F480331

General Info

Members Datasets Scaffolds Average Seq Length
776 482 558 116

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0014548|Ga0495605_0014548_1736_2128
Length 130
Sequence MAETTRELLTAGGWKDLVFEPFRQDVTIHWIKPFEGDQPGVALLKYEAGAAVPRHLHQGLETILVLEGTQSDETGDYGKGSYIVNAIGTEHSVWSDTGCVVLIQWDRPVRILEEEAAFGRLCSSGISRQR

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
32 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
33 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
34 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
35 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
36 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
37 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
38 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
39 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
40 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
41 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
42 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
43 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
44 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
45 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
46 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
47 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
48 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
49 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
50 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
51 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
52 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
53 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
54 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
55 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
56 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
57 2643221558 Rhizobium sp. Root149 Isolate Unclassified
58 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
59 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
60 2643221719 Rhizobium sp. Root274 Isolate Unclassified
61 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
62 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
63 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
64 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
65 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
66 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
67 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
68 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
69 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
70 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
71 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
72 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
73 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
74 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
75 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
76 2738541293 Rhizobium sp. GV031 Isolate Unclassified
77 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
78 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
79 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
80 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
81 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
82 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
83 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
84 2791355260 Rhizobium sp. L9 Isolate Nodule
85 2791355261 Rhizobium sp. J15 Isolate Nodule
86 2791355263 Rhizobium chutanense C5 Isolate Nodule
87 2791355264 Rhizobium sp. S9 Isolate Nodule
88 2791355265 Rhizobium sp. H4 Isolate Nodule
89 2791355266 Rhizobium sp. L43 Isolate Nodule
90 2791355267 Rhizobium sp. L18 Isolate Nodule
91 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
92 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
93 2802429633 Rhizobium anhuiense J3 Isolate Nodule
94 2802429634 Rhizobium anhuiense S10 Isolate Nodule
95 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
96 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
97 2802429637 Rhizobium anhuiense C15 Isolate Nodule
98 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
99 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
100 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
101 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
102 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
103 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
104 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
105 2838048938 Rhizobium pisi 27/80 Isolate Nodule
106 2838061910 Rhizobium phaseoli L15 Isolate Nodule
107 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
108 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
109 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
110 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
111 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
112 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
113 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
114 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
115 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
116 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
117 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
118 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
119 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
120 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
121 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
122 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
123 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
124 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
125 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
126 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
127 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
128 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
129 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
130 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
131 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
132 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
133 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
134 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
135 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
136 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
137 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
138 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
139 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
140 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
141 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
142 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
143 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
144 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
145 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
146 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
147 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
148 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
149 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
150 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
151 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
152 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
153 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
154 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
155 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
156 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
157 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
158 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
159 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
160 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
161 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
162 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
163 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
164 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
165 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
166 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
167 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
168 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
169 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
170 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
171 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
172 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
173 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
174 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
175 2933599457 Rhizobium phaseoli M3 Isolate Nodule
176 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
177 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
178 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
179 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
180 2936381700 Rhizobium chutanense C16 Isolate Unclassified
181 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
182 2996887358 Rhizobium sp. R711 Isolate Nodule
183 2996893221 Rhizobium sp. R635 Isolate Nodule
184 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
185 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
186 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
187 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
188 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
189 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
190 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
191 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
192 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
193 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
194 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
195 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
196 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
197 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
198 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
199 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
200 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
201 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
202 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
203 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
204 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
205 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
206 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
207 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
208 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
209 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
210 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
211 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
212 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
213 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
214 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
215 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
216 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
217 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
218 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
219 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
220 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
221 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
226 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
227 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
228 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
229 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
230 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
231 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
232 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
233 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
234 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
235 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
236 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
237 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
238 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
239 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
240 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
241 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
242 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
243 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
244 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
245 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
246 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
247 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
248 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
249 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
250 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
251 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
252 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
253 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
254 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
255 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
256 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
257 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
258 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
259 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
260 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
261 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
262 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
263 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
264 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
265 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
267 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
268 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
269 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
272 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
273 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
275 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
280 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
292 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
294 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
300 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
301 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
302 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
303 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
306 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
307 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
308 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
309 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
310 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
313 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
314 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
315 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
316 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
317 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
318 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
319 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
320 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
321 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
322 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
323 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
324 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
325 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
334 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
335 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
336 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
337 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
338 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
339 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
349 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
352 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
355 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
379 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
380 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
405 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
413 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
424 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
425 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
426 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
427 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
428 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
429 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
430 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
433 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
434 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
439 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
440 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
441 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
448 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
451 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
452 8005258706 Rhizobium sp. R693 Isolate Nodule
453 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
454 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
455 8005321885 Rhizobium sp. R72 Isolate Nodule
456 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
457 8005382845 Rhizobium sp. R634 Isolate Nodule
458 8005395548 Rhizobium sp. R339 Isolate Nodule
459 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
460 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
461 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
462 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
463 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
464 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
465 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
466 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
467 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
468 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
469 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
470 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
471 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
472 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
473 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
474 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
475 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
476 8024501048 Rhizobium sp. H4 Isolate Nodule
477 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
478 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
479 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
480 8056382006 Rhizobium croatiense 13T Isolate Nodule
481 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
482 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.78
Metatranscriptomes 0
Isolates 28.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.51
Nodule 21.52
Rhizoplane 2.84
Rhizosphere 29.25
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000003 3300001979 Bacteria 127453
2 JGI25155J39150_1000017 3300002704 Bacteria 159274
3 JGI25156J39149_1000034 3300002705 Bacteria 114036
4 JGI25162J39368_1000069 3300002737 Bacteria 125244
5 JGI25154J39366_1000034 3300002738 Bacteria 176764
6 JGI25158J39367_1000132 3300002739 Bacteria 17517
7 JGI25157J39369_1000092 3300002741 Bacteria 76674
8 JGI25152J39213_1001418 3300002773 Bacteria 10379
9 JGI25152J39213_1002382 3300002773 Bacteria 7195
10 JGI25152J39213_1005221 3300002773 Bacteria 3863
11 JGI25152J39213_1014529 3300002773 Bacteria 1593
12 JGI25152J39213_1051624 3300002773 Bacteria 534
13 JGI25152J39213_1051633 3300002773 Bacteria 534
14 JGI25150J39212_1000010 3300002774 Bacteria 236260
15 JGI25150J39212_1017894 3300002774 Bacteria 1137
16 JGI25159J45721_1000421 3300002987 Bacteria 19571
17 JGI25159J45721_1001354 3300002987 Bacteria 10259
18 JGI25151J46595_10000026 3300003187 Bacteria 211045
19 JGI25151J46595_10000383 3300003187 Bacteria 45964
20 JGI25151J46595_10093007 3300003187 Bacteria 834
21 JGI25165J46597_1000018 3300003214 Bacteria 374701
22 JGI25165J46597_1014227 3300003214 Bacteria 1085
23 JGI25153J46596_10000858 3300003215 Bacteria 18539
24 JGI25153J46596_10005939 3300003215 Bacteria 6292
25 JGI25153J46596_10013444 3300003215 Bacteria 3456
26 JGI25153J46596_10035348 3300003215 Bacteria 1620
27 JGI25153J46596_10090646 3300003215 Bacteria 739
28 JGI25153J46596_10102720 3300003215 Bacteria 670
29 JGI25153J46596_10137924 3300003215 Bacteria 534
30 JGI25153J46596_10137947 3300003215 Bacteria 534
31 rootH1_10016543 3300003316 Bacteria 1192
32 rootH1_10040367 3300003316 Bacteria 11432
33 rootH2_10083368 3300003320 Bacteria 2788
34 rootL2_10009173 3300003322 Bacteria 30207
35 rootL2_10070897 3300003322 Bacteria 1605
36 rootH1_10020310 3300003316 Bacteria 3119
37 rootH1_10020310 3300003323 Bacteria 4096
38 JGI25160J50197_1000599 3300003354 Bacteria 20168
39 JGI25160J50197_1003370 3300003354 Bacteria 7165
40 JGI25160J50197_1004142 3300003354 Bacteria 6320
41 JGI25160J50197_1034304 3300003354 Bacteria 1262
42 JGI25160J50197_1038120 3300003354 Bacteria 1142
43 JGI25161J50226_1000050 3300003374 Bacteria 110628
44 JGI25161J50226_1000424 3300003374 Bacteria 20168
45 JGI25161J50226_1002379 3300003374 Bacteria 4846
46 Ga0055539_1022794 3300003752 Bacteria 738
47 Ga0055526_1000661 3300003771 Bacteria 26488
48 Ga0055526_1001610 3300003771 Bacteria 15842
49 Ga0055526_1002306 3300003771 Bacteria 13015
50 Ga0055526_1007407 3300003771 Bacteria 5709
51 Ga0055526_1017301 3300003771 Bacteria 2760
52 Ga0055526_1021612 3300003771 Bacteria 2229
53 Ga0055526_1031463 3300003771 Bacteria 1520
54 Ga0055524_1000936 3300003775 Bacteria 18722
55 Ga0055524_1001468 3300003775 Bacteria 13460
56 Ga0055524_1002754 3300003775 Bacteria 8838
57 Ga0055524_1005288 3300003775 Bacteria 5796
58 Ga0055524_1045897 3300003775 Bacteria 1045
59 Ga0055536_1001115 3300003781 Bacteria 16861
60 Ga0055528_1000096 3300003790 Bacteria 70375
61 Ga0055528_1000681 3300003790 Bacteria 24503
62 Ga0055528_1003470 3300003790 Bacteria 7879
63 Ga0055528_1009316 3300003790 Bacteria 4112
64 Ga0055528_1009508 3300003790 Bacteria 4051
65 Ga0055528_1009927 3300003790 Bacteria 3927
66 Ga0055528_1027264 3300003790 Bacteria 1614
67 Ga0055528_1060574 3300003790 Bacteria 717
68 Ga0055530_10028614 3300003791 Bacteria 1501
69 Ga0055540_1000728 3300003792 Bacteria 22432
70 Ga0055540_1009933 3300003792 Bacteria 3219
71 Ga0055540_1018639 3300003792 Bacteria 1896
72 Ga0055540_1020467 3300003792 Bacteria 1748
73 Ga0055540_1039119 3300003792 Bacteria 1035
74 Ga0055531_10005662 3300003794 Bacteria 7258
75 Ga0055543_1000023 3300004625 Bacteria 140513
76 Ga0055543_1000576 3300004625 Bacteria 20206
77 Ga0055543_1004138 3300004625 Bacteria 4033
78 Ga0055543_1005969 3300004625 Bacteria 3024
79 Ga0055543_1067750 3300004625 Bacteria 564
80 Ga0065165_1002596 3300005262 Bacteria 14818
81 Ga0065165_1021771 3300005262 Bacteria 2216
82 Ga0065165_1024177 3300005262 Bacteria 2046
83 Ga0065165_1147045 3300005262 Bacteria 552
84 Ga0065165_1147375 3300005262 Bacteria 551
85 Ga0070658_10441811 3300005327 Bacteria 1120
86 Ga0070670_100036429 3300005331 Bacteria 4234
87 Ga0070666_10253898 3300005335 Bacteria 1245
88 Ga0070661_101755997 3300005344 Bacteria 526
89 Ga0070667_100276016 3300005367 Bacteria 1508
90 Ga0070663_101742622 3300005455 Bacteria 557
91 Ga0070665_100014876 3300005548 Bacteria 7810
92 Ga0068855_100236734 3300005563 Bacteria 2041
93 Ga0068854_100030411 3300005578 Bacteria 3746
94 Ga0068851_10031766 3300005834 Bacteria 2624
95 Ga0068862_101679203 3300005844 Bacteria 643
96 Ga0075365_10004903 3300006038 Bacteria 7153
97 Ga0075365_10019303 3300006038 Bacteria 4206
98 Ga0075365_10082343 3300006038 Bacteria 2182
99 Ga0075368_10146953 3300006042 Bacteria 984
100 Ga0075363_100157737 3300006048 Bacteria 1284
101 Ga0075363_100783544 3300006048 Bacteria 579
102 Ga0075362_10000551 3300006177 Bacteria 10907
103 Ga0075362_10397088 3300006177 Bacteria 695
104 Ga0075367_10395603 3300006178 Bacteria 874
105 Ga0075369_10003191 3300006186 Bacteria 5947
106 Ga0075369_10016631 3300006186 Bacteria 2971
107 Ga0075369_10122672 3300006186 Bacteria 1177
108 Ga0075366_10919346 3300006195 Bacteria 545
109 Ga0075370_10209622 3300006353 Bacteria 1150
110 Ga0075370_10679738 3300006353 Bacteria 625
111 Ga0075370_10702873 3300006353 Bacteria 615
112 Ga0075370_10989941 3300006353 Bacteria 515
113 Ga0105251_10110680 3300009011 Bacteria 1251
114 Ga0105244_10102659 3300009036 Bacteria 1397
115 Ga0105244_10291259 3300009036 Bacteria 756
116 Ga0105250_10162888 3300009092 Bacteria 932
117 Ga0105240_10000240 3300009093 Bacteria 109195
118 Ga0105247_10322250 3300009101 Bacteria 1079
119 Ga0105247_10478878 3300009101 Bacteria 903
120 Ga0105243_10167213 3300009148 Bacteria 1902
121 Ga0105248_10183848 3300009177 Bacteria 2356
122 Ga0105248_11044148 3300009177 Bacteria 923
123 Ga0105237_10003272 3300009545 Bacteria 19351
124 Ga0105238_12517054 3300009551 Bacteria 551
125 Ga0123342_1012677 3300009766 Bacteria 8698
126 Ga0123342_1016141 3300009766 Bacteria 6571
127 Ga0105239_10021907 3300010375 Bacteria 7044
128 Ga0157322_1000796 3300012490 Bacteria 1347
129 Ga0157327_1080255 3300012512 Bacteria 523
130 Ga0157373_10129215 3300013100 Bacteria 1776
131 Ga0157373_10944156 3300013100 Unclassified 641
132 Ga0157370_10001696 3300013104 Bacteria 27110
133 Ga0157369_10380172 3300013105 Bacteria 1466
134 Ga0157378_10657127 3300013297 Bacteria 1064
135 Ga0182008_10018574 3300014497 Bacteria 3599
136 Ga0182007_10000406 3300015262 Bacteria 26542
137 Ga0182005_1006240 3300015265 Bacteria 3661
138 Ga0163161_10544431 3300017792 Bacteria 951
139 Ga0214544_1000906 3300021320 Bacteria 58379
140 Ga0214542_1000400 3300021321 Bacteria 76349
141 Ga0214543_1000019 3300021327 Bacteria 267908
142 Ga0209435_100023 3300025206 Bacteria 201972
143 Ga0209436_100031 3300025208 Bacteria 82827
144 Ga0209437_100022 3300025233 Bacteria 625694
145 Ga0207425_1000010 3300025245 Bacteria 572898
146 Ga0207425_1004436 3300025245 Bacteria 4208
147 Ga0207425_1005593 3300025245 Bacteria 3559
148 Ga0207425_1016108 3300025245 Bacteria 1664
149 Ga0209646_1000080 3300025246 Bacteria 201975
150 Ga0209646_1043672 3300025246 Bacteria 556
151 Ga0209026_1000076 3300025250 Bacteria 201975
152 Ga0209677_100499 3300025253 Bacteria 22078
153 Ga0209759_1000059 3300025256 Bacteria 201975
154 Ga0209129_1000197 3300025258 Bacteria 78908
155 Ga0209129_1000625 3300025258 Bacteria 23733
156 Ga0209129_1001067 3300025258 Bacteria 16195
157 Ga0209129_1001986 3300025258 Bacteria 10630
158 Ga0209129_1005724 3300025258 Bacteria 4276
159 Ga0209129_1005870 3300025258 Bacteria 4171
160 Ga0209129_1018438 3300025258 Bacteria 1340
161 Ga0209233_1000031 3300025261 Bacteria 624646
162 Ga0209233_1000203 3300025261 Bacteria 118984
163 Ga0209565_1021431 3300025263 Bacteria 1351
164 Ga0209673_1000063 3300025273 Bacteria 256709
165 Ga0209673_1000252 3300025273 Bacteria 101552
166 Ga0209673_1003927 3300025273 Bacteria 8335
167 Ga0209673_1005480 3300025273 Bacteria 6362
168 Ga0209673_1006322 3300025273 Bacteria 5747
169 Ga0209673_1010561 3300025273 Bacteria 3880
170 Ga0209673_1017618 3300025273 Bacteria 2628
171 Ga0209673_1031851 3300025273 Bacteria 1633
172 Ga0209130_1000031 3300025284 Bacteria 322932
173 Ga0209130_1001091 3300025284 Bacteria 20220
174 Ga0209130_1025614 3300025284 Bacteria 1275
175 Ga0209130_1027836 3300025284 Bacteria 1195
176 Ga0209675_1054312 3300025291 Bacteria 814
177 Ga0209676_1002049 3300025292 Bacteria 15759
178 Ga0209676_1005325 3300025292 Bacteria 6777
179 Ga0209676_1039289 3300025292 Bacteria 1346
180 Ga0209025_1000022 3300025294 Bacteria 574487
181 Ga0209025_1000397 3300025294 Bacteria 89703
182 Ga0209025_1002306 3300025294 Bacteria 20689
183 Ga0209025_1016728 3300025294 Bacteria 4297
184 Ga0209025_1020329 3300025294 Bacteria 3638
185 Ga0209025_1044394 3300025294 Bacteria 1858
186 Ga0209564_1000482 3300025295 Bacteria 66363
187 Ga0209564_1000511 3300025295 Bacteria 63773
188 Ga0209564_1000586 3300025295 Bacteria 57490
189 Ga0209564_1002586 3300025295 Bacteria 13890
190 Ga0209564_1010499 3300025295 Bacteria 4257
191 Ga0209564_1019663 3300025295 Bacteria 2513
192 Ga0209758_1000086 3300025297 Bacteria 254778
193 Ga0209758_1000585 3300025297 Bacteria 56861
194 Ga0209758_1000688 3300025297 Bacteria 50116
195 Ga0209758_1001274 3300025297 Bacteria 31178
196 Ga0209758_1014554 3300025297 Bacteria 4171
197 Ga0209758_1014603 3300025297 Bacteria 4160
198 Ga0209758_1019485 3300025297 Bacteria 3268
199 Ga0209758_1022160 3300025297 Bacteria 2928
200 Ga0209758_1029954 3300025297 Bacteria 2263
201 Ga0209758_1051251 3300025297 Bacteria 1438
202 Ga0209758_1052275 3300025297 Bacteria 1415
203 Ga0209758_1060846 3300025297 Bacteria 1248
204 Ga0209050_1005653 3300025298 Bacteria 7741
205 Ga0209050_1020198 3300025298 Bacteria 2489
206 Ga0209256_1000786 3300025299 Bacteria 40946
207 Ga0209256_1002344 3300025299 Bacteria 15777
208 Ga0209256_1005287 3300025299 Bacteria 7521
209 Ga0209256_1005765 3300025299 Bacteria 6918
210 Ga0209256_1036117 3300025299 Bacteria 1299
211 Ga0209256_1041953 3300025299 Bacteria 1159
212 Ga0209256_1062509 3300025299 Bacteria 862
213 Ga0209256_1087814 3300025299 Bacteria 667
214 Ga0209256_1104670 3300025299 Bacteria 580
215 Ga0209256_1112501 3300025299 Bacteria 545
216 Ga0207426_1000042 3300025302 Bacteria 433289
217 Ga0207426_1000200 3300025302 Bacteria 144028
218 Ga0207426_1000355 3300025302 Bacteria 83450
219 Ga0207426_1002795 3300025302 Bacteria 10477
220 Ga0207426_1053245 3300025302 Bacteria 1195
221 Ga0209051_1000038 3300025303 Bacteria 320926
222 Ga0209051_1002500 3300025303 Bacteria 13097
223 Ga0209051_1007982 3300025303 Bacteria 5683
224 Ga0209051_1104225 3300025303 Bacteria 755
225 Ga0209257_1017762 3300025304 Bacteria 2783
226 Ga0209257_1099623 3300025304 Bacteria 711
227 Ga0207656_10095355 3300025321 Bacteria 1356
228 Ga0207647_10554759 3300025904 Bacteria 637
229 Ga0207695_10000118 3300025913 Bacteria 237085
230 Ga0207671_10000410 3300025914 Bacteria 60046
231 Ga0207650_10001958 3300025925 Bacteria 14473
232 Ga0207709_10579501 3300025935 Bacteria 886
233 Ga0207711_10113169 3300025941 Bacteria 2416
234 Ga0207667_10914406 3300025949 Bacteria 869
235 Ga0207668_10601671 3300025972 Bacteria 958
236 Ga0209813_10288423 3300027866 Bacteria 634
237 Ga0268266_10203661 3300028379 Bacteria 1812
238 Ga0307515_10000375 3300028794 Bacteria 109285
239 Ga0307515_10013166 3300028794 Bacteria 15476
240 Ga0307515_10017859 3300028794 Bacteria 12890
241 Ga0307513_10000335 3300031456 Bacteria 67961
242 Ga0307513_10007331 3300031456 Bacteria 14320
243 Ga0307408_100447129 3300031548 Bacteria 1120
244 Ga0307408_101127243 3300031548 Bacteria 729
245 Ga0307405_10003524 3300031731 Bacteria 7211
246 Ga0307406_10018684 3300031901 Bacteria 4054
247 Ga0307412_10235347 3300031911 Bacteria 1413
248 Ga0307414_12087186 3300032004 Bacteria 529
249 Ga0439436_0051800 3300041404 Bacteria 1158
250 Ga0439438_062811 3300041405 Bacteria 928
251 Ga0439447_023188 3300041407 Bacteria 1619
252 Ga0439466_0046196 3300041411 Bacteria 1439
253 Ga0439465_0001359 3300041413 Bacteria 7878
254 Ga0439465_0012292 3300041413 Bacteria 2679
255 Ga0439465_0018277 3300041413 Bacteria 2191
256 Ga0451787_496533 3300041441 Bacteria 1693
257 Ga0451789_1098931 3300041443 Bacteria 1516
258 Ga0451793_0819188 3300041452 Bacteria 1094
259 Ga0451798_0885988 3300041458 Bacteria 1356
260 Ga0451802_1466569 3300041460 Bacteria 1192
261 Ga0451833_0146614 3300041491 Bacteria 3098
262 Ga0451833_0611857 3300041491 Bacteria 1302
263 Ga0451837_0143144 3300041494 Bacteria 2176
264 Ga0451837_1297148 3300041494 Bacteria 1280
265 Ga0451839_0678247 3300041496 Bacteria 2947
266 Ga0451839_1595413 3300041496 Bacteria 565
267 Ga0451841_0305811 3300041498 Bacteria 2100
268 Ga0451847_0140318 3300041503 Bacteria 1281
269 Ga0451847_0707496 3300041503 Bacteria 2218
270 Ga0451849_0597870 3300041505 Bacteria 1295
271 Ga0451851_0868248 3300041507 Bacteria 1110
272 Ga0451851_0972318 3300041507 Bacteria 2272
273 Ga0451843_0515827 3300041509 Bacteria 695
274 Ga0451843_0541337 3300041509 Bacteria 4447
275 Ga0451855_0815332 3300041511 Bacteria 703
276 Ga0451853_0630923 3300041512 Bacteria 1605
277 Ga0451853_3746137 3300041512 Bacteria 824
278 Ga0439449_0029950 3300042007 Bacteria 2028
279 Ga0450919_017637 3300042121 Bacteria 805
280 Ga0450920_010004 3300042122 Bacteria 1754
281 Ga0450906_002063 3300042145 Bacteria 4392
282 Ga0450918_034223 3300042531 Bacteria 902
283 Ga0495627_115648 3300046453 Bacteria 759
284 Ga0495592_0135462 3300046454 Bacteria 1718
285 Ga0495629_0155593 3300046459 Bacteria 1588
286 Ga0495638_0000084 3300046460 Bacteria 153168
287 Ga0495638_0000420 3300046460 Bacteria 51327
288 Ga0495638_0105980 3300046460 Bacteria 1675
289 Ga0495653_0829829 3300046463 Bacteria 554
290 Ga0495650_0017101 3300046471 Bacteria 3647
291 Ga0495650_0022686 3300046471 Bacteria 3007
292 Ga0495650_0072982 3300046471 Bacteria 1342
293 Ga0495605_0014548 3300046474 Bacteria 4304
294 Ga0495605_0018386 3300046474 Bacteria 3747
295 Ga0495639_0142964 3300046475 Bacteria 1151
296 Ga0495662_0001314 3300046476 Bacteria 12303
297 Ga0495664_0109113 3300046477 Bacteria 1670
298 Ga0495584_0231810 3300046491 Bacteria 939
299 Ga0495585_0006217 3300046492 Bacteria 7439
300 Ga0495585_0072173 3300046492 Bacteria 1881
301 Ga0495607_0037149 3300046501 Bacteria 2927
302 Ga0495607_0089125 3300046501 Bacteria 1675
303 Ga0495607_0129012 3300046501 Bacteria 1318
304 Ga0495607_0226581 3300046501 Bacteria 911
305 Ga0495607_0344494 3300046501 Bacteria 689
306 Ga0495583_0004969 3300046506 Bacteria 9228
307 Ga0495583_0011616 3300046506 Bacteria 5046
308 Ga0495583_0021146 3300046506 Bacteria 3352
309 Ga0495606_0000848 3300046507 Bacteria 45957
310 Ga0495606_0004464 3300046507 Bacteria 13955
311 Ga0495606_0086935 3300046507 Bacteria 1931
312 Ga0495606_0138583 3300046507 Bacteria 1439
313 Ga0495606_0190090 3300046507 Bacteria 1177
314 Ga0495610_0000694 3300046512 Bacteria 32397
315 Ga0495610_0010647 3300046512 Bacteria 5696
316 Ga0495610_0180434 3300046512 Bacteria 878
317 Ga0495610_0241339 3300046512 Bacteria 720
318 Ga0495616_0066349 3300046513 Bacteria 1756
319 Ga0495616_0216754 3300046513 Bacteria 835
320 Ga0495620_0011307 3300046515 Bacteria 4657
321 Ga0495620_0014856 3300046515 Bacteria 3947
322 Ga0495620_0036518 3300046515 Bacteria 2198
323 Ga0495620_0108977 3300046515 Bacteria 1099
324 Ga0495628_1009529 3300046516 Bacteria 572
325 Ga0495631_0008921 3300046518 Bacteria 5029
326 Ga0495631_0041639 3300046518 Bacteria 2032
327 Ga0495631_0076886 3300046518 Bacteria 1440
328 Ga0495632_0004193 3300046519 Bacteria 9860
329 Ga0495632_0022250 3300046519 Bacteria 3400
330 Ga0495632_0166049 3300046519 Bacteria 1015
331 Ga0495637_0007239 3300046520 Bacteria 5518
332 Ga0495643_0003806 3300046522 Bacteria 10904
333 Ga0495643_0007745 3300046522 Bacteria 6877
334 Ga0495643_0010332 3300046522 Bacteria 5747
335 Ga0495643_0032932 3300046522 Bacteria 2871
336 Ga0495643_0089349 3300046522 Bacteria 1591
337 Ga0495648_0013425 3300046524 Bacteria 6057
338 Ga0495648_0014179 3300046524 Bacteria 5848
339 Ga0495648_0071036 3300046524 Bacteria 2020
340 Ga0495663_0001716 3300046525 Bacteria 6806
341 Ga0495652_0078663 3300046529 Bacteria 2729
342 Ga0495654_0000114 3300046530 Bacteria 91751
343 Ga0495640_0235010 3300046533 Bacteria 1152
344 Ga0495587_0170504 3300046536 Bacteria 1236
345 Ga0495609_0027131 3300046538 Bacteria 2619
346 Ga0495609_0161450 3300046538 Bacteria 949
347 Ga0495597_0044037 3300046542 Bacteria 1985
348 Ga0495633_0004140 3300046558 Bacteria 9326
349 Ga0495656_0028607 3300046615 Bacteria 2237
350 Ga0495656_0052905 3300046615 Bacteria 1743
351 Ga0495668_0003832 3300046616 Bacteria 11012
352 Ga0495668_0056851 3300046616 Bacteria 2159
353 Ga0495668_0185231 3300046616 Bacteria 1140
354 Ga0495611_0024632 3300046648 Bacteria 2619
355 Ga0495625_0009342 3300046660 Bacteria 8214
356 Ga0495625_0015205 3300046660 Bacteria 6105
357 Ga0495625_0059273 3300046660 Bacteria 2716
358 Ga0495625_0176621 3300046660 Bacteria 1423
359 Ga0495625_0340039 3300046660 Bacteria 951
360 Ga0495625_0653791 3300046660 Bacteria 625
361 Ga0495661_0179773 3300046665 Bacteria 1122
362 Ga0495588_0000378 3300046674 Bacteria 25869
363 Ga0495588_0281046 3300046674 Bacteria 877
364 Ga0495588_0511565 3300046674 Bacteria 629
365 Ga0495657_0194627 3300046675 Bacteria 1238
366 Ga0495658_0015634 3300046683 Bacteria 3895
367 Ga0495670_0014478 3300046691 Bacteria 3878
368 Ga0495670_0108305 3300046691 Bacteria 1436
369 Ga0495671_0000867 3300046692 Bacteria 21672
370 Ga0495671_0054422 3300046692 Bacteria 1984
371 Ga0495671_0256497 3300046692 Bacteria 844
372 Ga0495671_0314018 3300046692 Bacteria 753
373 Ga0495649_0018726 3300046694 Bacteria 3890
374 Ga0495649_0033601 3300046694 Bacteria 2823
375 Ga0495649_0043522 3300046694 Bacteria 2451
376 Ga0495589_0039636 3300046794 Bacteria 2354
377 Ga0495600_0076570 3300046809 Bacteria 2184
378 Ga0495660_0087704 3300046810 Bacteria 1622
379 Ga0495660_0161377 3300046810 Bacteria 1099
380 Ga0495660_0200618 3300046810 Bacteria 952
381 Ga0495604_0194220 3300047317 Bacteria 1412
382 Ga0495636_0047695 3300047318 Bacteria 1789
383 Ga0495636_0057672 3300047318 Bacteria 1636
384 Ga0495674_0285533 3300047319 Bacteria 1351
385 Ga0495672_0023628 3300047320 Bacteria 3975
386 Ga0495676_0505585 3300047321 Bacteria 793
387 Ga0495683_0128552 3300047323 Bacteria 1197
388 Ga0495687_006530 3300047443 Bacteria 7125
389 Ga0495687_066046 3300047443 Bacteria 1470
390 Ga0495685_024438 3300047447 Bacteria 2080
391 Ga0495673_0068514 3300047469 Bacteria 1499
392 Ga0495673_0109708 3300047469 Bacteria 1105
393 Ga0495681_0000678 3300047470 Bacteria 25887
394 Ga0495681_0021104 3300047470 Bacteria 3516
395 Ga0495681_0053765 3300047470 Bacteria 1884
396 Ga0495681_0058730 3300047470 Bacteria 1781
397 Ga0495681_0337402 3300047470 Bacteria 576
398 Ga0495686_0000296 3300047472 Bacteria 86346
399 Ga0495686_0011203 3300047472 Bacteria 6327
400 Ga0495686_0022801 3300047472 Bacteria 4137
401 Ga0495686_0240160 3300047472 Bacteria 1022
402 Ga0495686_0377466 3300047472 Bacteria 765
403 Ga0495626_0071269 3300048091 Bacteria 1562
404 Ga0495626_0273955 3300048091 Bacteria 672
405 Ga0496100_0040378 3300048903 Bacteria 2968
406 Ga0496100_0518902 3300048903 Bacteria 919
407 Ga0496100_0829165 3300048903 Bacteria 725
408 Ga0496102_0016095 3300048905 Bacteria 6530
409 Ga0496102_0083303 3300048905 Bacteria 2951
410 Ga0496103_0020495 3300048906 Bacteria 3971
411 Ga0496104_0585150 3300048907 Bacteria 1026
412 Ga0496105_0208532 3300048908 Bacteria 1593
413 Ga0496106_0001056 3300048909 Bacteria 20286
414 Ga0496106_0265173 3300048909 Bacteria 1375
415 Ga0496106_1565609 3300048909 Bacteria 506
416 Ga0496107_0219298 3300048910 Bacteria 1415
417 Ga0496110_0154656 3300048913 Bacteria 2077
418 Ga0496110_0885243 3300048913 Bacteria 799
419 Ga0496113_0026868 3300048916 Bacteria 4120
420 Ga0496116_0003396 3300048919 Bacteria 15767
421 Ga0496116_0013786 3300048919 Bacteria 6493
422 Ga0496116_0020125 3300048919 Bacteria 5079
423 Ga0496116_0030645 3300048919 Bacteria 3861
424 Ga0496116_0040659 3300048919 Bacteria 3199
425 Ga0496117_0001380 3300048920 Bacteria 35320
426 Ga0496117_0012124 3300048920 Bacteria 7643
427 Ga0496117_0013898 3300048920 Bacteria 6979
428 Ga0496117_0019559 3300048920 Bacteria 5557
429 Ga0496117_0092120 3300048920 Bacteria 1948
430 Ga0496118_0001922 3300048921 Bacteria 29492
431 Ga0496118_0006564 3300048921 Bacteria 12721
432 Ga0496118_0021379 3300048921 Bacteria 5697
433 Ga0496118_0022580 3300048921 Bacteria 5494
434 Ga0496118_0064044 3300048921 Bacteria 2701
435 Ga0496118_0152397 3300048921 Bacteria 1445
436 Ga0496119_0014776 3300048922 Bacteria 6077
437 Ga0496119_0017450 3300048922 Bacteria 5395
438 Ga0496119_0018901 3300048922 Bacteria 5103
439 Ga0496119_0042973 3300048922 Bacteria 2861
440 Ga0496119_0079060 3300048922 Bacteria 1901
441 Ga0496119_0477244 3300048922 Bacteria 583
442 Ga0496120_0018031 3300048923 Bacteria 4560
443 Ga0496120_0022015 3300048923 Bacteria 4015
444 Ga0496120_0037056 3300048923 Bacteria 2898
445 Ga0496120_0135362 3300048923 Bacteria 1257
446 Ga0496121_0001817 3300048924 Bacteria 34409
447 Ga0496121_0004588 3300048924 Bacteria 18420
448 Ga0496121_0022112 3300048924 Bacteria 6188
449 Ga0496121_0031641 3300048924 Bacteria 4829
450 Ga0496121_0051672 3300048924 Bacteria 3459
451 Ga0496121_0072426 3300048924 Bacteria 2766
452 Ga0496121_0158055 3300048924 Bacteria 1661
453 Ga0496121_0176053 3300048924 Bacteria 1549
454 Ga0496121_0300282 3300048924 Bacteria 1090
455 Ga0496121_0310114 3300048924 Bacteria 1067
456 Ga0496122_0006070 3300048925 Bacteria 14077
457 Ga0496122_0022093 3300048925 Bacteria 5668
458 Ga0496122_0047377 3300048925 Bacteria 3319
459 Ga0496122_0051586 3300048925 Bacteria 3124
460 Ga0496122_0085855 3300048925 Bacteria 2169
461 Ga0496122_0324758 3300048925 Bacteria 816
462 Ga0496122_0326723 3300048925 Bacteria 812
463 Ga0496123_0004386 3300048926 Bacteria 14875
464 Ga0496123_0015998 3300048926 Bacteria 6116
465 Ga0496123_0019205 3300048926 Bacteria 5394
466 Ga0496123_0023238 3300048926 Bacteria 4749
467 Ga0496123_0048989 3300048926 Bacteria 2837
468 Ga0496124_0004324 3300048927 Bacteria 16651
469 Ga0496124_0006892 3300048927 Bacteria 12211
470 Ga0496124_0010829 3300048927 Bacteria 9184
471 Ga0496124_0013839 3300048927 Bacteria 7846
472 Ga0496124_0048309 3300048927 Bacteria 3637
473 Ga0496124_0049581 3300048927 Bacteria 3581
474 Ga0496124_0066739 3300048927 Bacteria 2995
475 Ga0496124_0145019 3300048927 Bacteria 1869
476 Ga0496124_0171846 3300048927 Bacteria 1677
477 Ga0496125_0004658 3300048928 Bacteria 15641
478 Ga0496125_0032139 3300048928 Bacteria 4665
479 Ga0496125_0032561 3300048928 Bacteria 4630
480 Ga0496125_0056456 3300048928 Bacteria 3188
481 Ga0496125_0335939 3300048928 Bacteria 909
482 Ga0496126_0042292 3300048929 Bacteria 4209
483 Ga0496126_0371164 3300048929 Bacteria 1166
484 Ga0495678_001350 3300049459 Bacteria 19638
485 Ga0495678_026013 3300049459 Bacteria 2505
486 Ga0495678_106515 3300049459 Bacteria 963
487 Ga0495682_0005253 3300049460 Bacteria 5412
488 Ga0495682_0025279 3300049460 Bacteria 2211
489 Ga0501032_0050994 3300049569 Bacteria 2790
490 Ga0501034_0043885 3300049571 Bacteria 4522
491 Ga0501036_1064638 3300049572 Bacteria 661
492 Ga0501046_0047291 3300049580 Bacteria 3411
493 Ga0501047_0142028 3300049581 Bacteria 2279
494 Ga0501068_0052620 3300049584 Bacteria 2464
495 Ga0501080_1882106 3300049742 Bacteria 501
496 Ga0501280_041395 3300049776 Bacteria 748
497 nmdc:mga03n38_344896_c1 3300050490 Bacteria 809
498 nmdc:mga03n38_661507_c1 3300050490 Bacteria 599
499 nmdc:mga0yw44_1019742_c1 3300050492 Bacteria 560
500 nmdc:mga0yw44_1123799_c1 3300050492 Bacteria 531
501 nmdc:mga0yw44_18982_c1 3300050492 Bacteria 3781
502 nmdc:mga0yw44_23732_c1 3300050492 Bacteria 3460
503 nmdc:mga0k408_58320_c1 3300050493 Bacteria 2242
504 nmdc:mga06z11_62685_c1 3300050494 Bacteria 1943
505 nmdc:mga04h51_30035_c1 3300050495 Bacteria 1707
506 nmdc:mga07m45_196919_c1 3300050496 Bacteria 1172
507 nmdc:mga07m45_292243_c1 3300050496 Bacteria 948
508 nmdc:mga07m45_352003_c1 3300050496 Bacteria 856
509 nmdc:mga0sz30_174151_c1 3300050516 Bacteria 954
510 nmdc:mga0sz30_51978_c1 3300050516 Bacteria 1739
511 nmdc:mga0sz30_7667_c1 3300050516 Bacteria 4052
512 Ga0495601_0512867 3300053077 Bacteria 773
513 Ga0500610_0007217 3300053079 Bacteria 4741
514 Ga0500610_0179008 3300053079 Bacteria 1040
515 Ga0495619_0174917 3300053085 Bacteria 1485
516 Ga0500578_0146576 3300053086 Bacteria 1472
517 Ga0500578_0363556 3300053086 Bacteria 843
518 Ga0500646_0332573 3300053090 Bacteria 551
519 Ga0500651_0418622 3300053093 Bacteria 750
520 Ga0500566_0457030 3300053094 Bacteria 558
521 Ga0500555_110014 3300053103 Bacteria 694
522 Ga0500569_336813 3300053109 Bacteria 503
523 Ga0500572_057416 3300053111 Bacteria 1175
524 Ga0500572_163371 3300053111 Bacteria 729
525 Ga0500594_0003798 3300053118 Bacteria 3323
526 Ga0500594_0035474 3300053118 Bacteria 1338
527 Ga0500608_071714 3300053122 Bacteria 1646
528 Ga0500608_164039 3300053122 Bacteria 960
529 Ga0500614_061029 3300053123 Bacteria 1014
530 Ga0500618_000031 3300053125 Bacteria 129550
531 Ga0500618_000296 3300053125 Bacteria 37750
532 Ga0500618_013202 3300053125 Bacteria 2143
533 Ga0500621_205605 3300053126 Bacteria 694
534 Ga0500658_0000877 3300053134 Bacteria 12346
535 Ga0500658_0007391 3300053134 Bacteria 4058
536 Ga0500658_0035803 3300053134 Bacteria 1967
537 Ga0500559_0522051 3300053136 Bacteria 544
538 Ga0500568_0000200 3300053139 Bacteria 52499
539 Ga0500568_0002409 3300053139 Bacteria 11035
540 Ga0500568_0384752 3300053139 Bacteria 508
541 Ga0500577_0188286 3300053142 Bacteria 887
542 Ga0500588_0282182 3300053146 Bacteria 627
543 Ga0500590_000137 3300053148 Bacteria 20276
544 Ga0500604_0032854 3300053151 Bacteria 1531
545 Ga0500616_0000102 3300053153 Bacteria 168834
546 Ga0500616_0000795 3300053153 Bacteria 36180
547 Ga0500616_0004137 3300053153 Bacteria 10499
548 Ga0500620_226901 3300053155 Bacteria 629
549 Ga0500622_0000559 3300053156 Bacteria 34086
550 Ga0500622_0045245 3300053156 Bacteria 2279
551 Ga0500624_009571 3300053157 Bacteria 1380
552 Ga0500627_0178875 3300053158 Bacteria 954
553 Ga0500633_0017299 3300053160 Bacteria 2112
554 Ga0500633_0106695 3300053160 Bacteria 1035
555 Ga0500633_0163626 3300053160 Bacteria 835
556 Ga0500636_0000011 3300053177 Bacteria 140769
557 Ga0500636_0000121 3300053177 Bacteria 40628
558 Ga0501082_0047207 3300060353 Bacteria 3711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0079060 Ga0496119_0079060_1104_1418 104
2 3300046460 Ga0495638_0000420 Ga0495638_0000420_35190_35519 109
3 3300046501 Ga0495607_0037149 Ga0495607_0037149_1496_1825 109
4 3300046501 Ga0495607_0129012 Ga0495607_0129012_639_968 109
5 3300046506 Ga0495583_0021146 Ga0495583_0021146_2281_2610 109
6 3300046512 Ga0495610_0010647 Ga0495610_0010647_3723_4052 109
7 3300046513 Ga0495616_0216754 Ga0495616_0216754_457_786 109
8 3300046515 Ga0495620_0108977 Ga0495620_0108977_39_368 109
9 3300046520 Ga0495637_0007239 Ga0495637_0007239_3536_3865 109
10 3300046522 Ga0495643_0010332 Ga0495643_0010332_2309_2638 109
11 3300046524 Ga0495648_0014179 Ga0495648_0014179_77_406 109
12 3300046525 Ga0495663_0001716 Ga0495663_0001716_3362_3691 109
13 3300046538 Ga0495609_0161450 Ga0495609_0161450_209_538 109
14 3300046648 Ga0495611_0024632 Ga0495611_0024632_271_600 109
15 3300046660 Ga0495625_0009342 Ga0495625_0009342_4322_4651 109
16 3300046665 Ga0495661_0179773 Ga0495661_0179773_608_937 109
17 3300046674 Ga0495588_0000378 Ga0495588_0000378_5864_6193 109
18 3300046691 Ga0495670_0014478 Ga0495670_0014478_133_462 109
19 3300046692 Ga0495671_0000867 Ga0495671_0000867_15761_16090 109
20 3300046694 Ga0495649_0018726 Ga0495649_0018726_2728_3057 109
21 3300046810 Ga0495660_0200618 Ga0495660_0200618_167_496 109
22 3300047443 Ga0495687_006530 Ga0495687_006530_6034_6363 109
23 3300047443 Ga0495687_066046 Ga0495687_066046_763_1092 109
24 3300047470 Ga0495681_0000678 Ga0495681_0000678_15795_16124 109
25 3300047470 Ga0495681_0021104 Ga0495681_0021104_1529_1858 109
26 3300049459 Ga0495678_001350 Ga0495678_001350_15766_16095 109
27 3300049460 Ga0495682_0005253 Ga0495682_0005253_2359_2688 109
28 3300053079 Ga0500610_0179008 Ga0500610_0179008_476_805 109
29 3300053103 Ga0500555_110014 Ga0500555_110014_300_629 109
30 3300053122 Ga0500608_164039 Ga0500608_164039_55_384 109
31 3300053136 Ga0500559_0522051 Ga0500559_0522051_203_532 109
32 3300053146 Ga0500588_0282182 Ga0500588_0282182_88_417 109
33 3300053157 Ga0500624_009571 Ga0500624_009571_300_629 109
34 3300053177 Ga0500636_0000121 Ga0500636_0000121_8744_9073 109
35 iso_pu_bacteria 2643221558 2643814707 109
36 iso_pu_bacteria 2718217997 2719668354 109
37 iso_pu_bacteria 2718218199 2720489047 109
38 iso_pu_bacteria 2718218232 2720609740 109
39 iso_pu_bacteria 2718218233 2720617171 109
40 iso_pu_bacteria 2718218235 2720628303 109
41 iso_pu_bacteria 2718218269 2720772267 109
42 iso_pu_bacteria 2721755556 2723029687 109
43 iso_pu_bacteria 2721755684 2723564056 109
44 iso_pu_bacteria 2721755685 2723569591 109
45 iso_pu_bacteria 2721755819 2724092296 109
46 iso_pu_bacteria 2721755822 2724101138 109
47 iso_pu_bacteria 2721755823 2724112663 109
48 iso_pu_bacteria 2728369352 2730110220 109
49 iso_pu_bacteria 2838016132 2838016429 109
50 iso_pu_bacteria 2838048938 2838050127 109
51 iso_pu_bacteria 2838061910 2838065159 109
52 iso_pu_bacteria 2838068647 2838068965 109
53 iso_pu_bacteria 2842264693 2842265302 109
54 iso_pu_bacteria 2842311132 2842313460 109
55 iso_pu_bacteria 2842422224 2842423111 109
56 iso_pu_bacteria 2842428310 2842428645 109
57 iso_pu_bacteria 2842434925 2842435259 109
58 iso_pu_bacteria 2842441272 2842441878 109
59 iso_pu_bacteria 2842447887 2842448073 109
60 iso_pu_bacteria 2842462802 2842463071 109
61 iso_pu_bacteria 2842469257 2842469591 109
62 iso_pu_bacteria 2933599457 2933599632 109
63 iso_pu_bacteria 8005382845 8005383618 109
64 iso_pu_bacteria 8005497431 8005502560 109
65 iso_pu_bacteria 8005619151 8005623770 109
66 iso_pu_bacteria 8005626139 8005626328 109
67 iso_pu_bacteria 8005668836 8005673988 109
68 iso_pu_bacteria 8054558443 8054563354 109
69 iso_pu_bacteria 2513237144 2513910076 110
70 iso_pu_bacteria 2519899620 2520378976 110
71 iso_pu_bacteria 2775507049 2776912543 110
72 iso_pu_bacteria 2510461069 2510841026 111
73 iso_pu_bacteria 2558860100 2558865254 111
74 iso_pu_bacteria 2582581308 2585278522 111
75 iso_pu_bacteria 2582581315 2585324622 111
76 iso_pu_bacteria 2585427527 2585535437 111
77 iso_pu_bacteria 2585427530 2585556824 111
78 iso_pu_bacteria 2615840626 2616308040 111
79 iso_pu_bacteria 2643221653 2644298189 111
80 iso_pu_bacteria 2643221719 2644656441 111
81 iso_pu_bacteria 2791355091 2792624480 111
82 iso_pu_bacteria 2791355092 2792630584 111
83 iso_pu_bacteria 2791355261 2793329498 111
84 iso_pu_bacteria 2791355263 2793343357 111
85 iso_pu_bacteria 2818991453 2819640969 111
86 iso_pu_bacteria 2842285085 2842288042 111
87 iso_pu_bacteria 2842402390 2842405308 111
88 iso_pu_bacteria 2842409023 2842411935 111
89 iso_pu_bacteria 2842415677 2842418538 111
90 iso_pu_bacteria 2899803654 2899808406 111
91 iso_pu_bacteria 2913295892 2913301582 111
92 iso_pu_bacteria 2936381700 2936386477 111
93 iso_pu_bacteria 2989776772 2989776856 111
94 iso_pu_bacteria 643692032 643822261 111
95 iso_pu_bacteria 2585427531 2585563881 112
96 iso_pu_bacteria 2585427608 2585902514 112
97 iso_pu_bacteria 2838042994 2838045339 112
98 iso_pu_bacteria 2996893221 2996895548 112
99 iso_pu_bacteria 3003930520 3003934201 112
100 3300028794 Ga0307515_10013166 Ga0307515_1001316614 113
101 3300031456 Ga0307513_10007331 Ga0307513_1000733113 113
102 3300049571 Ga0501034_0043885 Ga0501034_0043885_1530_1871 113
103 3300053156 Ga0500622_0045245 Ga0500622_0045245_1825_2166 113
104 iso_pu_bacteria 2509276021 2509390923 113
105 iso_pu_bacteria 2509276033 2509445336 113
106 iso_pu_bacteria 2510917026 2511173282 113
107 iso_pu_bacteria 2510917028 2511183730 113
108 iso_pu_bacteria 2510917030 2511200233 113
109 iso_pu_bacteria 2513237103 2513712235 113
110 iso_pu_bacteria 2513237138 2513867796 113
111 iso_pu_bacteria 2513237146 2513924811 113
112 iso_pu_bacteria 2516653077 2517042659 113
113 iso_pu_bacteria 2516653085 2517081378 113
114 iso_pu_bacteria 2517093000 2517100239 113
115 iso_pu_bacteria 2529292951 2530648665 113
116 iso_pu_bacteria 2534681796 2535520721 113
117 iso_pu_bacteria 2582581294 2585199943 113
118 iso_pu_bacteria 2582581298 2585222388 113
119 iso_pu_bacteria 2582581299 2585230232 113
120 iso_pu_bacteria 2582581304 2585254480 113
121 iso_pu_bacteria 2582581306 2585265891 113
122 iso_pu_bacteria 2582581866 2585395352 113
123 iso_pu_bacteria 2582581867 2585403138 113
124 iso_pu_bacteria 2585427528 2585538718 113
125 iso_pu_bacteria 2585427529 2585544660 113
126 iso_pu_bacteria 2585427590 2585823961 113
127 iso_pu_bacteria 2585427594 2585845932 113
128 iso_pu_bacteria 2585427633 2585996270 113
129 iso_pu_bacteria 2585427634 2586000881 113
130 iso_pu_bacteria 2599185170 2599416373 113
131 iso_pu_bacteria 2615840624 2616294727 113
132 iso_pu_bacteria 2617270742 2617384578 113
133 iso_pu_bacteria 2643221643 2644239348 113
134 iso_pu_bacteria 2667528174 2671113199 113
135 iso_pu_bacteria 2738541293 2738801903 113
136 iso_pu_bacteria 2738541333 2739034141 113
137 iso_pu_bacteria 2765235942 2766068214 113
138 iso_pu_bacteria 2775507266 2778173912 113
139 iso_pu_bacteria 2791355259 2793317749 113
140 iso_pu_bacteria 2791355260 2793321626 113
141 iso_pu_bacteria 2791355264 2793346105 113
142 iso_pu_bacteria 2791355265 2793355997 113
143 iso_pu_bacteria 2802429605 2805930677 113
144 iso_pu_bacteria 2802429606 2805934137 113
145 iso_pu_bacteria 2802429633 2806042938 113
146 iso_pu_bacteria 2818991448 2819611845 113
147 iso_pu_bacteria 2838022645 2838024946 113
148 iso_pu_bacteria 2838029111 2838031719 113
149 iso_pu_bacteria 2838035591 2838036488 113
150 iso_pu_bacteria 2838661181 2838662530 113
151 iso_pu_bacteria 2838668709 2838671319 113
152 iso_pu_bacteria 2838680041 2838685755 113
153 iso_pu_bacteria 2838686498 2838688395 113
154 iso_pu_bacteria 2838694306 2838700337 113
155 iso_pu_bacteria 2838701080 2838703500 113
156 iso_pu_bacteria 2838707686 2838713592 113
157 iso_pu_bacteria 2838729681 2838734470 113
158 iso_pu_bacteria 2838742623 2838746929 113
159 iso_pu_bacteria 2841851746 2841852136 113
160 iso_pu_bacteria 2841864319 2841865744 113
161 iso_pu_bacteria 2842077413 2842082763 113
162 iso_pu_bacteria 2842110456 2842111608 113
163 iso_pu_bacteria 2842118031 2842123881 113
164 iso_pu_bacteria 2842146304 2842149498 113
165 iso_pu_bacteria 2842156927 2842158789 113
166 iso_pu_bacteria 2842163707 2842166218 113
167 iso_pu_bacteria 2842180545 2842182403 113
168 iso_pu_bacteria 2842192696 2842197734 113
169 iso_pu_bacteria 2842198810 2842202030 113
170 iso_pu_bacteria 2842217011 2842222457 113
171 iso_pu_bacteria 2842229732 2842234584 113
172 iso_pu_bacteria 2842237096 2842242995 113
173 iso_pu_bacteria 2842243621 2842248317 113
174 iso_pu_bacteria 2842250916 2842253864 113
175 iso_pu_bacteria 2842257432 2842262510 113
176 iso_pu_bacteria 2842271015 2842272655 113
177 iso_pu_bacteria 2842291075 2842297078 113
178 iso_pu_bacteria 2842304105 2842307904 113
179 iso_pu_bacteria 2842317721 2842321572 113
180 iso_pu_bacteria 2842341865 2842345693 113
181 iso_pu_bacteria 2842363717 2842363989 113
182 iso_pu_bacteria 2842370503 2842376408 113
183 iso_pu_bacteria 2842377471 2842383469 113
184 iso_pu_bacteria 2842384541 2842390638 113
185 iso_pu_bacteria 2842475841 2842478451 113
186 iso_pu_bacteria 2842489311 2842493093 113
187 iso_pu_bacteria 2842495871 2842499339 113
188 iso_pu_bacteria 2842502639 2842505603 113
189 iso_pu_bacteria 2842509118 2842514438 113
190 iso_pu_bacteria 2842521101 2842526819 113
191 iso_pu_bacteria 2844454524 2844461553 113
192 iso_pu_bacteria 2852387548 2852394778 113
193 iso_pu_bacteria 2857516855 2857520625 113
194 iso_pu_bacteria 2919100787 2919102962 113
195 iso_pu_bacteria 2919171160 2919174642 113
196 iso_pu_bacteria 2919408235 2919412967 113
197 iso_pu_bacteria 2923556063 2923559358 113
198 iso_pu_bacteria 2933016740 2933020684 113
199 iso_pu_bacteria 2933570622 2933574355 113
200 iso_pu_bacteria 2996887358 2996887815 113
201 iso_pu_bacteria 3005445848 3005450880 113
202 iso_pu_bacteria 3005452660 3005454069 113
203 iso_pu_bacteria 639633055 639650947 113
204 iso_pu_bacteria 8005258706 8005259161 113
205 iso_pu_bacteria 8005301065 8005307299 113
206 iso_pu_bacteria 8005307578 8005311978 113
207 iso_pu_bacteria 8005321885 8005322342 113
208 iso_pu_bacteria 8005376324 8005382379 113
209 iso_pu_bacteria 8005395548 8005398132 113
210 iso_pu_bacteria 8005542996 8005548488 113
211 iso_pu_bacteria 8005570704 8005575791 113
212 iso_pu_bacteria 8005645114 8005647543 113
213 iso_pu_bacteria 8005688590 8005688860 113
214 iso_pu_bacteria 8018127388 8018131929 113
215 iso_pu_bacteria 8024486573 8024487578 113
216 iso_pu_bacteria 8024501048 8024506123 113
217 iso_pu_bacteria 8046767195 8046771324 113
218 iso_pu_bacteria 8056375014 8056381838 113
219 iso_pu_bacteria 8056382006 8056382924 113
220 iso_pu_bacteria 8057575449 8057581327 113
221 3300003214 JGI25165J46597_1014227 JGI25165J46597_10142272 115
222 3300003752 Ga0055539_1022794 Ga0055539_10227942 115
223 3300005327 Ga0070658_10441811 Ga0070658_104418111 115
224 3300005548 Ga0070665_100014876 Ga0070665_1000148767 115
225 3300005563 Ga0068855_100236734 Ga0068855_1002367344 115
226 3300005578 Ga0068854_100030411 Ga0068854_1000304115 115
227 3300005834 Ga0068851_10031766 Ga0068851_100317662 115
228 3300009036 Ga0105244_10102659 Ga0105244_101026592 115
229 3300009093 Ga0105240_10000240 Ga0105240_1000024029 115
230 3300009101 Ga0105247_10322250 Ga0105247_103222502 115
231 3300009148 Ga0105243_10167213 Ga0105243_101672134 115
232 3300009177 Ga0105248_10183848 Ga0105248_101838483 115
233 3300009545 Ga0105237_10003272 Ga0105237_1000327220 115
234 3300010375 Ga0105239_10021907 Ga0105239_100219077 115
235 3300013104 Ga0157370_10001696 Ga0157370_100016964 115
236 3300013297 Ga0157378_10657127 Ga0157378_106571272 115
237 3300014497 Ga0182008_10018574 Ga0182008_100185743 115
238 3300015262 Ga0182007_10000406 Ga0182007_1000040614 115
239 3300015265 Ga0182005_1006240 Ga0182005_10062404 115
240 3300021320 Ga0214544_1000906 Ga0214544_100090643 115
241 3300021321 Ga0214542_1000400 Ga0214542_100040039 115
242 3300021327 Ga0214543_1000019 Ga0214543_100001939 115
243 3300025253 Ga0209677_100499 Ga0209677_10049921 115
244 3300025261 Ga0209233_1000203 Ga0209233_100020391 115
245 3300025321 Ga0207656_10095355 Ga0207656_100953553 115
246 3300025904 Ga0207647_10554759 Ga0207647_105547591 115
247 3300025913 Ga0207695_10000118 Ga0207695_1000011830 115
248 3300025914 Ga0207671_10000410 Ga0207671_1000041054 115
249 3300025935 Ga0207709_10579501 Ga0207709_105795012 115
250 3300025941 Ga0207711_10113169 Ga0207711_101131693 115
251 3300025949 Ga0207667_10914406 Ga0207667_109144062 115
252 3300028379 Ga0268266_10203661 Ga0268266_102036613 115
253 3300032004 Ga0307414_12087186 Ga0307414_120871862 115
254 3300041507 Ga0451851_0972318 Ga0451851_0972318_1347_1694 115
255 3300048903 Ga0496100_0040378 Ga0496100_0040378_2440_2787 115
256 3300048905 Ga0496102_0016095 Ga0496102_0016095_561_908 115
257 3300048906 Ga0496103_0020495 Ga0496103_0020495_2253_2600 115
258 3300048916 Ga0496113_0026868 Ga0496113_0026868_2413_2760 115
259 3300048919 Ga0496116_0040659 Ga0496116_0040659_1845_2192 115
260 3300048920 Ga0496117_0001380 Ga0496117_0001380_33804_34151 115
261 3300048921 Ga0496118_0001922 Ga0496118_0001922_26695_27042 115
262 3300048922 Ga0496119_0017450 Ga0496119_0017450_4864_5211 115
263 3300048923 Ga0496120_0018031 Ga0496120_0018031_2035_2382 115
264 3300048924 Ga0496121_0001817 Ga0496121_0001817_18140_18487 115
265 3300048925 Ga0496122_0326723 Ga0496122_0326723_11_358 115
266 3300048926 Ga0496123_0019205 Ga0496123_0019205_3124_3471 115
267 3300048927 Ga0496124_0006892 Ga0496124_0006892_7797_8144 115
268 3300048928 Ga0496125_0032139 Ga0496125_0032139_3988_4335 115
269 3300048929 Ga0496126_0371164 Ga0496126_0371164_434_781 115
270 3300049776 Ga0501280_041395 Ga0501280_041395_69_416 115
271 iso_pu_bacteria 2513237088 2513599373 115
272 3300003322 rootL2_10070897 rootL2_100708972 116
273 3300046507 Ga0495606_0190090 Ga0495606_0190090_557_907 116
274 3300001979 JGI24740J21852_10000003 JGI24740J21852_1000000319 117
275 3300002704 JGI25155J39150_1000017 JGI25155J39150_100001730 117
276 3300002705 JGI25156J39149_1000034 JGI25156J39149_100003480 117
277 3300002737 JGI25162J39368_1000069 JGI25162J39368_1000069116 117
278 3300002738 JGI25154J39366_1000034 JGI25154J39366_1000034140 117
279 3300002739 JGI25158J39367_1000132 JGI25158J39367_100013213 117
280 3300002741 JGI25157J39369_1000092 JGI25157J39369_100009249 117
281 3300002773 JGI25152J39213_1001418 JGI25152J39213_10014185 117
282 3300002773 JGI25152J39213_1002382 JGI25152J39213_10023828 117
283 3300002773 JGI25152J39213_1005221 JGI25152J39213_10052215 117
284 3300002773 JGI25152J39213_1014529 JGI25152J39213_10145292 117
285 3300002773 JGI25152J39213_1051624 JGI25152J39213_10516241 117
286 3300002773 JGI25152J39213_1051633 JGI25152J39213_10516331 117
287 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010181 117
288 3300002774 JGI25150J39212_1017894 JGI25150J39212_10178942 117
289 3300002987 JGI25159J45721_1000421 JGI25159J45721_10004218 117
290 3300002987 JGI25159J45721_1001354 JGI25159J45721_10013544 117
291 3300003187 JGI25151J46595_10000026 JGI25151J46595_10000026161 117
292 3300003187 JGI25151J46595_10000383 JGI25151J46595_100003835 117
293 3300003187 JGI25151J46595_10093007 JGI25151J46595_100930071 117
294 3300003214 JGI25165J46597_1000018 JGI25165J46597_100001833 117
295 3300003215 JGI25153J46596_10000858 JGI25153J46596_100008583 117
296 3300003215 JGI25153J46596_10005939 JGI25153J46596_100059395 117
297 3300003215 JGI25153J46596_10013444 JGI25153J46596_100134442 117
298 3300003215 JGI25153J46596_10035348 JGI25153J46596_100353483 117
299 3300003215 JGI25153J46596_10090646 JGI25153J46596_100906462 117
300 3300003215 JGI25153J46596_10102720 JGI25153J46596_101027202 117
301 3300003215 JGI25153J46596_10137924 JGI25153J46596_101379241 117
302 3300003215 JGI25153J46596_10137947 JGI25153J46596_101379471 117
303 3300003316 rootH1_10016543 rootH1_100165432 117
304 3300003316 rootH1_10040367 rootH1_100403673 117
305 3300003320 rootH2_10083368 rootH2_100833682 117
306 3300003322 rootL2_10009173 rootL2_1000917315 117
307 3300003323 rootH1_10020310 rootH1_100203102 117
308 3300003354 JGI25160J50197_1000599 JGI25160J50197_100059915 117
309 3300003354 JGI25160J50197_1003370 JGI25160J50197_10033708 117
310 3300003354 JGI25160J50197_1004142 JGI25160J50197_10041427 117
311 3300003354 JGI25160J50197_1034304 JGI25160J50197_10343042 117
312 3300003354 JGI25160J50197_1038120 JGI25160J50197_10381202 117
313 3300003374 JGI25161J50226_1000050 JGI25161J50226_100005057 117
314 3300003374 JGI25161J50226_1000424 JGI25161J50226_100042415 117
315 3300003374 JGI25161J50226_1002379 JGI25161J50226_10023793 117
316 3300003771 Ga0055526_1000661 Ga0055526_10006611 117
317 3300003771 Ga0055526_1001610 Ga0055526_10016103 117
318 3300003771 Ga0055526_1002306 Ga0055526_10023068 117
319 3300003771 Ga0055526_1007407 Ga0055526_10074071 117
320 3300003771 Ga0055526_1017301 Ga0055526_10173013 117
321 3300003771 Ga0055526_1021612 Ga0055526_10216122 117
322 3300003771 Ga0055526_1031463 Ga0055526_10314632 117
323 3300003775 Ga0055524_1000936 Ga0055524_10009362 117
324 3300003775 Ga0055524_1001468 Ga0055524_10014682 117
325 3300003775 Ga0055524_1002754 Ga0055524_10027546 117
326 3300003775 Ga0055524_1005288 Ga0055524_10052882 117
327 3300003775 Ga0055524_1045897 Ga0055524_10458972 117
328 3300003781 Ga0055536_1001115 Ga0055536_100111516 117
329 3300003790 Ga0055528_1000096 Ga0055528_100009631 117
330 3300003790 Ga0055528_1000681 Ga0055528_100068131 117
331 3300003790 Ga0055528_1003470 Ga0055528_10034702 117
332 3300003790 Ga0055528_1009316 Ga0055528_10093162 117
333 3300003790 Ga0055528_1009508 Ga0055528_10095086 117
334 3300003790 Ga0055528_1009927 Ga0055528_10099272 117
335 3300003790 Ga0055528_1027264 Ga0055528_10272642 117
336 3300003790 Ga0055528_1060574 Ga0055528_10605742 117
337 3300003791 Ga0055530_10028614 Ga0055530_100286143 117
338 3300003792 Ga0055540_1000728 Ga0055540_100072817 117
339 3300003792 Ga0055540_1009933 Ga0055540_10099333 117
340 3300003792 Ga0055540_1018639 Ga0055540_10186392 117
341 3300003792 Ga0055540_1020467 Ga0055540_10204672 117
342 3300003792 Ga0055540_1039119 Ga0055540_10391192 117
343 3300003794 Ga0055531_10005662 Ga0055531_100056627 117
344 3300004625 Ga0055543_1000023 Ga0055543_100002314 117
345 3300004625 Ga0055543_1000576 Ga0055543_100057615 117
346 3300004625 Ga0055543_1004138 Ga0055543_10041381 117
347 3300004625 Ga0055543_1005969 Ga0055543_10059695 117
348 3300004625 Ga0055543_1067750 Ga0055543_10677501 117
349 3300005262 Ga0065165_1002596 Ga0065165_100259614 117
350 3300005262 Ga0065165_1021771 Ga0065165_10217713 117
351 3300005262 Ga0065165_1024177 Ga0065165_10241773 117
352 3300005262 Ga0065165_1147045 Ga0065165_11470451 117
353 3300005262 Ga0065165_1147375 Ga0065165_11473751 117
354 3300005331 Ga0070670_100036429 Ga0070670_1000364292 117
355 3300005335 Ga0070666_10253898 Ga0070666_102538982 117
356 3300005344 Ga0070661_101755997 Ga0070661_1017559971 117
357 3300005367 Ga0070667_100276016 Ga0070667_1002760162 117
358 3300005455 Ga0070663_101742622 Ga0070663_1017426221 117
359 3300005844 Ga0068862_101679203 Ga0068862_1016792032 117
360 3300006038 Ga0075365_10004903 Ga0075365_100049035 117
361 3300006038 Ga0075365_10019303 Ga0075365_100193035 117
362 3300006038 Ga0075365_10082343 Ga0075365_100823432 117
363 3300006042 Ga0075368_10146953 Ga0075368_101469532 117
364 3300006048 Ga0075363_100157737 Ga0075363_1001577372 117
365 3300006048 Ga0075363_100783544 Ga0075363_1007835442 117
366 3300006177 Ga0075362_10000551 Ga0075362_100005518 117
367 3300006177 Ga0075362_10397088 Ga0075362_103970881 117
368 3300006178 Ga0075367_10395603 Ga0075367_103956032 117
369 3300006186 Ga0075369_10003191 Ga0075369_100031915 117
370 3300006186 Ga0075369_10016631 Ga0075369_100166314 117
371 3300006186 Ga0075369_10122672 Ga0075369_101226722 117
372 3300006195 Ga0075366_10919346 Ga0075366_109193461 117
373 3300006353 Ga0075370_10209622 Ga0075370_102096222 117
374 3300006353 Ga0075370_10679738 Ga0075370_106797382 117
375 3300006353 Ga0075370_10702873 Ga0075370_107028732 117
376 3300006353 Ga0075370_10989941 Ga0075370_109899411 117
377 3300009011 Ga0105251_10110680 Ga0105251_101106802 117
378 3300009036 Ga0105244_10291259 Ga0105244_102912592 117
379 3300009092 Ga0105250_10162888 Ga0105250_101628882 117
380 3300009101 Ga0105247_10478878 Ga0105247_104788782 117
381 3300009177 Ga0105248_11044148 Ga0105248_110441481 117
382 3300009551 Ga0105238_12517054 Ga0105238_125170542 117
383 3300009766 Ga0123342_1012677 Ga0123342_10126776 117
384 3300009766 Ga0123342_1016141 Ga0123342_10161414 117
385 3300012490 Ga0157322_1000796 Ga0157322_10007962 117
386 3300012512 Ga0157327_1080255 Ga0157327_10802551 117
387 3300013100 Ga0157373_10129215 Ga0157373_101292152 117
388 3300013100 Ga0157373_10944156 Ga0157373_109441562 117
389 3300013105 Ga0157369_10380172 Ga0157369_103801722 117
390 3300017792 Ga0163161_10544431 Ga0163161_105444312 117
391 3300025206 Ga0209435_100023 Ga0209435_100023161 117
392 3300025208 Ga0209436_100031 Ga0209436_10003129 117
393 3300025233 Ga0209437_100022 Ga0209437_10002298 117
394 3300025245 Ga0207425_1000010 Ga0207425_1000010508 117
395 3300025245 Ga0207425_1004436 Ga0207425_10044363 117
396 3300025245 Ga0207425_1005593 Ga0207425_10055934 117
397 3300025245 Ga0207425_1016108 Ga0207425_10161082 117
398 3300025246 Ga0209646_1000080 Ga0209646_1000080161 117
399 3300025246 Ga0209646_1043672 Ga0209646_10436722 117
400 3300025250 Ga0209026_1000076 Ga0209026_1000076161 117
401 3300025256 Ga0209759_1000059 Ga0209759_1000059161 117
402 3300025258 Ga0209129_1000197 Ga0209129_100019775 117
403 3300025258 Ga0209129_1000625 Ga0209129_100062521 117
404 3300025258 Ga0209129_1001067 Ga0209129_100106713 117
405 3300025258 Ga0209129_1001986 Ga0209129_10019863 117
406 3300025258 Ga0209129_1005724 Ga0209129_10057245 117
407 3300025258 Ga0209129_1005870 Ga0209129_10058703 117
408 3300025258 Ga0209129_1018438 Ga0209129_10184383 117
409 3300025261 Ga0209233_1000031 Ga0209233_100003198 117
410 3300025263 Ga0209565_1021431 Ga0209565_10214312 117
411 3300025273 Ga0209673_1000063 Ga0209673_1000063211 117
412 3300025273 Ga0209673_1000252 Ga0209673_100025262 117
413 3300025273 Ga0209673_1003927 Ga0209673_10039275 117
414 3300025273 Ga0209673_1005480 Ga0209673_10054803 117
415 3300025273 Ga0209673_1006322 Ga0209673_10063224 117
416 3300025273 Ga0209673_1010561 Ga0209673_10105613 117
417 3300025273 Ga0209673_1017618 Ga0209673_10176183 117
418 3300025273 Ga0209673_1031851 Ga0209673_10318513 117
419 3300025284 Ga0209130_1000031 Ga0209130_100003144 117
420 3300025284 Ga0209130_1001091 Ga0209130_100109111 117
421 3300025284 Ga0209130_1025614 Ga0209130_10256142 117
422 3300025284 Ga0209130_1027836 Ga0209130_10278362 117
423 3300025291 Ga0209675_1054312 Ga0209675_10543122 117
424 3300025292 Ga0209676_1002049 Ga0209676_10020497 117
425 3300025292 Ga0209676_1005325 Ga0209676_10053252 117
426 3300025292 Ga0209676_1039289 Ga0209676_10392891 117
427 3300025294 Ga0209025_1000022 Ga0209025_100002275 117
428 3300025294 Ga0209025_1000397 Ga0209025_100039745 117
429 3300025294 Ga0209025_1002306 Ga0209025_100230611 117
430 3300025294 Ga0209025_1016728 Ga0209025_10167283 117
431 3300025294 Ga0209025_1020329 Ga0209025_10203292 117
432 3300025294 Ga0209025_1044394 Ga0209025_10443942 117
433 3300025295 Ga0209564_1000482 Ga0209564_10004827 117
434 3300025295 Ga0209564_1000511 Ga0209564_100051136 117
435 3300025295 Ga0209564_1000586 Ga0209564_10005868 117
436 3300025295 Ga0209564_1002586 Ga0209564_100258612 117
437 3300025295 Ga0209564_1010499 Ga0209564_10104994 117
438 3300025295 Ga0209564_1019663 Ga0209564_10196633 117
439 3300025297 Ga0209758_1000086 Ga0209758_1000086184 117
440 3300025297 Ga0209758_1000585 Ga0209758_100058540 117
441 3300025297 Ga0209758_1000688 Ga0209758_100068838 117
442 3300025297 Ga0209758_1001274 Ga0209758_100127413 117
443 3300025297 Ga0209758_1014554 Ga0209758_10145543 117
444 3300025297 Ga0209758_1014603 Ga0209758_10146033 117
445 3300025297 Ga0209758_1019485 Ga0209758_10194852 117
446 3300025297 Ga0209758_1022160 Ga0209758_10221602 117
447 3300025297 Ga0209758_1029954 Ga0209758_10299543 117
448 3300025297 Ga0209758_1051251 Ga0209758_10512512 117
449 3300025297 Ga0209758_1052275 Ga0209758_10522752 117
450 3300025297 Ga0209758_1060846 Ga0209758_10608463 117
451 3300025298 Ga0209050_1005653 Ga0209050_10056536 117
452 3300025298 Ga0209050_1020198 Ga0209050_10201982 117
453 3300025299 Ga0209256_1000786 Ga0209256_10007865 117
454 3300025299 Ga0209256_1002344 Ga0209256_100234418 117
455 3300025299 Ga0209256_1005287 Ga0209256_10052873 117
456 3300025299 Ga0209256_1005765 Ga0209256_10057654 117
457 3300025299 Ga0209256_1036117 Ga0209256_10361172 117
458 3300025299 Ga0209256_1041953 Ga0209256_10419532 117
459 3300025299 Ga0209256_1062509 Ga0209256_10625092 117
460 3300025299 Ga0209256_1087814 Ga0209256_10878142 117
461 3300025299 Ga0209256_1104670 Ga0209256_11046702 117
462 3300025299 Ga0209256_1112501 Ga0209256_11125012 117
463 3300025302 Ga0207426_1000042 Ga0207426_1000042366 117
464 3300025302 Ga0207426_1000200 Ga0207426_100020019 117
465 3300025302 Ga0207426_1000355 Ga0207426_100035536 117
466 3300025302 Ga0207426_1002795 Ga0207426_10027957 117
467 3300025302 Ga0207426_1053245 Ga0207426_10532453 117
468 3300025303 Ga0209051_1000038 Ga0209051_100003810 117
469 3300025303 Ga0209051_1002500 Ga0209051_10025006 117
470 3300025303 Ga0209051_1007982 Ga0209051_10079826 117
471 3300025303 Ga0209051_1104225 Ga0209051_11042251 117
472 3300025304 Ga0209257_1017762 Ga0209257_10177622 117
473 3300025304 Ga0209257_1099623 Ga0209257_10996232 117
474 3300025925 Ga0207650_10001958 Ga0207650_1000195812 117
475 3300025972 Ga0207668_10601671 Ga0207668_106016712 117
476 3300027866 Ga0209813_10288423 Ga0209813_102884231 117
477 3300028794 Ga0307515_10000375 Ga0307515_1000037530 117
478 3300028794 Ga0307515_10017859 Ga0307515_1001785910 117
479 3300031456 Ga0307513_10000335 Ga0307513_1000033559 117
480 3300031548 Ga0307408_100447129 Ga0307408_1004471292 117
481 3300031548 Ga0307408_101127243 Ga0307408_1011272432 117
482 3300031731 Ga0307405_10003524 Ga0307405_100035247 117
483 3300031901 Ga0307406_10018684 Ga0307406_100186842 117
484 3300031911 Ga0307412_10235347 Ga0307412_102353472 117
485 3300041404 Ga0439436_0051800 Ga0439436_0051800_64_417 117
486 3300041405 Ga0439438_062811 Ga0439438_062811_396_749 117
487 3300041407 Ga0439447_023188 Ga0439447_023188_450_803 117
488 3300041411 Ga0439466_0046196 Ga0439466_0046196_114_467 117
489 3300041413 Ga0439465_0001359 Ga0439465_0001359_2775_3128 117
490 3300041413 Ga0439465_0012292 Ga0439465_0012292_1605_1958 117
491 3300041413 Ga0439465_0018277 Ga0439465_0018277_1750_2103 117
492 3300041441 Ga0451787_496533 Ga0451787_496533_16_399 117
493 3300041443 Ga0451789_1098931 Ga0451789_1098931_808_1161 117
494 3300041452 Ga0451793_0819188 Ga0451793_0819188_21_374 117
495 3300041458 Ga0451798_0885988 Ga0451798_0885988_271_654 117
496 3300041460 Ga0451802_1466569 Ga0451802_1466569_131_514 117
497 3300041491 Ga0451833_0146614 Ga0451833_0146614_629_1012 117
498 3300041491 Ga0451833_0611857 Ga0451833_0611857_212_565 117
499 3300041494 Ga0451837_0143144 Ga0451837_0143144_241_624 117
500 3300041494 Ga0451837_1297148 Ga0451837_1297148_212_565 117
501 3300041496 Ga0451839_0678247 Ga0451839_0678247_187_540 117
502 3300041496 Ga0451839_1595413 Ga0451839_1595413_197_550 117
503 3300041498 Ga0451841_0305811 Ga0451841_0305811_1583_1936 117
504 3300041503 Ga0451847_0140318 Ga0451847_0140318_723_1076 117
505 3300041503 Ga0451847_0707496 Ga0451847_0707496_389_742 117
506 3300041505 Ga0451849_0597870 Ga0451849_0597870_16_369 117
507 3300041507 Ga0451851_0868248 Ga0451851_0868248_212_565 117
508 3300041509 Ga0451843_0515827 Ga0451843_0515827_113_466 117
509 3300041509 Ga0451843_0541337 Ga0451843_0541337_2512_2865 117
510 3300041511 Ga0451855_0815332 Ga0451855_0815332_271_624 117
511 3300041512 Ga0451853_0630923 Ga0451853_0630923_864_1247 117
512 3300041512 Ga0451853_3746137 Ga0451853_3746137_265_618 117
513 3300042007 Ga0439449_0029950 Ga0439449_0029950_1546_1899 117
514 3300042121 Ga0450919_017637 Ga0450919_017637_50_403 117
515 3300042122 Ga0450920_010004 Ga0450920_010004_114_467 117
516 3300042145 Ga0450906_002063 Ga0450906_002063_2255_2608 117
517 3300042531 Ga0450918_034223 Ga0450918_034223_533_886 117
518 3300046453 Ga0495627_115648 Ga0495627_115648_122_475 117
519 3300046454 Ga0495592_0135462 Ga0495592_0135462_703_1062 117
520 3300046459 Ga0495629_0155593 Ga0495629_0155593_303_662 117
521 3300046460 Ga0495638_0000084 Ga0495638_0000084_103224_103577 117
522 3300046460 Ga0495638_0105980 Ga0495638_0105980_56_409 117
523 3300046463 Ga0495653_0829829 Ga0495653_0829829_115_474 117
524 3300046471 Ga0495650_0017101 Ga0495650_0017101_2873_3226 117
525 3300046471 Ga0495650_0022686 Ga0495650_0022686_2175_2528 117
526 3300046471 Ga0495650_0072982 Ga0495650_0072982_420_773 117
527 3300046474 Ga0495605_0014548 Ga0495605_0014548_1736_2128 117
528 3300046474 Ga0495605_0018386 Ga0495605_0018386_2771_3124 117
529 3300046475 Ga0495639_0142964 Ga0495639_0142964_437_796 117
530 3300046476 Ga0495662_0001314 Ga0495662_0001314_2665_3042 117
531 3300046477 Ga0495664_0109113 Ga0495664_0109113_325_702 117
532 3300046491 Ga0495584_0231810 Ga0495584_0231810_364_717 117
533 3300046492 Ga0495585_0006217 Ga0495585_0006217_1060_1443 117
534 3300046492 Ga0495585_0072173 Ga0495585_0072173_1064_1456 117
535 3300046501 Ga0495607_0089125 Ga0495607_0089125_936_1289 117
536 3300046501 Ga0495607_0226581 Ga0495607_0226581_94_486 117
537 3300046501 Ga0495607_0344494 Ga0495607_0344494_20_373 117
538 3300046506 Ga0495583_0004969 Ga0495583_0004969_4067_4420 117
539 3300046506 Ga0495583_0011616 Ga0495583_0011616_3136_3528 117
540 3300046507 Ga0495606_0000848 Ga0495606_0000848_33641_33994 117
541 3300046507 Ga0495606_0004464 Ga0495606_0004464_1129_1482 117
542 3300046507 Ga0495606_0086935 Ga0495606_0086935_122_475 117
543 3300046507 Ga0495606_0138583 Ga0495606_0138583_524_877 117
544 3300046512 Ga0495610_0000694 Ga0495610_0000694_28384_28737 117
545 3300046512 Ga0495610_0180434 Ga0495610_0180434_348_701 117
546 3300046512 Ga0495610_0241339 Ga0495610_0241339_210_593 117
547 3300046513 Ga0495616_0066349 Ga0495616_0066349_175_558 117
548 3300046515 Ga0495620_0011307 Ga0495620_0011307_2942_3295 117
549 3300046515 Ga0495620_0014856 Ga0495620_0014856_2455_2808 117
550 3300046515 Ga0495620_0036518 Ga0495620_0036518_555_908 117
551 3300046516 Ga0495628_1009529 Ga0495628_1009529_183_560 117
552 3300046518 Ga0495631_0008921 Ga0495631_0008921_1160_1552 117
553 3300046518 Ga0495631_0041639 Ga0495631_0041639_250_603 117
554 3300046518 Ga0495631_0076886 Ga0495631_0076886_1043_1396 117
555 3300046519 Ga0495632_0004193 Ga0495632_0004193_4744_5097 117
556 3300046519 Ga0495632_0022250 Ga0495632_0022250_2151_2504 117
557 3300046519 Ga0495632_0166049 Ga0495632_0166049_275_628 117
558 3300046522 Ga0495643_0003806 Ga0495643_0003806_1330_1683 117
559 3300046522 Ga0495643_0007745 Ga0495643_0007745_2191_2544 117
560 3300046522 Ga0495643_0032932 Ga0495643_0032932_2151_2504 117
561 3300046522 Ga0495643_0089349 Ga0495643_0089349_874_1227 117
562 3300046524 Ga0495648_0013425 Ga0495648_0013425_1689_2072 117
563 3300046524 Ga0495648_0071036 Ga0495648_0071036_1499_1858 117
564 3300046529 Ga0495652_0078663 Ga0495652_0078663_681_1040 117
565 3300046530 Ga0495654_0000114 Ga0495654_0000114_48528_48881 117
566 3300046533 Ga0495640_0235010 Ga0495640_0235010_546_905 117
567 3300046536 Ga0495587_0170504 Ga0495587_0170504_337_714 117
568 3300046538 Ga0495609_0027131 Ga0495609_0027131_86_478 117
569 3300046542 Ga0495597_0044037 Ga0495597_0044037_221_574 117
570 3300046558 Ga0495633_0004140 Ga0495633_0004140_5503_5886 117
571 3300046615 Ga0495656_0028607 Ga0495656_0028607_300_653 117
572 3300046615 Ga0495656_0052905 Ga0495656_0052905_368_721 117
573 3300046616 Ga0495668_0003832 Ga0495668_0003832_9215_9607 117
574 3300046616 Ga0495668_0056851 Ga0495668_0056851_875_1228 117
575 3300046616 Ga0495668_0185231 Ga0495668_0185231_163_546 117
576 3300046660 Ga0495625_0015205 Ga0495625_0015205_2077_2469 117
577 3300046660 Ga0495625_0059273 Ga0495625_0059273_1431_1784 117
578 3300046660 Ga0495625_0176621 Ga0495625_0176621_927_1280 117
579 3300046660 Ga0495625_0340039 Ga0495625_0340039_46_399 117
580 3300046660 Ga0495625_0653791 Ga0495625_0653791_225_578 117
581 3300046674 Ga0495588_0281046 Ga0495588_0281046_35_412 117
582 3300046674 Ga0495588_0511565 Ga0495588_0511565_254_607 117
583 3300046675 Ga0495657_0194627 Ga0495657_0194627_225_602 117
584 3300046683 Ga0495658_0015634 Ga0495658_0015634_2279_2656 117
585 3300046691 Ga0495670_0108305 Ga0495670_0108305_366_758 117
586 3300046692 Ga0495671_0054422 Ga0495671_0054422_1159_1512 117
587 3300046692 Ga0495671_0256497 Ga0495671_0256497_218_571 117
588 3300046692 Ga0495671_0314018 Ga0495671_0314018_49_432 117
589 3300046694 Ga0495649_0033601 Ga0495649_0033601_420_773 117
590 3300046694 Ga0495649_0043522 Ga0495649_0043522_1168_1521 117
591 3300046794 Ga0495589_0039636 Ga0495589_0039636_757_1110 117
592 3300046809 Ga0495600_0076570 Ga0495600_0076570_1289_1666 117
593 3300046810 Ga0495660_0087704 Ga0495660_0087704_999_1352 117
594 3300046810 Ga0495660_0161377 Ga0495660_0161377_358_750 117
595 3300047317 Ga0495604_0194220 Ga0495604_0194220_216_593 117
596 3300047318 Ga0495636_0047695 Ga0495636_0047695_477_830 117
597 3300047318 Ga0495636_0057672 Ga0495636_0057672_1017_1370 117
598 3300047319 Ga0495674_0285533 Ga0495674_0285533_738_1115 117
599 3300047320 Ga0495672_0023628 Ga0495672_0023628_2321_2674 117
600 3300047321 Ga0495676_0505585 Ga0495676_0505585_287_646 117
601 3300047323 Ga0495683_0128552 Ga0495683_0128552_549_902 117
602 3300047447 Ga0495685_024438 Ga0495685_024438_1282_1635 117
603 3300047469 Ga0495673_0068514 Ga0495673_0068514_930_1283 117
604 3300047469 Ga0495673_0109708 Ga0495673_0109708_102_455 117
605 3300047470 Ga0495681_0053765 Ga0495681_0053765_854_1207 117
606 3300047470 Ga0495681_0058730 Ga0495681_0058730_329_712 117
607 3300047470 Ga0495681_0337402 Ga0495681_0337402_60_413 117
608 3300047472 Ga0495686_0000296 Ga0495686_0000296_36219_36572 117
609 3300047472 Ga0495686_0011203 Ga0495686_0011203_5122_5475 117
610 3300047472 Ga0495686_0022801 Ga0495686_0022801_2727_3080 117
611 3300047472 Ga0495686_0240160 Ga0495686_0240160_78_431 117
612 3300047472 Ga0495686_0377466 Ga0495686_0377466_211_564 117
613 3300048091 Ga0495626_0071269 Ga0495626_0071269_613_966 117
614 3300048091 Ga0495626_0273955 Ga0495626_0273955_21_374 117
615 3300048903 Ga0496100_0518902 Ga0496100_0518902_165_518 117
616 3300048903 Ga0496100_0829165 Ga0496100_0829165_77_430 117
617 3300048905 Ga0496102_0083303 Ga0496102_0083303_2421_2774 117
618 3300048907 Ga0496104_0585150 Ga0496104_0585150_103_456 117
619 3300048908 Ga0496105_0208532 Ga0496105_0208532_445_798 117
620 3300048909 Ga0496106_0001056 Ga0496106_0001056_16944_17297 117
621 3300048909 Ga0496106_0265173 Ga0496106_0265173_498_851 117
622 3300048909 Ga0496106_1565609 Ga0496106_1565609_69_422 117
623 3300048910 Ga0496107_0219298 Ga0496107_0219298_496_849 117
624 3300048913 Ga0496110_0154656 Ga0496110_0154656_783_1136 117
625 3300048913 Ga0496110_0885243 Ga0496110_0885243_388_741 117
626 3300048919 Ga0496116_0003396 Ga0496116_0003396_13241_13594 117
627 3300048919 Ga0496116_0013786 Ga0496116_0013786_4200_4553 117
628 3300048919 Ga0496116_0020125 Ga0496116_0020125_1874_2227 117
629 3300048919 Ga0496116_0030645 Ga0496116_0030645_825_1178 117
630 3300048920 Ga0496117_0012124 Ga0496117_0012124_3779_4132 117
631 3300048920 Ga0496117_0013898 Ga0496117_0013898_2974_3327 117
632 3300048920 Ga0496117_0019559 Ga0496117_0019559_3812_4195 117
633 3300048920 Ga0496117_0092120 Ga0496117_0092120_1553_1906 117
634 3300048921 Ga0496118_0006564 Ga0496118_0006564_10977_11330 117
635 3300048921 Ga0496118_0021379 Ga0496118_0021379_4417_4770 117
636 3300048921 Ga0496118_0022580 Ga0496118_0022580_1502_1855 117
637 3300048921 Ga0496118_0064044 Ga0496118_0064044_588_941 117
638 3300048921 Ga0496118_0152397 Ga0496118_0152397_1045_1398 117
639 3300048922 Ga0496119_0014776 Ga0496119_0014776_3193_3546 117
640 3300048922 Ga0496119_0018901 Ga0496119_0018901_1021_1374 117
641 3300048922 Ga0496119_0042973 Ga0496119_0042973_140_493 117
642 3300048922 Ga0496119_0477244 Ga0496119_0477244_162_539 117
643 3300048923 Ga0496120_0022015 Ga0496120_0022015_1643_1996 117
644 3300048923 Ga0496120_0037056 Ga0496120_0037056_1574_1927 117
645 3300048923 Ga0496120_0135362 Ga0496120_0135362_500_853 117
646 3300048924 Ga0496121_0004588 Ga0496121_0004588_10153_10506 117
647 3300048924 Ga0496121_0022112 Ga0496121_0022112_5086_5439 117
648 3300048924 Ga0496121_0031641 Ga0496121_0031641_2816_3169 117
649 3300048924 Ga0496121_0051672 Ga0496121_0051672_953_1306 117
650 3300048924 Ga0496121_0072426 Ga0496121_0072426_213_566 117
651 3300048924 Ga0496121_0158055 Ga0496121_0158055_416_769 117
652 3300048924 Ga0496121_0176053 Ga0496121_0176053_1008_1361 117
653 3300048924 Ga0496121_0300282 Ga0496121_0300282_536_889 117
654 3300048924 Ga0496121_0310114 Ga0496121_0310114_73_426 117
655 3300048925 Ga0496122_0006070 Ga0496122_0006070_4206_4559 117
656 3300048925 Ga0496122_0022093 Ga0496122_0022093_1194_1547 117
657 3300048925 Ga0496122_0047377 Ga0496122_0047377_2506_2859 117
658 3300048925 Ga0496122_0051586 Ga0496122_0051586_2063_2416 117
659 3300048925 Ga0496122_0085855 Ga0496122_0085855_235_588 117
660 3300048925 Ga0496122_0324758 Ga0496122_0324758_22_375 117
661 3300048926 Ga0496123_0004386 Ga0496123_0004386_10315_10668 117
662 3300048926 Ga0496123_0015998 Ga0496123_0015998_1423_1776 117
663 3300048926 Ga0496123_0023238 Ga0496123_0023238_3169_3522 117
664 3300048926 Ga0496123_0048989 Ga0496123_0048989_1049_1402 117
665 3300048927 Ga0496124_0004324 Ga0496124_0004324_4168_4521 117
666 3300048927 Ga0496124_0010829 Ga0496124_0010829_121_474 117
667 3300048927 Ga0496124_0013839 Ga0496124_0013839_3286_3639 117
668 3300048927 Ga0496124_0048309 Ga0496124_0048309_856_1209 117
669 3300048927 Ga0496124_0049581 Ga0496124_0049581_1453_1806 117
670 3300048927 Ga0496124_0066739 Ga0496124_0066739_870_1223 117
671 3300048927 Ga0496124_0145019 Ga0496124_0145019_88_441 117
672 3300048927 Ga0496124_0171846 Ga0496124_0171846_189_542 117
673 3300048928 Ga0496125_0004658 Ga0496125_0004658_10519_10872 117
674 3300048928 Ga0496125_0032561 Ga0496125_0032561_321_674 117
675 3300048928 Ga0496125_0056456 Ga0496125_0056456_2018_2371 117
676 3300048928 Ga0496125_0335939 Ga0496125_0335939_438_791 117
677 3300048929 Ga0496126_0042292 Ga0496126_0042292_2202_2555 117
678 3300049459 Ga0495678_026013 Ga0495678_026013_2116_2469 117
679 3300049459 Ga0495678_106515 Ga0495678_106515_30_383 117
680 3300049460 Ga0495682_0025279 Ga0495682_0025279_874_1266 117
681 3300049569 Ga0501032_0050994 Ga0501032_0050994_2402_2755 117
682 3300049572 Ga0501036_1064638 Ga0501036_1064638_52_405 117
683 3300049580 Ga0501046_0047291 Ga0501046_0047291_2591_2944 117
684 3300049581 Ga0501047_0142028 Ga0501047_0142028_998_1351 117
685 3300049584 Ga0501068_0052620 Ga0501068_0052620_1031_1384 117
686 3300049742 Ga0501080_1882106 Ga0501080_1882106_76_429 117
687 3300050490 nmdc:mga03n38_344896_c1 nmdc:mga03n38_344896_c1_321_674 117
688 3300050490 nmdc:mga03n38_661507_c1 nmdc:mga03n38_661507_c1_187_540 117
689 3300050492 nmdc:mga0yw44_1019742_c1 nmdc:mga0yw44_1019742_c1_57_410 117
690 3300050492 nmdc:mga0yw44_1123799_c1 nmdc:mga0yw44_1123799_c1_32_415 117
691 3300050492 nmdc:mga0yw44_18982_c1 nmdc:mga0yw44_18982_c1_3052_3405 117
692 3300050492 nmdc:mga0yw44_23732_c1 nmdc:mga0yw44_23732_c1_524_877 117
693 3300050493 nmdc:mga0k408_58320_c1 nmdc:mga0k408_58320_c1_1407_1760 117
694 3300050494 nmdc:mga06z11_62685_c1 nmdc:mga06z11_62685_c1_269_622 117
695 3300050495 nmdc:mga04h51_30035_c1 nmdc:mga04h51_30035_c1_1319_1672 117
696 3300050496 nmdc:mga07m45_196919_c1 nmdc:mga07m45_196919_c1_138_491 117
697 3300050496 nmdc:mga07m45_292243_c1 nmdc:mga07m45_292243_c1_523_906 117
698 3300050496 nmdc:mga07m45_352003_c1 nmdc:mga07m45_352003_c1_143_496 117
699 3300050516 nmdc:mga0sz30_174151_c1 nmdc:mga0sz30_174151_c1_31_384 117
700 3300050516 nmdc:mga0sz30_51978_c1 nmdc:mga0sz30_51978_c1_550_903 117
701 3300050516 nmdc:mga0sz30_7667_c1 nmdc:mga0sz30_7667_c1_998_1351 117
702 3300053077 Ga0495601_0512867 Ga0495601_0512867_294_671 117
703 3300053079 Ga0500610_0007217 Ga0500610_0007217_2625_2978 117
704 3300053085 Ga0495619_0174917 Ga0495619_0174917_309_686 117
705 3300053086 Ga0500578_0146576 Ga0500578_0146576_772_1125 117
706 3300053086 Ga0500578_0363556 Ga0500578_0363556_298_690 117
707 3300053090 Ga0500646_0332573 Ga0500646_0332573_36_389 117
708 3300053093 Ga0500651_0418622 Ga0500651_0418622_24_377 117
709 3300053094 Ga0500566_0457030 Ga0500566_0457030_194_547 117
710 3300053109 Ga0500569_336813 Ga0500569_336813_58_441 117
711 3300053111 Ga0500572_057416 Ga0500572_057416_267_620 117
712 3300053111 Ga0500572_163371 Ga0500572_163371_186_539 117
713 3300053118 Ga0500594_0003798 Ga0500594_0003798_1931_2323 117
714 3300053118 Ga0500594_0035474 Ga0500594_0035474_132_515 117
715 3300053122 Ga0500608_071714 Ga0500608_071714_1116_1472 117
716 3300053123 Ga0500614_061029 Ga0500614_061029_248_625 117
717 3300053125 Ga0500618_000031 Ga0500618_000031_52674_53027 117
718 3300053125 Ga0500618_000296 Ga0500618_000296_19358_19711 117
719 3300053125 Ga0500618_013202 Ga0500618_013202_1738_2091 117
720 3300053126 Ga0500621_205605 Ga0500621_205605_139_492 117
721 3300053134 Ga0500658_0000877 Ga0500658_0000877_10816_11169 117
722 3300053134 Ga0500658_0007391 Ga0500658_0007391_2368_2721 117
723 3300053134 Ga0500658_0035803 Ga0500658_0035803_1577_1930 117
724 3300053139 Ga0500568_0000200 Ga0500568_0000200_47601_47954 117
725 3300053139 Ga0500568_0002409 Ga0500568_0002409_2235_2588 117
726 3300053139 Ga0500568_0384752 Ga0500568_0384752_144_497 117
727 3300053142 Ga0500577_0188286 Ga0500577_0188286_258_650 117
728 3300053148 Ga0500590_000137 Ga0500590_000137_14005_14364 117
729 3300053151 Ga0500604_0032854 Ga0500604_0032854_918_1271 117
730 3300053153 Ga0500616_0000102 Ga0500616_0000102_110159_110512 117
731 3300053153 Ga0500616_0000795 Ga0500616_0000795_35135_35488 117
732 3300053153 Ga0500616_0004137 Ga0500616_0004137_727_1080 117
733 3300053155 Ga0500620_226901 Ga0500620_226901_24_377 117
734 3300053156 Ga0500622_0000559 Ga0500622_0000559_9093_9446 117
735 3300053158 Ga0500627_0178875 Ga0500627_0178875_451_804 117
736 3300053160 Ga0500633_0017299 Ga0500633_0017299_1597_1950 117
737 3300053160 Ga0500633_0106695 Ga0500633_0106695_243_596 117
738 3300053160 Ga0500633_0163626 Ga0500633_0163626_248_601 117
739 3300053177 Ga0500636_0000011 Ga0500636_0000011_49496_49849 117
740 3300060353 Ga0501082_0047207 Ga0501082_0047207_2503_2856 117
741 iso_pu_bacteria 2510065019 2510137521 117
742 iso_pu_bacteria 2510461076 2510893417 117
743 iso_pu_bacteria 2513237084 2513573925 117
744 iso_pu_bacteria 2513237085 2513575921 117
745 iso_pu_bacteria 2513237093 2513633646 117
746 iso_pu_bacteria 2513237162 2514019132 117
747 iso_pu_bacteria 2515075009 2515109592 117
748 iso_pu_bacteria 2515154113 2515634357 117
749 iso_pu_bacteria 2515154114 2515641764 117
750 iso_pu_bacteria 2515154116 2515658968 117
751 iso_pu_bacteria 2515154134 2515742667 117
752 iso_pu_bacteria 2517287029 2517411150 117
753 iso_pu_bacteria 2585427526 2585526465 117
754 iso_pu_bacteria 2585427593 2585836671 117
755 iso_pu_bacteria 2599185156 2599334509 117
756 iso_pu_bacteria 2724679232 2725950907 117
757 iso_pu_bacteria 2791355266 2793359959 117
758 iso_pu_bacteria 2791355267 2793367352 117
759 iso_pu_bacteria 2802429634 2806050891 117
760 iso_pu_bacteria 2802429635 2806057941 117
761 iso_pu_bacteria 2802429636 2806065346 117
762 iso_pu_bacteria 2802429637 2806076829 117
763 iso_pu_bacteria 2842922631 2842925281 117
764 iso_pu_bacteria 2933586486 2933590814 117
765 iso_pu_bacteria 2935894831 2935900201 117
766 iso_pu_bacteria 2935901341 2935907900 117
767 iso_pu_bacteria 2936367885 2936373695 117
768 iso_pu_bacteria 2936375103 2936377219 117
769 iso_pu_bacteria 8005460587 8005466140 117
770 iso_pu_bacteria 8005556819 8005563066 117
771 iso_pu_bacteria 8005563573 8005564914 117
772 iso_pu_bacteria 8005695170 8005695403 117
773 iso_pu_bacteria 8018163183 8018169962 117
774 iso_pu_bacteria 8023680758 8023685968 117
775 iso_pu_bacteria 8024479707 8024486408 117
776 iso_pu_bacteria 8057874678 8057876240 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

11

107

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yu2-assembly1.cif.gz_A crystal structure of hjhdm1a without a-ketoglutarate 0.9324 41 105
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9228 15 105
3cjx-assembly11.cif.gz_B crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution 0.9226 25 109
7uv9-assembly1.cif.gz_K kdm2a-nucleosome structure stabilized by h3k36c-unc8015 covalent conjugate 0.9198 41 105
2yu1-assembly1.cif.gz_A crystal structure of hjhdm1a complexed with a-ketoglutarate 0.917 41 105
ID Description Score Start End Superfamily
af_O94603_133_414_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9235 41 105 2.60.120.650
4qx8A01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9201 41 105 2.60.120.650
af_A0A0P0XHH9_265_498_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9197 40 105 2.60.120.650
af_Q95Q98_1_277_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9151 41 105 2.60.120.650
af_A0A0R0KME4_229_450_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9059 41 105 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A0M3GCC3-F1-model_v4 deleted 0.9961 12 113
AF-A0A521QXR3-F1-model_v4 ChrR-like cupin domain-containing protein 0.9885 39 113
AF-A0A531M5Y2-F1-model_v4 Allophanate hydrolase 0.9845 45 115 GO:0016787
AF-A0A246SYR6-F1-model_v4 Allophanate hydrolase 0.9824 1 113 GO:0016787
AF-A0A2E9AKC5-F1-model_v4 Transcription negative regulator ChrR 0.9792 19 112

Feature Viewer

pLDDT pTM Quality
94.12 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map