteria | 5599 |
| 97 | Ga0070693_100035141 | 3300005547 | Bacteria | 2777 |
| 98 | Ga0070665_100032433 | 3300005548 | Bacteria | 5257 |
| 99 | Ga0070665_100093943 | 3300005548 | Bacteria | 3004 |
| 100 | Ga0070665_100243167 | 3300005548 | Bacteria | 1800 |
| 101 | Ga0070665_100330910 | 3300005548 | Bacteria | 1528 |
| 102 | Ga0070704_100009105 | 3300005549 | Bacteria | 5991 |
| 103 | Ga0070704_100368296 | 3300005549 | Bacteria | 1217 |
| 104 | Ga0068855_100144282 | 3300005563 | Bacteria | 2711 |
| 105 | Ga0068855_100605270 | 3300005563 | Bacteria | 1181 |
| 106 | Ga0070664_100265141 | 3300005564 | Bacteria | 1546 |
| 107 | Ga0068857_100453718 | 3300005577 | Bacteria | 1199 |
| 108 | Ga0068854_100003350 | 3300005578 | Bacteria | 9987 |
| 109 | Ga0068854_100459025 | 3300005578 | Bacteria | 1065 |
| 110 | Ga0068854_100547591 | 3300005578 | Bacteria | 981 |
| 111 | Ga0068856_100515414 | 3300005614 | Bacteria | 1217 |
| 112 | Ga0068856_100816258 | 3300005614 | Bacteria | 952 |
| 113 | Ga0070702_100005590 | 3300005615 | Bacteria | 5877 |
| 114 | Ga0070702_100053368 | 3300005615 | Bacteria | 2322 |
| 115 | Ga0070702_100559856 | 3300005615 | Bacteria | 850 |
| 116 | Ga0070702_100798590 | 3300005615 | Bacteria | 729 |
| 117 | Ga0068852_100220505 | 3300005616 | Bacteria | 1803 |
| 118 | Ga0068852_100365629 | 3300005616 | Bacteria | 1412 |
| 119 | Ga0068852_100653140 | 3300005616 | Bacteria | 1059 |
| 120 | Ga0068859_100000228 | 3300005617 | Bacteria | 55135 |
| 121 | Ga0068859_100007849 | 3300005617 | Bacteria | 10832 |
| 122 | Ga0068859_100039310 | 3300005617 | Bacteria | 4745 |
| 123 | Ga0068859_100674713 | 3300005617 | Bacteria | 1125 |
| 124 | Ga0068864_100191743 | 3300005618 | Bacteria | 1874 |
| 125 | Ga0068864_100269860 | 3300005618 | Bacteria | 1585 |
| 126 | Ga0068864_100369965 | 3300005618 | Bacteria | 1356 |
| 127 | Ga0068866_10007629 | 3300005718 | Bacteria | 4535 |
| 128 | Ga0068866_10135103 | 3300005718 | Bacteria | 1408 |
| 129 | Ga0068861_100101529 | 3300005719 | Bacteria | 2288 |
| 130 | Ga0068861_100184404 | 3300005719 | Bacteria | 1739 |
| 131 | Ga0068861_100696235 | 3300005719 | Bacteria | 944 |
| 132 | Ga0068861_101106013 | 3300005719 | Bacteria | 762 |
| 133 | Ga0068851_10042165 | 3300005834 | Bacteria | 2297 |
| 134 | Ga0068851_10096254 | 3300005834 | Bacteria | 1565 |
| 135 | Ga0068870_10270109 | 3300005840 | Bacteria | 1062 |
| 136 | Ga0068863_100000320 | 3300005841 | Bacteria | 48819 |
| 137 | Ga0068863_100005646 | 3300005841 | Bacteria | 12282 |
| 138 | Ga0068863_100068366 | 3300005841 | Bacteria | 3360 |
| 139 | Ga0068858_100007891 | 3300005842 | Bacteria | 10259 |
| 140 | Ga0068858_100096673 | 3300005842 | Bacteria | 2753 |
| 141 | Ga0068858_100535526 | 3300005842 | Bacteria | 1133 |
| 142 | Ga0068860_100000011 | 3300005843 | Bacteria | 328172 |
| 143 | Ga0068860_100010227 | 3300005843 | Bacteria | 9284 |
| 144 | Ga0068860_100235042 | 3300005843 | Bacteria | 1781 |
| 145 | Ga0068862_100000012 | 3300005844 | Bacteria | 267598 |
| 146 | Ga0068862_100004860 | 3300005844 | Bacteria | 11312 |
| 147 | Ga0068862_100374372 | 3300005844 | Bacteria | 1327 |
| 148 | Ga0068862_100518262 | 3300005844 | Bacteria | 1134 |
| 149 | Ga0068862_101400941 | 3300005844 | Bacteria | 702 |
| 150 | Ga0081455_10082195 | 3300005937 | Bacteria | 2635 |
| 151 | Ga0081455_10093089 | 3300005937 | Bacteria | 2437 |
| 152 | Ga0081455_10606130 | 3300005937 | Bacteria | 713 |
| 153 | Ga0081455_10640939 | 3300005937 | Bacteria | 686 |
| 154 | Ga0081538_10237713 | 3300005981 | Bacteria | 705 |
| 155 | Ga0070717_11267887 | 3300006028 | Bacteria | 670 |
| 156 | Ga0075365_10011053 | 3300006038 | Bacteria | 5292 |
| 157 | Ga0075365_10034360 | 3300006038 | Bacteria | 3274 |
| 158 | Ga0075365_10089639 | 3300006038 | Bacteria | 2094 |
| 159 | Ga0075365_10090150 | 3300006038 | Bacteria | 2088 |
| 160 | Ga0075365_10094517 | 3300006038 | Bacteria | 2040 |
| 161 | Ga0075365_10402863 | 3300006038 | Bacteria | 966 |
| 162 | Ga0075368_10002796 | 3300006042 | Bacteria | 5762 |
| 163 | Ga0075363_100001106 | 3300006048 | Bacteria | 9786 |
| 164 | Ga0075363_100001667 | 3300006048 | Bacteria | 8585 |
| 165 | Ga0075363_100005000 | 3300006048 | Bacteria | 5863 |
| 166 | Ga0075363_100005230 | 3300006048 | Bacteria | 5751 |
| 167 | Ga0075363_100005940 | 3300006048 | Bacteria | 5503 |
| 168 | Ga0075363_100037318 | 3300006048 | Bacteria | 2552 |
| 169 | Ga0075363_100105208 | 3300006048 | Bacteria | 1565 |
| 170 | Ga0075363_100123025 | 3300006048 | Bacteria | 1450 |
| 171 | Ga0075363_100137173 | 3300006048 | Bacteria | 1375 |
| 172 | Ga0075363_100221553 | 3300006048 | Bacteria | 1084 |
| 173 | Ga0075364_10000519 | 3300006051 | Bacteria | 19573 |
| 174 | Ga0075364_10005336 | 3300006051 | Bacteria | 7462 |
| 175 | Ga0075364_10008221 | 3300006051 | Bacteria | 6229 |
| 176 | Ga0075364_10022592 | 3300006051 | Bacteria | 3974 |
| 177 | Ga0075364_10049494 | 3300006051 | Bacteria | 2741 |
| 178 | Ga0075364_10062065 | 3300006051 | Bacteria | 2452 |
| 179 | Ga0075364_10067012 | 3300006051 | Bacteria | 2359 |
| 180 | Ga0075364_10227969 | 3300006051 | Bacteria | 1265 |
| 181 | Ga0075364_10304044 | 3300006051 | Bacteria | 1086 |
| 182 | Ga0070715_10019983 | 3300006163 | Bacteria | 2576 |
| 183 | Ga0070715_10037584 | 3300006163 | Bacteria | 2004 |
| 184 | Ga0070716_100040134 | 3300006173 | Bacteria | 2602 |
| 185 | Ga0070716_100075126 | 3300006173 | Bacteria | 1999 |
| 186 | Ga0070716_100435816 | 3300006173 | Bacteria | 951 |
| 187 | Ga0070712_100002115 | 3300006175 | Bacteria | 12210 |
| 188 | Ga0070712_100026519 | 3300006175 | Bacteria | 3861 |
| 189 | Ga0070712_100240452 | 3300006175 | Bacteria | 1442 |
| 190 | Ga0075362_10030400 | 3300006177 | Bacteria | 2332 |
| 191 | Ga0075362_10071424 | 3300006177 | Bacteria | 1586 |
| 192 | Ga0075362_10087347 | 3300006177 | Bacteria | 1444 |
| 193 | Ga0075362_10104333 | 3300006177 | Bacteria | 1328 |
| 194 | Ga0075362_10140004 | 3300006177 | Bacteria | 1156 |
| 195 | Ga0075367_10001891 | 3300006178 | Bacteria | 9270 |
| 196 | Ga0075367_10136534 | 3300006178 | Bacteria | 1517 |
| 197 | Ga0075367_10165850 | 3300006178 | Bacteria | 1375 |
| 198 | Ga0075367_10509311 | 3300006178 | Bacteria | 764 |
| 199 | Ga0075369_10000939 | 3300006186 | Bacteria | 9690 |
| 200 | Ga0075369_10002016 | 3300006186 | Bacteria | 7157 |
| 201 | Ga0075369_10003852 | 3300006186 | Bacteria | 5502 |
| 202 | Ga0075369_10025356 | 3300006186 | Bacteria | 2464 |
| 203 | Ga0075369_10034411 | 3300006186 | Bacteria | 2150 |
| 204 | Ga0075369_10034496 | 3300006186 | Bacteria | 2148 |
| 205 | Ga0075369_10035905 | 3300006186 | Bacteria | 2108 |
| 206 | Ga0075369_10105133 | 3300006186 | Bacteria | 1269 |
| 207 | Ga0075369_10238579 | 3300006186 | Bacteria | 843 |
| 208 | Ga0075366_10243700 | 3300006195 | Bacteria | 1096 |
| 209 | Ga0097621_100294195 | 3300006237 | Bacteria | 1432 |
| 210 | Ga0097621_101610940 | 3300006237 | Bacteria | 617 |
| 211 | Ga0075370_10002684 | 3300006353 | Bacteria | 8325 |
| 212 | Ga0075370_10005575 | 3300006353 | Bacteria | 6275 |
| 213 | Ga0075370_10044254 | 3300006353 | Bacteria | 2517 |
| 214 | Ga0075370_10048770 | 3300006353 | Bacteria | 2399 |
| 215 | Ga0075370_10056226 | 3300006353 | Bacteria | 2236 |
| 216 | Ga0075370_10186384 | 3300006353 | Bacteria | 1222 |
| 217 | Ga0068871_100309700 | 3300006358 | Bacteria | 1388 |
| 218 | Ga0075428_100010284 | 3300006844 | Bacteria | 10385 |
| 219 | Ga0075428_101303178 | 3300006844 | Bacteria | 764 |
| 220 | Ga0075430_100100421 | 3300006846 | Bacteria | 2417 |
| 221 | Ga0075430_100413142 | 3300006846 | Bacteria | 1114 |
| 222 | Ga0075431_100244794 | 3300006847 | Bacteria | 1823 |
| 223 | Ga0068865_100034950 | 3300006881 | Bacteria | 3376 |
| 224 | Ga0068865_100157012 | 3300006881 | Bacteria | 1731 |
| 225 | Ga0068865_100857652 | 3300006881 | Bacteria | 787 |
| 226 | Ga0097620_100000228 | 3300006931 | Bacteria | 55135 |
| 227 | Ga0097620_100007849 | 3300006931 | Bacteria | 10832 |
| 228 | Ga0097620_100039311 | 3300006931 | Bacteria | 4745 |
| 229 | Ga0097620_100674709 | 3300006931 | Bacteria | 1125 |
| 230 | Ga0111539_10709038 | 3300009094 | Bacteria | 1171 |
| 231 | Ga0111539_10912619 | 3300009094 | Bacteria | 1021 |
| 232 | Ga0111539_10961095 | 3300009094 | Bacteria | 993 |
| 233 | Ga0105245_10018331 | 3300009098 | Bacteria | 6120 |
| 234 | Ga0105245_10273917 | 3300009098 | Bacteria | 1647 |
| 235 | Ga0105245_11046233 | 3300009098 | Bacteria | 861 |
| 236 | Ga0105245_11296449 | 3300009098 | Bacteria | 777 |
| 237 | Ga0105247_10000007 | 3300009101 | Bacteria | 409490 |
| 238 | Ga0105247_10000493 | 3300009101 | Bacteria | 32730 |
| 239 | Ga0105247_10173461 | 3300009101 | Bacteria | 1435 |
| 240 | Ga0114129_10020186 | 3300009147 | Bacteria | 9482 |
| 241 | Ga0105243_10025411 | 3300009148 | Bacteria | 4526 |
| 242 | Ga0105243_10070887 | 3300009148 | Bacteria | 2816 |
| 243 | Ga0105242_10006143 | 3300009176 | Bacteria | 9259 |
| 244 | Ga0105242_10301618 | 3300009176 | Bacteria | 1462 |
| 245 | Ga0105242_10555989 | 3300009176 | Bacteria | 1101 |
| 246 | Ga0105248_10000040 | 3300009177 | Bacteria | 172452 |
| 247 | Ga0105248_10160150 | 3300009177 | Bacteria | 2539 |
| 248 | Ga0105248_10940165 | 3300009177 | Bacteria | 976 |
| 249 | Ga0105237_10000866 | 3300009545 | Bacteria | 41152 |
| 250 | Ga0105237_10375541 | 3300009545 | Bacteria | 1426 |
| 251 | Ga0105237_10398496 | 3300009545 | Bacteria | 1381 |
| 252 | Ga0105237_10446775 | 3300009545 | Bacteria | 1299 |
| 253 | Ga0105237_12042926 | 3300009545 | Bacteria | 582 |
| 254 | Ga0105238_10269447 | 3300009551 | Bacteria | 1683 |
| 255 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 256 | Ga0105249_10004967 | 3300009553 | Bacteria | 11471 |
| 257 | Ga0105249_10798033 | 3300009553 | Bacteria | 1008 |
| 258 | Ga0105249_11513330 | 3300009553 | Bacteria | 743 |
| 259 | Ga0105147_104579 | 3300009982 | Bacteria | 1161 |
| 260 | Ga0105239_10024187 | 3300010375 | Bacteria | 6690 |
| 261 | Ga0105239_10042937 | 3300010375 | Bacteria | 4954 |
| 262 | Ga0105239_10286403 | 3300010375 | Bacteria | 1855 |
| 263 | Ga0105239_10340499 | 3300010375 | Bacteria | 1692 |
| 264 | Ga0105239_10464204 | 3300010375 | Bacteria | 1437 |
| 265 | Ga0105239_10823587 | 3300010375 | Bacteria | 1064 |
| 266 | Ga0105246_10013593 | 3300011119 | Bacteria | 5107 |
| 267 | Ga0105246_10701295 | 3300011119 | Bacteria | 887 |
| 268 | Ga0157342_1045623 | 3300012507 | Bacteria | 601 |
| 269 | Ga0157371_10481776 | 3300013102 | Bacteria | 915 |
| 270 | Ga0157369_11428547 | 3300013105 | Bacteria | 704 |
| 271 | Ga0157374_10023631 | 3300013296 | Bacteria | 5500 |
| 272 | Ga0157374_10253847 | 3300013296 | Bacteria | 1731 |
| 273 | Ga0157378_10018019 | 3300013297 | Bacteria | 6199 |
| 274 | Ga0157378_10268135 | 3300013297 | Bacteria | 1641 |
| 275 | Ga0157378_11627735 | 3300013297 | Bacteria | 692 |
| 276 | Ga0163162_10043694 | 3300013306 | Bacteria | 4487 |
| 277 | Ga0163162_10147662 | 3300013306 | Bacteria | 2468 |
| 278 | Ga0163162_10308997 | 3300013306 | Bacteria | 1713 |
| 279 | Ga0163162_10509934 | 3300013306 | Bacteria | 1333 |
| 280 | Ga0157372_10083603 | 3300013307 | Bacteria | 3616 |
| 281 | Ga0157375_10001035 | 3300013308 | Bacteria | 24005 |
| 282 | Ga0157375_10156949 | 3300013308 | Bacteria | 2415 |
| 283 | Ga0157375_10381060 | 3300013308 | Bacteria | 1577 |
| 284 | Ga0163163_10017990 | 3300014325 | Bacteria | 6602 |
| 285 | Ga0163163_10032189 | 3300014325 | Bacteria | 5065 |
| 286 | Ga0163163_10478876 | 3300014325 | Bacteria | 1306 |
| 287 | Ga0157380_10002208 | 3300014326 | Bacteria | 13091 |
| 288 | Ga0157377_10287703 | 3300014745 | Bacteria | 1080 |
| 289 | Ga0157379_10008394 | 3300014968 | Bacteria | 8976 |
| 290 | Ga0157379_10253806 | 3300014968 | Bacteria | 1597 |
| 291 | Ga0157379_10734985 | 3300014968 | Bacteria | 928 |
| 292 | Ga0163161_10006898 | 3300017792 | Bacteria | 7857 |
| 293 | Ga0163161_10743909 | 3300017792 | Bacteria | 820 |
| 294 | Ga0213876_10034716 | 3300021384 | Bacteria | 2660 |
| 295 | Ga0209673_1003496 | 3300025273 | Bacteria | 9211 |
| 296 | Ga0209051_1000200 | 3300025303 | Bacteria | 106484 |
| 297 | Ga0209051_1002041 | 3300025303 | Bacteria | 15342 |
| 298 | Ga0209051_1005266 | 3300025303 | Bacteria | 7621 |
| 299 | Ga0209051_1026542 | 3300025303 | Bacteria | 2331 |
| 300 | Ga0209051_1049909 | 3300025303 | Bacteria | 1406 |
| 301 | Ga0207653_10041015 | 3300025885 | Bacteria | 1519 |
| 302 | Ga0207692_10167999 | 3300025898 | Bacteria | 1269 |
| 303 | Ga0207692_10253428 | 3300025898 | Bacteria | 1055 |
| 304 | Ga0207642_10008087 | 3300025899 | Bacteria | 3588 |
| 305 | Ga0207642_10309132 | 3300025899 | Bacteria | 919 |
| 306 | Ga0207710_10000013 | 3300025900 | Bacteria | 409402 |
| 307 | Ga0207710_10153070 | 3300025900 | Bacteria | 1120 |
| 308 | Ga0207688_10010649 | 3300025901 | Bacteria | 5002 |
| 309 | Ga0207688_10015766 | 3300025901 | Bacteria | 4098 |
| 310 | Ga0207680_10014650 | 3300025903 | Bacteria | 4067 |
| 311 | Ga0207680_10228538 | 3300025903 | Bacteria | 1278 |
| 312 | Ga0207647_10045862 | 3300025904 | Bacteria | 2725 |
| 313 | Ga0207647_10079686 | 3300025904 | Bacteria | 1965 |
| 314 | Ga0207685_10066279 | 3300025905 | Bacteria | 1448 |
| 315 | Ga0207685_10068956 | 3300025905 | Bacteria | 1427 |
| 316 | Ga0207699_10069286 | 3300025906 | Bacteria | 2150 |
| 317 | Ga0207699_10127692 | 3300025906 | Bacteria | 1654 |
| 318 | Ga0207645_10047657 | 3300025907 | Bacteria | 2736 |
| 319 | Ga0207643_10066300 | 3300025908 | Bacteria | 2070 |
| 320 | Ga0207705_10636927 | 3300025909 | Bacteria | 829 |
| 321 | Ga0207671_10132980 | 3300025914 | Bacteria | 1911 |
| 322 | Ga0207671_10262858 | 3300025914 | Bacteria | 1358 |
| 323 | Ga0207693_10000948 | 3300025915 | Bacteria | 25998 |
| 324 | Ga0207693_10013160 | 3300025915 | Bacteria | 6675 |
| 325 | Ga0207663_10009277 | 3300025916 | Bacteria | 5191 |
| 326 | Ga0207663_10026527 | 3300025916 | Bacteria | 3365 |
| 327 | Ga0207660_10113609 | 3300025917 | Bacteria | 2042 |
| 328 | Ga0207662_10024982 | 3300025918 | Bacteria | 3439 |
| 329 | Ga0207657_10133271 | 3300025919 | Bacteria | 2035 |
| 330 | Ga0207646_11058461 | 3300025922 | Bacteria | 715 |
| 331 | Ga0207681_10110026 | 3300025923 | Bacteria | 2002 |
| 332 | Ga0207681_10456651 | 3300025923 | Bacteria | 1040 |
| 333 | Ga0207694_10722446 | 3300025924 | Bacteria | 840 |
| 334 | Ga0207687_10030076 | 3300025927 | Bacteria | 3659 |
| 335 | Ga0207687_10392614 | 3300025927 | Bacteria | 1139 |
| 336 | Ga0207687_10451954 | 3300025927 | Bacteria | 1066 |
| 337 | Ga0207687_10689127 | 3300025927 | Bacteria | 866 |
| 338 | Ga0207687_10902654 | 3300025927 | Bacteria | 756 |
| 339 | Ga0207700_10914555 | 3300025928 | Bacteria | 785 |
| 340 | Ga0207664_10111151 | 3300025929 | Bacteria | 2279 |
| 341 | Ga0207664_11001729 | 3300025929 | Bacteria | 749 |
| 342 | Ga0207644_10545481 | 3300025931 | Bacteria | 959 |
| 343 | Ga0207690_10007157 | 3300025932 | Bacteria | 6627 |
| 344 | Ga0207690_11237244 | 3300025932 | Bacteria | 624 |
| 345 | Ga0207706_10016408 | 3300025933 | Bacteria | 6688 |
| 346 | Ga0207686_10030154 | 3300025934 | Bacteria | 3208 |
| 347 | Ga0207686_10381371 | 3300025934 | Bacteria | 1069 |
| 348 | Ga0207709_10009685 | 3300025935 | Bacteria | 5308 |
| 349 | Ga0207709_10102360 | 3300025935 | Bacteria | 1896 |
| 350 | Ga0207709_10607808 | 3300025935 | Bacteria | 866 |
| 351 | Ga0207670_10013309 | 3300025936 | Bacteria | 4845 |
| 352 | Ga0207670_10145492 | 3300025936 | Bacteria | 1752 |
| 353 | Ga0207669_10001996 | 3300025937 | Bacteria | 8658 |
| 354 | Ga0207669_10277860 | 3300025937 | Bacteria | 1261 |
| 355 | Ga0207669_11340357 | 3300025937 | Bacteria | 608 |
| 356 | Ga0207704_10010210 | 3300025938 | Bacteria | 4568 |
| 357 | Ga0207704_10672084 | 3300025938 | Bacteria | 855 |
| 358 | Ga0207665_10007002 | 3300025939 | Bacteria | 7464 |
| 359 | Ga0207665_10024371 | 3300025939 | Bacteria | 3989 |
| 360 | Ga0207665_10033302 | 3300025939 | Bacteria | 3414 |
| 361 | Ga0207691_10127600 | 3300025940 | Bacteria | 2249 |
| 362 | Ga0207691_10159759 | 3300025940 | Bacteria | 1978 |
| 363 | Ga0207711_10000209 | 3300025941 | Bacteria | 62724 |
| 364 | Ga0207711_10033962 | 3300025941 | Bacteria | 4318 |
| 365 | Ga0207689_10017604 | 3300025942 | Bacteria | 6040 |
| 366 | Ga0207689_10041021 | 3300025942 | Bacteria | 3830 |
| 367 | Ga0207667_10076012 | 3300025949 | Bacteria | 3486 |
| 368 | Ga0207667_10848935 | 3300025949 | Bacteria | 907 |
| 369 | Ga0207651_10036194 | 3300025960 | Bacteria | 3220 |
| 370 | Ga0207651_10112616 | 3300025960 | Bacteria | 2046 |
| 371 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 372 | Ga0207712_10041899 | 3300025961 | Bacteria | 3150 |
| 373 | Ga0207712_10294139 | 3300025961 | Bacteria | 1330 |
| 374 | Ga0207712_10575184 | 3300025961 | Bacteria | 972 |
| 375 | Ga0207668_10005506 | 3300025972 | Bacteria | 7464 |
| 376 | Ga0207668_10018853 | 3300025972 | Bacteria | 4349 |
| 377 | Ga0207668_10144274 | 3300025972 | Bacteria | 1835 |
| 378 | Ga0207668_10250880 | 3300025972 | Bacteria | 1437 |
| 379 | Ga0207640_10047319 | 3300025981 | Bacteria | 2773 |
| 380 | Ga0207640_10263309 | 3300025981 | Bacteria | 1345 |
| 381 | Ga0207658_10000108 | 3300025986 | Bacteria | 90165 |
| 382 | Ga0207658_10020469 | 3300025986 | Bacteria | 4580 |
| 383 | Ga0207658_10050864 | 3300025986 | Bacteria | 3051 |
| 384 | Ga0207658_10068289 | 3300025986 | Bacteria | 2681 |
| 385 | Ga0207658_10351811 | 3300025986 | Bacteria | 1283 |
| 386 | Ga0207658_10381050 | 3300025986 | Bacteria | 1235 |
| 387 | Ga0207677_10016974 | 3300026023 | Bacteria | 4326 |
| 388 | Ga0207677_10017772 | 3300026023 | Bacteria | 4250 |
| 389 | Ga0207703_10036116 | 3300026035 | Bacteria | 3931 |
| 390 | Ga0207703_10362910 | 3300026035 | Bacteria | 1336 |
| 391 | Ga0207639_10042240 | 3300026041 | Bacteria | 3416 |
| 392 | Ga0207639_10299536 | 3300026041 | Bacteria | 1421 |
| 393 | Ga0207639_10362555 | 3300026041 | Bacteria | 1297 |
| 394 | Ga0207678_10007087 | 3300026067 | Bacteria | 9946 |
| 395 | Ga0207678_10034146 | 3300026067 | Bacteria | 4431 |
| 396 | Ga0207678_10035547 | 3300026067 | Bacteria | 4338 |
| 397 | Ga0207678_10062998 | 3300026067 | Bacteria | 3187 |
| 398 | Ga0207678_10905667 | 3300026067 | Bacteria | 780 |
| 399 | Ga0207708_10003344 | 3300026075 | Bacteria | 11820 |
| 400 | Ga0207708_10006244 | 3300026075 | Bacteria | 8828 |
| 401 | Ga0207702_10414466 | 3300026078 | Bacteria | 1301 |
| 402 | Ga0207702_10508455 | 3300026078 | Bacteria | 1175 |
| 403 | Ga0207641_10005726 | 3300026088 | Bacteria | 10557 |
| 404 | Ga0207641_10012181 | 3300026088 | Bacteria | 7058 |
| 405 | Ga0207641_10029726 | 3300026088 | Bacteria | 4520 |
| 406 | Ga0207648_10001826 | 3300026089 | Bacteria | 23274 |
| 407 | Ga0207676_10137481 | 3300026095 | Bacteria | 2087 |
| 408 | Ga0207675_100011768 | 3300026118 | Bacteria | 8178 |
| 409 | Ga0207675_100027774 | 3300026118 | Bacteria | 5271 |
| 410 | Ga0207675_100064794 | 3300026118 | Bacteria | 3416 |
| 411 | Ga0207675_100564577 | 3300026118 | Bacteria | 1138 |
| 412 | Ga0207683_10001024 | 3300026121 | Bacteria | 25508 |
| 413 | Ga0207683_10122181 | 3300026121 | Bacteria | 2339 |
| 414 | Ga0207698_10071151 | 3300026142 | Bacteria | 2759 |
| 415 | Ga0209813_10005434 | 3300027866 | Bacteria | 3091 |
| 416 | Ga0268266_10056976 | 3300028379 | Bacteria | 3362 |
| 417 | Ga0268266_10062458 | 3300028379 | Bacteria | 3215 |
| 418 | Ga0268266_10379472 | 3300028379 | Bacteria | 1333 |
| 419 | Ga0268266_10685847 | 3300028379 | Bacteria | 987 |
| 420 | Ga0268265_10000016 | 3300028380 | Bacteria | 299380 |
| 421 | Ga0268265_10048080 | 3300028380 | Bacteria | 3200 |
| 422 | Ga0268265_10722276 | 3300028380 | Bacteria | 964 |
| 423 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 424 | Ga0268264_10021522 | 3300028381 | Bacteria | 5264 |
| 425 | Ga0268264_10701565 | 3300028381 | Bacteria | 1005 |
| 426 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 427 | Ga0265327_10002053 | 3300031251 | Bacteria | 22609 |
| 428 | Ga0265327_10126243 | 3300031251 | Bacteria | 1207 |
| 429 | Ga0265327_10174082 | 3300031251 | Bacteria | 987 |
| 430 | Ga0307405_10631643 | 3300031731 | Bacteria | 878 |
| 431 | Ga0307413_10016069 | 3300031824 | Bacteria | 3854 |
| 432 | Ga0307413_10082161 | 3300031824 | Bacteria | 2069 |
| 433 | Ga0307413_10427393 | 3300031824 | Bacteria | 1045 |
| 434 | Ga0307410_10180794 | 3300031852 | Bacteria | 1597 |
| 435 | Ga0307410_10225154 | 3300031852 | Bacteria | 1445 |
| 436 | Ga0307410_10284492 | 3300031852 | Bacteria | 1299 |
| 437 | Ga0307410_10371595 | 3300031852 | Bacteria | 1148 |
| 438 | Ga0307406_10039793 | 3300031901 | Bacteria | 2919 |
| 439 | Ga0307407_10173583 | 3300031903 | Bacteria | 1422 |
| 440 | Ga0307407_10255008 | 3300031903 | Bacteria | 1204 |
| 441 | Ga0307407_10456682 | 3300031903 | Bacteria | 928 |
| 442 | Ga0307407_10500600 | 3300031903 | Bacteria | 890 |
| 443 | Ga0307409_100090404 | 3300031995 | Bacteria | 2506 |
| 444 | Ga0307409_100782706 | 3300031995 | Bacteria | 960 |
| 445 | Ga0307416_100098703 | 3300032002 | Bacteria | 2534 |
| 446 | Ga0307416_102090707 | 3300032002 | Bacteria | 668 |
| 447 | Ga0307415_100037888 | 3300032126 | Bacteria | 3173 |
| 448 | Ga0307415_100545590 | 3300032126 | Bacteria | 1022 |
| 449 | Ga0373930_0220684 | 3300034816 | Bacteria | 500 |
| 450 | Ga0373948_0059635 | 3300034817 | Bacteria | 836 |
| 451 | Ga0373951_0058853 | 3300035091 | Bacteria | 959 |
| 452 | Ga0373960_0069639 | 3300035121 | Bacteria | 1085 |
| 453 | Ga0373961_0155025 | 3300035241 | Bacteria | 783 |
| 454 | Ga0373962_0123458 | 3300035242 | Bacteria | 828 |
| 455 | Ga0373962_0130515 | 3300035242 | Bacteria | 809 |
| 456 | Ga0373962_0160256 | 3300035242 | Bacteria | 742 |
| 457 | Ga0373931_0009696 | 3300035691 | Bacteria | 4611 |
| 458 | Ga0373931_0043047 | 3300035691 | Bacteria | 2376 |
| 459 | Ga0373927_0592017 | 3300035695 | Bacteria | 733 |
| 460 | Ga0436364_0966796 | 3300037853 | Bacteria | 16733 |
| 461 | Ga0436364_1054040 | 3300037853 | Bacteria | 4546 |
| 462 | Ga0436365_0424244 | 3300039437 | Bacteria | 7088 |
| 463 | Ga0436365_1310270 | 3300039437 | Bacteria | 662 |
| 464 | Ga0436365_1543341 | 3300039437 | Bacteria | 16498 |
| 465 | Ga0436365_1555470 | 3300039437 | Bacteria | 33349 |
| 466 | Ga0436361_0832440 | 3300039447 | Bacteria | 1955 |
| 467 | Ga0436363_0119995 | 3300039450 | Bacteria | 1068 |
| 468 | Ga0436363_0910126 | 3300039450 | Bacteria | 2340 |
| 469 | Ga0436363_1592980 | 3300039450 | Bacteria | 585 |
| 470 | Ga0439461_0000129 | 3300041410 | Bacteria | 10026 |
| 471 | Ga0439461_0007029 | 3300041410 | Bacteria | 1980 |
| 472 | Ga0439466_0003642 | 3300041411 | Bacteria | 5945 |
| 473 | Ga0439466_0037815 | 3300041411 | Bacteria | 1623 |
| 474 | Ga0439465_0002557 | 3300041413 | Bacteria | 5923 |
| 475 | Ga0439465_0002704 | 3300041413 | Bacteria | 5799 |
| 476 | Ga0451791_1631205 | 3300041451 | Bacteria | 1280 |
| 477 | Ga0451793_0430583 | 3300041452 | Bacteria | 3537 |
| 478 | Ga0451793_1320588 | 3300041452 | Bacteria | 1100 |
| 479 | Ga0451795_1369390 | 3300041456 | Bacteria | 942 |
| 480 | Ga0451802_0792079 | 3300041460 | Bacteria | 1161 |
| 481 | Ga0451806_395821 | 3300041462 | Bacteria | 1634 |
| 482 | Ga0451807_2344173 | 3300041486 | Bacteria | 610 |
| 483 | Ga0451855_0424312 | 3300041511 | Bacteria | 644 |
| 484 | Ga0451853_3841286 | 3300041512 | Bacteria | 635 |
| 485 | Ga0439431_0000843 | 3300041997 | Bacteria | 6619 |
| 486 | Ga0439433_0047126 | 3300041999 | Bacteria | 1012 |
| 487 | Ga0439442_036881 | 3300042002 | Bacteria | 1024 |
| 488 | Ga0439442_046221 | 3300042002 | Bacteria | 917 |
| 489 | Ga0439445_0005872 | 3300042004 | Bacteria | 2807 |
| 490 | Ga0439445_0020704 | 3300042004 | Bacteria | 1648 |
| 491 | Ga0439450_082279 | 3300042008 | Bacteria | 802 |
| 492 | Ga0439454_071921 | 3300042011 | Bacteria | 615 |
| 493 | Ga0439434_0000169 | 3300042435 | Bacteria | 17768 |
| 494 | Ga0439434_0012056 | 3300042435 | Bacteria | 2555 |
| 495 | Ga0466972_0025814 | 3300044658 | Bacteria | 2911 |
| 496 | Ga0466965_0014993 | 3300044683 | Bacteria | 3676 |
| 497 | Ga0466965_0031112 | 3300044683 | Bacteria | 2601 |
| 498 | Ga0466966_0001732 | 3300044684 | Bacteria | 14107 |
| 499 | Ga0466966_0016069 | 3300044684 | Bacteria | 4949 |
| 500 | Ga0466966_0120382 | 3300044684 | Bacteria | 1612 |
| 501 | Ga0466961_0021624 | 3300044693 | Bacteria | 4139 |
| 502 | Ga0466961_0039446 | 3300044693 | Bacteria | 3027 |
| 503 | Ga0466961_0052430 | 3300044693 | Bacteria | 2603 |
| 504 | Ga0466963_0047750 | 3300044694 | Bacteria | 2826 |
| 505 | Ga0466963_0147297 | 3300044694 | Bacteria | 1634 |
| 506 | Ga0466963_0196471 | 3300044694 | Bacteria | 1410 |
| 507 | Ga0466963_0206769 | 3300044694 | Bacteria | 1373 |
| 508 | Ga0466964_0021875 | 3300044706 | Bacteria | 2476 |
| 509 | Ga0466964_0259735 | 3300044706 | Bacteria | 860 |
| 510 | Ga0466971_0062730 | 3300044719 | Bacteria | 1682 |
| 511 | Ga0466971_0090341 | 3300044719 | Bacteria | 1402 |
| 512 | Ga0466968_0020629 | 3300044735 | Bacteria | 2661 |
| 513 | Ga0466968_0065731 | 3300044735 | Bacteria | 1570 |
| 514 | Ga0466968_0457203 | 3300044735 | Bacteria | 632 |
| 515 | Ga0466970_0010728 | 3300044765 | Bacteria | 4657 |
| 516 | Ga0466970_0013308 | 3300044765 | Bacteria | 4217 |
| 517 | Ga0466970_0017448 | 3300044765 | Bacteria | 3710 |
| 518 | Ga0466970_0170753 | 3300044765 | Bacteria | 1205 |
| 519 | Ga0466957_0025981 | 3300044842 | Bacteria | 3473 |
| 520 | Ga0466957_0786047 | 3300044842 | Bacteria | 675 |
| 521 | Ga0466960_0000554 | 3300044901 | Bacteria | 12872 |
| 522 | Ga0466960_0070711 | 3300044901 | Bacteria | 1737 |
| 523 | Ga0466959_0012702 | 3300045049 | Bacteria | 6091 |
| 524 | Ga0466959_0058987 | 3300045049 | Bacteria | 2795 |
| 525 | Ga0466959_0276527 | 3300045049 | Bacteria | 1153 |
| 526 | Ga0466959_0701103 | 3300045049 | Bacteria | 678 |
| 527 | Ga0466958_0007264 | 3300045836 | Bacteria | 6079 |
| 528 | Ga0466958_0013044 | 3300045836 | Bacteria | 4723 |
| 529 | Ga0466958_0065276 | 3300045836 | Bacteria | 2221 |
| 530 | Ga0466967_0059467 | 3300045976 | Bacteria | 3383 |
| 531 | Ga0466967_0138283 | 3300045976 | Bacteria | 2267 |
| 532 | Ga0466967_0140305 | 3300045976 | Bacteria | 2250 |
| 533 | Ga0466967_0233509 | 3300045976 | Bacteria | 1752 |
| 534 | Ga0466967_0570928 | 3300045976 | Bacteria | 1114 |
| 535 | Ga0466967_0775806 | 3300045976 | Bacteria | 951 |
| 536 | Ga0466967_0815958 | 3300045976 | Bacteria | 926 |
| 537 | Ga0466967_1486880 | 3300045976 | Bacteria | 675 |
| 538 | Ga0466967_2026026 | 3300045976 | Bacteria | 572 |
| 539 | Ga0495638_0000596 | 3300046460 | Bacteria | 40671 |
| 540 | Ga0495641_0020652 | 3300046461 | Bacteria | 3333 |
| 541 | Ga0495639_0157186 | 3300046475 | Bacteria | 1099 |
| 542 | Ga0495662_0054303 | 3300046476 | Bacteria | 1935 |
| 543 | Ga0495664_0364936 | 3300046477 | Bacteria | 869 |
| 544 | Ga0495594_0044634 | 3300046499 | Bacteria | 2432 |
| 545 | Ga0495606_0468762 | 3300046507 | Bacteria | 642 |
| 546 | Ga0495608_0307245 | 3300046511 | Bacteria | 981 |
| 547 | Ga0495648_0002584 | 3300046524 | Bacteria | 16584 |
| 548 | Ga0495648_0176045 | 3300046524 | Bacteria | 1092 |
| 549 | Ga0495654_0166168 | 3300046530 | Bacteria | 965 |
| 550 | Ga0495668_0024608 | 3300046616 | Bacteria | 3424 |
| 551 | Ga0495668_0108413 | 3300046616 | Bacteria | 1519 |
| 552 | Ga0495611_0104181 | 3300046648 | Bacteria | 1319 |
| 553 | Ga0495658_0209104 | 3300046683 | Bacteria | 1219 |
| 554 | Ga0495624_0026794 | 3300046690 | Bacteria | 3777 |
| 555 | Ga0495649_0050424 | 3300046694 | Bacteria | 2259 |
| 556 | Ga0495672_0002481 | 3300047320 | Bacteria | 16913 |
| 557 | Ga0495672_0024805 | 3300047320 | Bacteria | 3855 |
| 558 | Ga0495676_0045082 | 3300047321 | Bacteria | 3593 |
| 559 | Ga0495680_0790259 | 3300047322 | Bacteria | 621 |
| 560 | Ga0495673_0001087 | 3300047469 | Bacteria | 23738 |
| 561 | Ga0495686_0007307 | 3300047472 | Bacteria | 8299 |
| 562 | Ga0496100_0000112 | 3300048903 | Bacteria | 46798 |
| 563 | Ga0496100_0000510 | 3300048903 | Bacteria | 18704 |
| 564 | Ga0496100_0001466 | 3300048903 | Bacteria | 11542 |
| 565 | Ga0496100_0035795 | 3300048903 | Bacteria | 3126 |
| 566 | Ga0496100_0097257 | 3300048903 | Bacteria | 2021 |
| 567 | Ga0496100_0125524 | 3300048903 | Bacteria | 1801 |
| 568 | Ga0496100_0520717 | 3300048903 | Bacteria | 918 |
| 569 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 570 | Ga0496101_0000315 | 3300048904 | Bacteria | 33411 |
| 571 | Ga0496101_0001462 | 3300048904 | Bacteria | 14111 |
| 572 | Ga0496101_0016410 | 3300048904 | Bacteria | 5003 |
| 573 | Ga0496101_0122381 | 3300048904 | Bacteria | 1968 |
| 574 | Ga0496101_0157165 | 3300048904 | Bacteria | 1742 |
| 575 | Ga0496101_0378959 | 3300048904 | Bacteria | 1113 |
| 576 | Ga0496101_0390932 | 3300048904 | Bacteria | 1095 |
| 577 | Ga0496101_0647505 | 3300048904 | Bacteria | 835 |
| 578 | Ga0496101_0669690 | 3300048904 | Bacteria | 820 |
| 579 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 580 | Ga0496102_0000501 | 3300048905 | Bacteria | 43004 |
| 581 | Ga0496102_0006565 | 3300048905 | Bacteria | 9933 |
| 582 | Ga0496102_0024991 | 3300048905 | Bacteria | 5314 |
| 583 | Ga0496102_0034761 | 3300048905 | Bacteria | 4535 |
| 584 | Ga0496102_0069873 | 3300048905 | Bacteria | 3224 |
| 585 | Ga0496102_0071767 | 3300048905 | Bacteria | 3179 |
| 586 | Ga0496102_0175755 | 3300048905 | Bacteria | 2016 |
| 587 | Ga0496102_0281392 | 3300048905 | Bacteria | 1568 |
| 588 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 589 | Ga0496103_0002141 | 3300048906 | Bacteria | 12578 |
| 590 | Ga0496103_0021911 | 3300048906 | Bacteria | 3845 |
| 591 | Ga0496103_0390208 | 3300048906 | Bacteria | 894 |
| 592 | Ga0496103_0743167 | 3300048906 | Bacteria | 620 |
| 593 | Ga0496104_0004228 | 3300048907 | Bacteria | 12471 |
| 594 | Ga0496104_0016856 | 3300048907 | Bacteria | 6642 |
| 595 | Ga0496104_0085043 | 3300048907 | Bacteria | 3019 |
| 596 | Ga0496104_0380706 | 3300048907 | Bacteria | 1324 |
| 597 | Ga0496104_0544970 | 3300048907 | Bacteria | 1071 |
| 598 | Ga0496104_0594666 | 3300048907 | Bacteria | 1017 |
| 599 | Ga0496105_0016589 | 3300048908 | Bacteria | 5881 |
| 600 | Ga0496105_0030474 | 3300048908 | Bacteria | 4420 |
| 601 | Ga0496105_0182568 | 3300048908 | Bacteria | 1718 |
| 602 | Ga0496106_0001749 | 3300048909 | Bacteria | 16233 |
| 603 | Ga0496106_0005685 | 3300048909 | Bacteria | 9223 |
| 604 | Ga0496106_0015219 | 3300048909 | Bacteria | 5692 |
| 605 | Ga0496106_0030282 | 3300048909 | Bacteria | 4036 |
| 606 | Ga0496106_0107023 | 3300048909 | Bacteria | 2174 |
| 607 | Ga0496106_0279770 | 3300048909 | Bacteria | 1337 |
| 608 | Ga0496106_0407811 | 3300048909 | Bacteria | 1092 |
| 609 | Ga0496107_0002019 | 3300048910 | Bacteria | 12956 |
| 610 | Ga0496107_0002911 | 3300048910 | Bacteria | 11316 |
| 611 | Ga0496107_0011293 | 3300048910 | Bacteria | 6217 |
| 612 | Ga0496107_0162139 | 3300048910 | Bacteria | 1657 |
| 613 | Ga0496107_0251202 | 3300048910 | Bacteria | 1316 |
| 614 | Ga0496107_0304530 | 3300048910 | Bacteria | 1186 |
| 615 | Ga0496107_0453880 | 3300048910 | Bacteria | 952 |
| 616 | Ga0496108_0000513 | 3300048911 | Bacteria | 30303 |
| 617 | Ga0496108_0007236 | 3300048911 | Bacteria | 8996 |
| 618 | Ga0496108_0023945 | 3300048911 | Bacteria | 5026 |
| 619 | Ga0496108_0054449 | 3300048911 | Bacteria | 3357 |
| 620 | Ga0496108_0682171 | 3300048911 | Bacteria | 892 |
| 621 | Ga0496109_0002563 | 3300048912 | Bacteria | 15218 |
| 622 | Ga0496109_0012513 | 3300048912 | Bacteria | 7326 |
| 623 | Ga0496109_0012790 | 3300048912 | Bacteria | 7256 |
| 624 | Ga0496109_0013266 | 3300048912 | Bacteria | 7138 |
| 625 | Ga0496109_0135368 | 3300048912 | Bacteria | 2302 |
| 626 | Ga0496109_0192235 | 3300048912 | Bacteria | 1918 |
| 627 | Ga0496109_0246806 | 3300048912 | Bacteria | 1681 |
| 628 | Ga0496109_0275636 | 3300048912 | Bacteria | 1585 |
| 629 | Ga0496110_0004960 | 3300048913 | Bacteria | 10393 |
| 630 | Ga0496110_0015736 | 3300048913 | Bacteria | 6304 |
| 631 | Ga0496110_0300120 | 3300048913 | Bacteria | 1463 |
| 632 | Ga0496110_0548008 | 3300048913 | Bacteria | 1051 |
| 633 | Ga0496110_1587472 | 3300048913 | Bacteria | 564 |
| 634 | Ga0496111_0021711 | 3300048914 | Bacteria | 4485 |
| 635 | Ga0496111_0151036 | 3300048914 | Bacteria | 1723 |
| 636 | Ga0496111_0366415 | 3300048914 | Bacteria | 1066 |
| 637 | Ga0496112_0002229 | 3300048915 | Bacteria | 15469 |
| 638 | Ga0496112_0015830 | 3300048915 | Bacteria | 7048 |
| 639 | Ga0496112_0033418 | 3300048915 | Bacteria | 5001 |
| 640 | Ga0496112_0921916 | 3300048915 | Bacteria | 795 |
| 641 | Ga0496113_0010076 | 3300048916 | Bacteria | 6234 |
| 642 | Ga0496113_0030979 | 3300048916 | Bacteria | 3877 |
| 643 | Ga0496113_0179659 | 3300048916 | Bacteria | 1677 |
| 644 | Ga0496113_0237457 | 3300048916 | Bacteria | 1454 |
| 645 | Ga0496113_0355087 | 3300048916 | Bacteria | 1176 |
| 646 | Ga0496114_0000479 | 3300048917 | Bacteria | 29293 |
| 647 | Ga0496114_0003971 | 3300048917 | Bacteria | 11423 |
| 648 | Ga0496114_0006179 | 3300048917 | Bacteria | 9426 |
| 649 | Ga0496114_0154352 | 3300048917 | Bacteria | 1993 |
| 650 | Ga0496114_0589665 | 3300048917 | Bacteria | 980 |
| 651 | Ga0496115_0002801 | 3300048918 | Bacteria | 12532 |
| 652 | Ga0496115_0007561 | 3300048918 | Bacteria | 8003 |
| 653 | Ga0496115_0020340 | 3300048918 | Bacteria | 5119 |
| 654 | Ga0496115_0458935 | 3300048918 | Bacteria | 1028 |
| 655 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 656 | Ga0496116_0005329 | 3300048919 | Bacteria | 11985 |
| 657 | Ga0496116_0006143 | 3300048919 | Bacteria | 10982 |
| 658 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 659 | Ga0496117_0000998 | 3300048920 | Bacteria | 43288 |
| 660 | Ga0496117_0247465 | 3300048920 | Bacteria | 974 |
| 661 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 662 | Ga0496118_0002304 | 3300048921 | Bacteria | 25933 |
| 663 | Ga0496118_0009803 | 3300048921 | Bacteria | 9601 |
| 664 | Ga0496118_0304067 | 3300048921 | Bacteria | 874 |
| 665 | Ga0496119_0003459 | 3300048922 | Bacteria | 16379 |
| 666 | Ga0496119_0007190 | 3300048922 | Bacteria | 10085 |
| 667 | Ga0496120_0010528 | 3300048923 | Bacteria | 6443 |
| 668 | Ga0496120_0033242 | 3300048923 | Bacteria | 3100 |
| 669 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 670 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 671 | Ga0496122_0000132 | 3300048925 | Bacteria | 172228 |
| 672 | Ga0496122_0006467 | 3300048925 | Bacteria | 13439 |
| 673 | Ga0496123_0003386 | 3300048926 | Bacteria | 18000 |
| 674 | Ga0496123_0029070 | 3300048926 | Bacteria | 4080 |
| 675 | Ga0496124_0000106 | 3300048927 | Bacteria | 172511 |
| 676 | Ga0496124_0033104 | 3300048927 | Bacteria | 4551 |
| 677 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 678 | Ga0496125_0100641 | 3300048928 | Bacteria | 2130 |
| 679 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 680 | Ga0496126_0000236 | 3300048929 | Bacteria | 119350 |
| 681 | Ga0496126_0003944 | 3300048929 | Bacteria | 18155 |
| 682 | Ga0496126_0197109 | 3300048929 | Bacteria | 1702 |
| 683 | Ga0496126_0197114 | 3300048929 | Bacteria | 1702 |
| 684 | Ga0496126_0203640 | 3300048929 | Bacteria | 1669 |
| 685 | Ga0496126_0364227 | 3300048929 | Bacteria | 1180 |
| 686 | Ga0501032_0217655 | 3300049569 | Bacteria | 1243 |
| 687 | Ga0501032_0556543 | 3300049569 | Bacteria | 731 |
| 688 | Ga0501033_0225672 | 3300049570 | Bacteria | 1332 |
| 689 | Ga0501034_0093749 | 3300049571 | Bacteria | 2999 |
| 690 | Ga0501046_0408257 | 3300049580 | Bacteria | 980 |
| 691 | Ga0501047_0012606 | 3300049581 | Bacteria | 8010 |
| 692 | Ga0501070_0052271 | 3300049586 | Bacteria | 3391 |
| 693 | Ga0501070_0136418 | 3300049586 | Bacteria | 2026 |
| 694 | Ga0501035_0000162 | 3300049822 | Bacteria | 81903 |
| 695 | Ga0501035_0329784 | 3300049822 | Bacteria | 1281 |
| 696 | Ga0501044_0000166 | 3300049823 | Bacteria | 81728 |
| 697 | Ga0501044_1332092 | 3300049823 | Bacteria | 584 |
| 698 | nmdc:mga03683_130768_c1 | 3300050489 | Bacteria | 1123 |
| 699 | nmdc:mga03683_140134_c1 | 3300050489 | Bacteria | 1087 |
| 700 | nmdc:mga03683_22666_c1 | 3300050489 | Bacteria | 2436 |
| 701 | nmdc:mga03683_68736_c1 | 3300050489 | Bacteria | 1510 |
| 702 | nmdc:mga03n38_10684_c1 | 3300050490 | Bacteria | 3389 |
| 703 | nmdc:mga03n38_121342_c1 | 3300050490 | Bacteria | 1285 |
| 704 | nmdc:mga03n38_14025_c1 | 3300050490 | Bacteria | 3062 |
| 705 | nmdc:mga03n38_14464_c1 | 3300050490 | Bacteria | 3025 |
| 706 | nmdc:mga03n38_16819_c1 | 3300050490 | Bacteria | 2854 |
| 707 | nmdc:mga03n38_221042_c1 | 3300050490 | Bacteria | 989 |
| 708 | nmdc:mga03n38_27650_c1 | 3300050490 | Bacteria | 2355 |
| 709 | nmdc:mga03n38_45695_c1 | 3300050490 | Bacteria | 1930 |
| 710 | nmdc:mga03n38_5063_c1 | 3300050490 | Bacteria | 4447 |
| 711 | nmdc:mga03n38_98751_c1 | 3300050490 | Bacteria | 1405 |
| 712 | nmdc:mga00v17_103120_c1 | 3300050491 | Bacteria | 580 |
| 713 | nmdc:mga00v17_1449_c1 | 3300050491 | Bacteria | 12421 |
| 714 | nmdc:mga00v17_196160_c1 | 3300050491 | Bacteria | 1305 |
| 715 | nmdc:mga00v17_319061_c1 | 3300050491 | Bacteria | 1010 |
| 716 | nmdc:mga00v17_37308_c1 | 3300050491 | Bacteria | 2901 |
| 717 | nmdc:mga00v17_44518_c1 | 3300050491 | Bacteria | 2677 |
| 718 | nmdc:mga00v17_56391_c1 | 3300050491 | Bacteria | 2402 |
| 719 | nmdc:mga00v17_64964_c1 | 3300050491 | Bacteria | 2250 |
| 720 | nmdc:mga00v17_93234_c1 | 3300050491 | Bacteria | 1893 |
| 721 | nmdc:mga00v17_9855_c1 | 3300050491 | Bacteria | 5193 |
| 722 | nmdc:mga0yw44_131369_c1 | 3300050492 | Bacteria | 1621 |
| 723 | nmdc:mga0yw44_3380_c1 | 3300050492 | Bacteria | 7079 |
| 724 | nmdc:mga0yw44_4426_c1 | 3300050492 | Bacteria | 6441 |
| 725 | nmdc:mga0yw44_64949_c1 | 3300050492 | Bacteria | 2247 |
| 726 | nmdc:mga0yw44_762566_c1 | 3300050492 | Bacteria | 657 |
| 727 | nmdc:mga0yw44_81925_c1 | 3300050492 | Bacteria | 2024 |
| 728 | nmdc:mga06z11_227903_c1 | 3300050494 | Bacteria | 1091 |
| 729 | nmdc:mga06z11_593055_c1 | 3300050494 | Bacteria | 674 |
| 730 | nmdc:mga04h51_45531_c1 | 3300050495 | Bacteria | 1451 |
| 731 | nmdc:mga07m45_11568_c1 | 3300050496 | Bacteria | 4641 |
| 732 | nmdc:mga07m45_12285_c2 | 3300050496 | Bacteria | 1123 |
| 733 | nmdc:mga07m45_60788_c1 | 3300050496 | Bacteria | 2139 |
| 734 | nmdc:mga07m45_81568_c1 | 3300050496 | Bacteria | 1847 |
| 735 | nmdc:mga07m45_85722_c1 | 3300050496 | Bacteria | 1801 |
| 736 | nmdc:mga05p37_1084168_c1 | 3300050507 | Bacteria | 841 |
| 737 | nmdc:mga0qj67_468870_c1 | 3300050509 | Bacteria | 1014 |
| 738 | nmdc:mga0qj67_5742_c1 | 3300050509 | Bacteria | 9084 |
| 739 | nmdc:mga06r32_493483_c1 | 3300050510 | Bacteria | 1202 |
| 740 | nmdc:mga08y16_1863072_c1 | 3300050511 | Bacteria | 553 |
| 741 | nmdc:mga08y16_748663_c1 | 3300050511 | Bacteria | 973 |
| 742 | nmdc:mga0sz30_11873_c1 | 3300050516 | Bacteria | 3377 |
| 743 | nmdc:mga0sz30_14420_c1 | 3300050516 | Bacteria | 3110 |
| 744 | nmdc:mga0sz30_152693_c1 | 3300050516 | Bacteria | 1022 |
| 745 | nmdc:mga0sz30_159425_c1 | 3300050516 | Bacteria | 999 |
| 746 | nmdc:mga0sz30_2233_c1 | 3300050516 | Bacteria | 6925 |
| 747 | nmdc:mga0sz30_34217_c1 | 3300050516 | Bacteria | 2114 |
| 748 | nmdc:mga0sz30_406893_c1 | 3300050516 | Bacteria | 610 |
| 749 | nmdc:mga0sz30_4115_c1 | 3300050516 | Bacteria | 4755 |
| 750 | nmdc:mga0sz30_552136_c1 | 3300050516 | Bacteria | 520 |
| 751 | nmdc:mga0sz30_736_c1 | 3300050516 | Bacteria | 11963 |
| 752 | nmdc:mga0sz30_98735_c1 | 3300050516 | Bacteria | 1274 |
| 753 | Ga0500610_0039278 | 3300053079 | Bacteria | 2442 |
| 754 | Ga0500635_0000718 | 3300053080 | Bacteria | 8332 |
| 755 | Ga0495655_0035743 | 3300053083 | Bacteria | 1238 |
| 756 | Ga0500643_004567 | 3300053087 | Bacteria | 6201 |
| 757 | Ga0500644_0066707 | 3300053088 | Bacteria | 1285 |
| 758 | Ga0500556_0022834 | 3300053104 | Bacteria | 2036 |
| 759 | Ga0500562_040774 | 3300053108 | Bacteria | 1234 |
| 760 | Ga0500628_157244 | 3300053129 | Bacteria | 639 |
| 761 | Ga0500652_000967 | 3300053131 | Bacteria | 9493 |
| 762 | Ga0500604_0157913 | 3300053151 | Bacteria | 772 |
| 763 | Ga0500616_0005662 | 3300053153 | Bacteria | 8429 |
| 764 | Ga0500616_0021813 | 3300053153 | Bacteria | 3583 |
| 765 | Ga0466962_0008869 | 3300061719 | Bacteria | 4820 |
| 766 | Ga0466962_0084822 | 3300061719 | Bacteria | 1516 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041411 | Ga0439466_0003642 | Ga0439466_0003642_2190_2732 | 137 |
| 2 | 3300042002 | Ga0439442_036881 | Ga0439442_036881_379_921 | 137 |
| 3 | 3300031731 | Ga0307405_10631643 | Ga0307405_106316432 | 138 |
| 4 | 3300031824 | Ga0307413_10427393 | Ga0307413_104273932 | 138 |
| 5 | 3300031901 | Ga0307406_10039793 | Ga0307406_100397932 | 138 |
| 6 | 3300041410 | Ga0439461_0000129 | Ga0439461_0000129_3761_4303 | 138 |
| 7 | 3300041997 | Ga0439431_0000843 | Ga0439431_0000843_1070_1567 | 138 |
| 8 | 3300041999 | Ga0439433_0047126 | Ga0439433_0047126_362_859 | 138 |
| 9 | 3300042004 | Ga0439445_0005872 | Ga0439445_0005872_2200_2706 | 138 |
| 10 | 3300042435 | Ga0439434_0000169 | Ga0439434_0000169_8732_9229 | 138 |
| 11 | 3300031251 | Ga0265327_10000081 | Ga0265327_10000081195 | 141 |
| 12 | 3300048905 | Ga0496102_0281392 | Ga0496102_0281392_481_954 | 142 |
| 13 | 3300050490 | nmdc:mga03n38_10684_c1 | nmdc:mga03n38_10684_c1_1093_1521 | 142 |
| 14 | 3300050496 | nmdc:mga07m45_12285_c2 | nmdc:mga07m45_12285_c2_334_762 | 142 |
| 15 | 3300050516 | nmdc:mga0sz30_34217_c1 | nmdc:mga0sz30_34217_c1_955_1383 | 142 |
| 16 | 3300006051 | Ga0075364_10022592 | Ga0075364_100225924 | 143 |
| 17 | 3300050491 | nmdc:mga00v17_64964_c1 | nmdc:mga00v17_64964_c1_889_1395 | 143 |
| 18 | 3300053080 | Ga0500635_0000718 | Ga0500635_0000718_7829_8260 | 143 |
| 19 | iso_pu_bacteria | 2842134933 | 2842138020 | 144 |
| 20 | 3300039450 | Ga0436363_1592980 | Ga0436363_1592980_135_575 | 145 |
| 21 | iso_pu_bacteria | 2939582691 | 2939585891 | 145 |
| 22 | 3300044706 | Ga0466964_0259735 | Ga0466964_0259735_201_668 | 146 |
| 23 | 3300006038 | Ga0075365_10034360 | Ga0075365_100343602 | 147 |
| 24 | 3300006186 | Ga0075369_10002016 | Ga0075369_100020168 | 147 |
| 25 | 3300039437 | Ga0436365_0424244 | Ga0436365_0424244_5302_5754 | 147 |
| 26 | 3300046524 | Ga0495648_0002584 | Ga0495648_0002584_877_1320 | 147 |
| 27 | 3300046530 | Ga0495654_0166168 | Ga0495654_0166168_79_522 | 147 |
| 28 | 3300046616 | Ga0495668_0024608 | Ga0495668_0024608_1718_2161 | 147 |
| 29 | 3300046648 | Ga0495611_0104181 | Ga0495611_0104181_37_480 | 147 |
| 30 | 3300047320 | Ga0495672_0002481 | Ga0495672_0002481_1734_2177 | 147 |
| 31 | 3300047469 | Ga0495673_0001087 | Ga0495673_0001087_10155_10598 | 147 |
| 32 | 3300050492 | nmdc:mga0yw44_81925_c1 | nmdc:mga0yw44_81925_c1_1087_1560 | 147 |
| 33 | 3300050516 | nmdc:mga0sz30_2233_c1 | nmdc:mga0sz30_2233_c1_2310_2765 | 147 |
| 34 | 3300005844 | Ga0068862_101400941 | Ga0068862_1014009412 | 148 |
| 35 | 3300006038 | Ga0075365_10402863 | Ga0075365_104028632 | 148 |
| 36 | 3300006048 | Ga0075363_100005940 | Ga0075363_1000059405 | 148 |
| 37 | 3300006048 | Ga0075363_100123025 | Ga0075363_1001230252 | 148 |
| 38 | 3300006048 | Ga0075363_100137173 | Ga0075363_1001371732 | 148 |
| 39 | 3300006048 | Ga0075363_100221553 | Ga0075363_1002215532 | 148 |
| 40 | 3300006051 | Ga0075364_10008221 | Ga0075364_100082213 | 148 |
| 41 | 3300006051 | Ga0075364_10067012 | Ga0075364_100670123 | 148 |
| 42 | 3300006177 | Ga0075362_10087347 | Ga0075362_100873472 | 148 |
| 43 | 3300006177 | Ga0075362_10140004 | Ga0075362_101400041 | 148 |
| 44 | 3300006353 | Ga0075370_10005575 | Ga0075370_100055755 | 148 |
| 45 | 3300009094 | Ga0111539_10961095 | Ga0111539_109610952 | 148 |
| 46 | 3300009982 | Ga0105147_104579 | Ga0105147_1045792 | 148 |
| 47 | 3300013105 | Ga0157369_11428547 | Ga0157369_114285471 | 148 |
| 48 | 3300025961 | Ga0207712_10294139 | Ga0207712_102941392 | 148 |
| 49 | 3300031251 | Ga0265327_10126243 | Ga0265327_101262432 | 148 |
| 50 | 3300031824 | Ga0307413_10016069 | Ga0307413_100160694 | 148 |
| 51 | 3300031824 | Ga0307413_10082161 | Ga0307413_100821613 | 148 |
| 52 | 3300031852 | Ga0307410_10180794 | Ga0307410_101807943 | 148 |
| 53 | 3300031852 | Ga0307410_10371595 | Ga0307410_103715952 | 148 |
| 54 | 3300031903 | Ga0307407_10173583 | Ga0307407_101735831 | 148 |
| 55 | 3300031995 | Ga0307409_100090404 | Ga0307409_1000904043 | 148 |
| 56 | 3300032002 | Ga0307416_100098703 | Ga0307416_1000987033 | 148 |
| 57 | 3300032002 | Ga0307416_102090707 | Ga0307416_1020907072 | 148 |
| 58 | 3300032126 | Ga0307415_100037888 | Ga0307415_1000378882 | 148 |
| 59 | 3300032126 | Ga0307415_100545590 | Ga0307415_1005455902 | 148 |
| 60 | 3300035121 | Ga0373960_0069639 | Ga0373960_0069639_113_583 | 148 |
| 61 | 3300039447 | Ga0436361_0832440 | Ga0436361_0832440_1129_1653 | 148 |
| 62 | 3300044683 | Ga0466965_0031112 | Ga0466965_0031112_1316_1765 | 148 |
| 63 | 3300044684 | Ga0466966_0120382 | Ga0466966_0120382_214_663 | 148 |
| 64 | 3300044693 | Ga0466961_0039446 | Ga0466961_0039446_1650_2099 | 148 |
| 65 | 3300044706 | Ga0466964_0021875 | Ga0466964_0021875_1364_1813 | 148 |
| 66 | 3300044719 | Ga0466971_0090341 | Ga0466971_0090341_328_777 | 148 |
| 67 | 3300044735 | Ga0466968_0457203 | Ga0466968_0457203_91_540 | 148 |
| 68 | 3300044765 | Ga0466970_0013308 | Ga0466970_0013308_113_562 | 148 |
| 69 | 3300044842 | Ga0466957_0786047 | Ga0466957_0786047_216_665 | 148 |
| 70 | 3300045049 | Ga0466959_0058987 | Ga0466959_0058987_396_845 | 148 |
| 71 | 3300045049 | Ga0466959_0701103 | Ga0466959_0701103_35_484 | 148 |
| 72 | 3300045836 | Ga0466958_0065276 | Ga0466958_0065276_1316_1765 | 148 |
| 73 | 3300045976 | Ga0466967_0138283 | Ga0466967_0138283_582_1031 | 148 |
| 74 | 3300049586 | Ga0501070_0052271 | Ga0501070_0052271_2139_2588 | 148 |
| 75 | 3300050489 | nmdc:mga03683_68736_c1 | nmdc:mga03683_68736_c1_745_1194 | 148 |
| 76 | 3300050490 | nmdc:mga03n38_121342_c1 | nmdc:mga03n38_121342_c1_308_757 | 148 |
| 77 | 3300050490 | nmdc:mga03n38_45695_c1 | nmdc:mga03n38_45695_c1_644_1093 | 148 |
| 78 | 3300050490 | nmdc:mga03n38_98751_c1 | nmdc:mga03n38_98751_c1_648_1097 | 148 |
| 79 | 3300050491 | nmdc:mga00v17_196160_c1 | nmdc:mga00v17_196160_c1_733_1182 | 148 |
| 80 | 3300050491 | nmdc:mga00v17_56391_c1 | nmdc:mga00v17_56391_c1_1667_2116 | 148 |
| 81 | 3300050491 | nmdc:mga00v17_9855_c1 | nmdc:mga00v17_9855_c1_3103_3552 | 148 |
| 82 | 3300050496 | nmdc:mga07m45_11568_c1 | nmdc:mga07m45_11568_c1_1218_1667 | 148 |
| 83 | 3300050511 | nmdc:mga08y16_748663_c1 | nmdc:mga08y16_748663_c1_353_802 | 148 |
| 84 | 3300061719 | Ga0466962_0008869 | Ga0466962_0008869_2481_2930 | 148 |
| 85 | 3300001977 | JGI24746J21847_1006043 | JGI24746J21847_10060433 | 149 |
| 86 | 3300001989 | JGI24739J22299_10064480 | JGI24739J22299_100644803 | 149 |
| 87 | 3300001990 | JGI24737J22298_10090771 | JGI24737J22298_100907712 | 149 |
| 88 | 3300001991 | JGI24743J22301_10021518 | JGI24743J22301_100215182 | 149 |
| 89 | 3300002076 | JGI24749J21850_1018715 | JGI24749J21850_10187152 | 149 |
| 90 | 3300002076 | JGI24749J21850_1044622 | JGI24749J21850_10446222 | 149 |
| 91 | 3300002077 | JGI24744J21845_10004357 | JGI24744J21845_100043573 | 149 |
| 92 | 3300002077 | JGI24744J21845_10007935 | JGI24744J21845_100079352 | 149 |
| 93 | 3300002077 | JGI24744J21845_10015062 | JGI24744J21845_100150622 | 149 |
| 94 | 3300002239 | JGI24034J26672_10010318 | JGI24034J26672_100103182 | 149 |
| 95 | 3300002244 | JGI24742J22300_10002543 | JGI24742J22300_100025433 | 149 |
| 96 | 3300005328 | Ga0070676_10538825 | Ga0070676_105388252 | 149 |
| 97 | 3300005330 | Ga0070690_100047180 | Ga0070690_1000471803 | 149 |
| 98 | 3300005334 | Ga0068869_100014192 | Ga0068869_1000141924 | 149 |
| 99 | 3300005334 | Ga0068869_100021458 | Ga0068869_1000214583 | 149 |
| 100 | 3300005335 | Ga0070666_10839131 | Ga0070666_108391311 | 149 |
| 101 | 3300005336 | Ga0070680_100571885 | Ga0070680_1005718852 | 149 |
| 102 | 3300005337 | Ga0070682_100028988 | Ga0070682_1000289883 | 149 |
| 103 | 3300005337 | Ga0070682_100403360 | Ga0070682_1004033602 | 149 |
| 104 | 3300005338 | Ga0068868_100084285 | Ga0068868_1000842853 | 149 |
| 105 | 3300005338 | Ga0068868_100319478 | Ga0068868_1003194783 | 149 |
| 106 | 3300005339 | Ga0070660_100202387 | Ga0070660_1002023872 | 149 |
| 107 | 3300005340 | Ga0070689_100015826 | Ga0070689_1000158264 | 149 |
| 108 | 3300005340 | Ga0070689_100255938 | Ga0070689_1002559382 | 149 |
| 109 | 3300005341 | Ga0070691_10010731 | Ga0070691_100107313 | 149 |
| 110 | 3300005343 | Ga0070687_100099851 | Ga0070687_1000998512 | 149 |
| 111 | 3300005347 | Ga0070668_100005011 | Ga0070668_1000050117 | 149 |
| 112 | 3300005347 | Ga0070668_100390653 | Ga0070668_1003906532 | 149 |
| 113 | 3300005353 | Ga0070669_100103632 | Ga0070669_1001036323 | 149 |
| 114 | 3300005355 | Ga0070671_100187674 | Ga0070671_1001876743 | 149 |
| 115 | 3300005355 | Ga0070671_100597002 | Ga0070671_1005970022 | 149 |
| 116 | 3300005356 | Ga0070674_100001944 | Ga0070674_1000019443 | 149 |
| 117 | 3300005364 | Ga0070673_100021193 | Ga0070673_1000211934 | 149 |
| 118 | 3300005364 | Ga0070673_100054699 | Ga0070673_1000546993 | 149 |
| 119 | 3300005365 | Ga0070688_101180909 | Ga0070688_1011809091 | 149 |
| 120 | 3300005366 | Ga0070659_100093615 | Ga0070659_1000936152 | 149 |
| 121 | 3300005366 | Ga0070659_101517014 | Ga0070659_1015170141 | 149 |
| 122 | 3300005367 | Ga0070667_100126662 | Ga0070667_1001266623 | 149 |
| 123 | 3300005367 | Ga0070667_100220122 | Ga0070667_1002201222 | 149 |
| 124 | 3300005367 | Ga0070667_100298323 | Ga0070667_1002983231 | 149 |
| 125 | 3300005406 | Ga0070703_10019787 | Ga0070703_100197873 | 149 |
| 126 | 3300005434 | Ga0070709_10056517 | Ga0070709_100565173 | 149 |
| 127 | 3300005436 | Ga0070713_100713552 | Ga0070713_1007135522 | 149 |
| 128 | 3300005437 | Ga0070710_10011300 | Ga0070710_100113003 | 149 |
| 129 | 3300005437 | Ga0070710_10167820 | Ga0070710_101678202 | 149 |
| 130 | 3300005438 | Ga0070701_10002180 | Ga0070701_100021802 | 149 |
| 131 | 3300005439 | Ga0070711_100007630 | Ga0070711_1000076306 | 149 |
| 132 | 3300005439 | Ga0070711_100025360 | Ga0070711_1000253603 | 149 |
| 133 | 3300005440 | Ga0070705_100024507 | Ga0070705_1000245073 | 149 |
| 134 | 3300005440 | Ga0070705_100079075 | Ga0070705_1000790753 | 149 |
| 135 | 3300005441 | Ga0070700_100002262 | Ga0070700_1000022624 | 149 |
| 136 | 3300005441 | Ga0070700_100146862 | Ga0070700_1001468622 | 149 |
| 137 | 3300005444 | Ga0070694_100056180 | Ga0070694_1000561803 | 149 |
| 138 | 3300005445 | Ga0070708_100759264 | Ga0070708_1007592642 | 149 |
| 139 | 3300005455 | Ga0070663_100014779 | Ga0070663_1000147793 | 149 |
| 140 | 3300005455 | Ga0070663_100057979 | Ga0070663_1000579793 | 149 |
| 141 | 3300005456 | Ga0070678_100024985 | Ga0070678_1000249854 | 149 |
| 142 | 3300005456 | Ga0070678_100375048 | Ga0070678_1003750481 | 149 |
| 143 | 3300005457 | Ga0070662_100004152 | Ga0070662_1000041523 | 149 |
| 144 | 3300005457 | Ga0070662_100059388 | Ga0070662_1000593883 | 149 |
| 145 | 3300005459 | Ga0068867_100009518 | Ga0068867_1000095185 | 149 |
| 146 | 3300005466 | Ga0070685_10020941 | Ga0070685_100209413 | 149 |
| 147 | 3300005466 | Ga0070685_10266754 | Ga0070685_102667542 | 149 |
| 148 | 3300005468 | Ga0070707_100293042 | Ga0070707_1002930423 | 149 |
| 149 | 3300005539 | Ga0068853_100006384 | Ga0068853_1000063848 | 149 |
| 150 | 3300005543 | Ga0070672_100137072 | Ga0070672_1001370723 | 149 |
| 151 | 3300005543 | Ga0070672_100522179 | Ga0070672_1005221792 | 149 |
| 152 | 3300005544 | Ga0070686_100024436 | Ga0070686_1000244364 | 149 |
| 153 | 3300005544 | Ga0070686_100103057 | Ga0070686_1001030573 | 149 |
| 154 | 3300005545 | Ga0070695_100024070 | Ga0070695_1000240701 | 149 |
| 155 | 3300005546 | Ga0070696_100011765 | Ga0070696_1000117652 | 149 |
| 156 | 3300005546 | Ga0070696_100133650 | Ga0070696_1001336502 | 149 |
| 157 | 3300005547 | Ga0070693_100006684 | Ga0070693_1000066844 | 149 |
| 158 | 3300005547 | Ga0070693_100035141 | Ga0070693_1000351413 | 149 |
| 159 | 3300005548 | Ga0070665_100032433 | Ga0070665_1000324334 | 149 |
| 160 | 3300005548 | Ga0070665_100093943 | Ga0070665_1000939433 | 149 |
| 161 | 3300005549 | Ga0070704_100009105 | Ga0070704_1000091053 | 149 |
| 162 | 3300005549 | Ga0070704_100368296 | Ga0070704_1003682963 | 149 |
| 163 | 3300005563 | Ga0068855_100144282 | Ga0068855_1001442823 | 149 |
| 164 | 3300005577 | Ga0068857_100453718 | Ga0068857_1004537182 | 149 |
| 165 | 3300005578 | Ga0068854_100003350 | Ga0068854_10000335010 | 149 |
| 166 | 3300005578 | Ga0068854_100459025 | Ga0068854_1004590252 | 149 |
| 167 | 3300005614 | Ga0068856_100515414 | Ga0068856_1005154142 | 149 |
| 168 | 3300005614 | Ga0068856_100816258 | Ga0068856_1008162582 | 149 |
| 169 | 3300005615 | Ga0070702_100005590 | Ga0070702_1000055903 | 149 |
| 170 | 3300005615 | Ga0070702_100798590 | Ga0070702_1007985901 | 149 |
| 171 | 3300005616 | Ga0068852_100220505 | Ga0068852_1002205052 | 149 |
| 172 | 3300005617 | Ga0068859_100007849 | Ga0068859_1000078499 | 149 |
| 173 | 3300005617 | Ga0068859_100039310 | Ga0068859_1000393103 | 149 |
| 174 | 3300005618 | Ga0068864_100191743 | Ga0068864_1001917433 | 149 |
| 175 | 3300005618 | Ga0068864_100369965 | Ga0068864_1003699652 | 149 |
| 176 | 3300005718 | Ga0068866_10007629 | Ga0068866_100076291 | 149 |
| 177 | 3300005719 | Ga0068861_100101529 | Ga0068861_1001015292 | 149 |
| 178 | 3300005719 | Ga0068861_100184404 | Ga0068861_1001844043 | 149 |
| 179 | 3300005719 | Ga0068861_100696235 | Ga0068861_1006962351 | 149 |
| 180 | 3300005719 | Ga0068861_101106013 | Ga0068861_1011060132 | 149 |
| 181 | 3300005834 | Ga0068851_10042165 | Ga0068851_100421653 | 149 |
| 182 | 3300005840 | Ga0068870_10270109 | Ga0068870_102701092 | 149 |
| 183 | 3300005841 | Ga0068863_100005646 | Ga0068863_1000056466 | 149 |
| 184 | 3300005841 | Ga0068863_100068366 | Ga0068863_1000683662 | 149 |
| 185 | 3300005842 | Ga0068858_100007891 | Ga0068858_1000078919 | 149 |
| 186 | 3300005842 | Ga0068858_100096673 | Ga0068858_1000966732 | 149 |
| 187 | 3300005842 | Ga0068858_100535526 | Ga0068858_1005355262 | 149 |
| 188 | 3300005843 | Ga0068860_100010227 | Ga0068860_1000102273 | 149 |
| 189 | 3300005843 | Ga0068860_100235042 | Ga0068860_1002350422 | 149 |
| 190 | 3300005844 | Ga0068862_100004860 | Ga0068862_10000486010 | 149 |
| 191 | 3300005844 | Ga0068862_100374372 | Ga0068862_1003743723 | 149 |
| 192 | 3300005844 | Ga0068862_100518262 | Ga0068862_1005182622 | 149 |
| 193 | 3300005937 | Ga0081455_10093089 | Ga0081455_100930893 | 149 |
| 194 | 3300005937 | Ga0081455_10606130 | Ga0081455_106061302 | 149 |
| 195 | 3300005937 | Ga0081455_10640939 | Ga0081455_106409392 | 149 |
| 196 | 3300005981 | Ga0081538_10237713 | Ga0081538_102377131 | 149 |
| 197 | 3300006038 | Ga0075365_10011053 | Ga0075365_100110534 | 149 |
| 198 | 3300006038 | Ga0075365_10090150 | Ga0075365_100901502 | 149 |
| 199 | 3300006038 | Ga0075365_10094517 | Ga0075365_100945173 | 149 |
| 200 | 3300006042 | Ga0075368_10002796 | Ga0075368_100027964 | 149 |
| 201 | 3300006048 | Ga0075363_100001106 | Ga0075363_1000011068 | 149 |
| 202 | 3300006048 | Ga0075363_100001667 | Ga0075363_1000016673 | 149 |
| 203 | 3300006048 | Ga0075363_100037318 | Ga0075363_1000373183 | 149 |
| 204 | 3300006048 | Ga0075363_100105208 | Ga0075363_1001052083 | 149 |
| 205 | 3300006051 | Ga0075364_10000519 | Ga0075364_1000051912 | 149 |
| 206 | 3300006051 | Ga0075364_10005336 | Ga0075364_100053365 | 149 |
| 207 | 3300006051 | Ga0075364_10049494 | Ga0075364_100494943 | 149 |
| 208 | 3300006051 | Ga0075364_10227969 | Ga0075364_102279693 | 149 |
| 209 | 3300006163 | Ga0070715_10019983 | Ga0070715_100199833 | 149 |
| 210 | 3300006163 | Ga0070715_10037584 | Ga0070715_100375842 | 149 |
| 211 | 3300006173 | Ga0070716_100040134 | Ga0070716_1000401342 | 149 |
| 212 | 3300006173 | Ga0070716_100435816 | Ga0070716_1004358162 | 149 |
| 213 | 3300006175 | Ga0070712_100002115 | Ga0070712_1000021157 | 149 |
| 214 | 3300006175 | Ga0070712_100026519 | Ga0070712_1000265194 | 149 |
| 215 | 3300006177 | Ga0075362_10030400 | Ga0075362_100304003 | 149 |
| 216 | 3300006177 | Ga0075362_10071424 | Ga0075362_100714242 | 149 |
| 217 | 3300006178 | Ga0075367_10001891 | Ga0075367_100018918 | 149 |
| 218 | 3300006178 | Ga0075367_10136534 | Ga0075367_101365342 | 149 |
| 219 | 3300006178 | Ga0075367_10165850 | Ga0075367_101658502 | 149 |
| 220 | 3300006178 | Ga0075367_10509311 | Ga0075367_105093111 | 149 |
| 221 | 3300006186 | Ga0075369_10000939 | Ga0075369_100009393 | 149 |
| 222 | 3300006186 | Ga0075369_10003852 | Ga0075369_100038522 | 149 |
| 223 | 3300006186 | Ga0075369_10025356 | Ga0075369_100253563 | 149 |
| 224 | 3300006186 | Ga0075369_10034411 | Ga0075369_100344113 | 149 |
| 225 | 3300006186 | Ga0075369_10238579 | Ga0075369_102385792 | 149 |
| 226 | 3300006195 | Ga0075366_10243700 | Ga0075366_102437001 | 149 |
| 227 | 3300006237 | Ga0097621_100294195 | Ga0097621_1002941952 | 149 |
| 228 | 3300006353 | Ga0075370_10002684 | Ga0075370_100026843 | 149 |
| 229 | 3300006353 | Ga0075370_10044254 | Ga0075370_100442543 | 149 |
| 230 | 3300006353 | Ga0075370_10048770 | Ga0075370_100487703 | 149 |
| 231 | 3300006353 | Ga0075370_10056226 | Ga0075370_100562263 | 149 |
| 232 | 3300006358 | Ga0068871_100309700 | Ga0068871_1003097002 | 149 |
| 233 | 3300006844 | Ga0075428_100010284 | Ga0075428_1000102846 | 149 |
| 234 | 3300006844 | Ga0075428_101303178 | Ga0075428_1013031782 | 149 |
| 235 | 3300006846 | Ga0075430_100100421 | Ga0075430_1001004213 | 149 |
| 236 | 3300006846 | Ga0075430_100413142 | Ga0075430_1004131422 | 149 |
| 237 | 3300006847 | Ga0075431_100244794 | Ga0075431_1002447942 | 149 |
| 238 | 3300006881 | Ga0068865_100157012 | Ga0068865_1001570122 | 149 |
| 239 | 3300006931 | Ga0097620_100007849 | Ga0097620_1000078494 | 149 |
| 240 | 3300006931 | Ga0097620_100039311 | Ga0097620_1000393113 | 149 |
| 241 | 3300009094 | Ga0111539_10912619 | Ga0111539_109126192 | 149 |
| 242 | 3300009098 | Ga0105245_10018331 | Ga0105245_100183314 | 149 |
| 243 | 3300009098 | Ga0105245_11046233 | Ga0105245_110462332 | 149 |
| 244 | 3300009098 | Ga0105245_11296449 | Ga0105245_112964492 | 149 |
| 245 | 3300009101 | Ga0105247_10000493 | Ga0105247_1000049326 | 149 |
| 246 | 3300009147 | Ga0114129_10020186 | Ga0114129_100201863 | 149 |
| 247 | 3300009148 | Ga0105243_10025411 | Ga0105243_100254113 | 149 |
| 248 | 3300009148 | Ga0105243_10070887 | Ga0105243_100708873 | 149 |
| 249 | 3300009176 | Ga0105242_10006143 | Ga0105242_100061438 | 149 |
| 250 | 3300009176 | Ga0105242_10301618 | Ga0105242_103016183 | 149 |
| 251 | 3300009177 | Ga0105248_10160150 | Ga0105248_101601503 | 149 |
| 252 | 3300009177 | Ga0105248_10940165 | Ga0105248_109401652 | 149 |
| 253 | 3300009545 | Ga0105237_10375541 | Ga0105237_103755413 | 149 |
| 254 | 3300009545 | Ga0105237_10446775 | Ga0105237_104467753 | 149 |
| 255 | 3300009545 | Ga0105237_12042926 | Ga0105237_120429262 | 149 |
| 256 | 3300009553 | Ga0105249_10004967 | Ga0105249_100049673 | 149 |
| 257 | 3300009553 | Ga0105249_10798033 | Ga0105249_107980332 | 149 |
| 258 | 3300009553 | Ga0105249_11513330 | Ga0105249_115133302 | 149 |
| 259 | 3300010375 | Ga0105239_10286403 | Ga0105239_102864033 | 149 |
| 260 | 3300010375 | Ga0105239_10823587 | Ga0105239_108235872 | 149 |
| 261 | 3300011119 | Ga0105246_10013593 | Ga0105246_100135934 | 149 |
| 262 | 3300013102 | Ga0157371_10481776 | Ga0157371_104817762 | 149 |
| 263 | 3300013296 | Ga0157374_10023631 | Ga0157374_100236313 | 149 |
| 264 | 3300013296 | Ga0157374_10253847 | Ga0157374_102538473 | 149 |
| 265 | 3300013297 | Ga0157378_10018019 | Ga0157378_100180193 | 149 |
| 266 | 3300013297 | Ga0157378_10268135 | Ga0157378_102681352 | 149 |
| 267 | 3300013297 | Ga0157378_11627735 | Ga0157378_116277352 | 149 |
| 268 | 3300013306 | Ga0163162_10147662 | Ga0163162_101476623 | 149 |
| 269 | 3300013306 | Ga0163162_10308997 | Ga0163162_103089972 | 149 |
| 270 | 3300013306 | Ga0163162_10509934 | Ga0163162_105099343 | 149 |
| 271 | 3300013307 | Ga0157372_10083603 | Ga0157372_100836033 | 149 |
| 272 | 3300013308 | Ga0157375_10001035 | Ga0157375_1000103520 | 149 |
| 273 | 3300013308 | Ga0157375_10381060 | Ga0157375_103810602 | 149 |
| 274 | 3300014325 | Ga0163163_10032189 | Ga0163163_100321893 | 149 |
| 275 | 3300014326 | Ga0157380_10002208 | Ga0157380_1000220812 | 149 |
| 276 | 3300014745 | Ga0157377_10287703 | Ga0157377_102877032 | 149 |
| 277 | 3300014968 | Ga0157379_10008394 | Ga0157379_100083944 | 149 |
| 278 | 3300014968 | Ga0157379_10253806 | Ga0157379_102538063 | 149 |
| 279 | 3300014968 | Ga0157379_10734985 | Ga0157379_107349852 | 149 |
| 280 | 3300017792 | Ga0163161_10006898 | Ga0163161_100068984 | 149 |
| 281 | 3300017792 | Ga0163161_10743909 | Ga0163161_107439092 | 149 |
| 282 | 3300025885 | Ga0207653_10041015 | Ga0207653_100410152 | 149 |
| 283 | 3300025898 | Ga0207692_10167999 | Ga0207692_101679993 | 149 |
| 284 | 3300025898 | Ga0207692_10253428 | Ga0207692_102534282 | 149 |
| 285 | 3300025899 | Ga0207642_10008087 | Ga0207642_100080873 | 149 |
| 286 | 3300025899 | Ga0207642_10309132 | Ga0207642_103091322 | 149 |
| 287 | 3300025900 | Ga0207710_10153070 | Ga0207710_101530702 | 149 |
| 288 | 3300025901 | Ga0207688_10010649 | Ga0207688_100106493 | 149 |
| 289 | 3300025901 | Ga0207688_10015766 | Ga0207688_100157664 | 149 |
| 290 | 3300025903 | Ga0207680_10014650 | Ga0207680_100146503 | 149 |
| 291 | 3300025904 | Ga0207647_10045862 | Ga0207647_100458622 | 149 |
| 292 | 3300025904 | Ga0207647_10079686 | Ga0207647_100796863 | 149 |
| 293 | 3300025905 | Ga0207685_10066279 | Ga0207685_100662792 | 149 |
| 294 | 3300025905 | Ga0207685_10068956 | Ga0207685_100689562 | 149 |
| 295 | 3300025906 | Ga0207699_10069286 | Ga0207699_100692863 | 149 |
| 296 | 3300025906 | Ga0207699_10127692 | Ga0207699_101276922 | 149 |
| 297 | 3300025907 | Ga0207645_10047657 | Ga0207645_100476572 | 149 |
| 298 | 3300025908 | Ga0207643_10066300 | Ga0207643_100663003 | 149 |
| 299 | 3300025915 | Ga0207693_10000948 | Ga0207693_1000094811 | 149 |
| 300 | 3300025915 | Ga0207693_10013160 | Ga0207693_100131607 | 149 |
| 301 | 3300025916 | Ga0207663_10009277 | Ga0207663_100092772 | 149 |
| 302 | 3300025916 | Ga0207663_10026527 | Ga0207663_100265273 | 149 |
| 303 | 3300025917 | Ga0207660_10113609 | Ga0207660_101136093 | 149 |
| 304 | 3300025918 | Ga0207662_10024982 | Ga0207662_100249823 | 149 |
| 305 | 3300025922 | Ga0207646_11058461 | Ga0207646_110584612 | 149 |
| 306 | 3300025923 | Ga0207681_10456651 | Ga0207681_104566512 | 149 |
| 307 | 3300025927 | Ga0207687_10030076 | Ga0207687_100300763 | 149 |
| 308 | 3300025927 | Ga0207687_10392614 | Ga0207687_103926142 | 149 |
| 309 | 3300025927 | Ga0207687_10451954 | Ga0207687_104519541 | 149 |
| 310 | 3300025927 | Ga0207687_10689127 | Ga0207687_106891272 | 149 |
| 311 | 3300025928 | Ga0207700_10914555 | Ga0207700_109145552 | 149 |
| 312 | 3300025931 | Ga0207644_10545481 | Ga0207644_105454812 | 149 |
| 313 | 3300025932 | Ga0207690_10007157 | Ga0207690_100071571 | 149 |
| 314 | 3300025932 | Ga0207690_11237244 | Ga0207690_112372442 | 149 |
| 315 | 3300025933 | Ga0207706_10016408 | Ga0207706_100164083 | 149 |
| 316 | 3300025934 | Ga0207686_10030154 | Ga0207686_100301543 | 149 |
| 317 | 3300025934 | Ga0207686_10381371 | Ga0207686_103813712 | 149 |
| 318 | 3300025935 | Ga0207709_10009685 | Ga0207709_100096854 | 149 |
| 319 | 3300025935 | Ga0207709_10102360 | Ga0207709_101023603 | 149 |
| 320 | 3300025936 | Ga0207670_10013309 | Ga0207670_100133094 | 149 |
| 321 | 3300025936 | Ga0207670_10145492 | Ga0207670_101454923 | 149 |
| 322 | 3300025937 | Ga0207669_10001996 | Ga0207669_100019963 | 149 |
| 323 | 3300025937 | Ga0207669_10277860 | Ga0207669_102778602 | 149 |
| 324 | 3300025938 | Ga0207704_10010210 | Ga0207704_100102103 | 149 |
| 325 | 3300025939 | Ga0207665_10007002 | Ga0207665_100070023 | 149 |
| 326 | 3300025939 | Ga0207665_10024371 | Ga0207665_100243714 | 149 |
| 327 | 3300025940 | Ga0207691_10127600 | Ga0207691_101276003 | 149 |
| 328 | 3300025940 | Ga0207691_10159759 | Ga0207691_101597593 | 149 |
| 329 | 3300025941 | Ga0207711_10033962 | Ga0207711_100339624 | 149 |
| 330 | 3300025942 | Ga0207689_10017604 | Ga0207689_100176047 | 149 |
| 331 | 3300025942 | Ga0207689_10041021 | Ga0207689_100410213 | 149 |
| 332 | 3300025949 | Ga0207667_10076012 | Ga0207667_100760123 | 149 |
| 333 | 3300025960 | Ga0207651_10036194 | Ga0207651_100361943 | 149 |
| 334 | 3300025960 | Ga0207651_10112616 | Ga0207651_101126163 | 149 |
| 335 | 3300025961 | Ga0207712_10041899 | Ga0207712_100418993 | 149 |
| 336 | 3300025961 | Ga0207712_10575184 | Ga0207712_105751842 | 149 |
| 337 | 3300025972 | Ga0207668_10018853 | Ga0207668_100188534 | 149 |
| 338 | 3300025972 | Ga0207668_10144274 | Ga0207668_101442742 | 149 |
| 339 | 3300025972 | Ga0207668_10250880 | Ga0207668_102508802 | 149 |
| 340 | 3300025981 | Ga0207640_10047319 | Ga0207640_100473193 | 149 |
| 341 | 3300025986 | Ga0207658_10020469 | Ga0207658_100204693 | 149 |
| 342 | 3300025986 | Ga0207658_10050864 | Ga0207658_100508643 | 149 |
| 343 | 3300025986 | Ga0207658_10068289 | Ga0207658_100682893 | 149 |
| 344 | 3300025986 | Ga0207658_10381050 | Ga0207658_103810502 | 149 |
| 345 | 3300026023 | Ga0207677_10016974 | Ga0207677_100169746 | 149 |
| 346 | 3300026023 | Ga0207677_10017772 | Ga0207677_100177724 | 149 |
| 347 | 3300026035 | Ga0207703_10036116 | Ga0207703_100361163 | 149 |
| 348 | 3300026035 | Ga0207703_10362910 | Ga0207703_103629102 | 149 |
| 349 | 3300026041 | Ga0207639_10362555 | Ga0207639_103625553 | 149 |
| 350 | 3300026067 | Ga0207678_10034146 | Ga0207678_100341463 | 149 |
| 351 | 3300026067 | Ga0207678_10062998 | Ga0207678_100629983 | 149 |
| 352 | 3300026067 | Ga0207678_10905667 | Ga0207678_109056672 | 149 |
| 353 | 3300026075 | Ga0207708_10003344 | Ga0207708_100033443 | 149 |
| 354 | 3300026075 | Ga0207708_10006244 | Ga0207708_100062447 | 149 |
| 355 | 3300026078 | Ga0207702_10414466 | Ga0207702_104144662 | 149 |
| 356 | 3300026078 | Ga0207702_10508455 | Ga0207702_105084552 | 149 |
| 357 | 3300026088 | Ga0207641_10005726 | Ga0207641_100057265 | 149 |
| 358 | 3300026088 | Ga0207641_10029726 | Ga0207641_100297264 | 149 |
| 359 | 3300026089 | Ga0207648_10001826 | Ga0207648_1000182621 | 149 |
| 360 | 3300026095 | Ga0207676_10137481 | Ga0207676_101374813 | 149 |
| 361 | 3300026118 | Ga0207675_100011768 | Ga0207675_1000117687 | 149 |
| 362 | 3300026118 | Ga0207675_100027774 | Ga0207675_1000277744 | 149 |
| 363 | 3300026118 | Ga0207675_100064794 | Ga0207675_1000647943 | 149 |
| 364 | 3300026118 | Ga0207675_100564577 | Ga0207675_1005645772 | 149 |
| 365 | 3300026121 | Ga0207683_10001024 | Ga0207683_1000102419 | 149 |
| 366 | 3300026121 | Ga0207683_10122181 | Ga0207683_101221812 | 149 |
| 367 | 3300026142 | Ga0207698_10071151 | Ga0207698_100711513 | 149 |
| 368 | 3300027866 | Ga0209813_10005434 | Ga0209813_100054344 | 149 |
| 369 | 3300028379 | Ga0268266_10056976 | Ga0268266_100569762 | 149 |
| 370 | 3300028379 | Ga0268266_10062458 | Ga0268266_100624584 | 149 |
| 371 | 3300028380 | Ga0268265_10048080 | Ga0268265_100480803 | 149 |
| 372 | 3300028380 | Ga0268265_10722276 | Ga0268265_107222762 | 149 |
| 373 | 3300028381 | Ga0268264_10021522 | Ga0268264_100215223 | 149 |
| 374 | 3300028381 | Ga0268264_10701565 | Ga0268264_107015651 | 149 |
| 375 | 3300031852 | Ga0307410_10284492 | Ga0307410_102844922 | 149 |
| 376 | 3300031903 | Ga0307407_10255008 | Ga0307407_102550082 | 149 |
| 377 | 3300031903 | Ga0307407_10500600 | Ga0307407_105006002 | 149 |
| 378 | 3300031995 | Ga0307409_100782706 | Ga0307409_1007827062 | 149 |
| 379 | 3300034816 | Ga0373930_0220684 | Ga0373930_0220684_13_465 | 149 |
| 380 | 3300034817 | Ga0373948_0059635 | Ga0373948_0059635_354_806 | 149 |
| 381 | 3300035091 | Ga0373951_0058853 | Ga0373951_0058853_325_777 | 149 |
| 382 | 3300035241 | Ga0373961_0155025 | Ga0373961_0155025_75_527 | 149 |
| 383 | 3300035242 | Ga0373962_0123458 | Ga0373962_0123458_72_524 | 149 |
| 384 | 3300035691 | Ga0373931_0009696 | Ga0373931_0009696_821_1273 | 149 |
| 385 | 3300035691 | Ga0373931_0043047 | Ga0373931_0043047_1318_1770 | 149 |
| 386 | 3300041410 | Ga0439461_0007029 | Ga0439461_0007029_402_857 | 149 |
| 387 | 3300041411 | Ga0439466_0037815 | Ga0439466_0037815_1118_1573 | 149 |
| 388 | 3300041413 | Ga0439465_0002557 | Ga0439465_0002557_845_1300 | 149 |
| 389 | 3300041413 | Ga0439465_0002704 | Ga0439465_0002704_3722_4174 | 149 |
| 390 | 3300042002 | Ga0439442_046221 | Ga0439442_046221_61_516 | 149 |
| 391 | 3300042004 | Ga0439445_0020704 | Ga0439445_0020704_75_530 | 149 |
| 392 | 3300042008 | Ga0439450_082279 | Ga0439450_082279_46_498 | 149 |
| 393 | 3300042011 | Ga0439454_071921 | Ga0439454_071921_97_552 | 149 |
| 394 | 3300042435 | Ga0439434_0012056 | Ga0439434_0012056_1914_2366 | 149 |
| 395 | 3300044658 | Ga0466972_0025814 | Ga0466972_0025814_1702_2154 | 149 |
| 396 | 3300044735 | Ga0466968_0065731 | Ga0466968_0065731_964_1419 | 149 |
| 397 | 3300044765 | Ga0466970_0017448 | Ga0466970_0017448_1736_2188 | 149 |
| 398 | 3300045976 | Ga0466967_1486880 | Ga0466967_1486880_87_542 | 149 |
| 399 | 3300046694 | Ga0495649_0050424 | Ga0495649_0050424_941_1393 | 149 |
| 400 | 3300047320 | Ga0495672_0024805 | Ga0495672_0024805_456_908 | 149 |
| 401 | 3300048903 | Ga0496100_0097257 | Ga0496100_0097257_1203_1655 | 149 |
| 402 | 3300048903 | Ga0496100_0125524 | Ga0496100_0125524_1318_1770 | 149 |
| 403 | 3300048904 | Ga0496101_0122381 | Ga0496101_0122381_1235_1687 | 149 |
| 404 | 3300048904 | Ga0496101_0157165 | Ga0496101_0157165_707_1159 | 149 |
| 405 | 3300048904 | Ga0496101_0378959 | Ga0496101_0378959_523_981 | 149 |
| 406 | 3300048904 | Ga0496101_0669690 | Ga0496101_0669690_23_475 | 149 |
| 407 | 3300048905 | Ga0496102_0006565 | Ga0496102_0006565_7779_8231 | 149 |
| 408 | 3300048905 | Ga0496102_0024991 | Ga0496102_0024991_1029_1481 | 149 |
| 409 | 3300048905 | Ga0496102_0071767 | Ga0496102_0071767_614_1066 | 149 |
| 410 | 3300048905 | Ga0496102_0175755 | Ga0496102_0175755_885_1337 | 149 |
| 411 | 3300048906 | Ga0496103_0021911 | Ga0496103_0021911_1469_1921 | 149 |
| 412 | 3300048906 | Ga0496103_0743167 | Ga0496103_0743167_65_517 | 149 |
| 413 | 3300048907 | Ga0496104_0016856 | Ga0496104_0016856_4536_4988 | 149 |
| 414 | 3300048907 | Ga0496104_0380706 | Ga0496104_0380706_24_476 | 149 |
| 415 | 3300048907 | Ga0496104_0544970 | Ga0496104_0544970_425_877 | 149 |
| 416 | 3300048908 | Ga0496105_0030474 | Ga0496105_0030474_1601_2053 | 149 |
| 417 | 3300048908 | Ga0496105_0182568 | Ga0496105_0182568_1048_1500 | 149 |
| 418 | 3300048909 | Ga0496106_0005685 | Ga0496106_0005685_1127_1579 | 149 |
| 419 | 3300048909 | Ga0496106_0107023 | Ga0496106_0107023_799_1251 | 149 |
| 420 | 3300048909 | Ga0496106_0279770 | Ga0496106_0279770_650_1108 | 149 |
| 421 | 3300048909 | Ga0496106_0407811 | Ga0496106_0407811_615_1067 | 149 |
| 422 | 3300048910 | Ga0496107_0011293 | Ga0496107_0011293_487_939 | 149 |
| 423 | 3300048910 | Ga0496107_0162139 | Ga0496107_0162139_653_1105 | 149 |
| 424 | 3300048910 | Ga0496107_0304530 | Ga0496107_0304530_530_982 | 149 |
| 425 | 3300048911 | Ga0496108_0000513 | Ga0496108_0000513_19138_19590 | 149 |
| 426 | 3300048911 | Ga0496108_0682171 | Ga0496108_0682171_351_803 | 149 |
| 427 | 3300048912 | Ga0496109_0012513 | Ga0496109_0012513_6472_6924 | 149 |
| 428 | 3300048912 | Ga0496109_0012790 | Ga0496109_0012790_3635_4087 | 149 |
| 429 | 3300048913 | Ga0496110_0015736 | Ga0496110_0015736_5290_5742 | 149 |
| 430 | 3300048913 | Ga0496110_0548008 | Ga0496110_0548008_548_1000 | 149 |
| 431 | 3300048914 | Ga0496111_0151036 | Ga0496111_0151036_915_1367 | 149 |
| 432 | 3300048915 | Ga0496112_0002229 | Ga0496112_0002229_10337_10789 | 149 |
| 433 | 3300048915 | Ga0496112_0921916 | Ga0496112_0921916_183_635 | 149 |
| 434 | 3300048916 | Ga0496113_0010076 | Ga0496113_0010076_3718_4170 | 149 |
| 435 | 3300048916 | Ga0496113_0355087 | Ga0496113_0355087_202_654 | 149 |
| 436 | 3300048917 | Ga0496114_0006179 | Ga0496114_0006179_1127_1579 | 149 |
| 437 | 3300048917 | Ga0496114_0154352 | Ga0496114_0154352_701_1153 | 149 |
| 438 | 3300048918 | Ga0496115_0020340 | Ga0496115_0020340_4156_4608 | 149 |
| 439 | 3300048921 | Ga0496118_0304067 | Ga0496118_0304067_234_686 | 149 |
| 440 | 3300050489 | nmdc:mga03683_130768_c1 | nmdc:mga03683_130768_c1_661_1113 | 149 |
| 441 | 3300050489 | nmdc:mga03683_140134_c1 | nmdc:mga03683_140134_c1_393_845 | 149 |
| 442 | 3300050489 | nmdc:mga03683_22666_c1 | nmdc:mga03683_22666_c1_172_624 | 149 |
| 443 | 3300050490 | nmdc:mga03n38_14464_c1 | nmdc:mga03n38_14464_c1_1402_1854 | 149 |
| 444 | 3300050490 | nmdc:mga03n38_16819_c1 | nmdc:mga03n38_16819_c1_1809_2261 | 149 |
| 445 | 3300050490 | nmdc:mga03n38_221042_c1 | nmdc:mga03n38_221042_c1_420_872 | 149 |
| 446 | 3300050490 | nmdc:mga03n38_27650_c1 | nmdc:mga03n38_27650_c1_1052_1504 | 149 |
| 447 | 3300050490 | nmdc:mga03n38_5063_c1 | nmdc:mga03n38_5063_c1_322_774 | 149 |
| 448 | 3300050491 | nmdc:mga00v17_1449_c1 | nmdc:mga00v17_1449_c1_10862_11314 | 149 |
| 449 | 3300050491 | nmdc:mga00v17_319061_c1 | nmdc:mga00v17_319061_c1_491_943 | 149 |
| 450 | 3300050491 | nmdc:mga00v17_37308_c1 | nmdc:mga00v17_37308_c1_1011_1463 | 149 |
| 451 | 3300050491 | nmdc:mga00v17_44518_c1 | nmdc:mga00v17_44518_c1_2130_2582 | 149 |
| 452 | 3300050492 | nmdc:mga0yw44_3380_c1 | nmdc:mga0yw44_3380_c1_3438_3890 | 149 |
| 453 | 3300050492 | nmdc:mga0yw44_4426_c1 | nmdc:mga0yw44_4426_c1_1647_2099 | 149 |
| 454 | 3300050492 | nmdc:mga0yw44_64949_c1 | nmdc:mga0yw44_64949_c1_1506_1958 | 149 |
| 455 | 3300050494 | nmdc:mga06z11_227903_c1 | nmdc:mga06z11_227903_c1_394_846 | 149 |
| 456 | 3300050494 | nmdc:mga06z11_593055_c1 | nmdc:mga06z11_593055_c1_100_552 | 149 |
| 457 | 3300050495 | nmdc:mga04h51_45531_c1 | nmdc:mga04h51_45531_c1_475_927 | 149 |
| 458 | 3300050496 | nmdc:mga07m45_60788_c1 | nmdc:mga07m45_60788_c1_1355_1807 | 149 |
| 459 | 3300050496 | nmdc:mga07m45_81568_c1 | nmdc:mga07m45_81568_c1_487_939 | 149 |
| 460 | 3300050496 | nmdc:mga07m45_85722_c1 | nmdc:mga07m45_85722_c1_354_806 | 149 |
| 461 | 3300050507 | nmdc:mga05p37_1084168_c1 | nmdc:mga05p37_1084168_c1_73_525 | 149 |
| 462 | 3300050509 | nmdc:mga0qj67_468870_c1 | nmdc:mga0qj67_468870_c1_251_703 | 149 |
| 463 | 3300050509 | nmdc:mga0qj67_5742_c1 | nmdc:mga0qj67_5742_c1_5503_5955 | 149 |
| 464 | 3300050510 | nmdc:mga06r32_493483_c1 | nmdc:mga06r32_493483_c1_484_936 | 149 |
| 465 | 3300050511 | nmdc:mga08y16_1863072_c1 | nmdc:mga08y16_1863072_c1_32_490 | 149 |
| 466 | 3300050516 | nmdc:mga0sz30_11873_c1 | nmdc:mga0sz30_11873_c1_1994_2446 | 149 |
| 467 | 3300050516 | nmdc:mga0sz30_152693_c1 | nmdc:mga0sz30_152693_c1_103_555 | 149 |
| 468 | 3300050516 | nmdc:mga0sz30_159425_c1 | nmdc:mga0sz30_159425_c1_252_704 | 149 |
| 469 | 3300050516 | nmdc:mga0sz30_406893_c1 | nmdc:mga0sz30_406893_c1_133_585 | 149 |
| 470 | 3300050516 | nmdc:mga0sz30_4115_c1 | nmdc:mga0sz30_4115_c1_1031_1483 | 149 |
| 471 | 3300050516 | nmdc:mga0sz30_736_c1 | nmdc:mga0sz30_736_c1_1657_2109 | 149 |
| 472 | iso_pu_bacteria | 2523231044 | 2523386759 | 149 |
| 473 | 3300005329 | Ga0070683_100621571 | Ga0070683_1006215712 | 150 |
| 474 | 3300005337 | Ga0070682_100015100 | Ga0070682_1000151003 | 150 |
| 475 | 3300005338 | Ga0068868_100605980 | Ga0068868_1006059802 | 150 |
| 476 | 3300005339 | Ga0070660_100642937 | Ga0070660_1006429372 | 150 |
| 477 | 3300005341 | Ga0070691_10260552 | Ga0070691_102605522 | 150 |
| 478 | 3300005366 | Ga0070659_100932193 | Ga0070659_1009321932 | 150 |
| 479 | 3300005455 | Ga0070663_100011976 | Ga0070663_1000119764 | 150 |
| 480 | 3300005539 | Ga0068853_100402088 | Ga0068853_1004020882 | 150 |
| 481 | 3300005564 | Ga0070664_100265141 | Ga0070664_1002651413 | 150 |
| 482 | 3300005578 | Ga0068854_100547591 | Ga0068854_1005475911 | 150 |
| 483 | 3300005615 | Ga0070702_100053368 | Ga0070702_1000533683 | 150 |
| 484 | 3300005616 | Ga0068852_100365629 | Ga0068852_1003656292 | 150 |
| 485 | 3300005618 | Ga0068864_100269860 | Ga0068864_1002698602 | 150 |
| 486 | 3300005834 | Ga0068851_10096254 | Ga0068851_100962543 | 150 |
| 487 | 3300006048 | Ga0075363_100005230 | Ga0075363_1000052304 | 150 |
| 488 | 3300006173 | Ga0070716_100075126 | Ga0070716_1000751263 | 150 |
| 489 | 3300006175 | Ga0070712_100240452 | Ga0070712_1002404522 | 150 |
| 490 | 3300009094 | Ga0111539_10709038 | Ga0111539_107090382 | 150 |
| 491 | 3300009176 | Ga0105242_10555989 | Ga0105242_105559892 | 150 |
| 492 | 3300010375 | Ga0105239_10340499 | Ga0105239_103404993 | 150 |
| 493 | 3300012507 | Ga0157342_1045623 | Ga0157342_10456232 | 150 |
| 494 | 3300014325 | Ga0163163_10478876 | Ga0163163_104788762 | 150 |
| 495 | 3300025909 | Ga0207705_10636927 | Ga0207705_106369272 | 150 |
| 496 | 3300025919 | Ga0207657_10133271 | Ga0207657_101332713 | 150 |
| 497 | 3300025927 | Ga0207687_10902654 | Ga0207687_109026542 | 150 |
| 498 | 3300025937 | Ga0207669_11340357 | Ga0207669_113403571 | 150 |
| 499 | 3300025939 | Ga0207665_10033302 | Ga0207665_100333022 | 150 |
| 500 | 3300025981 | Ga0207640_10263309 | Ga0207640_102633092 | 150 |
| 501 | 3300026041 | Ga0207639_10299536 | Ga0207639_102995362 | 150 |
| 502 | 3300026067 | Ga0207678_10007087 | Ga0207678_100070874 | 150 |
| 503 | 3300035242 | Ga0373962_0130515 | Ga0373962_0130515_316_771 | 150 |
| 504 | 3300035695 | Ga0373927_0592017 | Ga0373927_0592017_30_485 | 150 |
| 505 | 3300039450 | Ga0436363_0119995 | Ga0436363_0119995_148_603 | 150 |
| 506 | 3300039450 | Ga0436363_0910126 | Ga0436363_0910126_729_1184 | 150 |
| 507 | 3300041512 | Ga0451853_3841286 | Ga0451853_3841286_57_512 | 150 |
| 508 | 3300045976 | Ga0466967_0059467 | Ga0466967_0059467_1133_1600 | 150 |
| 509 | 3300046461 | Ga0495641_0020652 | Ga0495641_0020652_1254_1709 | 150 |
| 510 | 3300046475 | Ga0495639_0157186 | Ga0495639_0157186_583_1038 | 150 |
| 511 | 3300046476 | Ga0495662_0054303 | Ga0495662_0054303_207_662 | 150 |
| 512 | 3300046477 | Ga0495664_0364936 | Ga0495664_0364936_383_838 | 150 |
| 513 | 3300046499 | Ga0495594_0044634 | Ga0495594_0044634_727_1182 | 150 |
| 514 | 3300046511 | Ga0495608_0307245 | Ga0495608_0307245_187_642 | 150 |
| 515 | 3300046683 | Ga0495658_0209104 | Ga0495658_0209104_160_615 | 150 |
| 516 | 3300046690 | Ga0495624_0026794 | Ga0495624_0026794_1400_1855 | 150 |
| 517 | 3300047321 | Ga0495676_0045082 | Ga0495676_0045082_1255_1710 | 150 |
| 518 | 3300047322 | Ga0495680_0790259 | Ga0495680_0790259_87_542 | 150 |
| 519 | 3300048904 | Ga0496101_0390932 | Ga0496101_0390932_94_549 | 150 |
| 520 | 3300048905 | Ga0496102_0069873 | Ga0496102_0069873_522_977 | 150 |
| 521 | 3300048910 | Ga0496107_0251202 | Ga0496107_0251202_337_792 | 150 |
| 522 | 3300048910 | Ga0496107_0453880 | Ga0496107_0453880_226_681 | 150 |
| 523 | 3300048911 | Ga0496108_0054449 | Ga0496108_0054449_2198_2653 | 150 |
| 524 | 3300048912 | Ga0496109_0013266 | Ga0496109_0013266_3431_3886 | 150 |
| 525 | 3300048912 | Ga0496109_0135368 | Ga0496109_0135368_1484_1939 | 150 |
| 526 | 3300048912 | Ga0496109_0275636 | Ga0496109_0275636_747_1202 | 150 |
| 527 | 3300048913 | Ga0496110_0300120 | Ga0496110_0300120_577_1032 | 150 |
| 528 | 3300048914 | Ga0496111_0366415 | Ga0496111_0366415_357_812 | 150 |
| 529 | 3300048915 | Ga0496112_0015830 | Ga0496112_0015830_1462_1917 | 150 |
| 530 | 3300048916 | Ga0496113_0030979 | Ga0496113_0030979_2527_2982 | 150 |
| 531 | 3300048916 | Ga0496113_0237457 | Ga0496113_0237457_436_891 | 150 |
| 532 | 3300048917 | Ga0496114_0589665 | Ga0496114_0589665_61_522 | 150 |
| 533 | 3300050490 | nmdc:mga03n38_14025_c1 | nmdc:mga03n38_14025_c1_2295_2750 | 150 |
| 534 | 3300053083 | Ga0495655_0035743 | Ga0495655_0035743_253_708 | 150 |
| 535 | 3300053129 | Ga0500628_157244 | Ga0500628_157244_171_626 | 150 |
| 536 | iso_pu_bacteria | 2929212328 | 2929215395 | 150 |
| 537 | 3300005347 | Ga0070668_100009916 | Ga0070668_1000099162 | 151 |
| 538 | 3300005353 | Ga0070669_100089039 | Ga0070669_1000890393 | 151 |
| 539 | 3300005365 | Ga0070688_100145899 | Ga0070688_1001458992 | 151 |
| 540 | 3300005937 | Ga0081455_10082195 | Ga0081455_100821953 | 151 |
| 541 | 3300006048 | Ga0075363_100005000 | Ga0075363_1000050004 | 151 |
| 542 | 3300006051 | Ga0075364_10062065 | Ga0075364_100620653 | 151 |
| 543 | 3300006177 | Ga0075362_10104333 | Ga0075362_101043332 | 151 |
| 544 | 3300006186 | Ga0075369_10034496 | Ga0075369_100344963 | 151 |
| 545 | 3300006186 | Ga0075369_10035905 | Ga0075369_100359052 | 151 |
| 546 | 3300006353 | Ga0075370_10186384 | Ga0075370_101863842 | 151 |
| 547 | 3300009101 | Ga0105247_10000007 | Ga0105247_10000007256 | 151 |
| 548 | 3300025900 | Ga0207710_10000013 | Ga0207710_10000013255 | 151 |
| 549 | 3300025923 | Ga0207681_10110026 | Ga0207681_101100263 | 151 |
| 550 | 3300025972 | Ga0207668_10005506 | Ga0207668_100055063 | 151 |
| 551 | 3300031852 | Ga0307410_10225154 | Ga0307410_102251543 | 151 |
| 552 | 3300031903 | Ga0307407_10456682 | Ga0307407_104566822 | 151 |
| 553 | 3300041511 | Ga0451855_0424312 | Ga0451855_0424312_133_600 | 151 |
| 554 | 3300044684 | Ga0466966_0001732 | Ga0466966_0001732_10890_11354 | 151 |
| 555 | 3300044693 | Ga0466961_0052430 | Ga0466961_0052430_1108_1572 | 151 |
| 556 | 3300044694 | Ga0466963_0196471 | Ga0466963_0196471_245_706 | 151 |
| 557 | 3300044694 | Ga0466963_0206769 | Ga0466963_0206769_178_642 | 151 |
| 558 | 3300044735 | Ga0466968_0020629 | Ga0466968_0020629_2131_2595 | 151 |
| 559 | 3300044765 | Ga0466970_0010728 | Ga0466970_0010728_2445_2909 | 151 |
| 560 | 3300044842 | Ga0466957_0025981 | Ga0466957_0025981_2455_2919 | 151 |
| 561 | 3300045049 | Ga0466959_0012702 | Ga0466959_0012702_4109_4573 | 151 |
| 562 | 3300045836 | Ga0466958_0007264 | Ga0466958_0007264_3018_3482 | 151 |
| 563 | 3300045976 | Ga0466967_0233509 | Ga0466967_0233509_895_1356 | 151 |
| 564 | 3300045976 | Ga0466967_0775806 | Ga0466967_0775806_17_478 | 151 |
| 565 | 3300045976 | Ga0466967_2026026 | Ga0466967_2026026_94_558 | 151 |
| 566 | 3300046460 | Ga0495638_0000596 | Ga0495638_0000596_33286_33750 | 151 |
| 567 | 3300046616 | Ga0495668_0108413 | Ga0495668_0108413_876_1340 | 151 |
| 568 | 3300048903 | Ga0496100_0035795 | Ga0496100_0035795_2519_3004 | 151 |
| 569 | 3300048904 | Ga0496101_0016410 | Ga0496101_0016410_3657_4142 | 151 |
| 570 | 3300048912 | Ga0496109_0246806 | Ga0496109_0246806_17_502 | 151 |
| 571 | 3300048928 | Ga0496125_0100641 | Ga0496125_0100641_848_1312 | 151 |
| 572 | 3300048929 | Ga0496126_0197109 | Ga0496126_0197109_1028_1513 | 151 |
| 573 | 3300050491 | nmdc:mga00v17_103120_c1 | nmdc:mga00v17_103120_c1_34_498 | 151 |
| 574 | 3300050516 | nmdc:mga0sz30_14420_c1 | nmdc:mga0sz30_14420_c1_1807_2271 | 151 |
| 575 | 3300053079 | Ga0500610_0039278 | Ga0500610_0039278_311_775 | 151 |
| 576 | 3300053088 | Ga0500644_0066707 | Ga0500644_0066707_343_807 | 151 |
| 577 | 3300053104 | Ga0500556_0022834 | Ga0500556_0022834_547_1011 | 151 |
| 578 | 3300053108 | Ga0500562_040774 | Ga0500562_040774_599_1063 | 151 |
| 579 | 3300053151 | Ga0500604_0157913 | Ga0500604_0157913_230_694 | 151 |
| 580 | 3300053153 | Ga0500616_0005662 | Ga0500616_0005662_5927_6388 | 151 |
| 581 | 3300053153 | Ga0500616_0021813 | Ga0500616_0021813_2908_3372 | 151 |
| 582 | 3300061719 | Ga0466962_0084822 | Ga0466962_0084822_977_1441 | 151 |
| 583 | iso_pu_bacteria | 2738541264 | 2738668752 | 151 |
| 584 | iso_pu_bacteria | 2738541356 | 2739147944 | 151 |
| 585 | 3300005548 | Ga0070665_100330910 | Ga0070665_1003309103 | 152 |
| 586 | 3300005615 | Ga0070702_100559856 | Ga0070702_1005598562 | 152 |
| 587 | 3300006028 | Ga0070717_11267887 | Ga0070717_112678872 | 152 |
| 588 | 3300006237 | Ga0097621_101610940 | Ga0097621_1016109401 | 152 |
| 589 | 3300009098 | Ga0105245_10273917 | Ga0105245_102739173 | 152 |
| 590 | 3300009101 | Ga0105247_10173461 | Ga0105247_101734612 | 152 |
| 591 | 3300028379 | Ga0268266_10685847 | Ga0268266_106858472 | 152 |
| 592 | 3300044684 | Ga0466966_0016069 | Ga0466966_0016069_4317_4778 | 152 |
| 593 | 3300044693 | Ga0466961_0021624 | Ga0466961_0021624_2841_3302 | 152 |
| 594 | 3300044694 | Ga0466963_0147297 | Ga0466963_0147297_690_1151 | 152 |
| 595 | 3300044765 | Ga0466970_0170753 | Ga0466970_0170753_360_821 | 152 |
| 596 | 3300044901 | Ga0466960_0070711 | Ga0466960_0070711_182_643 | 152 |
| 597 | 3300045049 | Ga0466959_0276527 | Ga0466959_0276527_135_596 | 152 |
| 598 | 3300045836 | Ga0466958_0013044 | Ga0466958_0013044_3960_4421 | 152 |
| 599 | 3300047472 | Ga0495686_0007307 | Ga0495686_0007307_2233_2706 | 152 |
| 600 | 3300048907 | Ga0496104_0594666 | Ga0496104_0594666_496_969 | 152 |
| 601 | 3300048911 | Ga0496108_0023945 | Ga0496108_0023945_1186_1659 | 152 |
| 602 | 3300048912 | Ga0496109_0192235 | Ga0496109_0192235_178_651 | 152 |
| 603 | 3300048913 | Ga0496110_1587472 | Ga0496110_1587472_64_537 | 152 |
| 604 | 3300050492 | nmdc:mga0yw44_762566_c1 | nmdc:mga0yw44_762566_c1_64_537 | 152 |
| 605 | iso_pu_bacteria | 2643221687 | 2644486051 | 152 |
| 606 | iso_pu_bacteria | 2902837492 | 2902840607 | 152 |
| 607 | 3300005337 | Ga0070682_101232325 | Ga0070682_1012323251 | 153 |
| 608 | 3300006051 | Ga0075364_10304044 | Ga0075364_103040442 | 153 |
| 609 | 3300006881 | Ga0068865_100857652 | Ga0068865_1008576522 | 153 |
| 610 | 3300021384 | Ga0213876_10034716 | Ga0213876_100347163 | 153 |
| 611 | 3300025929 | Ga0207664_11001729 | Ga0207664_110017291 | 153 |
| 612 | 3300026041 | Ga0207639_10042240 | Ga0207639_100422404 | 153 |
| 613 | 3300037853 | Ga0436364_1054040 | Ga0436364_1054040_857_1327 | 153 |
| 614 | 3300039437 | Ga0436365_1310270 | Ga0436365_1310270_46_513 | 153 |
| 615 | 3300039437 | Ga0436365_1543341 | Ga0436365_1543341_8221_8691 | 153 |
| 616 | 3300044694 | Ga0466963_0047750 | Ga0466963_0047750_259_729 | 153 |
| 617 | 3300044719 | Ga0466971_0062730 | Ga0466971_0062730_826_1296 | 153 |
| 618 | 3300044901 | Ga0466960_0000554 | Ga0466960_0000554_3968_4438 | 153 |
| 619 | 3300045976 | Ga0466967_0140305 | Ga0466967_0140305_453_923 | 153 |
| 620 | 3300045976 | Ga0466967_0815958 | Ga0466967_0815958_263_733 | 153 |
| 621 | 3300048903 | Ga0496100_0000510 | Ga0496100_0000510_3272_3763 | 153 |
| 622 | 3300048903 | Ga0496100_0520717 | Ga0496100_0520717_233_697 | 153 |
| 623 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_213026_213517 | 153 |
| 624 | 3300048904 | Ga0496101_0647505 | Ga0496101_0647505_263_727 | 153 |
| 625 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_89958_90449 | 153 |
| 626 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_225014_225505 | 153 |
| 627 | 3300048907 | Ga0496104_0085043 | Ga0496104_0085043_1140_1604 | 153 |
| 628 | 3300048909 | Ga0496106_0015219 | Ga0496106_0015219_517_1008 | 153 |
| 629 | 3300048918 | Ga0496115_0458935 | Ga0496115_0458935_485_955 | 153 |
| 630 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_86179_86670 | 153 |
| 631 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_225022_225513 | 153 |
| 632 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_225022_225513 | 153 |
| 633 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_343510_344001 | 153 |
| 634 | 3300048929 | Ga0496126_0000236 | Ga0496126_0000236_41895_42386 | 153 |
| 635 | 3300048929 | Ga0496126_0003944 | Ga0496126_0003944_13216_13686 | 153 |
| 636 | 3300049569 | Ga0501032_0556543 | Ga0501032_0556543_88_555 | 153 |
| 637 | 3300049586 | Ga0501070_0136418 | Ga0501070_0136418_99_566 | 153 |
| 638 | 3300049822 | Ga0501035_0329784 | Ga0501035_0329784_86_553 | 153 |
| 639 | 3300049823 | Ga0501044_1332092 | Ga0501044_1332092_37_504 | 153 |
| 640 | 3300053131 | Ga0500652_000967 | Ga0500652_000967_7618_8088 | 153 |
| 641 | iso_pu_bacteria | 2643221715 | 2644633641 | 153 |
| 642 | iso_pu_bacteria | 2902792274 | 2902796014 | 153 |
| 643 | iso_pu_bacteria | 2902810491 | 2902815069 | 153 |
| 644 | 3300005335 | Ga0070666_10017351 | Ga0070666_100173513 | 154 |
| 645 | 3300005435 | Ga0070714_100172700 | Ga0070714_1001727003 | 154 |
| 646 | 3300005617 | Ga0068859_100674713 | Ga0068859_1006747132 | 154 |
| 647 | 3300006931 | Ga0097620_100674709 | Ga0097620_1006747092 | 154 |
| 648 | 3300009545 | Ga0105237_10398496 | Ga0105237_103984962 | 154 |
| 649 | 3300010375 | Ga0105239_10042937 | Ga0105239_100429374 | 154 |
| 650 | 3300010375 | Ga0105239_10464204 | Ga0105239_104642041 | 154 |
| 651 | 3300025303 | Ga0209051_1000200 | Ga0209051_100020010 | 154 |
| 652 | 3300025903 | Ga0207680_10228538 | Ga0207680_102285382 | 154 |
| 653 | 3300025914 | Ga0207671_10262858 | Ga0207671_102628583 | 154 |
| 654 | 3300025929 | Ga0207664_10111151 | Ga0207664_101111513 | 154 |
| 655 | 3300031251 | Ga0265327_10002053 | Ga0265327_1000205315 | 154 |
| 656 | 3300031251 | Ga0265327_10174082 | Ga0265327_101740822 | 154 |
| 657 | 3300035242 | Ga0373962_0160256 | Ga0373962_0160256_52_528 | 154 |
| 658 | 3300044683 | Ga0466965_0014993 | Ga0466965_0014993_2215_2691 | 154 |
| 659 | 3300045976 | Ga0466967_0570928 | Ga0466967_0570928_80_556 | 154 |
| 660 | 3300048903 | Ga0496100_0000112 | Ga0496100_0000112_9678_10154 | 154 |
| 661 | 3300048904 | Ga0496101_0000315 | Ga0496101_0000315_22899_23375 | 154 |
| 662 | 3300048909 | Ga0496106_0001749 | Ga0496106_0001749_9766_10242 | 154 |
| 663 | 3300048910 | Ga0496107_0002911 | Ga0496107_0002911_1185_1661 | 154 |
| 664 | 3300048911 | Ga0496108_0007236 | Ga0496108_0007236_995_1471 | 154 |
| 665 | 3300048912 | Ga0496109_0002563 | Ga0496109_0002563_9768_10244 | 154 |
| 666 | 3300048913 | Ga0496110_0004960 | Ga0496110_0004960_7195_7671 | 154 |
| 667 | 3300048914 | Ga0496111_0021711 | Ga0496111_0021711_2354_2830 | 154 |
| 668 | 3300048915 | Ga0496112_0033418 | Ga0496112_0033418_430_924 | 154 |
| 669 | 3300048916 | Ga0496113_0179659 | Ga0496113_0179659_1144_1638 | 154 |
| 670 | 3300048917 | Ga0496114_0000479 | Ga0496114_0000479_27638_28114 | 154 |
| 671 | 3300048918 | Ga0496115_0002801 | Ga0496115_0002801_4967_5443 | 154 |
| 672 | 3300048919 | Ga0496116_0005329 | Ga0496116_0005329_9399_9875 | 154 |
| 673 | 3300048920 | Ga0496117_0247465 | Ga0496117_0247465_392_868 | 154 |
| 674 | 3300048921 | Ga0496118_0009803 | Ga0496118_0009803_1154_1630 | 154 |
| 675 | 3300048922 | Ga0496119_0003459 | Ga0496119_0003459_13348_13824 | 154 |
| 676 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_446905_447381 | 154 |
| 677 | 3300048925 | Ga0496122_0000132 | Ga0496122_0000132_9766_10242 | 154 |
| 678 | 3300048925 | Ga0496122_0006467 | Ga0496122_0006467_2903_3397 | 154 |
| 679 | 3300048926 | Ga0496123_0003386 | Ga0496123_0003386_15827_16321 | 154 |
| 680 | 3300048926 | Ga0496123_0029070 | Ga0496123_0029070_3350_3826 | 154 |
| 681 | 3300048927 | Ga0496124_0000106 | Ga0496124_0000106_161999_162475 | 154 |
| 682 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_446905_447381 | 154 |
| 683 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_163296_163772 | 154 |
| 684 | 3300048929 | Ga0496126_0203640 | Ga0496126_0203640_312_806 | 154 |
| 685 | 3300050491 | nmdc:mga00v17_93234_c1 | nmdc:mga00v17_93234_c1_791_1297 | 154 |
| 686 | 3300053087 | Ga0500643_004567 | Ga0500643_004567_158_637 | 154 |
| 687 | 3300041452 | Ga0451793_1320588 | Ga0451793_1320588_394_888 | 155 |
| 688 | 3300003792 | Ga0055540_1001444 | Ga0055540_10014446 | 156 |
| 689 | 3300003792 | Ga0055540_1005035 | Ga0055540_10050356 | 156 |
| 690 | 3300003792 | Ga0055540_1012894 | Ga0055540_10128943 | 156 |
| 691 | 3300003792 | Ga0055540_1056085 | Ga0055540_10560851 | 156 |
| 692 | 3300005455 | Ga0070663_100118814 | Ga0070663_1001188142 | 156 |
| 693 | 3300006038 | Ga0075365_10089639 | Ga0075365_100896393 | 156 |
| 694 | 3300025273 | Ga0209673_1003496 | Ga0209673_10034964 | 156 |
| 695 | 3300025303 | Ga0209051_1002041 | Ga0209051_100204111 | 156 |
| 696 | 3300025303 | Ga0209051_1005266 | Ga0209051_10052662 | 156 |
| 697 | 3300025303 | Ga0209051_1026542 | Ga0209051_10265422 | 156 |
| 698 | 3300025303 | Ga0209051_1049909 | Ga0209051_10499091 | 156 |
| 699 | 3300026067 | Ga0207678_10035547 | Ga0207678_100355473 | 156 |
| 700 | 3300041451 | Ga0451791_1631205 | Ga0451791_1631205_767_1237 | 156 |
| 701 | 3300041452 | Ga0451793_0430583 | Ga0451793_0430583_115_585 | 156 |
| 702 | 3300041456 | Ga0451795_1369390 | Ga0451795_1369390_152_622 | 156 |
| 703 | 3300041460 | Ga0451802_0792079 | Ga0451802_0792079_432_902 | 156 |
| 704 | 3300041462 | Ga0451806_395821 | Ga0451806_395821_855_1325 | 156 |
| 705 | 3300041486 | Ga0451807_2344173 | Ga0451807_2344173_101_571 | 156 |
| 706 | 3300050492 | nmdc:mga0yw44_131369_c1 | nmdc:mga0yw44_131369_c1_712_1185 | 156 |
| 707 | 3300050516 | nmdc:mga0sz30_552136_c1 | nmdc:mga0sz30_552136_c1_24_494 | 156 |
| 708 | 3300000546 | LJNas_1016072 | LJNas_10160722 | 157 |
| 709 | 3300002067 | JGI24735J21928_10083349 | JGI24735J21928_100833491 | 157 |
| 710 | 3300005367 | Ga0070667_100000034 | Ga0070667_100000034143 | 157 |
| 711 | 3300005367 | Ga0070667_100328445 | Ga0070667_1003284452 | 157 |
| 712 | 3300005548 | Ga0070665_100243167 | Ga0070665_1002431673 | 157 |
| 713 | 3300005563 | Ga0068855_100605270 | Ga0068855_1006052702 | 157 |
| 714 | 3300005616 | Ga0068852_100653140 | Ga0068852_1006531401 | 157 |
| 715 | 3300005617 | Ga0068859_100000228 | Ga0068859_1000002284 | 157 |
| 716 | 3300005718 | Ga0068866_10135103 | Ga0068866_101351033 | 157 |
| 717 | 3300005841 | Ga0068863_100000320 | Ga0068863_10000032026 | 157 |
| 718 | 3300005843 | Ga0068860_100000011 | Ga0068860_100000011188 | 157 |
| 719 | 3300005844 | Ga0068862_100000012 | Ga0068862_100000012229 | 157 |
| 720 | 3300006186 | Ga0075369_10105133 | Ga0075369_101051332 | 157 |
| 721 | 3300006881 | Ga0068865_100034950 | Ga0068865_1000349502 | 157 |
| 722 | 3300006931 | Ga0097620_100000228 | Ga0097620_1000002284 | 157 |
| 723 | 3300009177 | Ga0105248_10000040 | Ga0105248_1000004060 | 157 |
| 724 | 3300009545 | Ga0105237_10000866 | Ga0105237_1000086638 | 157 |
| 725 | 3300009551 | Ga0105238_10269447 | Ga0105238_102694473 | 157 |
| 726 | 3300009553 | Ga0105249_10000001 | Ga0105249_10000001232 | 157 |
| 727 | 3300010375 | Ga0105239_10024187 | Ga0105239_100241876 | 157 |
| 728 | 3300011119 | Ga0105246_10701295 | Ga0105246_107012952 | 157 |
| 729 | 3300013306 | Ga0163162_10043694 | Ga0163162_100436945 | 157 |
| 730 | 3300013308 | Ga0157375_10156949 | Ga0157375_101569493 | 157 |
| 731 | 3300014325 | Ga0163163_10017990 | Ga0163163_100179903 | 157 |
| 732 | 3300025914 | Ga0207671_10132980 | Ga0207671_101329802 | 157 |
| 733 | 3300025924 | Ga0207694_10722446 | Ga0207694_107224462 | 157 |
| 734 | 3300025935 | Ga0207709_10607808 | Ga0207709_106078082 | 157 |
| 735 | 3300025938 | Ga0207704_10672084 | Ga0207704_106720841 | 157 |
| 736 | 3300025941 | Ga0207711_10000209 | Ga0207711_100002097 | 157 |
| 737 | 3300025949 | Ga0207667_10848935 | Ga0207667_108489352 | 157 |
| 738 | 3300025961 | Ga0207712_10000006 | Ga0207712_10000006260 | 157 |
| 739 | 3300025986 | Ga0207658_10000108 | Ga0207658_1000010864 | 157 |
| 740 | 3300025986 | Ga0207658_10351811 | Ga0207658_103518113 | 157 |
| 741 | 3300026088 | Ga0207641_10012181 | Ga0207641_100121812 | 157 |
| 742 | 3300028379 | Ga0268266_10379472 | Ga0268266_103794723 | 157 |
| 743 | 3300028380 | Ga0268265_10000016 | Ga0268265_10000016253 | 157 |
| 744 | 3300028381 | Ga0268264_10000026 | Ga0268264_10000026256 | 157 |
| 745 | 3300037853 | Ga0436364_0966796 | Ga0436364_0966796_2203_2688 | 157 |
| 746 | 3300039437 | Ga0436365_1555470 | Ga0436365_1555470_6886_7371 | 157 |
| 747 | 3300046507 | Ga0495606_0468762 | Ga0495606_0468762_13_525 | 157 |
| 748 | 3300046524 | Ga0495648_0176045 | Ga0495648_0176045_560_1063 | 157 |
| 749 | 3300048903 | Ga0496100_0001466 | Ga0496100_0001466_9972_10493 | 157 |
| 750 | 3300048904 | Ga0496101_0001462 | Ga0496101_0001462_3485_4006 | 157 |
| 751 | 3300048905 | Ga0496102_0000501 | Ga0496102_0000501_29222_29725 | 157 |
| 752 | 3300048905 | Ga0496102_0034761 | Ga0496102_0034761_2141_2662 | 157 |
| 753 | 3300048906 | Ga0496103_0002141 | Ga0496103_0002141_33_536 | 157 |
| 754 | 3300048906 | Ga0496103_0390208 | Ga0496103_0390208_45_566 | 157 |
| 755 | 3300048907 | Ga0496104_0004228 | Ga0496104_0004228_623_1144 | 157 |
| 756 | 3300048908 | Ga0496105_0016589 | Ga0496105_0016589_2250_2771 | 157 |
| 757 | 3300048909 | Ga0496106_0030282 | Ga0496106_0030282_1855_2376 | 157 |
| 758 | 3300048910 | Ga0496107_0002019 | Ga0496107_0002019_1369_1890 | 157 |
| 759 | 3300048917 | Ga0496114_0003971 | Ga0496114_0003971_2722_3243 | 157 |
| 760 | 3300048918 | Ga0496115_0007561 | Ga0496115_0007561_3284_3805 | 157 |
| 761 | 3300048919 | Ga0496116_0006143 | Ga0496116_0006143_5345_5848 | 157 |
| 762 | 3300048920 | Ga0496117_0000998 | Ga0496117_0000998_1510_2013 | 157 |
| 763 | 3300048921 | Ga0496118_0002304 | Ga0496118_0002304_15487_15990 | 157 |
| 764 | 3300048922 | Ga0496119_0007190 | Ga0496119_0007190_9056_9571 | 157 |
| 765 | 3300048923 | Ga0496120_0010528 | Ga0496120_0010528_2373_2876 | 157 |
| 766 | 3300048923 | Ga0496120_0033242 | Ga0496120_0033242_2071_2586 | 157 |
| 767 | 3300048927 | Ga0496124_0033104 | Ga0496124_0033104_265_768 | 157 |
| 768 | 3300048929 | Ga0496126_0197114 | Ga0496126_0197114_172_675 | 157 |
| 769 | 3300048929 | Ga0496126_0364227 | Ga0496126_0364227_591_1070 | 157 |
| 770 | 3300049569 | Ga0501032_0217655 | Ga0501032_0217655_207_686 | 157 |
| 771 | 3300049570 | Ga0501033_0225672 | Ga0501033_0225672_488_967 | 157 |
| 772 | 3300049571 | Ga0501034_0093749 | Ga0501034_0093749_427_906 | 157 |
| 773 | 3300049580 | Ga0501046_0408257 | Ga0501046_0408257_246_725 | 157 |
| 774 | 3300049581 | Ga0501047_0012606 | Ga0501047_0012606_2285_2764 | 157 |
| 775 | 3300049822 | Ga0501035_0000162 | Ga0501035_0000162_66033_66512 | 157 |
| 776 | 3300049823 | Ga0501044_0000166 | Ga0501044_0000166_15206_15685 | 157 |
| 777 | 3300050516 | nmdc:mga0sz30_98735_c1 | nmdc:mga0sz30_98735_c1_638_1150 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p2p-assembly1.cif.gz_D | human signal peptidase complex paralog a (spc-a) | 0.8371 | 12 | 65 |
| 3dcx-assembly1.cif.gz_E | crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution | 0.7139 | 71 | 144 |
| 5gas-assembly1.cif.gz_Q | thermus thermophilus v/a-atpase, conformation 2 | 0.6748 | 15 | 70 |
| 4ifs-assembly1.cif.gz_A | crystal structure of the hssrp1 middle domain | 0.6714 | 71 | 115 |
| 6l1e-assembly1.cif.gz_A | crystal structure of middle domain of hssrp1 | 0.6427 | 71 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLY1_72_143_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8968 | 71 | 141 | 2.30.29.30 |
| af_P9WLY1_72_143_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8741 | 71 | 141 | 2.30.29.30 |
| af_Q9V3V3_225_317_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7817 | 72 | 146 | 2.30.29.30 |
| af_Q9XV49_1_95_1.20.5.170 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.6701 | 17 | 70 | 1.20.5.170 |
| af_P15038_1_164_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6648 | 73 | 138 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A2LKU5-F1-model_v4 | deleted | 0.9555 | 7 | 148 |
|
| AF-A0A1A2PR60-F1-model_v4 | Low molecular weight protein antigen 6 PH domain-containing protein | 0.9471 | 1 | 150 |
GO:0016020
|
| AF-A0A1Q4SSU5-F1-model_v4 | deleted | 0.946 | 3 | 151 |
|
| AF-A0A1X1YG56-F1-model_v4 | Uncharacterized protein | 0.9423 | 2 | 151 |
|
| AF-A0A1E3T3D2-F1-model_v4 | Low molecular weight protein antigen 6 PH domain-containing protein | 0.941 | 1 | 150 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar