F480316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 280 | 776 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10168344|Ga0207664_101683444 |
| Length | 152 |
| Sequence | MTTAATSHSPSRPRRERPKPIRLTDAAAARVREIIGDAEGRYLGVRVGVTNGGCAGMSYTMDYADEAKPLDEVVEDKGVRIFIDPKAILFLIGTEMDFVREKLGARFVFNNPNQTAACGCGESVSITPATATISRRPPSRTRLARLSSRSPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 202 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 267 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 268 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 271 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 273 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 276 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 278 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.48 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 92.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000036 | 3300003214 | Bacteria | 286380 |
| 2 | JGI25153J46596_10000852 | 3300003215 | Bacteria | 18699 |
| 3 | rootH2_10011227 | 3300003320 | Bacteria | 7672 |
| 4 | Ga0070658_10032522 | 3300005327 | Bacteria | 4193 |
| 5 | Ga0070658_10102858 | 3300005327 | Bacteria | 2362 |
| 6 | Ga0070658_10117330 | 3300005327 | Bacteria | 2210 |
| 7 | Ga0070658_11041750 | 3300005327 | Bacteria | 712 |
| 8 | Ga0070658_11513954 | 3300005327 | Bacteria | 582 |
| 9 | Ga0070676_10172592 | 3300005328 | Bacteria | 1400 |
| 10 | Ga0070683_101794710 | 3300005329 | Bacteria | 590 |
| 11 | Ga0070690_100023601 | 3300005330 | Bacteria | 3774 |
| 12 | Ga0070670_100202734 | 3300005331 | Bacteria | 1724 |
| 13 | Ga0070670_100352546 | 3300005331 | Bacteria | 1293 |
| 14 | Ga0068869_100547244 | 3300005334 | Bacteria | 972 |
| 15 | Ga0070666_10001920 | 3300005335 | Bacteria | 12642 |
| 16 | Ga0070666_10015384 | 3300005335 | Bacteria | 4879 |
| 17 | Ga0070666_10429985 | 3300005335 | Bacteria | 952 |
| 18 | Ga0070680_100000110 | 3300005336 | Bacteria | 47139 |
| 19 | Ga0070680_100018543 | 3300005336 | Bacteria | 5500 |
| 20 | Ga0070680_100072469 | 3300005336 | Bacteria | 2831 |
| 21 | Ga0070682_100250601 | 3300005337 | Bacteria | 1276 |
| 22 | Ga0070682_101253696 | 3300005337 | Bacteria | 628 |
| 23 | Ga0068868_100209435 | 3300005338 | Bacteria | 1629 |
| 24 | Ga0068868_100353727 | 3300005338 | Bacteria | 1259 |
| 25 | Ga0068868_100801850 | 3300005338 | Bacteria | 850 |
| 26 | Ga0070660_100246913 | 3300005339 | Bacteria | 1455 |
| 27 | Ga0070660_100260202 | 3300005339 | Bacteria | 1417 |
| 28 | Ga0070660_100776722 | 3300005339 | Bacteria | 805 |
| 29 | Ga0070660_101397091 | 3300005339 | Bacteria | 595 |
| 30 | Ga0070691_10001038 | 3300005341 | Bacteria | 11428 |
| 31 | Ga0070691_10037486 | 3300005341 | Bacteria | 2287 |
| 32 | Ga0070661_100000148 | 3300005344 | Bacteria | 57465 |
| 33 | Ga0070661_100277232 | 3300005344 | Bacteria | 1300 |
| 34 | Ga0070661_100743143 | 3300005344 | Bacteria | 802 |
| 35 | Ga0070661_100975057 | 3300005344 | Bacteria | 702 |
| 36 | Ga0070668_100212340 | 3300005347 | Bacteria | 1592 |
| 37 | Ga0070668_101145674 | 3300005347 | Bacteria | 703 |
| 38 | Ga0070675_100047404 | 3300005354 | Bacteria | 3521 |
| 39 | Ga0070673_100184616 | 3300005364 | Bacteria | 1787 |
| 40 | Ga0070673_100430740 | 3300005364 | Bacteria | 1184 |
| 41 | Ga0070673_101073552 | 3300005364 | Bacteria | 751 |
| 42 | Ga0070688_100475366 | 3300005365 | Bacteria | 938 |
| 43 | Ga0070688_100845421 | 3300005365 | Bacteria | 718 |
| 44 | Ga0070659_100027939 | 3300005366 | Bacteria | 4351 |
| 45 | Ga0070667_100009798 | 3300005367 | Bacteria | 7944 |
| 46 | Ga0070667_100993977 | 3300005367 | Bacteria | 783 |
| 47 | Ga0070709_10001050 | 3300005434 | Bacteria | 15238 |
| 48 | Ga0070709_10035060 | 3300005434 | Bacteria | 3047 |
| 49 | Ga0070709_10979865 | 3300005434 | Bacteria | 672 |
| 50 | Ga0070714_100047577 | 3300005435 | Bacteria | 3645 |
| 51 | Ga0070714_100115342 | 3300005435 | Bacteria | 2384 |
| 52 | Ga0070714_101451768 | 3300005435 | Bacteria | 670 |
| 53 | Ga0070713_100000004 | 3300005436 | Bacteria | 220768 |
| 54 | Ga0070713_100168380 | 3300005436 | Bacteria | 1961 |
| 55 | Ga0070713_100269457 | 3300005436 | Bacteria | 1559 |
| 56 | Ga0070711_100004994 | 3300005439 | Bacteria | 7880 |
| 57 | Ga0070694_100508823 | 3300005444 | Bacteria | 959 |
| 58 | Ga0070663_100235686 | 3300005455 | Bacteria | 1443 |
| 59 | Ga0070663_100772314 | 3300005455 | Bacteria | 822 |
| 60 | Ga0070663_101435082 | 3300005455 | Bacteria | 612 |
| 61 | Ga0070663_101998640 | 3300005455 | Bacteria | 522 |
| 62 | Ga0070678_100003363 | 3300005456 | Bacteria | 8916 |
| 63 | Ga0070678_100222930 | 3300005456 | Bacteria | 1568 |
| 64 | Ga0070662_101117780 | 3300005457 | Bacteria | 676 |
| 65 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 66 | Ga0070681_10145807 | 3300005458 | Bacteria | 2296 |
| 67 | Ga0070681_10197855 | 3300005458 | Bacteria | 1928 |
| 68 | Ga0070681_11176577 | 3300005458 | Bacteria | 688 |
| 69 | Ga0068867_100008753 | 3300005459 | Bacteria | 7146 |
| 70 | Ga0068867_100940892 | 3300005459 | Bacteria | 780 |
| 71 | Ga0070679_100000032 | 3300005530 | Bacteria | 105384 |
| 72 | Ga0070679_100018143 | 3300005530 | Bacteria | 6823 |
| 73 | Ga0070679_100032379 | 3300005530 | Bacteria | 5170 |
| 74 | Ga0070679_100058169 | 3300005530 | Bacteria | 3852 |
| 75 | Ga0070679_100179253 | 3300005530 | Bacteria | 2091 |
| 76 | Ga0070679_100273622 | 3300005530 | Bacteria | 1642 |
| 77 | Ga0070679_100323328 | 3300005530 | Bacteria | 1492 |
| 78 | Ga0070684_100414432 | 3300005535 | Bacteria | 1243 |
| 79 | Ga0070684_100501884 | 3300005535 | Bacteria | 1124 |
| 80 | Ga0068853_100037181 | 3300005539 | Bacteria | 4142 |
| 81 | Ga0068853_100204305 | 3300005539 | Bacteria | 1798 |
| 82 | Ga0068853_100466567 | 3300005539 | Bacteria | 1189 |
| 83 | Ga0068853_100569657 | 3300005539 | Bacteria | 1074 |
| 84 | Ga0068853_100828826 | 3300005539 | Bacteria | 887 |
| 85 | Ga0070672_100387686 | 3300005543 | Bacteria | 1196 |
| 86 | Ga0070695_100291022 | 3300005545 | Bacteria | 1204 |
| 87 | Ga0070696_100064429 | 3300005546 | Bacteria | 2568 |
| 88 | Ga0070693_100291274 | 3300005547 | Bacteria | 1097 |
| 89 | Ga0070693_100496561 | 3300005547 | Bacteria | 865 |
| 90 | Ga0070693_100691545 | 3300005547 | Bacteria | 746 |
| 91 | Ga0070665_100000879 | 3300005548 | Bacteria | 38675 |
| 92 | Ga0070665_100014442 | 3300005548 | Bacteria | 7922 |
| 93 | Ga0070665_100114106 | 3300005548 | Bacteria | 2704 |
| 94 | Ga0070665_100512780 | 3300005548 | Bacteria | 1211 |
| 95 | Ga0070665_100758309 | 3300005548 | Bacteria | 983 |
| 96 | Ga0070665_100961041 | 3300005548 | Bacteria | 867 |
| 97 | Ga0068855_100000111 | 3300005563 | Bacteria | 102282 |
| 98 | Ga0068855_100014305 | 3300005563 | Bacteria | 9555 |
| 99 | Ga0068855_100018471 | 3300005563 | Bacteria | 8380 |
| 100 | Ga0068855_100101800 | 3300005563 | Bacteria | 3306 |
| 101 | Ga0068855_100147934 | 3300005563 | Bacteria | 2673 |
| 102 | Ga0070664_100113906 | 3300005564 | Bacteria | 2362 |
| 103 | Ga0068857_100000944 | 3300005577 | Bacteria | 22139 |
| 104 | Ga0068857_100091519 | 3300005577 | Bacteria | 2723 |
| 105 | Ga0068857_100435493 | 3300005577 | Bacteria | 1224 |
| 106 | Ga0068857_101260539 | 3300005577 | Bacteria | 717 |
| 107 | Ga0068854_100501685 | 3300005578 | Bacteria | 1022 |
| 108 | Ga0068854_100652413 | 3300005578 | Bacteria | 904 |
| 109 | Ga0068854_100921864 | 3300005578 | Bacteria | 769 |
| 110 | Ga0068856_100000144 | 3300005614 | Bacteria | 72020 |
| 111 | Ga0068856_100008455 | 3300005614 | Bacteria | 10018 |
| 112 | Ga0068856_102586492 | 3300005614 | Bacteria | 514 |
| 113 | Ga0070702_100303165 | 3300005615 | Bacteria | 1106 |
| 114 | Ga0068852_100005341 | 3300005616 | Bacteria | 9173 |
| 115 | Ga0068852_100157245 | 3300005616 | Bacteria | 2119 |
| 116 | Ga0068859_100283647 | 3300005617 | Bacteria | 1749 |
| 117 | Ga0068864_100091729 | 3300005618 | Bacteria | 2681 |
| 118 | Ga0068864_100166760 | 3300005618 | Bacteria | 2006 |
| 119 | Ga0068864_101944153 | 3300005618 | Bacteria | 594 |
| 120 | Ga0068864_102555927 | 3300005618 | Bacteria | 517 |
| 121 | Ga0068861_100849070 | 3300005719 | Bacteria | 861 |
| 122 | Ga0068851_10093146 | 3300005834 | Bacteria | 1589 |
| 123 | Ga0068870_10100066 | 3300005840 | Bacteria | 1637 |
| 124 | Ga0068870_10427403 | 3300005840 | Bacteria | 868 |
| 125 | Ga0068858_100027867 | 3300005842 | Bacteria | 5249 |
| 126 | Ga0068858_100398009 | 3300005842 | Bacteria | 1323 |
| 127 | Ga0068858_100578048 | 3300005842 | Bacteria | 1089 |
| 128 | Ga0068860_100048418 | 3300005843 | Bacteria | 4051 |
| 129 | Ga0068860_100571799 | 3300005843 | Bacteria | 1134 |
| 130 | Ga0070716_100004517 | 3300006173 | Bacteria | 6663 |
| 131 | Ga0070712_100000293 | 3300006175 | Bacteria | 28103 |
| 132 | Ga0070712_100000567 | 3300006175 | Bacteria | 21500 |
| 133 | Ga0070712_100071161 | 3300006175 | Bacteria | 2488 |
| 134 | Ga0070712_101924055 | 3300006175 | Bacteria | 518 |
| 135 | Ga0075366_10119983 | 3300006195 | Bacteria | 1585 |
| 136 | Ga0097621_100031007 | 3300006237 | Bacteria | 4238 |
| 137 | Ga0097621_100036850 | 3300006237 | Bacteria | 3914 |
| 138 | Ga0097621_100053991 | 3300006237 | Bacteria | 3275 |
| 139 | Ga0097621_100274388 | 3300006237 | Bacteria | 1483 |
| 140 | Ga0097621_100691182 | 3300006237 | Unclassified | 939 |
| 141 | Ga0097621_100781342 | 3300006237 | Bacteria | 884 |
| 142 | Ga0075370_10056252 | 3300006353 | Bacteria | 2236 |
| 143 | Ga0075370_10946794 | 3300006353 | Bacteria | 527 |
| 144 | Ga0068871_100002461 | 3300006358 | Bacteria | 12642 |
| 145 | Ga0068871_100047905 | 3300006358 | Bacteria | 3448 |
| 146 | Ga0068871_100080526 | 3300006358 | Bacteria | 2696 |
| 147 | Ga0068871_100152545 | 3300006358 | Bacteria | 1971 |
| 148 | Ga0068871_100778371 | 3300006358 | Bacteria | 881 |
| 149 | Ga0075434_100068597 | 3300006871 | Bacteria | 3533 |
| 150 | Ga0068865_100003070 | 3300006881 | Bacteria | 9986 |
| 151 | Ga0068865_100268072 | 3300006881 | Bacteria | 1355 |
| 152 | Ga0068865_102125099 | 3300006881 | Bacteria | 511 |
| 153 | Ga0075436_100000574 | 3300006914 | Bacteria | 24043 |
| 154 | Ga0097620_100283649 | 3300006931 | Bacteria | 1749 |
| 155 | Ga0105250_10414351 | 3300009092 | Bacteria | 599 |
| 156 | Ga0105240_10006228 | 3300009093 | Bacteria | 17548 |
| 157 | Ga0105240_10010372 | 3300009093 | Bacteria | 13105 |
| 158 | Ga0105240_10013961 | 3300009093 | Bacteria | 10996 |
| 159 | Ga0105240_10027753 | 3300009093 | Bacteria | 7409 |
| 160 | Ga0105240_10036213 | 3300009093 | Bacteria | 6350 |
| 161 | Ga0105240_10056349 | 3300009093 | Bacteria | 4919 |
| 162 | Ga0105240_10059899 | 3300009093 | Bacteria | 4749 |
| 163 | Ga0105240_10174368 | 3300009093 | Bacteria | 2543 |
| 164 | Ga0105240_10520835 | 3300009093 | Bacteria | 1319 |
| 165 | Ga0105240_11124682 | 3300009093 | Bacteria | 835 |
| 166 | Ga0105240_11404993 | 3300009093 | Bacteria | 734 |
| 167 | Ga0105240_11978203 | 3300009093 | Bacteria | 606 |
| 168 | Ga0105245_10043251 | 3300009098 | Bacteria | 4018 |
| 169 | Ga0105245_10123480 | 3300009098 | Bacteria | 2421 |
| 170 | Ga0105245_10457093 | 3300009098 | Bacteria | 1286 |
| 171 | Ga0105247_10020883 | 3300009101 | Bacteria | 3938 |
| 172 | Ga0105247_10530822 | 3300009101 | Bacteria | 862 |
| 173 | Ga0105243_10129897 | 3300009148 | Bacteria | 2136 |
| 174 | Ga0105243_10377019 | 3300009148 | Bacteria | 1311 |
| 175 | Ga0105241_10001171 | 3300009174 | Bacteria | 19971 |
| 176 | Ga0105241_10034332 | 3300009174 | Bacteria | 3810 |
| 177 | Ga0105241_10139417 | 3300009174 | Bacteria | 1973 |
| 178 | Ga0105241_10217101 | 3300009174 | Bacteria | 1605 |
| 179 | Ga0105241_10246115 | 3300009174 | Bacteria | 1514 |
| 180 | Ga0105241_11535403 | 3300009174 | Bacteria | 642 |
| 181 | Ga0105241_12082036 | 3300009174 | Bacteria | 560 |
| 182 | Ga0105241_12417831 | 3300009174 | Unclassified | 525 |
| 183 | Ga0105242_10006404 | 3300009176 | Bacteria | 9066 |
| 184 | Ga0105242_10040101 | 3300009176 | Bacteria | 3772 |
| 185 | Ga0105242_10690670 | 3300009176 | Bacteria | 997 |
| 186 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 187 | Ga0105248_10035752 | 3300009177 | Bacteria | 5557 |
| 188 | Ga0105248_10069202 | 3300009177 | Bacteria | 3963 |
| 189 | Ga0105248_10148288 | 3300009177 | Bacteria | 2647 |
| 190 | Ga0105248_10703387 | 3300009177 | Bacteria | 1140 |
| 191 | Ga0105237_10016366 | 3300009545 | Bacteria | 7708 |
| 192 | Ga0105237_10017309 | 3300009545 | Bacteria | 7473 |
| 193 | Ga0105237_10116422 | 3300009545 | Bacteria | 2666 |
| 194 | Ga0105237_10581763 | 3300009545 | Unclassified | 1126 |
| 195 | Ga0105237_12281037 | 3300009545 | Bacteria | 551 |
| 196 | Ga0105238_10000847 | 3300009551 | Bacteria | 31513 |
| 197 | Ga0105238_10006764 | 3300009551 | Bacteria | 11456 |
| 198 | Ga0105238_10046152 | 3300009551 | Bacteria | 4398 |
| 199 | Ga0105238_10077477 | 3300009551 | Bacteria | 3315 |
| 200 | Ga0105238_10161348 | 3300009551 | Bacteria | 2217 |
| 201 | Ga0105238_10228957 | 3300009551 | Bacteria | 1836 |
| 202 | Ga0105238_10262790 | 3300009551 | Bacteria | 1706 |
| 203 | Ga0105238_10428462 | 3300009551 | Bacteria | 1318 |
| 204 | Ga0105238_10446022 | 3300009551 | Bacteria | 1291 |
| 205 | Ga0105238_10644374 | 3300009551 | Bacteria | 1069 |
| 206 | Ga0105238_11648951 | 3300009551 | Unclassified | 672 |
| 207 | Ga0105249_10789086 | 3300009553 | Bacteria | 1013 |
| 208 | Ga0105249_11839004 | 3300009553 | Bacteria | 678 |
| 209 | Ga0105249_12674259 | 3300009553 | Bacteria | 571 |
| 210 | Ga0105239_10001485 | 3300010375 | Bacteria | 31171 |
| 211 | Ga0105239_10005268 | 3300010375 | Bacteria | 15205 |
| 212 | Ga0105239_10006709 | 3300010375 | Bacteria | 13295 |
| 213 | Ga0105239_10026010 | 3300010375 | Bacteria | 6444 |
| 214 | Ga0105239_10104157 | 3300010375 | Bacteria | 3141 |
| 215 | Ga0105239_10167342 | 3300010375 | Bacteria | 2458 |
| 216 | Ga0105239_10298200 | 3300010375 | Bacteria | 1815 |
| 217 | Ga0105239_12377441 | 3300010375 | Bacteria | 617 |
| 218 | Ga0105239_13452461 | 3300010375 | Bacteria | 514 |
| 219 | Ga0105246_10020517 | 3300011119 | Bacteria | 4239 |
| 220 | Ga0105246_10559406 | 3300011119 | Bacteria | 981 |
| 221 | Ga0157373_10001245 | 3300013100 | Bacteria | 19459 |
| 222 | Ga0157373_10425485 | 3300013100 | Bacteria | 954 |
| 223 | Ga0157373_10441226 | 3300013100 | Bacteria | 936 |
| 224 | Ga0157373_10642832 | 3300013100 | Bacteria | 774 |
| 225 | Ga0157373_11313114 | 3300013100 | Bacteria | 548 |
| 226 | Ga0157370_10039363 | 3300013104 | Bacteria | 4569 |
| 227 | Ga0157370_10124379 | 3300013104 | Bacteria | 2408 |
| 228 | Ga0157370_10151238 | 3300013104 | Bacteria | 2160 |
| 229 | Ga0157370_11274873 | 3300013104 | Bacteria | 662 |
| 230 | Ga0157369_10010560 | 3300013105 | Bacteria | 10508 |
| 231 | Ga0157369_10199393 | 3300013105 | Bacteria | 2101 |
| 232 | Ga0157369_10238599 | 3300013105 | Bacteria | 1899 |
| 233 | Ga0157369_10258050 | 3300013105 | Bacteria | 1818 |
| 234 | Ga0157369_10375409 | 3300013105 | Bacteria | 1476 |
| 235 | Ga0157369_11291216 | 3300013105 | Bacteria | 744 |
| 236 | Ga0157374_10012434 | 3300013296 | Bacteria | 7404 |
| 237 | Ga0157374_10017187 | 3300013296 | Bacteria | 6368 |
| 238 | Ga0157374_10201534 | 3300013296 | Bacteria | 1949 |
| 239 | Ga0157374_10547475 | 3300013296 | Bacteria | 1165 |
| 240 | Ga0157378_10071178 | 3300013297 | Bacteria | 3123 |
| 241 | Ga0157378_10105031 | 3300013297 | Bacteria | 2582 |
| 242 | Ga0157378_10115124 | 3300013297 | Bacteria | 2471 |
| 243 | Ga0157378_10237312 | 3300013297 | Bacteria | 1740 |
| 244 | Ga0157378_10274718 | 3300013297 | Bacteria | 1622 |
| 245 | Ga0157378_10295752 | 3300013297 | Bacteria | 1565 |
| 246 | Ga0163162_10018224 | 3300013306 | Bacteria | 6876 |
| 247 | Ga0163162_10207002 | 3300013306 | Bacteria | 2091 |
| 248 | Ga0163162_10419140 | 3300013306 | Bacteria | 1471 |
| 249 | Ga0163162_11348922 | 3300013306 | Bacteria | 811 |
| 250 | Ga0157372_10027681 | 3300013307 | Bacteria | 6177 |
| 251 | Ga0157372_10079972 | 3300013307 | Bacteria | 3697 |
| 252 | Ga0157372_10685394 | 3300013307 | Bacteria | 1193 |
| 253 | Ga0157375_10060295 | 3300013308 | Bacteria | 3762 |
| 254 | Ga0157375_10427793 | 3300013308 | Bacteria | 1490 |
| 255 | Ga0157375_12281166 | 3300013308 | Bacteria | 645 |
| 256 | Ga0157375_12583621 | 3300013308 | Bacteria | 607 |
| 257 | Ga0163163_10000749 | 3300014325 | Bacteria | 27674 |
| 258 | Ga0163163_10227498 | 3300014325 | Bacteria | 1914 |
| 259 | Ga0163163_10363567 | 3300014325 | Bacteria | 1504 |
| 260 | Ga0163163_11356446 | 3300014325 | Bacteria | 773 |
| 261 | Ga0157380_10150009 | 3300014326 | Bacteria | 2014 |
| 262 | Ga0157380_11311957 | 3300014326 | Bacteria | 771 |
| 263 | Ga0182008_10071439 | 3300014497 | Bacteria | 1708 |
| 264 | Ga0157379_10003278 | 3300014968 | Bacteria | 13713 |
| 265 | Ga0157379_10013204 | 3300014968 | Bacteria | 7232 |
| 266 | Ga0157379_10031373 | 3300014968 | Bacteria | 4733 |
| 267 | Ga0157379_10066395 | 3300014968 | Bacteria | 3225 |
| 268 | Ga0157376_10007605 | 3300014969 | Bacteria | 7754 |
| 269 | Ga0157376_10325231 | 3300014969 | Bacteria | 1463 |
| 270 | Ga0157376_10469763 | 3300014969 | Bacteria | 1231 |
| 271 | Ga0157376_10590660 | 3300014969 | Bacteria | 1104 |
| 272 | Ga0182007_10032755 | 3300015262 | Bacteria | 1764 |
| 273 | Ga0163161_10003667 | 3300017792 | Bacteria | 10773 |
| 274 | Ga0163161_10781785 | 3300017792 | Bacteria | 801 |
| 275 | Ga0206353_11572703 | 3300020082 | Bacteria | 621 |
| 276 | Ga0213874_10000398 | 3300021377 | Bacteria | 8634 |
| 277 | Ga0213876_10000201 | 3300021384 | Bacteria | 61091 |
| 278 | Ga0224712_10050003 | 3300022467 | Bacteria | 1622 |
| 279 | Ga0207427_125719 | 3300025231 | Bacteria | 512 |
| 280 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 281 | Ga0209233_1002328 | 3300025261 | Bacteria | 7079 |
| 282 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 283 | Ga0209758_1066181 | 3300025297 | Bacteria | 1162 |
| 284 | Ga0207656_10060916 | 3300025321 | Bacteria | 1655 |
| 285 | Ga0207682_10456249 | 3300025893 | Bacteria | 605 |
| 286 | Ga0207710_10388400 | 3300025900 | Unclassified | 715 |
| 287 | Ga0207688_10021217 | 3300025901 | Bacteria | 3549 |
| 288 | Ga0207680_10002043 | 3300025903 | Bacteria | 9453 |
| 289 | Ga0207680_10113860 | 3300025903 | Bacteria | 1759 |
| 290 | Ga0207699_10011324 | 3300025906 | Bacteria | 4500 |
| 291 | Ga0207645_10094033 | 3300025907 | Bacteria | 1929 |
| 292 | Ga0207643_10093791 | 3300025908 | Bacteria | 1753 |
| 293 | Ga0207643_10415861 | 3300025908 | Bacteria | 852 |
| 294 | Ga0207705_10000391 | 3300025909 | Bacteria | 38775 |
| 295 | Ga0207705_10001089 | 3300025909 | Bacteria | 22089 |
| 296 | Ga0207705_10187835 | 3300025909 | Bacteria | 1561 |
| 297 | Ga0207705_10328805 | 3300025909 | Bacteria | 1175 |
| 298 | Ga0207654_10008441 | 3300025911 | Bacteria | 5208 |
| 299 | Ga0207654_10258215 | 3300025911 | Bacteria | 1170 |
| 300 | Ga0207654_10370710 | 3300025911 | Bacteria | 990 |
| 301 | Ga0207654_10813977 | 3300025911 | Bacteria | 675 |
| 302 | Ga0207654_11033159 | 3300025911 | Unclassified | 598 |
| 303 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 304 | Ga0207707_10054666 | 3300025912 | Bacteria | 3475 |
| 305 | Ga0207707_10197383 | 3300025912 | Bacteria | 1755 |
| 306 | Ga0207707_10268445 | 3300025912 | Bacteria | 1479 |
| 307 | Ga0207707_10354735 | 3300025912 | Bacteria | 1263 |
| 308 | Ga0207695_10000173 | 3300025913 | Bacteria | 189050 |
| 309 | Ga0207695_10010920 | 3300025913 | Bacteria | 11046 |
| 310 | Ga0207695_10032634 | 3300025913 | Bacteria | 5695 |
| 311 | Ga0207695_10035110 | 3300025913 | Bacteria | 5442 |
| 312 | Ga0207695_10138851 | 3300025913 | Bacteria | 2381 |
| 313 | Ga0207695_10140690 | 3300025913 | Bacteria | 2362 |
| 314 | Ga0207695_10150313 | 3300025913 | Bacteria | 2268 |
| 315 | Ga0207695_10258049 | 3300025913 | Bacteria | 1641 |
| 316 | Ga0207695_11684213 | 3300025913 | Bacteria | 515 |
| 317 | Ga0207671_10015697 | 3300025914 | Bacteria | 5920 |
| 318 | Ga0207671_10044806 | 3300025914 | Bacteria | 3271 |
| 319 | Ga0207671_10115634 | 3300025914 | Bacteria | 2045 |
| 320 | Ga0207671_10214011 | 3300025914 | Bacteria | 1508 |
| 321 | Ga0207671_10215863 | 3300025914 | Bacteria | 1502 |
| 322 | Ga0207671_10368082 | 3300025914 | Unclassified | 1141 |
| 323 | Ga0207671_10375240 | 3300025914 | Bacteria | 1129 |
| 324 | Ga0207693_10000163 | 3300025915 | Bacteria | 59871 |
| 325 | Ga0207693_10001708 | 3300025915 | Bacteria | 19323 |
| 326 | Ga0207693_10249012 | 3300025915 | Bacteria | 1394 |
| 327 | Ga0207693_10763882 | 3300025915 | Bacteria | 746 |
| 328 | Ga0207663_10156930 | 3300025916 | Bacteria | 1602 |
| 329 | Ga0207663_10304756 | 3300025916 | Bacteria | 1191 |
| 330 | Ga0207660_10001819 | 3300025917 | Bacteria | 14214 |
| 331 | Ga0207660_10009435 | 3300025917 | Bacteria | 6316 |
| 332 | Ga0207660_10073518 | 3300025917 | Bacteria | 2492 |
| 333 | Ga0207660_10173152 | 3300025917 | Bacteria | 1672 |
| 334 | Ga0207660_10246901 | 3300025917 | Bacteria | 1408 |
| 335 | Ga0207657_10011605 | 3300025919 | Bacteria | 8739 |
| 336 | Ga0207657_10025202 | 3300025919 | Bacteria | 5488 |
| 337 | Ga0207657_10087811 | 3300025919 | Bacteria | 2600 |
| 338 | Ga0207657_10194574 | 3300025919 | Bacteria | 1634 |
| 339 | Ga0207649_10000153 | 3300025920 | Bacteria | 56646 |
| 340 | Ga0207649_10073775 | 3300025920 | Bacteria | 2187 |
| 341 | Ga0207649_10183766 | 3300025920 | Bacteria | 1465 |
| 342 | Ga0207649_10213004 | 3300025920 | Unclassified | 1372 |
| 343 | Ga0207649_10681171 | 3300025920 | Bacteria | 796 |
| 344 | Ga0207649_10780515 | 3300025920 | Bacteria | 745 |
| 345 | Ga0207649_11012793 | 3300025920 | Bacteria | 654 |
| 346 | Ga0207652_10000419 | 3300025921 | Bacteria | 44102 |
| 347 | Ga0207652_10010126 | 3300025921 | Bacteria | 7595 |
| 348 | Ga0207652_10024819 | 3300025921 | Bacteria | 4975 |
| 349 | Ga0207652_10081972 | 3300025921 | Bacteria | 2822 |
| 350 | Ga0207652_10145113 | 3300025921 | Bacteria | 2124 |
| 351 | Ga0207652_10756682 | 3300025921 | Bacteria | 864 |
| 352 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 353 | Ga0207694_10025854 | 3300025924 | Bacteria | 4464 |
| 354 | Ga0207694_10031445 | 3300025924 | Bacteria | 4054 |
| 355 | Ga0207694_11105735 | 3300025924 | Bacteria | 671 |
| 356 | Ga0207694_11887334 | 3300025924 | Bacteria | 501 |
| 357 | Ga0207650_10239518 | 3300025925 | Bacteria | 1466 |
| 358 | Ga0207659_11256989 | 3300025926 | Bacteria | 636 |
| 359 | Ga0207687_10075870 | 3300025927 | Bacteria | 2413 |
| 360 | Ga0207687_10317268 | 3300025927 | Bacteria | 1260 |
| 361 | Ga0207687_10978445 | 3300025927 | Bacteria | 725 |
| 362 | Ga0207700_10000011 | 3300025928 | Bacteria | 266323 |
| 363 | Ga0207700_10046961 | 3300025928 | Bacteria | 3198 |
| 364 | Ga0207700_10239471 | 3300025928 | Bacteria | 1546 |
| 365 | Ga0207700_11249638 | 3300025928 | Bacteria | 662 |
| 366 | Ga0207664_10103678 | 3300025929 | Bacteria | 2354 |
| 367 | Ga0207664_10168344 | 3300025929 | Bacteria | 1874 |
| 368 | Ga0207644_10175828 | 3300025931 | Bacteria | 1675 |
| 369 | Ga0207644_10281339 | 3300025931 | Bacteria | 1336 |
| 370 | Ga0207690_10028467 | 3300025932 | Bacteria | 3542 |
| 371 | Ga0207690_10615486 | 3300025932 | Bacteria | 887 |
| 372 | Ga0207706_10644279 | 3300025933 | Bacteria | 908 |
| 373 | Ga0207706_10755812 | 3300025933 | Bacteria | 828 |
| 374 | Ga0207686_10005059 | 3300025934 | Bacteria | 7096 |
| 375 | Ga0207686_10017234 | 3300025934 | Bacteria | 4067 |
| 376 | Ga0207686_10296044 | 3300025934 | Bacteria | 1200 |
| 377 | Ga0207686_10531157 | 3300025934 | Bacteria | 917 |
| 378 | Ga0207709_10070859 | 3300025935 | Bacteria | 2212 |
| 379 | Ga0207670_10307701 | 3300025936 | Bacteria | 1243 |
| 380 | Ga0207704_10002288 | 3300025938 | Bacteria | 8609 |
| 381 | Ga0207704_10154288 | 3300025938 | Bacteria | 1625 |
| 382 | Ga0207704_10354204 | 3300025938 | Bacteria | 1144 |
| 383 | Ga0207665_10105393 | 3300025939 | Bacteria | 1974 |
| 384 | Ga0207691_10069799 | 3300025940 | Bacteria | 3173 |
| 385 | Ga0207691_10476763 | 3300025940 | Bacteria | 1061 |
| 386 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 387 | Ga0207711_10043357 | 3300025941 | Bacteria | 3837 |
| 388 | Ga0207711_10537141 | 3300025941 | Bacteria | 1090 |
| 389 | Ga0207711_10687653 | 3300025941 | Bacteria | 954 |
| 390 | Ga0207711_10719484 | 3300025941 | Bacteria | 931 |
| 391 | Ga0207661_10036171 | 3300025944 | Bacteria | 3853 |
| 392 | Ga0207679_10120435 | 3300025945 | Bacteria | 2088 |
| 393 | Ga0207667_10000011 | 3300025949 | Bacteria | 447785 |
| 394 | Ga0207667_10011191 | 3300025949 | Bacteria | 10442 |
| 395 | Ga0207667_10029812 | 3300025949 | Bacteria | 5911 |
| 396 | Ga0207667_10076783 | 3300025949 | Bacteria | 3466 |
| 397 | Ga0207667_10218399 | 3300025949 | Bacteria | 1953 |
| 398 | Ga0207667_10569642 | 3300025949 | Bacteria | 1144 |
| 399 | Ga0207667_10914069 | 3300025949 | Bacteria | 869 |
| 400 | Ga0207651_10148552 | 3300025960 | Bacteria | 1821 |
| 401 | Ga0207651_10420047 | 3300025960 | Bacteria | 1141 |
| 402 | Ga0207712_10594542 | 3300025961 | Bacteria | 956 |
| 403 | Ga0207668_10201503 | 3300025972 | Bacteria | 1585 |
| 404 | Ga0207640_10040807 | 3300025981 | Bacteria | 2947 |
| 405 | Ga0207640_10880833 | 3300025981 | Bacteria | 781 |
| 406 | Ga0207640_11107993 | 3300025981 | Bacteria | 701 |
| 407 | Ga0207658_10014985 | 3300025986 | Bacteria | 5316 |
| 408 | Ga0207677_10100309 | 3300026023 | Bacteria | 2129 |
| 409 | Ga0207677_10197806 | 3300026023 | Bacteria | 1595 |
| 410 | Ga0207677_10708772 | 3300026023 | Bacteria | 894 |
| 411 | Ga0207677_10764443 | 3300026023 | Bacteria | 862 |
| 412 | Ga0207703_10117170 | 3300026035 | Bacteria | 2281 |
| 413 | Ga0207703_10435695 | 3300026035 | Bacteria | 1222 |
| 414 | Ga0207639_10034281 | 3300026041 | Bacteria | 3751 |
| 415 | Ga0207639_10039639 | 3300026041 | Bacteria | 3511 |
| 416 | Ga0207639_10315836 | 3300026041 | Bacteria | 1386 |
| 417 | Ga0207639_10330850 | 3300026041 | Bacteria | 1355 |
| 418 | Ga0207639_10609839 | 3300026041 | Bacteria | 1007 |
| 419 | Ga0207678_10337375 | 3300026067 | Bacteria | 1298 |
| 420 | Ga0207678_10965736 | 3300026067 | Bacteria | 754 |
| 421 | Ga0207678_11305186 | 3300026067 | Bacteria | 642 |
| 422 | Ga0207702_10000226 | 3300026078 | Bacteria | 65919 |
| 423 | Ga0207702_10008271 | 3300026078 | Bacteria | 8790 |
| 424 | Ga0207702_10109377 | 3300026078 | Bacteria | 2454 |
| 425 | Ga0207702_11791137 | 3300026078 | Bacteria | 606 |
| 426 | Ga0207641_10806212 | 3300026088 | Bacteria | 929 |
| 427 | Ga0207648_10003109 | 3300026089 | Bacteria | 17532 |
| 428 | Ga0207648_10008012 | 3300026089 | Bacteria | 10295 |
| 429 | Ga0207648_10118436 | 3300026089 | Bacteria | 2327 |
| 430 | Ga0207676_10553043 | 3300026095 | Bacteria | 1100 |
| 431 | Ga0207676_10584942 | 3300026095 | Bacteria | 1070 |
| 432 | Ga0207676_11344080 | 3300026095 | Bacteria | 710 |
| 433 | Ga0207674_10000261 | 3300026116 | Bacteria | 66008 |
| 434 | Ga0207674_10032897 | 3300026116 | Bacteria | 5435 |
| 435 | Ga0207674_10378088 | 3300026116 | Bacteria | 1369 |
| 436 | Ga0207674_10641856 | 3300026116 | Bacteria | 1025 |
| 437 | Ga0207675_100331281 | 3300026118 | Bacteria | 1488 |
| 438 | Ga0207675_100844587 | 3300026118 | Bacteria | 930 |
| 439 | Ga0207683_10012952 | 3300026121 | Bacteria | 7121 |
| 440 | Ga0207683_10030570 | 3300026121 | Bacteria | 4667 |
| 441 | Ga0207683_10292888 | 3300026121 | Bacteria | 1488 |
| 442 | Ga0207698_10001869 | 3300026142 | Bacteria | 12302 |
| 443 | Ga0207698_10068701 | 3300026142 | Bacteria | 2799 |
| 444 | Ga0207698_10161414 | 3300026142 | Bacteria | 1960 |
| 445 | Ga0207698_10262598 | 3300026142 | Bacteria | 1587 |
| 446 | Ga0207698_10846908 | 3300026142 | Bacteria | 919 |
| 447 | Ga0268266_10000647 | 3300028379 | Bacteria | 47307 |
| 448 | Ga0268266_10021413 | 3300028379 | Bacteria | 5507 |
| 449 | Ga0268266_10034092 | 3300028379 | Bacteria | 4328 |
| 450 | Ga0268266_10713162 | 3300028379 | Bacteria | 967 |
| 451 | Ga0268265_10428451 | 3300028380 | Bacteria | 1230 |
| 452 | Ga0268265_11641149 | 3300028380 | Bacteria | 648 |
| 453 | Ga0268264_10222921 | 3300028381 | Bacteria | 1737 |
| 454 | Ga0265334_10019977 | 3300028573 | Bacteria | 2747 |
| 455 | Ga0265334_10111438 | 3300028573 | Bacteria | 983 |
| 456 | Ga0265318_10000104 | 3300028577 | Bacteria | 78958 |
| 457 | Ga0265318_10001589 | 3300028577 | Bacteria | 13138 |
| 458 | Ga0307517_10364215 | 3300028786 | Bacteria | 779 |
| 459 | Ga0265338_10000005 | 3300028800 | Bacteria | 571137 |
| 460 | Ga0265338_10016587 | 3300028800 | Bacteria | 7995 |
| 461 | Ga0265338_10030693 | 3300028800 | Bacteria | 5286 |
| 462 | Ga0265330_10027916 | 3300031235 | Bacteria | 2547 |
| 463 | Ga0265330_10134604 | 3300031235 | Bacteria | 1051 |
| 464 | Ga0265330_10283295 | 3300031235 | Bacteria | 698 |
| 465 | Ga0265330_10334150 | 3300031235 | Unclassified | 640 |
| 466 | Ga0265332_10048019 | 3300031238 | Bacteria | 1837 |
| 467 | Ga0265332_10204438 | 3300031238 | Bacteria | 820 |
| 468 | Ga0265332_10337502 | 3300031238 | Bacteria | 622 |
| 469 | Ga0265328_10120050 | 3300031239 | Bacteria | 980 |
| 470 | Ga0265328_10188597 | 3300031239 | Unclassified | 781 |
| 471 | Ga0265328_10348092 | 3300031239 | Bacteria | 577 |
| 472 | Ga0265328_10392959 | 3300031239 | Bacteria | 544 |
| 473 | Ga0265320_10005256 | 3300031240 | Bacteria | 8347 |
| 474 | Ga0265325_10000005 | 3300031241 | Bacteria | 321343 |
| 475 | Ga0265325_10000098 | 3300031241 | Bacteria | 61384 |
| 476 | Ga0265325_10003316 | 3300031241 | Bacteria | 10584 |
| 477 | Ga0265325_10005313 | 3300031241 | Bacteria | 7979 |
| 478 | Ga0265325_10007065 | 3300031241 | Bacteria | 6759 |
| 479 | Ga0265325_10028765 | 3300031241 | Bacteria | 2992 |
| 480 | Ga0265329_10017187 | 3300031242 | Bacteria | 2494 |
| 481 | Ga0265340_10000092 | 3300031247 | Bacteria | 42341 |
| 482 | Ga0265340_10027704 | 3300031247 | Bacteria | 2855 |
| 483 | Ga0265340_10064418 | 3300031247 | Bacteria | 1747 |
| 484 | Ga0265340_10135698 | 3300031247 | Bacteria | 1127 |
| 485 | Ga0265340_10192219 | 3300031247 | Bacteria | 920 |
| 486 | Ga0265340_10286389 | 3300031247 | Bacteria | 731 |
| 487 | Ga0265340_10408146 | 3300031247 | Bacteria | 599 |
| 488 | Ga0265339_10001877 | 3300031249 | Bacteria | 15427 |
| 489 | Ga0265339_10002558 | 3300031249 | Bacteria | 12972 |
| 490 | Ga0265339_10002598 | 3300031249 | Bacteria | 12887 |
| 491 | Ga0265339_10010635 | 3300031249 | Bacteria | 5705 |
| 492 | Ga0265339_10078354 | 3300031249 | Bacteria | 1749 |
| 493 | Ga0265339_10108605 | 3300031249 | Bacteria | 1438 |
| 494 | Ga0265339_10139877 | 3300031249 | Bacteria | 1232 |
| 495 | Ga0265339_10325723 | 3300031249 | Bacteria | 728 |
| 496 | Ga0265339_10544561 | 3300031249 | Bacteria | 534 |
| 497 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 498 | Ga0265331_10011578 | 3300031250 | Bacteria | 4824 |
| 499 | Ga0265331_10029215 | 3300031250 | Bacteria | 2753 |
| 500 | Ga0265331_10031715 | 3300031250 | Bacteria | 2625 |
| 501 | Ga0265331_10044112 | 3300031250 | Bacteria | 2157 |
| 502 | Ga0265327_10000187 | 3300031251 | Bacteria | 131135 |
| 503 | Ga0265316_10003669 | 3300031344 | Bacteria | 15465 |
| 504 | Ga0265316_10023813 | 3300031344 | Bacteria | 5142 |
| 505 | Ga0265316_10043378 | 3300031344 | Bacteria | 3585 |
| 506 | Ga0265316_10131928 | 3300031344 | Bacteria | 1881 |
| 507 | Ga0265316_10134135 | 3300031344 | Bacteria | 1863 |
| 508 | Ga0265316_10220429 | 3300031344 | Bacteria | 1400 |
| 509 | Ga0265316_10338785 | 3300031344 | Bacteria | 1090 |
| 510 | Ga0265313_10001748 | 3300031595 | Bacteria | 19956 |
| 511 | Ga0265313_10003640 | 3300031595 | Bacteria | 12352 |
| 512 | Ga0265313_10003817 | 3300031595 | Bacteria | 11907 |
| 513 | Ga0265313_10021395 | 3300031595 | Bacteria | 3538 |
| 514 | Ga0265313_10028305 | 3300031595 | Bacteria | 2915 |
| 515 | Ga0265313_10060125 | 3300031595 | Bacteria | 1784 |
| 516 | Ga0265313_10120761 | 3300031595 | Bacteria | 1143 |
| 517 | Ga0265313_10262494 | 3300031595 | Bacteria | 702 |
| 518 | Ga0265313_10359720 | 3300031595 | Bacteria | 576 |
| 519 | Ga0307508_10631639 | 3300031616 | Bacteria | 675 |
| 520 | Ga0265314_10000125 | 3300031711 | Bacteria | 118671 |
| 521 | Ga0265314_10000835 | 3300031711 | Bacteria | 36433 |
| 522 | Ga0265314_10019586 | 3300031711 | Bacteria | 5240 |
| 523 | Ga0265314_10040827 | 3300031711 | Bacteria | 3326 |
| 524 | Ga0265314_10056084 | 3300031711 | Bacteria | 2714 |
| 525 | Ga0265314_10061149 | 3300031711 | Bacteria | 2567 |
| 526 | Ga0265314_10062244 | 3300031711 | Bacteria | 2537 |
| 527 | Ga0265314_10074116 | 3300031711 | Bacteria | 2268 |
| 528 | Ga0265314_10469287 | 3300031711 | Bacteria | 667 |
| 529 | Ga0265342_10023744 | 3300031712 | Bacteria | 3876 |
| 530 | Ga0265342_10030086 | 3300031712 | Bacteria | 3368 |
| 531 | Ga0265342_10046434 | 3300031712 | Bacteria | 2610 |
| 532 | Ga0265342_10057095 | 3300031712 | Bacteria | 2311 |
| 533 | Ga0265342_10090739 | 3300031712 | Bacteria | 1752 |
| 534 | Ga0265342_10138175 | 3300031712 | Bacteria | 1361 |
| 535 | Ga0265342_10321162 | 3300031712 | Bacteria | 811 |
| 536 | Ga0265342_10350710 | 3300031712 | Bacteria | 769 |
| 537 | Ga0265342_10352258 | 3300031712 | Bacteria | 766 |
| 538 | Ga0265342_10489448 | 3300031712 | Unclassified | 628 |
| 539 | Ga0307516_10094863 | 3300031730 | Bacteria | 2807 |
| 540 | Ga0307516_10200220 | 3300031730 | Bacteria | 1717 |
| 541 | Ga0373923_0109988 | 3300035111 | Bacteria | 1223 |
| 542 | Ga0373932_0202524 | 3300035112 | Bacteria | 706 |
| 543 | Ga0373957_0123275 | 3300035120 | Bacteria | 1050 |
| 544 | Ga0373957_0165100 | 3300035120 | Bacteria | 913 |
| 545 | Ga0373957_0308564 | 3300035120 | Bacteria | 672 |
| 546 | Ga0373955_0132113 | 3300035172 | Bacteria | 1458 |
| 547 | Ga0373955_0333394 | 3300035172 | Bacteria | 917 |
| 548 | Ga0373942_0116873 | 3300035207 | Bacteria | 830 |
| 549 | Ga0373935_0669881 | 3300035692 | Bacteria | 762 |
| 550 | Ga0373927_0321531 | 3300035695 | Bacteria | 1019 |
| 551 | Ga0373933_0032349 | 3300035724 | Bacteria | 3040 |
| 552 | Ga0373933_0397218 | 3300035724 | Bacteria | 899 |
| 553 | Ga0373937_0004668 | 3300036401 | Bacteria | 11637 |
| 554 | Ga0373937_0162549 | 3300036401 | Bacteria | 2093 |
| 555 | Ga0373937_0492173 | 3300036401 | Bacteria | 1165 |
| 556 | Ga0373937_0496128 | 3300036401 | Bacteria | 1160 |
| 557 | Ga0373937_0642063 | 3300036401 | Bacteria | 1007 |
| 558 | Ga0373925_0068645 | 3300037068 | Bacteria | 2677 |
| 559 | Ga0373925_0817886 | 3300037068 | Bacteria | 768 |
| 560 | Ga0395900_0418422 | 3300037418 | Bacteria | 1301 |
| 561 | Ga0395900_1264769 | 3300037418 | Bacteria | 652 |
| 562 | Ga0395898_0079034 | 3300037466 | Bacteria | 3173 |
| 563 | Ga0395898_0292683 | 3300037466 | Bacteria | 1553 |
| 564 | Ga0395905_1746383 | 3300037471 | Bacteria | 528 |
| 565 | Ga0395901_0202057 | 3300038443 | Bacteria | 2083 |
| 566 | Ga0395901_0227683 | 3300038443 | Bacteria | 1947 |
| 567 | Ga0436365_0092617 | 3300039437 | Bacteria | 973 |
| 568 | Ga0436365_0495986 | 3300039437 | Bacteria | 71581 |
| 569 | Ga0436365_0906980 | 3300039437 | Bacteria | 3529 |
| 570 | Ga0436365_1052743 | 3300039437 | Bacteria | 736 |
| 571 | Ga0436365_1073490 | 3300039437 | Bacteria | 73987 |
| 572 | Ga0436365_1896990 | 3300039437 | Bacteria | 652 |
| 573 | Ga0436360_0541761 | 3300039438 | Bacteria | 1178 |
| 574 | Ga0436360_0728540 | 3300039438 | Bacteria | 657 |
| 575 | Ga0436361_0821138 | 3300039447 | Bacteria | 855 |
| 576 | Ga0436363_0027061 | 3300039450 | Bacteria | 1440 |
| 577 | Ga0436363_0386683 | 3300039450 | Bacteria | 740 |
| 578 | Ga0436363_0399751 | 3300039450 | Bacteria | 20052 |
| 579 | Ga0436363_1061920 | 3300039450 | Bacteria | 1439 |
| 580 | Ga0436362_0803129 | 3300039453 | Bacteria | 849 |
| 581 | Ga0436362_1209966 | 3300039453 | Bacteria | 1293 |
| 582 | Ga0451787_288411 | 3300041441 | Bacteria | 982 |
| 583 | Ga0451789_0954795 | 3300041443 | Bacteria | 843 |
| 584 | Ga0451795_0469109 | 3300041456 | Bacteria | 705 |
| 585 | Ga0451802_0453160 | 3300041460 | Bacteria | 1285 |
| 586 | Ga0451837_1219519 | 3300041494 | Bacteria | 520 |
| 587 | Ga0451839_1546439 | 3300041496 | Bacteria | 704 |
| 588 | Ga0451853_0937228 | 3300041512 | Bacteria | 612 |
| 589 | Ga0466957_0096925 | 3300044842 | Bacteria | 1854 |
| 590 | Ga0495592_0165908 | 3300046454 | Bacteria | 1516 |
| 591 | Ga0495592_0659461 | 3300046454 | Bacteria | 633 |
| 592 | Ga0495651_0239059 | 3300046462 | Bacteria | 1247 |
| 593 | Ga0495651_0323469 | 3300046462 | Bacteria | 1027 |
| 594 | Ga0495664_0026635 | 3300046477 | Bacteria | 3368 |
| 595 | Ga0495616_0086486 | 3300046513 | Bacteria | 1491 |
| 596 | Ga0495628_0062693 | 3300046516 | Bacteria | 2914 |
| 597 | Ga0495628_1152791 | 3300046516 | Bacteria | 528 |
| 598 | Ga0495652_0046452 | 3300046529 | Bacteria | 3729 |
| 599 | Ga0495654_0202066 | 3300046530 | Bacteria | 850 |
| 600 | Ga0495586_0227444 | 3300046535 | Bacteria | 1061 |
| 601 | Ga0495587_0414874 | 3300046536 | Bacteria | 748 |
| 602 | Ga0495587_0616704 | 3300046536 | Bacteria | 597 |
| 603 | Ga0495645_0002362 | 3300046543 | Bacteria | 12802 |
| 604 | Ga0495622_0006512 | 3300046557 | Bacteria | 5416 |
| 605 | Ga0495633_0369149 | 3300046558 | Bacteria | 650 |
| 606 | Ga0495625_0269624 | 3300046660 | Bacteria | 1099 |
| 607 | Ga0495646_0575361 | 3300046680 | Bacteria | 574 |
| 608 | Ga0495613_0729317 | 3300046689 | Bacteria | 651 |
| 609 | Ga0495670_0447428 | 3300046691 | Bacteria | 700 |
| 610 | Ga0495600_0361350 | 3300046809 | Bacteria | 908 |
| 611 | Ga0495600_0610153 | 3300046809 | Unclassified | 662 |
| 612 | Ga0495676_0394025 | 3300047321 | Bacteria | 920 |
| 613 | Ga0495675_0062083 | 3300047444 | Bacteria | 2366 |
| 614 | Ga0495675_0319396 | 3300047444 | Bacteria | 919 |
| 615 | Ga0495675_0430237 | 3300047444 | Bacteria | 766 |
| 616 | Ga0495684_0322563 | 3300047471 | Bacteria | 1104 |
| 617 | Ga0495602_0048635 | 3300048088 | Bacteria | 3809 |
| 618 | Ga0495602_0171887 | 3300048088 | Bacteria | 1681 |
| 619 | Ga0496102_1003319 | 3300048905 | Bacteria | 755 |
| 620 | Ga0496106_1136727 | 3300048909 | Bacteria | 611 |
| 621 | Ga0496108_0880785 | 3300048911 | Bacteria | 769 |
| 622 | Ga0496111_0644297 | 3300048914 | Bacteria | 773 |
| 623 | Ga0496126_0000498 | 3300048929 | Bacteria | 77619 |
| 624 | Ga0496126_0053473 | 3300048929 | Bacteria | 3664 |
| 625 | Ga0495682_0003854 | 3300049460 | Bacteria | 6574 |
| 626 | Ga0495682_0374942 | 3300049460 | Bacteria | 501 |
| 627 | Ga0501031_0005788 | 3300049568 | Bacteria | 8056 |
| 628 | Ga0501031_0218402 | 3300049568 | Bacteria | 1242 |
| 629 | Ga0501031_0622085 | 3300049568 | Bacteria | 694 |
| 630 | Ga0501032_0008519 | 3300049569 | Bacteria | 7476 |
| 631 | Ga0501032_0116827 | 3300049569 | Bacteria | 1764 |
| 632 | Ga0501032_0156000 | 3300049569 | Bacteria | 1500 |
| 633 | Ga0501032_0269207 | 3300049569 | Bacteria | 1104 |
| 634 | Ga0501033_0020678 | 3300049570 | Bacteria | 4973 |
| 635 | Ga0501033_0024643 | 3300049570 | Bacteria | 4537 |
| 636 | Ga0501033_0030976 | 3300049570 | Bacteria | 4020 |
| 637 | Ga0501033_0031252 | 3300049570 | Bacteria | 4002 |
| 638 | Ga0501033_0052738 | 3300049570 | Bacteria | 3014 |
| 639 | Ga0501033_0134629 | 3300049570 | Bacteria | 1788 |
| 640 | Ga0501033_0182168 | 3300049570 | Bacteria | 1505 |
| 641 | Ga0501033_0750930 | 3300049570 | Bacteria | 661 |
| 642 | Ga0501034_0001885 | 3300049571 | Bacteria | 26587 |
| 643 | Ga0501034_0016559 | 3300049571 | Bacteria | 7559 |
| 644 | Ga0501034_0063624 | 3300049571 | Bacteria | 3703 |
| 645 | Ga0501034_0125059 | 3300049571 | Bacteria | 2557 |
| 646 | Ga0501034_0554744 | 3300049571 | Bacteria | 1058 |
| 647 | Ga0501036_0022094 | 3300049572 | Bacteria | 5351 |
| 648 | Ga0501036_0066074 | 3300049572 | Bacteria | 3060 |
| 649 | Ga0501036_0163458 | 3300049572 | Bacteria | 1876 |
| 650 | Ga0501036_0590314 | 3300049572 | Bacteria | 922 |
| 651 | Ga0501036_0644289 | 3300049572 | Bacteria | 877 |
| 652 | Ga0501037_0015196 | 3300049573 | Bacteria | 5664 |
| 653 | Ga0501037_0083255 | 3300049573 | Bacteria | 2318 |
| 654 | Ga0501037_0096500 | 3300049573 | Bacteria | 2137 |
| 655 | Ga0501037_0206922 | 3300049573 | Bacteria | 1385 |
| 656 | Ga0501037_0725636 | 3300049573 | Bacteria | 660 |
| 657 | Ga0501038_0005734 | 3300049574 | Bacteria | 11507 |
| 658 | Ga0501038_0112540 | 3300049574 | Bacteria | 2253 |
| 659 | Ga0501038_0531747 | 3300049574 | Bacteria | 896 |
| 660 | Ga0501039_0477958 | 3300049575 | Bacteria | 978 |
| 661 | Ga0501039_1302835 | 3300049575 | Bacteria | 560 |
| 662 | Ga0501040_0688167 | 3300049576 | Bacteria | 739 |
| 663 | Ga0501042_0030584 | 3300049578 | Bacteria | 3804 |
| 664 | Ga0501042_0239301 | 3300049578 | Bacteria | 1310 |
| 665 | Ga0501043_0088740 | 3300049579 | Bacteria | 2430 |
| 666 | Ga0501043_0153798 | 3300049579 | Bacteria | 1799 |
| 667 | Ga0501043_0179083 | 3300049579 | Bacteria | 1652 |
| 668 | Ga0501043_0201910 | 3300049579 | Bacteria | 1543 |
| 669 | Ga0501043_0353577 | 3300049579 | Bacteria | 1116 |
| 670 | Ga0501043_0441777 | 3300049579 | Bacteria | 979 |
| 671 | Ga0501046_0008695 | 3300049580 | Bacteria | 8825 |
| 672 | Ga0501046_0053148 | 3300049580 | Bacteria | 3191 |
| 673 | Ga0501046_0188205 | 3300049580 | Bacteria | 1541 |
| 674 | Ga0501046_0453446 | 3300049580 | Bacteria | 922 |
| 675 | Ga0501046_0894298 | 3300049580 | Unclassified | 620 |
| 676 | Ga0501046_1174943 | 3300049580 | Bacteria | 528 |
| 677 | Ga0501047_0012566 | 3300049581 | Bacteria | 8019 |
| 678 | Ga0501047_0013767 | 3300049581 | Bacteria | 7682 |
| 679 | Ga0501047_0013897 | 3300049581 | Bacteria | 7645 |
| 680 | Ga0501047_0015474 | 3300049581 | Bacteria | 7269 |
| 681 | Ga0501047_0043833 | 3300049581 | Bacteria | 4321 |
| 682 | Ga0501047_0119204 | 3300049581 | Bacteria | 2521 |
| 683 | Ga0501047_0186059 | 3300049581 | Bacteria | 1942 |
| 684 | Ga0501047_0244246 | 3300049581 | Bacteria | 1645 |
| 685 | Ga0501048_0005128 | 3300049582 | Bacteria | 9980 |
| 686 | Ga0501048_0050571 | 3300049582 | Bacteria | 2960 |
| 687 | Ga0501048_1069953 | 3300049582 | Bacteria | 580 |
| 688 | Ga0501067_0000980 | 3300049583 | Bacteria | 15317 |
| 689 | Ga0501067_0073927 | 3300049583 | Bacteria | 1888 |
| 690 | Ga0501068_0055183 | 3300049584 | Bacteria | 2407 |
| 691 | Ga0501068_0229085 | 3300049584 | Bacteria | 1182 |
| 692 | Ga0501069_0005058 | 3300049585 | Bacteria | 6838 |
| 693 | Ga0501069_0227791 | 3300049585 | Bacteria | 1085 |
| 694 | Ga0501070_0000002 | 3300049586 | Bacteria | 347524 |
| 695 | Ga0501070_0023231 | 3300049586 | Bacteria | 5194 |
| 696 | Ga0501070_0224089 | 3300049586 | Bacteria | 1541 |
| 697 | Ga0501070_0456051 | 3300049586 | Bacteria | 1030 |
| 698 | Ga0501070_0696583 | 3300049586 | Bacteria | 804 |
| 699 | Ga0501070_0840399 | 3300049586 | Bacteria | 719 |
| 700 | Ga0501070_1083924 | 3300049586 | Bacteria | 618 |
| 701 | Ga0501071_0074730 | 3300049587 | Bacteria | 2474 |
| 702 | Ga0501073_0000591 | 3300049589 | Bacteria | 25613 |
| 703 | Ga0501073_0013808 | 3300049589 | Bacteria | 5873 |
| 704 | Ga0501073_0056012 | 3300049589 | Bacteria | 2758 |
| 705 | Ga0501073_0715772 | 3300049589 | Bacteria | 691 |
| 706 | Ga0501074_0151359 | 3300049590 | Bacteria | 1658 |
| 707 | Ga0501074_0851853 | 3300049590 | Bacteria | 642 |
| 708 | Ga0501074_0948069 | 3300049590 | Bacteria | 605 |
| 709 | Ga0501079_0007012 | 3300049741 | Bacteria | 8498 |
| 710 | Ga0501079_0009069 | 3300049741 | Bacteria | 7533 |
| 711 | Ga0501080_0019069 | 3300049742 | Bacteria | 6350 |
| 712 | Ga0501080_0021579 | 3300049742 | Bacteria | 5960 |
| 713 | Ga0501080_0022421 | 3300049742 | Bacteria | 5850 |
| 714 | Ga0501080_0114163 | 3300049742 | Bacteria | 2504 |
| 715 | Ga0501080_0146898 | 3300049742 | Bacteria | 2179 |
| 716 | Ga0501080_0228160 | 3300049742 | Bacteria | 1702 |
| 717 | Ga0501080_0243284 | 3300049742 | Bacteria | 1642 |
| 718 | Ga0501081_0108911 | 3300049743 | Bacteria | 1965 |
| 719 | Ga0501083_0187173 | 3300049744 | Bacteria | 1351 |
| 720 | Ga0501083_0302853 | 3300049744 | Bacteria | 1040 |
| 721 | Ga0501083_0472986 | 3300049744 | Bacteria | 816 |
| 722 | Ga0501083_0560191 | 3300049744 | Bacteria | 744 |
| 723 | Ga0501035_0029713 | 3300049822 | Bacteria | 4984 |
| 724 | Ga0501035_0037128 | 3300049822 | Bacteria | 4413 |
| 725 | Ga0501035_0046055 | 3300049822 | Bacteria | 3923 |
| 726 | Ga0501035_0190858 | 3300049822 | Bacteria | 1761 |
| 727 | Ga0501035_0259818 | 3300049822 | Bacteria | 1472 |
| 728 | Ga0501035_0338384 | 3300049822 | Bacteria | 1261 |
| 729 | Ga0501035_0528879 | 3300049822 | Bacteria | 968 |
| 730 | Ga0501035_0684787 | 3300049822 | Bacteria | 828 |
| 731 | Ga0501035_0936617 | 3300049822 | Bacteria | 684 |
| 732 | Ga0501035_0959340 | 3300049822 | Bacteria | 674 |
| 733 | Ga0501044_0000378 | 3300049823 | Bacteria | 55508 |
| 734 | Ga0501044_0001938 | 3300049823 | Bacteria | 23937 |
| 735 | Ga0501044_0014944 | 3300049823 | Bacteria | 8370 |
| 736 | Ga0501044_0025516 | 3300049823 | Bacteria | 6265 |
| 737 | Ga0501044_0029793 | 3300049823 | Bacteria | 5754 |
| 738 | Ga0501044_0072205 | 3300049823 | Bacteria | 3509 |
| 739 | Ga0501044_0138616 | 3300049823 | Bacteria | 2422 |
| 740 | Ga0501044_0338778 | 3300049823 | Bacteria | 1425 |
| 741 | Ga0501044_0354356 | 3300049823 | Bacteria | 1386 |
| 742 | Ga0501044_0432555 | 3300049823 | Bacteria | 1225 |
| 743 | Ga0501044_0899537 | 3300049823 | Bacteria | 760 |
| 744 | Ga0501044_1112392 | 3300049823 | Bacteria | 659 |
| 745 | Ga0501045_0427038 | 3300049824 | Bacteria | 986 |
| 746 | Ga0501045_0850001 | 3300049824 | Bacteria | 671 |
| 747 | nmdc:mga03n38_224569_c1 | 3300050490 | Bacteria | 982 |
| 748 | nmdc:mga07m45_314895_c1 | 3300050496 | Bacteria | 910 |
| 749 | nmdc:mga0n895_99325_c1 | 3300050512 | Bacteria | 2919 |
| 750 | nmdc:mga0rr50_986899_c1 | 3300050513 | Bacteria | 718 |
| 751 | nmdc:mga08x19_129_c1 | 3300050514 | Bacteria | 66982 |
| 752 | nmdc:mga08x19_44031_c1 | 3300050514 | Bacteria | 2848 |
| 753 | Ga0495601_0672152 | 3300053077 | Bacteria | 662 |
| 754 | Ga0500635_0102338 | 3300053080 | Bacteria | 1055 |
| 755 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 756 | Ga0500641_0010391 | 3300053096 | Bacteria | 3363 |
| 757 | Ga0500572_064930 | 3300053111 | Bacteria | 1117 |
| 758 | Ga0500594_0060504 | 3300053118 | Bacteria | 1091 |
| 759 | Ga0500595_000529 | 3300053119 | Bacteria | 23020 |
| 760 | Ga0500595_006042 | 3300053119 | Bacteria | 5200 |
| 761 | Ga0500595_015050 | 3300053119 | Bacteria | 2916 |
| 762 | Ga0500655_127362 | 3300053133 | Bacteria | 542 |
| 763 | Ga0500559_0035318 | 3300053136 | Bacteria | 2159 |
| 764 | Ga0500568_0100091 | 3300053139 | Bacteria | 1088 |
| 765 | Ga0500573_0000008 | 3300053140 | Bacteria | 237795 |
| 766 | Ga0500604_0106236 | 3300053151 | Bacteria | 929 |
| 767 | Ga0500639_018148 | 3300053163 | Bacteria | 3712 |
| 768 | Ga0500611_091443 | 3300053727 | Bacteria | 775 |
| 769 | Ga0501084_0000017 | 3300054114 | Bacteria | 148659 |
| 770 | Ga0501084_0006291 | 3300054114 | Bacteria | 9760 |
| 771 | Ga0501084_0135930 | 3300054114 | Bacteria | 2069 |
| 772 | Ga0501084_1481446 | 3300054114 | Bacteria | 568 |
| 773 | Ga0501082_0050887 | 3300060353 | Bacteria | 3572 |
| 774 | Ga0501082_0314265 | 3300060353 | Bacteria | 1364 |
| 775 | Ga0501082_0912024 | 3300060353 | Bacteria | 768 |
| 776 | Ga0501082_1204059 | 3300060353 | Unclassified | 662 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10001920 | Ga0070666_100019202 | 120 |
| 2 | 3300009177 | Ga0105248_10069202 | Ga0105248_100692025 | 120 |
| 3 | 3300025903 | Ga0207680_10002043 | Ga0207680_100020438 | 120 |
| 4 | 3300025941 | Ga0207711_10043357 | Ga0207711_100433575 | 120 |
| 5 | 3300048905 | Ga0496102_1003319 | Ga0496102_1003319_276_647 | 120 |
| 6 | 3300028800 | Ga0265338_10016587 | Ga0265338_100165878 | 121 |
| 7 | 3300005331 | Ga0070670_100202734 | Ga0070670_1002027343 | 122 |
| 8 | 3300005347 | Ga0070668_100212340 | Ga0070668_1002123402 | 122 |
| 9 | 3300005364 | Ga0070673_100430740 | Ga0070673_1004307401 | 122 |
| 10 | 3300005435 | Ga0070714_100115342 | Ga0070714_1001153421 | 122 |
| 11 | 3300005455 | Ga0070663_100772314 | Ga0070663_1007723142 | 122 |
| 12 | 3300005577 | Ga0068857_100435493 | Ga0068857_1004354933 | 122 |
| 13 | 3300005578 | Ga0068854_100501685 | Ga0068854_1005016852 | 122 |
| 14 | 3300005719 | Ga0068861_100849070 | Ga0068861_1008490702 | 122 |
| 15 | 3300006195 | Ga0075366_10119983 | Ga0075366_101199831 | 122 |
| 16 | 3300006353 | Ga0075370_10056252 | Ga0075370_100562524 | 122 |
| 17 | 3300025907 | Ga0207645_10094033 | Ga0207645_100940332 | 122 |
| 18 | 3300025925 | Ga0207650_10239518 | Ga0207650_102395183 | 122 |
| 19 | 3300025929 | Ga0207664_10103678 | Ga0207664_101036782 | 122 |
| 20 | 3300025933 | Ga0207706_10644279 | Ga0207706_106442791 | 122 |
| 21 | 3300025961 | Ga0207712_10594542 | Ga0207712_105945421 | 122 |
| 22 | 3300025972 | Ga0207668_10201503 | Ga0207668_102015032 | 122 |
| 23 | 3300025981 | Ga0207640_11107993 | Ga0207640_111079932 | 122 |
| 24 | 3300026118 | Ga0207675_100844587 | Ga0207675_1008445872 | 122 |
| 25 | 3300039438 | Ga0436360_0541761 | Ga0436360_0541761_307_684 | 122 |
| 26 | 3300039453 | Ga0436362_0803129 | Ga0436362_0803129_431_808 | 122 |
| 27 | 3300049572 | Ga0501036_0163458 | Ga0501036_0163458_1261_1647 | 122 |
| 28 | 3300049586 | Ga0501070_0456051 | Ga0501070_0456051_247_633 | 122 |
| 29 | 3300050490 | nmdc:mga03n38_224569_c1 | nmdc:mga03n38_224569_c1_385_768 | 122 |
| 30 | 3300050496 | nmdc:mga07m45_314895_c1 | nmdc:mga07m45_314895_c1_13_396 | 122 |
| 31 | 3300005546 | Ga0070696_100064429 | Ga0070696_1000644293 | 123 |
| 32 | 3300006175 | Ga0070712_100071161 | Ga0070712_1000711613 | 123 |
| 33 | 3300009093 | Ga0105240_10036213 | Ga0105240_100362133 | 123 |
| 34 | 3300009176 | Ga0105242_10690670 | Ga0105242_106906701 | 123 |
| 35 | 3300009551 | Ga0105238_10262790 | Ga0105238_102627903 | 123 |
| 36 | 3300010375 | Ga0105239_10006709 | Ga0105239_1000670912 | 123 |
| 37 | 3300013297 | Ga0157378_10071178 | Ga0157378_100711783 | 123 |
| 38 | 3300014968 | Ga0157379_10031373 | Ga0157379_100313731 | 123 |
| 39 | 3300021384 | Ga0213876_10000201 | Ga0213876_1000020111 | 123 |
| 40 | 3300025913 | Ga0207695_10140690 | Ga0207695_101406903 | 123 |
| 41 | 3300025914 | Ga0207671_10375240 | Ga0207671_103752401 | 123 |
| 42 | 3300025915 | Ga0207693_10249012 | Ga0207693_102490123 | 123 |
| 43 | 3300035207 | Ga0373942_0116873 | Ga0373942_0116873_389_760 | 123 |
| 44 | 3300039437 | Ga0436365_1073490 | Ga0436365_1073490_21004_21381 | 123 |
| 45 | 3300046809 | Ga0495600_0361350 | Ga0495600_0361350_17_400 | 123 |
| 46 | 3300049460 | Ga0495682_0374942 | Ga0495682_0374942_10_381 | 123 |
| 47 | 3300005327 | Ga0070658_10032522 | Ga0070658_100325222 | 124 |
| 48 | 3300005327 | Ga0070658_11041750 | Ga0070658_110417501 | 124 |
| 49 | 3300005337 | Ga0070682_101253696 | Ga0070682_1012536961 | 124 |
| 50 | 3300005339 | Ga0070660_100776722 | Ga0070660_1007767222 | 124 |
| 51 | 3300005347 | Ga0070668_101145674 | Ga0070668_1011456741 | 124 |
| 52 | 3300005367 | Ga0070667_100993977 | Ga0070667_1009939772 | 124 |
| 53 | 3300005530 | Ga0070679_100018143 | Ga0070679_1000181436 | 124 |
| 54 | 3300005539 | Ga0068853_100569657 | Ga0068853_1005696572 | 124 |
| 55 | 3300005563 | Ga0068855_100018471 | Ga0068855_1000184717 | 124 |
| 56 | 3300005577 | Ga0068857_101260539 | Ga0068857_1012605392 | 124 |
| 57 | 3300006237 | Ga0097621_100691182 | Ga0097621_1006911822 | 124 |
| 58 | 3300009093 | Ga0105240_10174368 | Ga0105240_101743684 | 124 |
| 59 | 3300009174 | Ga0105241_12417831 | Ga0105241_124178312 | 124 |
| 60 | 3300009551 | Ga0105238_10228957 | Ga0105238_102289573 | 124 |
| 61 | 3300009551 | Ga0105238_10428462 | Ga0105238_104284622 | 124 |
| 62 | 3300013104 | Ga0157370_11274873 | Ga0157370_112748732 | 124 |
| 63 | 3300013308 | Ga0157375_12583621 | Ga0157375_125836212 | 124 |
| 64 | 3300014325 | Ga0163163_11356446 | Ga0163163_113564462 | 124 |
| 65 | 3300014969 | Ga0157376_10469763 | Ga0157376_104697633 | 124 |
| 66 | 3300025909 | Ga0207705_10187835 | Ga0207705_101878353 | 124 |
| 67 | 3300025913 | Ga0207695_10010920 | Ga0207695_100109209 | 124 |
| 68 | 3300025913 | Ga0207695_10138851 | Ga0207695_101388513 | 124 |
| 69 | 3300025913 | Ga0207695_10150313 | Ga0207695_101503133 | 124 |
| 70 | 3300025914 | Ga0207671_10044806 | Ga0207671_100448063 | 124 |
| 71 | 3300025914 | Ga0207671_10368082 | Ga0207671_103680822 | 124 |
| 72 | 3300025920 | Ga0207649_10213004 | Ga0207649_102130042 | 124 |
| 73 | 3300025920 | Ga0207649_11012793 | Ga0207649_110127931 | 124 |
| 74 | 3300025924 | Ga0207694_10025854 | Ga0207694_100258544 | 124 |
| 75 | 3300025949 | Ga0207667_10076783 | Ga0207667_100767834 | 124 |
| 76 | 3300025949 | Ga0207667_10218399 | Ga0207667_102183993 | 124 |
| 77 | 3300026116 | Ga0207674_10032897 | Ga0207674_100328975 | 124 |
| 78 | 3300026116 | Ga0207674_10641856 | Ga0207674_106418563 | 124 |
| 79 | 3300031235 | Ga0265330_10027916 | Ga0265330_100279162 | 124 |
| 80 | 3300031238 | Ga0265332_10337502 | Ga0265332_103375022 | 124 |
| 81 | 3300031239 | Ga0265328_10348092 | Ga0265328_103480922 | 124 |
| 82 | 3300031241 | Ga0265325_10028765 | Ga0265325_100287653 | 124 |
| 83 | 3300031247 | Ga0265340_10000092 | Ga0265340_1000009219 | 124 |
| 84 | 3300031250 | Ga0265331_10031715 | Ga0265331_100317152 | 124 |
| 85 | 3300031344 | Ga0265316_10003669 | Ga0265316_1000366910 | 124 |
| 86 | 3300031344 | Ga0265316_10043378 | Ga0265316_100433784 | 124 |
| 87 | 3300031344 | Ga0265316_10220429 | Ga0265316_102204292 | 124 |
| 88 | 3300031595 | Ga0265313_10028305 | Ga0265313_100283054 | 124 |
| 89 | 3300031595 | Ga0265313_10262494 | Ga0265313_102624942 | 124 |
| 90 | 3300031711 | Ga0265314_10056084 | Ga0265314_100560843 | 124 |
| 91 | 3300031712 | Ga0265342_10030086 | Ga0265342_100300864 | 124 |
| 92 | 3300031712 | Ga0265342_10138175 | Ga0265342_101381752 | 124 |
| 93 | 3300039437 | Ga0436365_1896990 | Ga0436365_1896990_74_448 | 124 |
| 94 | 3300039447 | Ga0436361_0821138 | Ga0436361_0821138_371_766 | 124 |
| 95 | 3300039450 | Ga0436363_0027061 | Ga0436363_0027061_478_852 | 124 |
| 96 | 3300046513 | Ga0495616_0086486 | Ga0495616_0086486_947_1345 | 124 |
| 97 | 3300047444 | Ga0495675_0319396 | Ga0495675_0319396_509_895 | 124 |
| 98 | 3300031235 | Ga0265330_10134604 | Ga0265330_101346043 | 125 |
| 99 | 3300031238 | Ga0265332_10204438 | Ga0265332_102044382 | 125 |
| 100 | 3300031241 | Ga0265325_10005313 | Ga0265325_100053137 | 125 |
| 101 | 3300031247 | Ga0265340_10064418 | Ga0265340_100644182 | 125 |
| 102 | 3300031247 | Ga0265340_10286389 | Ga0265340_102863892 | 125 |
| 103 | 3300031249 | Ga0265339_10001877 | Ga0265339_1000187711 | 125 |
| 104 | 3300031249 | Ga0265339_10108605 | Ga0265339_101086052 | 125 |
| 105 | 3300031249 | Ga0265339_10139877 | Ga0265339_101398773 | 125 |
| 106 | 3300031249 | Ga0265339_10325723 | Ga0265339_103257231 | 125 |
| 107 | 3300031344 | Ga0265316_10134135 | Ga0265316_101341353 | 125 |
| 108 | 3300031595 | Ga0265313_10359720 | Ga0265313_103597202 | 125 |
| 109 | 3300031711 | Ga0265314_10000125 | Ga0265314_1000012558 | 125 |
| 110 | 3300031712 | Ga0265342_10046434 | Ga0265342_100464343 | 125 |
| 111 | 3300031712 | Ga0265342_10321162 | Ga0265342_103211622 | 125 |
| 112 | 3300039438 | Ga0436360_0728540 | Ga0436360_0728540_18_395 | 125 |
| 113 | 3300046462 | Ga0495651_0239059 | Ga0495651_0239059_91_474 | 125 |
| 114 | 3300046516 | Ga0495628_1152791 | Ga0495628_1152791_81_464 | 125 |
| 115 | 3300049570 | Ga0501033_0052738 | Ga0501033_0052738_1944_2339 | 125 |
| 116 | 3300049571 | Ga0501034_0554744 | Ga0501034_0554744_91_480 | 125 |
| 117 | 3300049581 | Ga0501047_0043833 | Ga0501047_0043833_2036_2425 | 125 |
| 118 | 3300049583 | Ga0501067_0000980 | Ga0501067_0000980_13451_13840 | 125 |
| 119 | 3300049589 | Ga0501073_0013808 | Ga0501073_0013808_360_749 | 125 |
| 120 | 3300049742 | Ga0501080_0021579 | Ga0501080_0021579_2930_3319 | 125 |
| 121 | 3300049823 | Ga0501044_0338778 | Ga0501044_0338778_960_1355 | 125 |
| 122 | 3300060353 | Ga0501082_1204059 | Ga0501082_1204059_239_628 | 125 |
| 123 | 3300003215 | JGI25153J46596_10000852 | JGI25153J46596_1000085214 | 126 |
| 124 | 3300003320 | rootH2_10011227 | rootH2_100112277 | 126 |
| 125 | 3300005327 | Ga0070658_10117330 | Ga0070658_101173304 | 126 |
| 126 | 3300005327 | Ga0070658_11513954 | Ga0070658_115139542 | 126 |
| 127 | 3300005328 | Ga0070676_10172592 | Ga0070676_101725923 | 126 |
| 128 | 3300005329 | Ga0070683_101794710 | Ga0070683_1017947101 | 126 |
| 129 | 3300005330 | Ga0070690_100023601 | Ga0070690_1000236013 | 126 |
| 130 | 3300005331 | Ga0070670_100352546 | Ga0070670_1003525463 | 126 |
| 131 | 3300005335 | Ga0070666_10015384 | Ga0070666_100153844 | 126 |
| 132 | 3300005335 | Ga0070666_10429985 | Ga0070666_104299851 | 126 |
| 133 | 3300005336 | Ga0070680_100000110 | Ga0070680_10000011036 | 126 |
| 134 | 3300005336 | Ga0070680_100018543 | Ga0070680_1000185434 | 126 |
| 135 | 3300005338 | Ga0068868_100209435 | Ga0068868_1002094352 | 126 |
| 136 | 3300005338 | Ga0068868_100353727 | Ga0068868_1003537271 | 126 |
| 137 | 3300005338 | Ga0068868_100801850 | Ga0068868_1008018501 | 126 |
| 138 | 3300005339 | Ga0070660_100246913 | Ga0070660_1002469132 | 126 |
| 139 | 3300005344 | Ga0070661_100000148 | Ga0070661_10000014816 | 126 |
| 140 | 3300005344 | Ga0070661_100277232 | Ga0070661_1002772321 | 126 |
| 141 | 3300005344 | Ga0070661_100743143 | Ga0070661_1007431432 | 126 |
| 142 | 3300005354 | Ga0070675_100047404 | Ga0070675_1000474044 | 126 |
| 143 | 3300005364 | Ga0070673_100184616 | Ga0070673_1001846161 | 126 |
| 144 | 3300005364 | Ga0070673_101073552 | Ga0070673_1010735522 | 126 |
| 145 | 3300005365 | Ga0070688_100475366 | Ga0070688_1004753663 | 126 |
| 146 | 3300005365 | Ga0070688_100845421 | Ga0070688_1008454211 | 126 |
| 147 | 3300005366 | Ga0070659_100027939 | Ga0070659_1000279391 | 126 |
| 148 | 3300005367 | Ga0070667_100009798 | Ga0070667_1000097987 | 126 |
| 149 | 3300005434 | Ga0070709_10979865 | Ga0070709_109798652 | 126 |
| 150 | 3300005436 | Ga0070713_100168380 | Ga0070713_1001683801 | 126 |
| 151 | 3300005455 | Ga0070663_100235686 | Ga0070663_1002356863 | 126 |
| 152 | 3300005457 | Ga0070662_101117780 | Ga0070662_1011177801 | 126 |
| 153 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001393 | 126 |
| 154 | 3300005458 | Ga0070681_10145807 | Ga0070681_101458074 | 126 |
| 155 | 3300005459 | Ga0068867_100940892 | Ga0068867_1009408922 | 126 |
| 156 | 3300005530 | Ga0070679_100000032 | Ga0070679_1000000327 | 126 |
| 157 | 3300005530 | Ga0070679_100032379 | Ga0070679_1000323795 | 126 |
| 158 | 3300005530 | Ga0070679_100058169 | Ga0070679_1000581696 | 126 |
| 159 | 3300005530 | Ga0070679_100323328 | Ga0070679_1003233282 | 126 |
| 160 | 3300005535 | Ga0070684_100501884 | Ga0070684_1005018843 | 126 |
| 161 | 3300005539 | Ga0068853_100466567 | Ga0068853_1004665671 | 126 |
| 162 | 3300005539 | Ga0068853_100828826 | Ga0068853_1008288262 | 126 |
| 163 | 3300005543 | Ga0070672_100387686 | Ga0070672_1003876862 | 126 |
| 164 | 3300005547 | Ga0070693_100691545 | Ga0070693_1006915452 | 126 |
| 165 | 3300005548 | Ga0070665_100000879 | Ga0070665_10000087913 | 126 |
| 166 | 3300005548 | Ga0070665_100014442 | Ga0070665_1000144421 | 126 |
| 167 | 3300005548 | Ga0070665_100114106 | Ga0070665_1001141064 | 126 |
| 168 | 3300005548 | Ga0070665_100512780 | Ga0070665_1005127803 | 126 |
| 169 | 3300005548 | Ga0070665_100961041 | Ga0070665_1009610413 | 126 |
| 170 | 3300005563 | Ga0068855_100000111 | Ga0068855_10000011123 | 126 |
| 171 | 3300005563 | Ga0068855_100101800 | Ga0068855_1001018002 | 126 |
| 172 | 3300005563 | Ga0068855_100147934 | Ga0068855_1001479344 | 126 |
| 173 | 3300005577 | Ga0068857_100091519 | Ga0068857_1000915194 | 126 |
| 174 | 3300005578 | Ga0068854_100652413 | Ga0068854_1006524131 | 126 |
| 175 | 3300005614 | Ga0068856_102586492 | Ga0068856_1025864922 | 126 |
| 176 | 3300005615 | Ga0070702_100303165 | Ga0070702_1003031653 | 126 |
| 177 | 3300005616 | Ga0068852_100157245 | Ga0068852_1001572453 | 126 |
| 178 | 3300005617 | Ga0068859_100283647 | Ga0068859_1002836474 | 126 |
| 179 | 3300005618 | Ga0068864_100091729 | Ga0068864_1000917293 | 126 |
| 180 | 3300005618 | Ga0068864_100166760 | Ga0068864_1001667603 | 126 |
| 181 | 3300005834 | Ga0068851_10093146 | Ga0068851_100931464 | 126 |
| 182 | 3300005840 | Ga0068870_10100066 | Ga0068870_101000662 | 126 |
| 183 | 3300005840 | Ga0068870_10427403 | Ga0068870_104274032 | 126 |
| 184 | 3300005842 | Ga0068858_100027867 | Ga0068858_1000278674 | 126 |
| 185 | 3300005843 | Ga0068860_100048418 | Ga0068860_1000484184 | 126 |
| 186 | 3300005843 | Ga0068860_100571799 | Ga0068860_1005717992 | 126 |
| 187 | 3300006175 | Ga0070712_101924055 | Ga0070712_1019240552 | 126 |
| 188 | 3300006237 | Ga0097621_100036850 | Ga0097621_1000368505 | 126 |
| 189 | 3300006237 | Ga0097621_100053991 | Ga0097621_1000539912 | 126 |
| 190 | 3300006237 | Ga0097621_100274388 | Ga0097621_1002743883 | 126 |
| 191 | 3300006237 | Ga0097621_100781342 | Ga0097621_1007813421 | 126 |
| 192 | 3300006358 | Ga0068871_100080526 | Ga0068871_1000805261 | 126 |
| 193 | 3300006358 | Ga0068871_100152545 | Ga0068871_1001525453 | 126 |
| 194 | 3300006931 | Ga0097620_100283649 | Ga0097620_1002836494 | 126 |
| 195 | 3300009092 | Ga0105250_10414351 | Ga0105250_104143512 | 126 |
| 196 | 3300009093 | Ga0105240_10010372 | Ga0105240_100103728 | 126 |
| 197 | 3300009093 | Ga0105240_10056349 | Ga0105240_100563497 | 126 |
| 198 | 3300009093 | Ga0105240_10520835 | Ga0105240_105208353 | 126 |
| 199 | 3300009093 | Ga0105240_11124682 | Ga0105240_111246822 | 126 |
| 200 | 3300009093 | Ga0105240_11404993 | Ga0105240_114049932 | 126 |
| 201 | 3300009093 | Ga0105240_11978203 | Ga0105240_119782032 | 126 |
| 202 | 3300009098 | Ga0105245_10043251 | Ga0105245_100432514 | 126 |
| 203 | 3300009101 | Ga0105247_10020883 | Ga0105247_100208835 | 126 |
| 204 | 3300009101 | Ga0105247_10530822 | Ga0105247_105308222 | 126 |
| 205 | 3300009148 | Ga0105243_10129897 | Ga0105243_101298972 | 126 |
| 206 | 3300009174 | Ga0105241_10217101 | Ga0105241_102171013 | 126 |
| 207 | 3300009174 | Ga0105241_10246115 | Ga0105241_102461152 | 126 |
| 208 | 3300009174 | Ga0105241_11535403 | Ga0105241_115354031 | 126 |
| 209 | 3300009176 | Ga0105242_10006404 | Ga0105242_100064046 | 126 |
| 210 | 3300009177 | Ga0105248_10035752 | Ga0105248_100357525 | 126 |
| 211 | 3300009177 | Ga0105248_10703387 | Ga0105248_107033872 | 126 |
| 212 | 3300009545 | Ga0105237_12281037 | Ga0105237_122810372 | 126 |
| 213 | 3300009551 | Ga0105238_10046152 | Ga0105238_100461523 | 126 |
| 214 | 3300009551 | Ga0105238_10161348 | Ga0105238_101613484 | 126 |
| 215 | 3300009551 | Ga0105238_10446022 | Ga0105238_104460221 | 126 |
| 216 | 3300009551 | Ga0105238_10644374 | Ga0105238_106443742 | 126 |
| 217 | 3300009551 | Ga0105238_11648951 | Ga0105238_116489512 | 126 |
| 218 | 3300009553 | Ga0105249_10789086 | Ga0105249_107890862 | 126 |
| 219 | 3300009553 | Ga0105249_11839004 | Ga0105249_118390042 | 126 |
| 220 | 3300010375 | Ga0105239_10001485 | Ga0105239_100014859 | 126 |
| 221 | 3300010375 | Ga0105239_10005268 | Ga0105239_1000526812 | 126 |
| 222 | 3300010375 | Ga0105239_10104157 | Ga0105239_101041574 | 126 |
| 223 | 3300010375 | Ga0105239_10167342 | Ga0105239_101673422 | 126 |
| 224 | 3300010375 | Ga0105239_10298200 | Ga0105239_102982002 | 126 |
| 225 | 3300011119 | Ga0105246_10559406 | Ga0105246_105594062 | 126 |
| 226 | 3300013100 | Ga0157373_10642832 | Ga0157373_106428322 | 126 |
| 227 | 3300013104 | Ga0157370_10039363 | Ga0157370_100393634 | 126 |
| 228 | 3300013105 | Ga0157369_10199393 | Ga0157369_101993931 | 126 |
| 229 | 3300013105 | Ga0157369_10238599 | Ga0157369_102385991 | 126 |
| 230 | 3300013105 | Ga0157369_10375409 | Ga0157369_103754091 | 126 |
| 231 | 3300013105 | Ga0157369_11291216 | Ga0157369_112912162 | 126 |
| 232 | 3300013296 | Ga0157374_10012434 | Ga0157374_100124345 | 126 |
| 233 | 3300013297 | Ga0157378_10105031 | Ga0157378_101050314 | 126 |
| 234 | 3300013297 | Ga0157378_10237312 | Ga0157378_102373123 | 126 |
| 235 | 3300013297 | Ga0157378_10295752 | Ga0157378_102957523 | 126 |
| 236 | 3300013306 | Ga0163162_10207002 | Ga0163162_102070023 | 126 |
| 237 | 3300013307 | Ga0157372_10685394 | Ga0157372_106853941 | 126 |
| 238 | 3300013308 | Ga0157375_10427793 | Ga0157375_104277933 | 126 |
| 239 | 3300013308 | Ga0157375_12281166 | Ga0157375_122811662 | 126 |
| 240 | 3300014325 | Ga0163163_10227498 | Ga0163163_102274983 | 126 |
| 241 | 3300014326 | Ga0157380_10150009 | Ga0157380_101500094 | 126 |
| 242 | 3300014326 | Ga0157380_11311957 | Ga0157380_113119572 | 126 |
| 243 | 3300014968 | Ga0157379_10003278 | Ga0157379_100032784 | 126 |
| 244 | 3300014969 | Ga0157376_10325231 | Ga0157376_103252312 | 126 |
| 245 | 3300017792 | Ga0163161_10781785 | Ga0163161_107817852 | 126 |
| 246 | 3300021377 | Ga0213874_10000398 | Ga0213874_100003987 | 126 |
| 247 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013317 | 126 |
| 248 | 3300025297 | Ga0209758_1066181 | Ga0209758_10661811 | 126 |
| 249 | 3300025321 | Ga0207656_10060916 | Ga0207656_100609162 | 126 |
| 250 | 3300025900 | Ga0207710_10388400 | Ga0207710_103884002 | 126 |
| 251 | 3300025903 | Ga0207680_10113860 | Ga0207680_101138602 | 126 |
| 252 | 3300025908 | Ga0207643_10093791 | Ga0207643_100937912 | 126 |
| 253 | 3300025908 | Ga0207643_10415861 | Ga0207643_104158612 | 126 |
| 254 | 3300025909 | Ga0207705_10001089 | Ga0207705_1000108921 | 126 |
| 255 | 3300025909 | Ga0207705_10328805 | Ga0207705_103288053 | 126 |
| 256 | 3300025911 | Ga0207654_10370710 | Ga0207654_103707102 | 126 |
| 257 | 3300025911 | Ga0207654_11033159 | Ga0207654_110331592 | 126 |
| 258 | 3300025912 | Ga0207707_10000001 | Ga0207707_1000000180 | 126 |
| 259 | 3300025912 | Ga0207707_10197383 | Ga0207707_101973832 | 126 |
| 260 | 3300025912 | Ga0207707_10354735 | Ga0207707_103547352 | 126 |
| 261 | 3300025913 | Ga0207695_10000173 | Ga0207695_10000173161 | 126 |
| 262 | 3300025913 | Ga0207695_10258049 | Ga0207695_102580493 | 126 |
| 263 | 3300025913 | Ga0207695_11684213 | Ga0207695_116842132 | 126 |
| 264 | 3300025914 | Ga0207671_10214011 | Ga0207671_102140111 | 126 |
| 265 | 3300025914 | Ga0207671_10215863 | Ga0207671_102158634 | 126 |
| 266 | 3300025915 | Ga0207693_10763882 | Ga0207693_107638822 | 126 |
| 267 | 3300025916 | Ga0207663_10156930 | Ga0207663_101569301 | 126 |
| 268 | 3300025917 | Ga0207660_10001819 | Ga0207660_100018197 | 126 |
| 269 | 3300025917 | Ga0207660_10009435 | Ga0207660_100094355 | 126 |
| 270 | 3300025917 | Ga0207660_10246901 | Ga0207660_102469013 | 126 |
| 271 | 3300025919 | Ga0207657_10025202 | Ga0207657_100252022 | 126 |
| 272 | 3300025919 | Ga0207657_10194574 | Ga0207657_101945742 | 126 |
| 273 | 3300025920 | Ga0207649_10000153 | Ga0207649_1000015319 | 126 |
| 274 | 3300025920 | Ga0207649_10073775 | Ga0207649_100737754 | 126 |
| 275 | 3300025920 | Ga0207649_10183766 | Ga0207649_101837662 | 126 |
| 276 | 3300025921 | Ga0207652_10000419 | Ga0207652_100004198 | 126 |
| 277 | 3300025921 | Ga0207652_10010126 | Ga0207652_100101265 | 126 |
| 278 | 3300025921 | Ga0207652_10145113 | Ga0207652_101451133 | 126 |
| 279 | 3300025921 | Ga0207652_10756682 | Ga0207652_107566821 | 126 |
| 280 | 3300025924 | Ga0207694_10000005 | Ga0207694_10000005415 | 126 |
| 281 | 3300025924 | Ga0207694_10031445 | Ga0207694_100314451 | 126 |
| 282 | 3300025924 | Ga0207694_11887334 | Ga0207694_118873342 | 126 |
| 283 | 3300025927 | Ga0207687_10317268 | Ga0207687_103172683 | 126 |
| 284 | 3300025927 | Ga0207687_10978445 | Ga0207687_109784451 | 126 |
| 285 | 3300025928 | Ga0207700_10046961 | Ga0207700_100469612 | 126 |
| 286 | 3300025928 | Ga0207700_11249638 | Ga0207700_112496381 | 126 |
| 287 | 3300025931 | Ga0207644_10175828 | Ga0207644_101758283 | 126 |
| 288 | 3300025932 | Ga0207690_10028467 | Ga0207690_100284674 | 126 |
| 289 | 3300025933 | Ga0207706_10755812 | Ga0207706_107558122 | 126 |
| 290 | 3300025934 | Ga0207686_10005059 | Ga0207686_100050596 | 126 |
| 291 | 3300025934 | Ga0207686_10296044 | Ga0207686_102960443 | 126 |
| 292 | 3300025935 | Ga0207709_10070859 | Ga0207709_100708594 | 126 |
| 293 | 3300025936 | Ga0207670_10307701 | Ga0207670_103077013 | 126 |
| 294 | 3300025940 | Ga0207691_10069799 | Ga0207691_100697993 | 126 |
| 295 | 3300025941 | Ga0207711_10537141 | Ga0207711_105371413 | 126 |
| 296 | 3300025941 | Ga0207711_10719484 | Ga0207711_107194842 | 126 |
| 297 | 3300025944 | Ga0207661_10036171 | Ga0207661_100361714 | 126 |
| 298 | 3300025949 | Ga0207667_10000011 | Ga0207667_10000011168 | 126 |
| 299 | 3300025949 | Ga0207667_10029812 | Ga0207667_100298122 | 126 |
| 300 | 3300025949 | Ga0207667_10569642 | Ga0207667_105696423 | 126 |
| 301 | 3300025960 | Ga0207651_10148552 | Ga0207651_101485521 | 126 |
| 302 | 3300025981 | Ga0207640_10040807 | Ga0207640_100408074 | 126 |
| 303 | 3300025986 | Ga0207658_10014985 | Ga0207658_100149853 | 126 |
| 304 | 3300026023 | Ga0207677_10197806 | Ga0207677_101978062 | 126 |
| 305 | 3300026023 | Ga0207677_10708772 | Ga0207677_107087722 | 126 |
| 306 | 3300026023 | Ga0207677_10764443 | Ga0207677_107644432 | 126 |
| 307 | 3300026035 | Ga0207703_10117170 | Ga0207703_101171703 | 126 |
| 308 | 3300026041 | Ga0207639_10315836 | Ga0207639_103158363 | 126 |
| 309 | 3300026041 | Ga0207639_10330850 | Ga0207639_103308502 | 126 |
| 310 | 3300026041 | Ga0207639_10609839 | Ga0207639_106098393 | 126 |
| 311 | 3300026067 | Ga0207678_10337375 | Ga0207678_103373752 | 126 |
| 312 | 3300026067 | Ga0207678_10965736 | Ga0207678_109657362 | 126 |
| 313 | 3300026078 | Ga0207702_10109377 | Ga0207702_101093774 | 126 |
| 314 | 3300026078 | Ga0207702_11791137 | Ga0207702_117911371 | 126 |
| 315 | 3300026089 | Ga0207648_10008012 | Ga0207648_100080129 | 126 |
| 316 | 3300026095 | Ga0207676_10584942 | Ga0207676_105849422 | 126 |
| 317 | 3300026095 | Ga0207676_11344080 | Ga0207676_113440802 | 126 |
| 318 | 3300026116 | Ga0207674_10378088 | Ga0207674_103780883 | 126 |
| 319 | 3300026118 | Ga0207675_100331281 | Ga0207675_1003312814 | 126 |
| 320 | 3300026121 | Ga0207683_10292888 | Ga0207683_102928882 | 126 |
| 321 | 3300026142 | Ga0207698_10001869 | Ga0207698_1000186910 | 126 |
| 322 | 3300026142 | Ga0207698_10068701 | Ga0207698_100687014 | 126 |
| 323 | 3300026142 | Ga0207698_10846908 | Ga0207698_108469082 | 126 |
| 324 | 3300028379 | Ga0268266_10000647 | Ga0268266_1000064729 | 126 |
| 325 | 3300028379 | Ga0268266_10021413 | Ga0268266_100214137 | 126 |
| 326 | 3300028379 | Ga0268266_10034092 | Ga0268266_100340922 | 126 |
| 327 | 3300028379 | Ga0268266_10713162 | Ga0268266_107131622 | 126 |
| 328 | 3300028380 | Ga0268265_10428451 | Ga0268265_104284513 | 126 |
| 329 | 3300028380 | Ga0268265_11641149 | Ga0268265_116411492 | 126 |
| 330 | 3300028381 | Ga0268264_10222921 | Ga0268264_102229212 | 126 |
| 331 | 3300028786 | Ga0307517_10364215 | Ga0307517_103642152 | 126 |
| 332 | 3300028800 | Ga0265338_10030693 | Ga0265338_100306933 | 126 |
| 333 | 3300031235 | Ga0265330_10334150 | Ga0265330_103341502 | 126 |
| 334 | 3300031239 | Ga0265328_10392959 | Ga0265328_103929591 | 126 |
| 335 | 3300031240 | Ga0265320_10005256 | Ga0265320_100052561 | 126 |
| 336 | 3300031241 | Ga0265325_10003316 | Ga0265325_100033165 | 126 |
| 337 | 3300031241 | Ga0265325_10007065 | Ga0265325_100070654 | 126 |
| 338 | 3300031247 | Ga0265340_10027704 | Ga0265340_100277043 | 126 |
| 339 | 3300031247 | Ga0265340_10135698 | Ga0265340_101356983 | 126 |
| 340 | 3300031249 | Ga0265339_10002558 | Ga0265339_100025587 | 126 |
| 341 | 3300031249 | Ga0265339_10544561 | Ga0265339_105445612 | 126 |
| 342 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003144 | 126 |
| 343 | 3300031250 | Ga0265331_10029215 | Ga0265331_100292152 | 126 |
| 344 | 3300031595 | Ga0265313_10001748 | Ga0265313_1000174810 | 126 |
| 345 | 3300031595 | Ga0265313_10120761 | Ga0265313_101207612 | 126 |
| 346 | 3300031616 | Ga0307508_10631639 | Ga0307508_106316392 | 126 |
| 347 | 3300031711 | Ga0265314_10019586 | Ga0265314_100195863 | 126 |
| 348 | 3300031711 | Ga0265314_10061149 | Ga0265314_100611492 | 126 |
| 349 | 3300031711 | Ga0265314_10062244 | Ga0265314_100622444 | 126 |
| 350 | 3300031711 | Ga0265314_10074116 | Ga0265314_100741163 | 126 |
| 351 | 3300031712 | Ga0265342_10023744 | Ga0265342_100237442 | 126 |
| 352 | 3300031712 | Ga0265342_10489448 | Ga0265342_104894482 | 126 |
| 353 | 3300031730 | Ga0307516_10094863 | Ga0307516_100948632 | 126 |
| 354 | 3300031730 | Ga0307516_10200220 | Ga0307516_102002203 | 126 |
| 355 | 3300035120 | Ga0373957_0123275 | Ga0373957_0123275_532_918 | 126 |
| 356 | 3300035724 | Ga0373933_0397218 | Ga0373933_0397218_191_577 | 126 |
| 357 | 3300036401 | Ga0373937_0496128 | Ga0373937_0496128_635_1021 | 126 |
| 358 | 3300037418 | Ga0395900_0418422 | Ga0395900_0418422_635_1027 | 126 |
| 359 | 3300037466 | Ga0395898_0292683 | Ga0395898_0292683_1031_1423 | 126 |
| 360 | 3300037471 | Ga0395905_1746383 | Ga0395905_1746383_82_462 | 126 |
| 361 | 3300038443 | Ga0395901_0202057 | Ga0395901_0202057_271_663 | 126 |
| 362 | 3300039437 | Ga0436365_0092617 | Ga0436365_0092617_191_571 | 126 |
| 363 | 3300039450 | Ga0436363_0386683 | Ga0436363_0386683_101_481 | 126 |
| 364 | 3300039450 | Ga0436363_0399751 | Ga0436363_0399751_11823_12209 | 126 |
| 365 | 3300041441 | Ga0451787_288411 | Ga0451787_288411_544_924 | 126 |
| 366 | 3300041443 | Ga0451789_0954795 | Ga0451789_0954795_367_747 | 126 |
| 367 | 3300041456 | Ga0451795_0469109 | Ga0451795_0469109_267_653 | 126 |
| 368 | 3300041460 | Ga0451802_0453160 | Ga0451802_0453160_775_1155 | 126 |
| 369 | 3300041494 | Ga0451837_1219519 | Ga0451837_1219519_126_506 | 126 |
| 370 | 3300046454 | Ga0495592_0165908 | Ga0495592_0165908_495_881 | 126 |
| 371 | 3300046454 | Ga0495592_0659461 | Ga0495592_0659461_55_435 | 126 |
| 372 | 3300046477 | Ga0495664_0026635 | Ga0495664_0026635_2963_3349 | 126 |
| 373 | 3300046516 | Ga0495628_0062693 | Ga0495628_0062693_1058_1444 | 126 |
| 374 | 3300046529 | Ga0495652_0046452 | Ga0495652_0046452_419_805 | 126 |
| 375 | 3300046530 | Ga0495654_0202066 | Ga0495654_0202066_330_710 | 126 |
| 376 | 3300046536 | Ga0495587_0616704 | Ga0495587_0616704_36_416 | 126 |
| 377 | 3300046543 | Ga0495645_0002362 | Ga0495645_0002362_8016_8402 | 126 |
| 378 | 3300046557 | Ga0495622_0006512 | Ga0495622_0006512_2507_2887 | 126 |
| 379 | 3300046558 | Ga0495633_0369149 | Ga0495633_0369149_114_494 | 126 |
| 380 | 3300046691 | Ga0495670_0447428 | Ga0495670_0447428_223_603 | 126 |
| 381 | 3300047444 | Ga0495675_0062083 | Ga0495675_0062083_393_779 | 126 |
| 382 | 3300049460 | Ga0495682_0003854 | Ga0495682_0003854_1941_2327 | 126 |
| 383 | 3300049568 | Ga0501031_0005788 | Ga0501031_0005788_6574_6957 | 126 |
| 384 | 3300049568 | Ga0501031_0218402 | Ga0501031_0218402_691_1089 | 126 |
| 385 | 3300049569 | Ga0501032_0008519 | Ga0501032_0008519_782_1165 | 126 |
| 386 | 3300049569 | Ga0501032_0269207 | Ga0501032_0269207_651_1034 | 126 |
| 387 | 3300049570 | Ga0501033_0030976 | Ga0501033_0030976_3414_3794 | 126 |
| 388 | 3300049570 | Ga0501033_0031252 | Ga0501033_0031252_985_1383 | 126 |
| 389 | 3300049571 | Ga0501034_0001885 | Ga0501034_0001885_18226_18609 | 126 |
| 390 | 3300049571 | Ga0501034_0063624 | Ga0501034_0063624_3070_3453 | 126 |
| 391 | 3300049572 | Ga0501036_0022094 | Ga0501036_0022094_1131_1514 | 126 |
| 392 | 3300049572 | Ga0501036_0590314 | Ga0501036_0590314_71_466 | 126 |
| 393 | 3300049573 | Ga0501037_0015196 | Ga0501037_0015196_4310_4693 | 126 |
| 394 | 3300049573 | Ga0501037_0083255 | Ga0501037_0083255_656_1036 | 126 |
| 395 | 3300049573 | Ga0501037_0206922 | Ga0501037_0206922_209_607 | 126 |
| 396 | 3300049574 | Ga0501038_0005734 | Ga0501038_0005734_4704_5087 | 126 |
| 397 | 3300049574 | Ga0501038_0531747 | Ga0501038_0531747_257_652 | 126 |
| 398 | 3300049575 | Ga0501039_0477958 | Ga0501039_0477958_50_433 | 126 |
| 399 | 3300049575 | Ga0501039_1302835 | Ga0501039_1302835_18_401 | 126 |
| 400 | 3300049576 | Ga0501040_0688167 | Ga0501040_0688167_105_488 | 126 |
| 401 | 3300049578 | Ga0501042_0030584 | Ga0501042_0030584_1717_2100 | 126 |
| 402 | 3300049579 | Ga0501043_0153798 | Ga0501043_0153798_635_1018 | 126 |
| 403 | 3300049579 | Ga0501043_0201910 | Ga0501043_0201910_315_695 | 126 |
| 404 | 3300049579 | Ga0501043_0441777 | Ga0501043_0441777_82_465 | 126 |
| 405 | 3300049580 | Ga0501046_0008695 | Ga0501046_0008695_8236_8619 | 126 |
| 406 | 3300049580 | Ga0501046_0053148 | Ga0501046_0053148_1352_1732 | 126 |
| 407 | 3300049580 | Ga0501046_0453446 | Ga0501046_0453446_47_433 | 126 |
| 408 | 3300049580 | Ga0501046_0894298 | Ga0501046_0894298_92_487 | 126 |
| 409 | 3300049581 | Ga0501047_0012566 | Ga0501047_0012566_5349_5729 | 126 |
| 410 | 3300049581 | Ga0501047_0013767 | Ga0501047_0013767_2271_2669 | 126 |
| 411 | 3300049581 | Ga0501047_0015474 | Ga0501047_0015474_6312_6695 | 126 |
| 412 | 3300049581 | Ga0501047_0186059 | Ga0501047_0186059_617_1012 | 126 |
| 413 | 3300049582 | Ga0501048_0005128 | Ga0501048_0005128_6563_6946 | 126 |
| 414 | 3300049582 | Ga0501048_0050571 | Ga0501048_0050571_1059_1442 | 126 |
| 415 | 3300049582 | Ga0501048_1069953 | Ga0501048_1069953_158_538 | 126 |
| 416 | 3300049583 | Ga0501067_0073927 | Ga0501067_0073927_1381_1764 | 126 |
| 417 | 3300049584 | Ga0501068_0055183 | Ga0501068_0055183_162_545 | 126 |
| 418 | 3300049584 | Ga0501068_0229085 | Ga0501068_0229085_533_913 | 126 |
| 419 | 3300049586 | Ga0501070_0023231 | Ga0501070_0023231_1120_1503 | 126 |
| 420 | 3300049586 | Ga0501070_1083924 | Ga0501070_1083924_58_441 | 126 |
| 421 | 3300049589 | Ga0501073_0000591 | Ga0501073_0000591_23941_24324 | 126 |
| 422 | 3300049590 | Ga0501074_0151359 | Ga0501074_0151359_141_524 | 126 |
| 423 | 3300049590 | Ga0501074_0851853 | Ga0501074_0851853_80_463 | 126 |
| 424 | 3300049741 | Ga0501079_0007012 | Ga0501079_0007012_93_476 | 126 |
| 425 | 3300049742 | Ga0501080_0022421 | Ga0501080_0022421_1020_1406 | 126 |
| 426 | 3300049742 | Ga0501080_0228160 | Ga0501080_0228160_1290_1673 | 126 |
| 427 | 3300049742 | Ga0501080_0243284 | Ga0501080_0243284_961_1356 | 126 |
| 428 | 3300049743 | Ga0501081_0108911 | Ga0501081_0108911_368_760 | 126 |
| 429 | 3300049744 | Ga0501083_0187173 | Ga0501083_0187173_552_935 | 126 |
| 430 | 3300049744 | Ga0501083_0302853 | Ga0501083_0302853_586_978 | 126 |
| 431 | 3300049822 | Ga0501035_0029713 | Ga0501035_0029713_4011_4409 | 126 |
| 432 | 3300049822 | Ga0501035_0037128 | Ga0501035_0037128_782_1165 | 126 |
| 433 | 3300049822 | Ga0501035_0046055 | Ga0501035_0046055_1726_2106 | 126 |
| 434 | 3300049822 | Ga0501035_0259818 | Ga0501035_0259818_752_1147 | 126 |
| 435 | 3300049822 | Ga0501035_0528879 | Ga0501035_0528879_524_922 | 126 |
| 436 | 3300049822 | Ga0501035_0936617 | Ga0501035_0936617_173_556 | 126 |
| 437 | 3300049823 | Ga0501044_0001938 | Ga0501044_0001938_12319_12699 | 126 |
| 438 | 3300049823 | Ga0501044_0014944 | Ga0501044_0014944_4713_5111 | 126 |
| 439 | 3300049823 | Ga0501044_0025516 | Ga0501044_0025516_4692_5075 | 126 |
| 440 | 3300049823 | Ga0501044_0072205 | Ga0501044_0072205_819_1214 | 126 |
| 441 | 3300049823 | Ga0501044_0138616 | Ga0501044_0138616_977_1375 | 126 |
| 442 | 3300049823 | Ga0501044_0432555 | Ga0501044_0432555_823_1206 | 126 |
| 443 | 3300049823 | Ga0501044_0899537 | Ga0501044_0899537_338_721 | 126 |
| 444 | 3300049823 | Ga0501044_1112392 | Ga0501044_1112392_81_479 | 126 |
| 445 | 3300049824 | Ga0501045_0427038 | Ga0501045_0427038_214_597 | 126 |
| 446 | 3300049824 | Ga0501045_0850001 | Ga0501045_0850001_58_438 | 126 |
| 447 | 3300053080 | Ga0500635_0102338 | Ga0500635_0102338_569_949 | 126 |
| 448 | 3300053096 | Ga0500641_0010391 | Ga0500641_0010391_1455_1835 | 126 |
| 449 | 3300053118 | Ga0500594_0060504 | Ga0500594_0060504_342_722 | 126 |
| 450 | 3300053119 | Ga0500595_006042 | Ga0500595_006042_1472_1852 | 126 |
| 451 | 3300053133 | Ga0500655_127362 | Ga0500655_127362_43_429 | 126 |
| 452 | 3300053136 | Ga0500559_0035318 | Ga0500559_0035318_1673_2068 | 126 |
| 453 | 3300053140 | Ga0500573_0000008 | Ga0500573_0000008_229617_230000 | 126 |
| 454 | 3300053151 | Ga0500604_0106236 | Ga0500604_0106236_328_708 | 126 |
| 455 | 3300053163 | Ga0500639_018148 | Ga0500639_018148_1452_1832 | 126 |
| 456 | 3300054114 | Ga0501084_0006291 | Ga0501084_0006291_1135_1518 | 126 |
| 457 | 3300054114 | Ga0501084_1481446 | Ga0501084_1481446_24_404 | 126 |
| 458 | 3300060353 | Ga0501082_0314265 | Ga0501082_0314265_914_1294 | 126 |
| 459 | 3300060353 | Ga0501082_0912024 | Ga0501082_0912024_141_524 | 126 |
| 460 | 3300003214 | JGI25165J46597_1000036 | JGI25165J46597_100003630 | 127 |
| 461 | 3300005327 | Ga0070658_10102858 | Ga0070658_101028582 | 127 |
| 462 | 3300005334 | Ga0068869_100547244 | Ga0068869_1005472441 | 127 |
| 463 | 3300005336 | Ga0070680_100072469 | Ga0070680_1000724694 | 127 |
| 464 | 3300005337 | Ga0070682_100250601 | Ga0070682_1002506012 | 127 |
| 465 | 3300005339 | Ga0070660_100260202 | Ga0070660_1002602021 | 127 |
| 466 | 3300005339 | Ga0070660_101397091 | Ga0070660_1013970911 | 127 |
| 467 | 3300005341 | Ga0070691_10001038 | Ga0070691_100010385 | 127 |
| 468 | 3300005341 | Ga0070691_10037486 | Ga0070691_100374864 | 127 |
| 469 | 3300005344 | Ga0070661_100975057 | Ga0070661_1009750571 | 127 |
| 470 | 3300005434 | Ga0070709_10001050 | Ga0070709_100010504 | 127 |
| 471 | 3300005434 | Ga0070709_10035060 | Ga0070709_100350603 | 127 |
| 472 | 3300005435 | Ga0070714_100047577 | Ga0070714_1000475773 | 127 |
| 473 | 3300005435 | Ga0070714_101451768 | Ga0070714_1014517682 | 127 |
| 474 | 3300005436 | Ga0070713_100000004 | Ga0070713_100000004174 | 127 |
| 475 | 3300005436 | Ga0070713_100269457 | Ga0070713_1002694572 | 127 |
| 476 | 3300005439 | Ga0070711_100004994 | Ga0070711_1000049949 | 127 |
| 477 | 3300005444 | Ga0070694_100508823 | Ga0070694_1005088232 | 127 |
| 478 | 3300005455 | Ga0070663_101435082 | Ga0070663_1014350821 | 127 |
| 479 | 3300005455 | Ga0070663_101998640 | Ga0070663_1019986401 | 127 |
| 480 | 3300005456 | Ga0070678_100003363 | Ga0070678_1000033635 | 127 |
| 481 | 3300005456 | Ga0070678_100222930 | Ga0070678_1002229302 | 127 |
| 482 | 3300005458 | Ga0070681_10197855 | Ga0070681_101978553 | 127 |
| 483 | 3300005458 | Ga0070681_11176577 | Ga0070681_111765771 | 127 |
| 484 | 3300005459 | Ga0068867_100008753 | Ga0068867_1000087533 | 127 |
| 485 | 3300005530 | Ga0070679_100179253 | Ga0070679_1001792533 | 127 |
| 486 | 3300005530 | Ga0070679_100273622 | Ga0070679_1002736222 | 127 |
| 487 | 3300005535 | Ga0070684_100414432 | Ga0070684_1004144321 | 127 |
| 488 | 3300005539 | Ga0068853_100037181 | Ga0068853_1000371812 | 127 |
| 489 | 3300005539 | Ga0068853_100204305 | Ga0068853_1002043051 | 127 |
| 490 | 3300005545 | Ga0070695_100291022 | Ga0070695_1002910222 | 127 |
| 491 | 3300005547 | Ga0070693_100291274 | Ga0070693_1002912741 | 127 |
| 492 | 3300005547 | Ga0070693_100496561 | Ga0070693_1004965611 | 127 |
| 493 | 3300005548 | Ga0070665_100758309 | Ga0070665_1007583092 | 127 |
| 494 | 3300005563 | Ga0068855_100014305 | Ga0068855_10001430512 | 127 |
| 495 | 3300005564 | Ga0070664_100113906 | Ga0070664_1001139062 | 127 |
| 496 | 3300005577 | Ga0068857_100000944 | Ga0068857_1000009442 | 127 |
| 497 | 3300005578 | Ga0068854_100921864 | Ga0068854_1009218642 | 127 |
| 498 | 3300005614 | Ga0068856_100000144 | Ga0068856_10000014434 | 127 |
| 499 | 3300005614 | Ga0068856_100008455 | Ga0068856_1000084554 | 127 |
| 500 | 3300005616 | Ga0068852_100005341 | Ga0068852_1000053415 | 127 |
| 501 | 3300005618 | Ga0068864_101944153 | Ga0068864_1019441531 | 127 |
| 502 | 3300005618 | Ga0068864_102555927 | Ga0068864_1025559272 | 127 |
| 503 | 3300005842 | Ga0068858_100398009 | Ga0068858_1003980093 | 127 |
| 504 | 3300005842 | Ga0068858_100578048 | Ga0068858_1005780482 | 127 |
| 505 | 3300006173 | Ga0070716_100004517 | Ga0070716_1000045177 | 127 |
| 506 | 3300006175 | Ga0070712_100000293 | Ga0070712_1000002938 | 127 |
| 507 | 3300006175 | Ga0070712_100000567 | Ga0070712_10000056711 | 127 |
| 508 | 3300006237 | Ga0097621_100031007 | Ga0097621_1000310075 | 127 |
| 509 | 3300006353 | Ga0075370_10946794 | Ga0075370_109467941 | 127 |
| 510 | 3300006358 | Ga0068871_100002461 | Ga0068871_1000024615 | 127 |
| 511 | 3300006358 | Ga0068871_100047905 | Ga0068871_1000479055 | 127 |
| 512 | 3300006358 | Ga0068871_100778371 | Ga0068871_1007783712 | 127 |
| 513 | 3300006871 | Ga0075434_100068597 | Ga0075434_1000685971 | 127 |
| 514 | 3300006881 | Ga0068865_100003070 | Ga0068865_1000030706 | 127 |
| 515 | 3300006881 | Ga0068865_100268072 | Ga0068865_1002680722 | 127 |
| 516 | 3300006881 | Ga0068865_102125099 | Ga0068865_1021250991 | 127 |
| 517 | 3300006914 | Ga0075436_100000574 | Ga0075436_10000057416 | 127 |
| 518 | 3300009093 | Ga0105240_10006228 | Ga0105240_100062286 | 127 |
| 519 | 3300009093 | Ga0105240_10013961 | Ga0105240_100139615 | 127 |
| 520 | 3300009093 | Ga0105240_10027753 | Ga0105240_100277536 | 127 |
| 521 | 3300009093 | Ga0105240_10059899 | Ga0105240_100598997 | 127 |
| 522 | 3300009098 | Ga0105245_10123480 | Ga0105245_101234803 | 127 |
| 523 | 3300009098 | Ga0105245_10457093 | Ga0105245_104570933 | 127 |
| 524 | 3300009148 | Ga0105243_10377019 | Ga0105243_103770193 | 127 |
| 525 | 3300009174 | Ga0105241_10001171 | Ga0105241_1000117119 | 127 |
| 526 | 3300009174 | Ga0105241_10034332 | Ga0105241_100343323 | 127 |
| 527 | 3300009174 | Ga0105241_10139417 | Ga0105241_101394173 | 127 |
| 528 | 3300009174 | Ga0105241_12082036 | Ga0105241_120820361 | 127 |
| 529 | 3300009176 | Ga0105242_10040101 | Ga0105242_100401014 | 127 |
| 530 | 3300009177 | Ga0105248_10000005 | Ga0105248_10000005534 | 127 |
| 531 | 3300009177 | Ga0105248_10148288 | Ga0105248_101482883 | 127 |
| 532 | 3300009545 | Ga0105237_10016366 | Ga0105237_100163664 | 127 |
| 533 | 3300009545 | Ga0105237_10017309 | Ga0105237_100173095 | 127 |
| 534 | 3300009545 | Ga0105237_10116422 | Ga0105237_101164222 | 127 |
| 535 | 3300009545 | Ga0105237_10581763 | Ga0105237_105817633 | 127 |
| 536 | 3300009551 | Ga0105238_10000847 | Ga0105238_1000084717 | 127 |
| 537 | 3300009551 | Ga0105238_10006764 | Ga0105238_100067647 | 127 |
| 538 | 3300009551 | Ga0105238_10077477 | Ga0105238_100774775 | 127 |
| 539 | 3300009553 | Ga0105249_12674259 | Ga0105249_126742591 | 127 |
| 540 | 3300010375 | Ga0105239_10026010 | Ga0105239_100260103 | 127 |
| 541 | 3300010375 | Ga0105239_12377441 | Ga0105239_123774412 | 127 |
| 542 | 3300010375 | Ga0105239_13452461 | Ga0105239_134524612 | 127 |
| 543 | 3300011119 | Ga0105246_10020517 | Ga0105246_100205174 | 127 |
| 544 | 3300013100 | Ga0157373_10001245 | Ga0157373_1000124516 | 127 |
| 545 | 3300013100 | Ga0157373_10425485 | Ga0157373_104254852 | 127 |
| 546 | 3300013100 | Ga0157373_10441226 | Ga0157373_104412262 | 127 |
| 547 | 3300013100 | Ga0157373_11313114 | Ga0157373_113131141 | 127 |
| 548 | 3300013104 | Ga0157370_10124379 | Ga0157370_101243794 | 127 |
| 549 | 3300013104 | Ga0157370_10151238 | Ga0157370_101512383 | 127 |
| 550 | 3300013105 | Ga0157369_10010560 | Ga0157369_100105607 | 127 |
| 551 | 3300013105 | Ga0157369_10258050 | Ga0157369_102580502 | 127 |
| 552 | 3300013296 | Ga0157374_10017187 | Ga0157374_100171871 | 127 |
| 553 | 3300013296 | Ga0157374_10201534 | Ga0157374_102015344 | 127 |
| 554 | 3300013296 | Ga0157374_10547475 | Ga0157374_105474752 | 127 |
| 555 | 3300013297 | Ga0157378_10115124 | Ga0157378_101151243 | 127 |
| 556 | 3300013297 | Ga0157378_10274718 | Ga0157378_102747182 | 127 |
| 557 | 3300013306 | Ga0163162_10018224 | Ga0163162_100182244 | 127 |
| 558 | 3300013306 | Ga0163162_10419140 | Ga0163162_104191401 | 127 |
| 559 | 3300013306 | Ga0163162_11348922 | Ga0163162_113489222 | 127 |
| 560 | 3300013307 | Ga0157372_10027681 | Ga0157372_100276816 | 127 |
| 561 | 3300013307 | Ga0157372_10079972 | Ga0157372_100799724 | 127 |
| 562 | 3300013308 | Ga0157375_10060295 | Ga0157375_100602953 | 127 |
| 563 | 3300014325 | Ga0163163_10000749 | Ga0163163_1000074912 | 127 |
| 564 | 3300014325 | Ga0163163_10363567 | Ga0163163_103635672 | 127 |
| 565 | 3300014497 | Ga0182008_10071439 | Ga0182008_100714394 | 127 |
| 566 | 3300014968 | Ga0157379_10013204 | Ga0157379_100132043 | 127 |
| 567 | 3300014968 | Ga0157379_10066395 | Ga0157379_100663953 | 127 |
| 568 | 3300014969 | Ga0157376_10007605 | Ga0157376_100076056 | 127 |
| 569 | 3300014969 | Ga0157376_10590660 | Ga0157376_105906602 | 127 |
| 570 | 3300015262 | Ga0182007_10032755 | Ga0182007_100327552 | 127 |
| 571 | 3300017792 | Ga0163161_10003667 | Ga0163161_100036676 | 127 |
| 572 | 3300020082 | Ga0206353_11572703 | Ga0206353_115727032 | 127 |
| 573 | 3300022467 | Ga0224712_10050003 | Ga0224712_100500033 | 127 |
| 574 | 3300025231 | Ga0207427_125719 | Ga0207427_1257192 | 127 |
| 575 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015808 | 127 |
| 576 | 3300025261 | Ga0209233_1002328 | Ga0209233_10023288 | 127 |
| 577 | 3300025893 | Ga0207682_10456249 | Ga0207682_104562491 | 127 |
| 578 | 3300025901 | Ga0207688_10021217 | Ga0207688_100212172 | 127 |
| 579 | 3300025906 | Ga0207699_10011324 | Ga0207699_100113243 | 127 |
| 580 | 3300025909 | Ga0207705_10000391 | Ga0207705_100003919 | 127 |
| 581 | 3300025911 | Ga0207654_10008441 | Ga0207654_100084414 | 127 |
| 582 | 3300025911 | Ga0207654_10258215 | Ga0207654_102582152 | 127 |
| 583 | 3300025911 | Ga0207654_10813977 | Ga0207654_108139771 | 127 |
| 584 | 3300025912 | Ga0207707_10054666 | Ga0207707_100546663 | 127 |
| 585 | 3300025912 | Ga0207707_10268445 | Ga0207707_102684451 | 127 |
| 586 | 3300025913 | Ga0207695_10032634 | Ga0207695_100326344 | 127 |
| 587 | 3300025913 | Ga0207695_10035110 | Ga0207695_100351105 | 127 |
| 588 | 3300025914 | Ga0207671_10015697 | Ga0207671_100156972 | 127 |
| 589 | 3300025914 | Ga0207671_10115634 | Ga0207671_101156344 | 127 |
| 590 | 3300025915 | Ga0207693_10000163 | Ga0207693_100001639 | 127 |
| 591 | 3300025915 | Ga0207693_10001708 | Ga0207693_100017085 | 127 |
| 592 | 3300025916 | Ga0207663_10304756 | Ga0207663_103047562 | 127 |
| 593 | 3300025917 | Ga0207660_10073518 | Ga0207660_100735181 | 127 |
| 594 | 3300025917 | Ga0207660_10173152 | Ga0207660_101731522 | 127 |
| 595 | 3300025919 | Ga0207657_10011605 | Ga0207657_1001160512 | 127 |
| 596 | 3300025919 | Ga0207657_10087811 | Ga0207657_100878113 | 127 |
| 597 | 3300025920 | Ga0207649_10681171 | Ga0207649_106811712 | 127 |
| 598 | 3300025920 | Ga0207649_10780515 | Ga0207649_107805152 | 127 |
| 599 | 3300025921 | Ga0207652_10024819 | Ga0207652_100248191 | 127 |
| 600 | 3300025921 | Ga0207652_10081972 | Ga0207652_100819724 | 127 |
| 601 | 3300025924 | Ga0207694_11105735 | Ga0207694_111057352 | 127 |
| 602 | 3300025926 | Ga0207659_11256989 | Ga0207659_112569891 | 127 |
| 603 | 3300025927 | Ga0207687_10075870 | Ga0207687_100758703 | 127 |
| 604 | 3300025928 | Ga0207700_10000011 | Ga0207700_10000011133 | 127 |
| 605 | 3300025928 | Ga0207700_10239471 | Ga0207700_102394712 | 127 |
| 606 | 3300025929 | Ga0207664_10168344 | Ga0207664_101683444 | 127 |
| 607 | 3300025931 | Ga0207644_10281339 | Ga0207644_102813393 | 127 |
| 608 | 3300025932 | Ga0207690_10615486 | Ga0207690_106154862 | 127 |
| 609 | 3300025934 | Ga0207686_10017234 | Ga0207686_100172343 | 127 |
| 610 | 3300025934 | Ga0207686_10531157 | Ga0207686_105311572 | 127 |
| 611 | 3300025938 | Ga0207704_10002288 | Ga0207704_100022885 | 127 |
| 612 | 3300025938 | Ga0207704_10154288 | Ga0207704_101542884 | 127 |
| 613 | 3300025938 | Ga0207704_10354204 | Ga0207704_103542041 | 127 |
| 614 | 3300025939 | Ga0207665_10105393 | Ga0207665_101053932 | 127 |
| 615 | 3300025940 | Ga0207691_10476763 | Ga0207691_104767632 | 127 |
| 616 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002531 | 127 |
| 617 | 3300025941 | Ga0207711_10687653 | Ga0207711_106876532 | 127 |
| 618 | 3300025945 | Ga0207679_10120435 | Ga0207679_101204353 | 127 |
| 619 | 3300025949 | Ga0207667_10011191 | Ga0207667_100111916 | 127 |
| 620 | 3300025949 | Ga0207667_10914069 | Ga0207667_109140692 | 127 |
| 621 | 3300025960 | Ga0207651_10420047 | Ga0207651_104200472 | 127 |
| 622 | 3300025981 | Ga0207640_10880833 | Ga0207640_108808332 | 127 |
| 623 | 3300026023 | Ga0207677_10100309 | Ga0207677_101003092 | 127 |
| 624 | 3300026035 | Ga0207703_10435695 | Ga0207703_104356952 | 127 |
| 625 | 3300026041 | Ga0207639_10034281 | Ga0207639_100342814 | 127 |
| 626 | 3300026041 | Ga0207639_10039639 | Ga0207639_100396394 | 127 |
| 627 | 3300026067 | Ga0207678_11305186 | Ga0207678_113051861 | 127 |
| 628 | 3300026078 | Ga0207702_10000226 | Ga0207702_1000022626 | 127 |
| 629 | 3300026078 | Ga0207702_10008271 | Ga0207702_100082717 | 127 |
| 630 | 3300026088 | Ga0207641_10806212 | Ga0207641_108062121 | 127 |
| 631 | 3300026089 | Ga0207648_10003109 | Ga0207648_100031097 | 127 |
| 632 | 3300026089 | Ga0207648_10118436 | Ga0207648_101184364 | 127 |
| 633 | 3300026095 | Ga0207676_10553043 | Ga0207676_105530432 | 127 |
| 634 | 3300026116 | Ga0207674_10000261 | Ga0207674_1000026151 | 127 |
| 635 | 3300026121 | Ga0207683_10012952 | Ga0207683_100129522 | 127 |
| 636 | 3300026121 | Ga0207683_10030570 | Ga0207683_100305702 | 127 |
| 637 | 3300026142 | Ga0207698_10161414 | Ga0207698_101614143 | 127 |
| 638 | 3300026142 | Ga0207698_10262598 | Ga0207698_102625982 | 127 |
| 639 | 3300028573 | Ga0265334_10019977 | Ga0265334_100199774 | 127 |
| 640 | 3300028573 | Ga0265334_10111438 | Ga0265334_101114381 | 127 |
| 641 | 3300028577 | Ga0265318_10000104 | Ga0265318_1000010466 | 127 |
| 642 | 3300028577 | Ga0265318_10001589 | Ga0265318_100015895 | 127 |
| 643 | 3300028800 | Ga0265338_10000005 | Ga0265338_10000005364 | 127 |
| 644 | 3300031235 | Ga0265330_10283295 | Ga0265330_102832952 | 127 |
| 645 | 3300031238 | Ga0265332_10048019 | Ga0265332_100480192 | 127 |
| 646 | 3300031239 | Ga0265328_10120050 | Ga0265328_101200503 | 127 |
| 647 | 3300031239 | Ga0265328_10188597 | Ga0265328_101885972 | 127 |
| 648 | 3300031241 | Ga0265325_10000005 | Ga0265325_10000005153 | 127 |
| 649 | 3300031241 | Ga0265325_10000098 | Ga0265325_1000009819 | 127 |
| 650 | 3300031242 | Ga0265329_10017187 | Ga0265329_100171872 | 127 |
| 651 | 3300031247 | Ga0265340_10192219 | Ga0265340_101922192 | 127 |
| 652 | 3300031247 | Ga0265340_10408146 | Ga0265340_104081461 | 127 |
| 653 | 3300031249 | Ga0265339_10002598 | Ga0265339_100025989 | 127 |
| 654 | 3300031249 | Ga0265339_10010635 | Ga0265339_100106353 | 127 |
| 655 | 3300031249 | Ga0265339_10078354 | Ga0265339_100783544 | 127 |
| 656 | 3300031250 | Ga0265331_10011578 | Ga0265331_100115785 | 127 |
| 657 | 3300031250 | Ga0265331_10044112 | Ga0265331_100441122 | 127 |
| 658 | 3300031251 | Ga0265327_10000187 | Ga0265327_1000018759 | 127 |
| 659 | 3300031344 | Ga0265316_10023813 | Ga0265316_100238132 | 127 |
| 660 | 3300031344 | Ga0265316_10131928 | Ga0265316_101319282 | 127 |
| 661 | 3300031344 | Ga0265316_10338785 | Ga0265316_103387852 | 127 |
| 662 | 3300031595 | Ga0265313_10003640 | Ga0265313_100036405 | 127 |
| 663 | 3300031595 | Ga0265313_10003817 | Ga0265313_100038175 | 127 |
| 664 | 3300031595 | Ga0265313_10021395 | Ga0265313_100213956 | 127 |
| 665 | 3300031595 | Ga0265313_10060125 | Ga0265313_100601252 | 127 |
| 666 | 3300031711 | Ga0265314_10000835 | Ga0265314_1000083519 | 127 |
| 667 | 3300031711 | Ga0265314_10040827 | Ga0265314_100408276 | 127 |
| 668 | 3300031711 | Ga0265314_10469287 | Ga0265314_104692871 | 127 |
| 669 | 3300031712 | Ga0265342_10057095 | Ga0265342_100570954 | 127 |
| 670 | 3300031712 | Ga0265342_10090739 | Ga0265342_100907393 | 127 |
| 671 | 3300031712 | Ga0265342_10350710 | Ga0265342_103507101 | 127 |
| 672 | 3300031712 | Ga0265342_10352258 | Ga0265342_103522582 | 127 |
| 673 | 3300035111 | Ga0373923_0109988 | Ga0373923_0109988_443_835 | 127 |
| 674 | 3300035112 | Ga0373932_0202524 | Ga0373932_0202524_43_435 | 127 |
| 675 | 3300035120 | Ga0373957_0165100 | Ga0373957_0165100_511_903 | 127 |
| 676 | 3300035120 | Ga0373957_0308564 | Ga0373957_0308564_55_444 | 127 |
| 677 | 3300035172 | Ga0373955_0132113 | Ga0373955_0132113_371_763 | 127 |
| 678 | 3300035172 | Ga0373955_0333394 | Ga0373955_0333394_107_499 | 127 |
| 679 | 3300035692 | Ga0373935_0669881 | Ga0373935_0669881_169_561 | 127 |
| 680 | 3300035695 | Ga0373927_0321531 | Ga0373927_0321531_195_587 | 127 |
| 681 | 3300035724 | Ga0373933_0032349 | Ga0373933_0032349_2058_2450 | 127 |
| 682 | 3300036401 | Ga0373937_0004668 | Ga0373937_0004668_4605_4997 | 127 |
| 683 | 3300036401 | Ga0373937_0162549 | Ga0373937_0162549_1370_1762 | 127 |
| 684 | 3300036401 | Ga0373937_0492173 | Ga0373937_0492173_168_572 | 127 |
| 685 | 3300036401 | Ga0373937_0642063 | Ga0373937_0642063_81_470 | 127 |
| 686 | 3300037068 | Ga0373925_0068645 | Ga0373925_0068645_1065_1457 | 127 |
| 687 | 3300037068 | Ga0373925_0817886 | Ga0373925_0817886_34_426 | 127 |
| 688 | 3300037418 | Ga0395900_1264769 | Ga0395900_1264769_105_503 | 127 |
| 689 | 3300037466 | Ga0395898_0079034 | Ga0395898_0079034_2394_2792 | 127 |
| 690 | 3300038443 | Ga0395901_0227683 | Ga0395901_0227683_1184_1582 | 127 |
| 691 | 3300039437 | Ga0436365_0495986 | Ga0436365_0495986_45186_45620 | 127 |
| 692 | 3300039437 | Ga0436365_0906980 | Ga0436365_0906980_1096_1503 | 127 |
| 693 | 3300039437 | Ga0436365_1052743 | Ga0436365_1052743_33_422 | 127 |
| 694 | 3300039450 | Ga0436363_1061920 | Ga0436363_1061920_261_656 | 127 |
| 695 | 3300039453 | Ga0436362_1209966 | Ga0436362_1209966_245_652 | 127 |
| 696 | 3300041496 | Ga0451839_1546439 | Ga0451839_1546439_12_401 | 127 |
| 697 | 3300041512 | Ga0451853_0937228 | Ga0451853_0937228_178_561 | 127 |
| 698 | 3300044842 | Ga0466957_0096925 | Ga0466957_0096925_877_1260 | 127 |
| 699 | 3300046462 | Ga0495651_0323469 | Ga0495651_0323469_435_824 | 127 |
| 700 | 3300046535 | Ga0495586_0227444 | Ga0495586_0227444_649_1038 | 127 |
| 701 | 3300046536 | Ga0495587_0414874 | Ga0495587_0414874_76_468 | 127 |
| 702 | 3300046660 | Ga0495625_0269624 | Ga0495625_0269624_271_654 | 127 |
| 703 | 3300046680 | Ga0495646_0575361 | Ga0495646_0575361_148_546 | 127 |
| 704 | 3300046689 | Ga0495613_0729317 | Ga0495613_0729317_175_558 | 127 |
| 705 | 3300046809 | Ga0495600_0610153 | Ga0495600_0610153_183_587 | 127 |
| 706 | 3300047321 | Ga0495676_0394025 | Ga0495676_0394025_357_752 | 127 |
| 707 | 3300047444 | Ga0495675_0430237 | Ga0495675_0430237_109_501 | 127 |
| 708 | 3300047471 | Ga0495684_0322563 | Ga0495684_0322563_692_1087 | 127 |
| 709 | 3300048088 | Ga0495602_0048635 | Ga0495602_0048635_996_1388 | 127 |
| 710 | 3300048088 | Ga0495602_0171887 | Ga0495602_0171887_575_979 | 127 |
| 711 | 3300048909 | Ga0496106_1136727 | Ga0496106_1136727_144_536 | 127 |
| 712 | 3300048911 | Ga0496108_0880785 | Ga0496108_0880785_69_461 | 127 |
| 713 | 3300048914 | Ga0496111_0644297 | Ga0496111_0644297_351_743 | 127 |
| 714 | 3300048929 | Ga0496126_0000498 | Ga0496126_0000498_35909_36304 | 127 |
| 715 | 3300048929 | Ga0496126_0053473 | Ga0496126_0053473_2920_3303 | 127 |
| 716 | 3300049568 | Ga0501031_0622085 | Ga0501031_0622085_207_596 | 127 |
| 717 | 3300049569 | Ga0501032_0116827 | Ga0501032_0116827_36_425 | 127 |
| 718 | 3300049569 | Ga0501032_0156000 | Ga0501032_0156000_950_1339 | 127 |
| 719 | 3300049570 | Ga0501033_0020678 | Ga0501033_0020678_3514_3900 | 127 |
| 720 | 3300049570 | Ga0501033_0024643 | Ga0501033_0024643_3832_4221 | 127 |
| 721 | 3300049570 | Ga0501033_0134629 | Ga0501033_0134629_73_474 | 127 |
| 722 | 3300049570 | Ga0501033_0182168 | Ga0501033_0182168_40_441 | 127 |
| 723 | 3300049570 | Ga0501033_0750930 | Ga0501033_0750930_64_468 | 127 |
| 724 | 3300049571 | Ga0501034_0016559 | Ga0501034_0016559_753_1142 | 127 |
| 725 | 3300049571 | Ga0501034_0125059 | Ga0501034_0125059_100_486 | 127 |
| 726 | 3300049572 | Ga0501036_0066074 | Ga0501036_0066074_960_1349 | 127 |
| 727 | 3300049572 | Ga0501036_0644289 | Ga0501036_0644289_10_399 | 127 |
| 728 | 3300049573 | Ga0501037_0096500 | Ga0501037_0096500_1378_1767 | 127 |
| 729 | 3300049573 | Ga0501037_0725636 | Ga0501037_0725636_246_635 | 127 |
| 730 | 3300049574 | Ga0501038_0112540 | Ga0501038_0112540_46_435 | 127 |
| 731 | 3300049578 | Ga0501042_0239301 | Ga0501042_0239301_725_1114 | 127 |
| 732 | 3300049579 | Ga0501043_0088740 | Ga0501043_0088740_317_706 | 127 |
| 733 | 3300049579 | Ga0501043_0179083 | Ga0501043_0179083_981_1382 | 127 |
| 734 | 3300049579 | Ga0501043_0353577 | Ga0501043_0353577_290_679 | 127 |
| 735 | 3300049580 | Ga0501046_0188205 | Ga0501046_0188205_1039_1428 | 127 |
| 736 | 3300049580 | Ga0501046_1174943 | Ga0501046_1174943_123_512 | 127 |
| 737 | 3300049581 | Ga0501047_0013897 | Ga0501047_0013897_3317_3706 | 127 |
| 738 | 3300049581 | Ga0501047_0119204 | Ga0501047_0119204_1702_2091 | 127 |
| 739 | 3300049581 | Ga0501047_0244246 | Ga0501047_0244246_1176_1580 | 127 |
| 740 | 3300049585 | Ga0501069_0005058 | Ga0501069_0005058_4953_5342 | 127 |
| 741 | 3300049585 | Ga0501069_0227791 | Ga0501069_0227791_52_441 | 127 |
| 742 | 3300049586 | Ga0501070_0000002 | Ga0501070_0000002_238273_238662 | 127 |
| 743 | 3300049586 | Ga0501070_0224089 | Ga0501070_0224089_865_1254 | 127 |
| 744 | 3300049586 | Ga0501070_0696583 | Ga0501070_0696583_115_519 | 127 |
| 745 | 3300049586 | Ga0501070_0840399 | Ga0501070_0840399_12_401 | 127 |
| 746 | 3300049587 | Ga0501071_0074730 | Ga0501071_0074730_1058_1447 | 127 |
| 747 | 3300049589 | Ga0501073_0056012 | Ga0501073_0056012_1604_1993 | 127 |
| 748 | 3300049589 | Ga0501073_0715772 | Ga0501073_0715772_225_614 | 127 |
| 749 | 3300049590 | Ga0501074_0948069 | Ga0501074_0948069_46_435 | 127 |
| 750 | 3300049741 | Ga0501079_0009069 | Ga0501079_0009069_6392_6781 | 127 |
| 751 | 3300049742 | Ga0501080_0019069 | Ga0501080_0019069_4880_5269 | 127 |
| 752 | 3300049742 | Ga0501080_0114163 | Ga0501080_0114163_2060_2461 | 127 |
| 753 | 3300049742 | Ga0501080_0146898 | Ga0501080_0146898_1025_1414 | 127 |
| 754 | 3300049744 | Ga0501083_0472986 | Ga0501083_0472986_124_513 | 127 |
| 755 | 3300049744 | Ga0501083_0560191 | Ga0501083_0560191_212_601 | 127 |
| 756 | 3300049822 | Ga0501035_0190858 | Ga0501035_0190858_333_722 | 127 |
| 757 | 3300049822 | Ga0501035_0338384 | Ga0501035_0338384_764_1168 | 127 |
| 758 | 3300049822 | Ga0501035_0684787 | Ga0501035_0684787_44_445 | 127 |
| 759 | 3300049822 | Ga0501035_0959340 | Ga0501035_0959340_203_586 | 127 |
| 760 | 3300049823 | Ga0501044_0000378 | Ga0501044_0000378_226_621 | 127 |
| 761 | 3300049823 | Ga0501044_0029793 | Ga0501044_0029793_680_1069 | 127 |
| 762 | 3300049823 | Ga0501044_0354356 | Ga0501044_0354356_489_890 | 127 |
| 763 | 3300050512 | nmdc:mga0n895_99325_c1 | nmdc:mga0n895_99325_c1_34_426 | 127 |
| 764 | 3300050513 | nmdc:mga0rr50_986899_c1 | nmdc:mga0rr50_986899_c1_70_462 | 127 |
| 765 | 3300050514 | nmdc:mga08x19_129_c1 | nmdc:mga08x19_129_c1_38174_38566 | 127 |
| 766 | 3300050514 | nmdc:mga08x19_44031_c1 | nmdc:mga08x19_44031_c1_271_663 | 127 |
| 767 | 3300053077 | Ga0495601_0672152 | Ga0495601_0672152_209_604 | 127 |
| 768 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_564566_564949 | 127 |
| 769 | 3300053111 | Ga0500572_064930 | Ga0500572_064930_350_733 | 127 |
| 770 | 3300053119 | Ga0500595_000529 | Ga0500595_000529_1567_1950 | 127 |
| 771 | 3300053119 | Ga0500595_015050 | Ga0500595_015050_880_1263 | 127 |
| 772 | 3300053139 | Ga0500568_0100091 | Ga0500568_0100091_209_592 | 127 |
| 773 | 3300053727 | Ga0500611_091443 | Ga0500611_091443_145_528 | 127 |
| 774 | 3300054114 | Ga0501084_0000017 | Ga0501084_0000017_106768_107163 | 127 |
| 775 | 3300054114 | Ga0501084_0135930 | Ga0501084_0135930_669_1058 | 127 |
| 776 | 3300060353 | Ga0501082_0050887 | Ga0501082_0050887_787_1176 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.9003 | 14 | 110 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.9001 | 16 | 109 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8994 | 16 | 111 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8835 | 14 | 110 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8736 | 16 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9001 | 16 | 109 | 2.60.300.12 |
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8994 | 16 | 111 | 2.60.300.12 |
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8976 | 16 | 118 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8936 | 16 | 99 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8819 | 16 | 109 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1M7N8-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.9134 | 16 | 111 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A354F7K9-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.902 | 15 | 107 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A1Z9F9J3-F1-model_v4 | deleted | 0.8973 | 14 | 118 |
|
| AF-A0A7V7T2I1-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.8966 | 16 | 118 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A1S3PKP3-F1-model_v4 | Iron-sulfur cluster assembly 1 homolog, mitochondrial | 0.8959 | 16 | 118 |
GO:0005739
GO:0016226 GO:0051537 GO:0097428 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar