F480316

General Info

Members Datasets Scaffolds Average Seq Length
776 280 776 128

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10168344|Ga0207664_101683444
Length 152
Sequence MTTAATSHSPSRPRRERPKPIRLTDAAAARVREIIGDAEGRYLGVRVGVTNGGCAGMSYTMDYADEAKPLDEVVEDKGVRIFIDPKAILFLIGTEMDFVREKLGARFVFNNPNQTAACGCGESVSITPATATISRRPPSRTRLARLSSRSPG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
278 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 1.03
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000036 3300003214 Bacteria 286380
2 JGI25153J46596_10000852 3300003215 Bacteria 18699
3 rootH2_10011227 3300003320 Bacteria 7672
4 Ga0070658_10032522 3300005327 Bacteria 4193
5 Ga0070658_10102858 3300005327 Bacteria 2362
6 Ga0070658_10117330 3300005327 Bacteria 2210
7 Ga0070658_11041750 3300005327 Bacteria 712
8 Ga0070658_11513954 3300005327 Bacteria 582
9 Ga0070676_10172592 3300005328 Bacteria 1400
10 Ga0070683_101794710 3300005329 Bacteria 590
11 Ga0070690_100023601 3300005330 Bacteria 3774
12 Ga0070670_100202734 3300005331 Bacteria 1724
13 Ga0070670_100352546 3300005331 Bacteria 1293
14 Ga0068869_100547244 3300005334 Bacteria 972
15 Ga0070666_10001920 3300005335 Bacteria 12642
16 Ga0070666_10015384 3300005335 Bacteria 4879
17 Ga0070666_10429985 3300005335 Bacteria 952
18 Ga0070680_100000110 3300005336 Bacteria 47139
19 Ga0070680_100018543 3300005336 Bacteria 5500
20 Ga0070680_100072469 3300005336 Bacteria 2831
21 Ga0070682_100250601 3300005337 Bacteria 1276
22 Ga0070682_101253696 3300005337 Bacteria 628
23 Ga0068868_100209435 3300005338 Bacteria 1629
24 Ga0068868_100353727 3300005338 Bacteria 1259
25 Ga0068868_100801850 3300005338 Bacteria 850
26 Ga0070660_100246913 3300005339 Bacteria 1455
27 Ga0070660_100260202 3300005339 Bacteria 1417
28 Ga0070660_100776722 3300005339 Bacteria 805
29 Ga0070660_101397091 3300005339 Bacteria 595
30 Ga0070691_10001038 3300005341 Bacteria 11428
31 Ga0070691_10037486 3300005341 Bacteria 2287
32 Ga0070661_100000148 3300005344 Bacteria 57465
33 Ga0070661_100277232 3300005344 Bacteria 1300
34 Ga0070661_100743143 3300005344 Bacteria 802
35 Ga0070661_100975057 3300005344 Bacteria 702
36 Ga0070668_100212340 3300005347 Bacteria 1592
37 Ga0070668_101145674 3300005347 Bacteria 703
38 Ga0070675_100047404 3300005354 Bacteria 3521
39 Ga0070673_100184616 3300005364 Bacteria 1787
40 Ga0070673_100430740 3300005364 Bacteria 1184
41 Ga0070673_101073552 3300005364 Bacteria 751
42 Ga0070688_100475366 3300005365 Bacteria 938
43 Ga0070688_100845421 3300005365 Bacteria 718
44 Ga0070659_100027939 3300005366 Bacteria 4351
45 Ga0070667_100009798 3300005367 Bacteria 7944
46 Ga0070667_100993977 3300005367 Bacteria 783
47 Ga0070709_10001050 3300005434 Bacteria 15238
48 Ga0070709_10035060 3300005434 Bacteria 3047
49 Ga0070709_10979865 3300005434 Bacteria 672
50 Ga0070714_100047577 3300005435 Bacteria 3645
51 Ga0070714_100115342 3300005435 Bacteria 2384
52 Ga0070714_101451768 3300005435 Bacteria 670
53 Ga0070713_100000004 3300005436 Bacteria 220768
54 Ga0070713_100168380 3300005436 Bacteria 1961
55 Ga0070713_100269457 3300005436 Bacteria 1559
56 Ga0070711_100004994 3300005439 Bacteria 7880
57 Ga0070694_100508823 3300005444 Bacteria 959
58 Ga0070663_100235686 3300005455 Bacteria 1443
59 Ga0070663_100772314 3300005455 Bacteria 822
60 Ga0070663_101435082 3300005455 Bacteria 612
61 Ga0070663_101998640 3300005455 Bacteria 522
62 Ga0070678_100003363 3300005456 Bacteria 8916
63 Ga0070678_100222930 3300005456 Bacteria 1568
64 Ga0070662_101117780 3300005457 Bacteria 676
65 Ga0070681_10000001 3300005458 Bacteria 946857
66 Ga0070681_10145807 3300005458 Bacteria 2296
67 Ga0070681_10197855 3300005458 Bacteria 1928
68 Ga0070681_11176577 3300005458 Bacteria 688
69 Ga0068867_100008753 3300005459 Bacteria 7146
70 Ga0068867_100940892 3300005459 Bacteria 780
71 Ga0070679_100000032 3300005530 Bacteria 105384
72 Ga0070679_100018143 3300005530 Bacteria 6823
73 Ga0070679_100032379 3300005530 Bacteria 5170
74 Ga0070679_100058169 3300005530 Bacteria 3852
75 Ga0070679_100179253 3300005530 Bacteria 2091
76 Ga0070679_100273622 3300005530 Bacteria 1642
77 Ga0070679_100323328 3300005530 Bacteria 1492
78 Ga0070684_100414432 3300005535 Bacteria 1243
79 Ga0070684_100501884 3300005535 Bacteria 1124
80 Ga0068853_100037181 3300005539 Bacteria 4142
81 Ga0068853_100204305 3300005539 Bacteria 1798
82 Ga0068853_100466567 3300005539 Bacteria 1189
83 Ga0068853_100569657 3300005539 Bacteria 1074
84 Ga0068853_100828826 3300005539 Bacteria 887
85 Ga0070672_100387686 3300005543 Bacteria 1196
86 Ga0070695_100291022 3300005545 Bacteria 1204
87 Ga0070696_100064429 3300005546 Bacteria 2568
88 Ga0070693_100291274 3300005547 Bacteria 1097
89 Ga0070693_100496561 3300005547 Bacteria 865
90 Ga0070693_100691545 3300005547 Bacteria 746
91 Ga0070665_100000879 3300005548 Bacteria 38675
92 Ga0070665_100014442 3300005548 Bacteria 7922
93 Ga0070665_100114106 3300005548 Bacteria 2704
94 Ga0070665_100512780 3300005548 Bacteria 1211
95 Ga0070665_100758309 3300005548 Bacteria 983
96 Ga0070665_100961041 3300005548 Bacteria 867
97 Ga0068855_100000111 3300005563 Bacteria 102282
98 Ga0068855_100014305 3300005563 Bacteria 9555
99 Ga0068855_100018471 3300005563 Bacteria 8380
100 Ga0068855_100101800 3300005563 Bacteria 3306
101 Ga0068855_100147934 3300005563 Bacteria 2673
102 Ga0070664_100113906 3300005564 Bacteria 2362
103 Ga0068857_100000944 3300005577 Bacteria 22139
104 Ga0068857_100091519 3300005577 Bacteria 2723
105 Ga0068857_100435493 3300005577 Bacteria 1224
106 Ga0068857_101260539 3300005577 Bacteria 717
107 Ga0068854_100501685 3300005578 Bacteria 1022
108 Ga0068854_100652413 3300005578 Bacteria 904
109 Ga0068854_100921864 3300005578 Bacteria 769
110 Ga0068856_100000144 3300005614 Bacteria 72020
111 Ga0068856_100008455 3300005614 Bacteria 10018
112 Ga0068856_102586492 3300005614 Bacteria 514
113 Ga0070702_100303165 3300005615 Bacteria 1106
114 Ga0068852_100005341 3300005616 Bacteria 9173
115 Ga0068852_100157245 3300005616 Bacteria 2119
116 Ga0068859_100283647 3300005617 Bacteria 1749
117 Ga0068864_100091729 3300005618 Bacteria 2681
118 Ga0068864_100166760 3300005618 Bacteria 2006
119 Ga0068864_101944153 3300005618 Bacteria 594
120 Ga0068864_102555927 3300005618 Bacteria 517
121 Ga0068861_100849070 3300005719 Bacteria 861
122 Ga0068851_10093146 3300005834 Bacteria 1589
123 Ga0068870_10100066 3300005840 Bacteria 1637
124 Ga0068870_10427403 3300005840 Bacteria 868
125 Ga0068858_100027867 3300005842 Bacteria 5249
126 Ga0068858_100398009 3300005842 Bacteria 1323
127 Ga0068858_100578048 3300005842 Bacteria 1089
128 Ga0068860_100048418 3300005843 Bacteria 4051
129 Ga0068860_100571799 3300005843 Bacteria 1134
130 Ga0070716_100004517 3300006173 Bacteria 6663
131 Ga0070712_100000293 3300006175 Bacteria 28103
132 Ga0070712_100000567 3300006175 Bacteria 21500
133 Ga0070712_100071161 3300006175 Bacteria 2488
134 Ga0070712_101924055 3300006175 Bacteria 518
135 Ga0075366_10119983 3300006195 Bacteria 1585
136 Ga0097621_100031007 3300006237 Bacteria 4238
137 Ga0097621_100036850 3300006237 Bacteria 3914
138 Ga0097621_100053991 3300006237 Bacteria 3275
139 Ga0097621_100274388 3300006237 Bacteria 1483
140 Ga0097621_100691182 3300006237 Unclassified 939
141 Ga0097621_100781342 3300006237 Bacteria 884
142 Ga0075370_10056252 3300006353 Bacteria 2236
143 Ga0075370_10946794 3300006353 Bacteria 527
144 Ga0068871_100002461 3300006358 Bacteria 12642
145 Ga0068871_100047905 3300006358 Bacteria 3448
146 Ga0068871_100080526 3300006358 Bacteria 2696
147 Ga0068871_100152545 3300006358 Bacteria 1971
148 Ga0068871_100778371 3300006358 Bacteria 881
149 Ga0075434_100068597 3300006871 Bacteria 3533
150 Ga0068865_100003070 3300006881 Bacteria 9986
151 Ga0068865_100268072 3300006881 Bacteria 1355
152 Ga0068865_102125099 3300006881 Bacteria 511
153 Ga0075436_100000574 3300006914 Bacteria 24043
154 Ga0097620_100283649 3300006931 Bacteria 1749
155 Ga0105250_10414351 3300009092 Bacteria 599
156 Ga0105240_10006228 3300009093 Bacteria 17548
157 Ga0105240_10010372 3300009093 Bacteria 13105
158 Ga0105240_10013961 3300009093 Bacteria 10996
159 Ga0105240_10027753 3300009093 Bacteria 7409
160 Ga0105240_10036213 3300009093 Bacteria 6350
161 Ga0105240_10056349 3300009093 Bacteria 4919
162 Ga0105240_10059899 3300009093 Bacteria 4749
163 Ga0105240_10174368 3300009093 Bacteria 2543
164 Ga0105240_10520835 3300009093 Bacteria 1319
165 Ga0105240_11124682 3300009093 Bacteria 835
166 Ga0105240_11404993 3300009093 Bacteria 734
167 Ga0105240_11978203 3300009093 Bacteria 606
168 Ga0105245_10043251 3300009098 Bacteria 4018
169 Ga0105245_10123480 3300009098 Bacteria 2421
170 Ga0105245_10457093 3300009098 Bacteria 1286
171 Ga0105247_10020883 3300009101 Bacteria 3938
172 Ga0105247_10530822 3300009101 Bacteria 862
173 Ga0105243_10129897 3300009148 Bacteria 2136
174 Ga0105243_10377019 3300009148 Bacteria 1311
175 Ga0105241_10001171 3300009174 Bacteria 19971
176 Ga0105241_10034332 3300009174 Bacteria 3810
177 Ga0105241_10139417 3300009174 Bacteria 1973
178 Ga0105241_10217101 3300009174 Bacteria 1605
179 Ga0105241_10246115 3300009174 Bacteria 1514
180 Ga0105241_11535403 3300009174 Bacteria 642
181 Ga0105241_12082036 3300009174 Bacteria 560
182 Ga0105241_12417831 3300009174 Unclassified 525
183 Ga0105242_10006404 3300009176 Bacteria 9066
184 Ga0105242_10040101 3300009176 Bacteria 3772
185 Ga0105242_10690670 3300009176 Bacteria 997
186 Ga0105248_10000005 3300009177 Bacteria 673111
187 Ga0105248_10035752 3300009177 Bacteria 5557
188 Ga0105248_10069202 3300009177 Bacteria 3963
189 Ga0105248_10148288 3300009177 Bacteria 2647
190 Ga0105248_10703387 3300009177 Bacteria 1140
191 Ga0105237_10016366 3300009545 Bacteria 7708
192 Ga0105237_10017309 3300009545 Bacteria 7473
193 Ga0105237_10116422 3300009545 Bacteria 2666
194 Ga0105237_10581763 3300009545 Unclassified 1126
195 Ga0105237_12281037 3300009545 Bacteria 551
196 Ga0105238_10000847 3300009551 Bacteria 31513
197 Ga0105238_10006764 3300009551 Bacteria 11456
198 Ga0105238_10046152 3300009551 Bacteria 4398
199 Ga0105238_10077477 3300009551 Bacteria 3315
200 Ga0105238_10161348 3300009551 Bacteria 2217
201 Ga0105238_10228957 3300009551 Bacteria 1836
202 Ga0105238_10262790 3300009551 Bacteria 1706
203 Ga0105238_10428462 3300009551 Bacteria 1318
204 Ga0105238_10446022 3300009551 Bacteria 1291
205 Ga0105238_10644374 3300009551 Bacteria 1069
206 Ga0105238_11648951 3300009551 Unclassified 672
207 Ga0105249_10789086 3300009553 Bacteria 1013
208 Ga0105249_11839004 3300009553 Bacteria 678
209 Ga0105249_12674259 3300009553 Bacteria 571
210 Ga0105239_10001485 3300010375 Bacteria 31171
211 Ga0105239_10005268 3300010375 Bacteria 15205
212 Ga0105239_10006709 3300010375 Bacteria 13295
213 Ga0105239_10026010 3300010375 Bacteria 6444
214 Ga0105239_10104157 3300010375 Bacteria 3141
215 Ga0105239_10167342 3300010375 Bacteria 2458
216 Ga0105239_10298200 3300010375 Bacteria 1815
217 Ga0105239_12377441 3300010375 Bacteria 617
218 Ga0105239_13452461 3300010375 Bacteria 514
219 Ga0105246_10020517 3300011119 Bacteria 4239
220 Ga0105246_10559406 3300011119 Bacteria 981
221 Ga0157373_10001245 3300013100 Bacteria 19459
222 Ga0157373_10425485 3300013100 Bacteria 954
223 Ga0157373_10441226 3300013100 Bacteria 936
224 Ga0157373_10642832 3300013100 Bacteria 774
225 Ga0157373_11313114 3300013100 Bacteria 548
226 Ga0157370_10039363 3300013104 Bacteria 4569
227 Ga0157370_10124379 3300013104 Bacteria 2408
228 Ga0157370_10151238 3300013104 Bacteria 2160
229 Ga0157370_11274873 3300013104 Bacteria 662
230 Ga0157369_10010560 3300013105 Bacteria 10508
231 Ga0157369_10199393 3300013105 Bacteria 2101
232 Ga0157369_10238599 3300013105 Bacteria 1899
233 Ga0157369_10258050 3300013105 Bacteria 1818
234 Ga0157369_10375409 3300013105 Bacteria 1476
235 Ga0157369_11291216 3300013105 Bacteria 744
236 Ga0157374_10012434 3300013296 Bacteria 7404
237 Ga0157374_10017187 3300013296 Bacteria 6368
238 Ga0157374_10201534 3300013296 Bacteria 1949
239 Ga0157374_10547475 3300013296 Bacteria 1165
240 Ga0157378_10071178 3300013297 Bacteria 3123
241 Ga0157378_10105031 3300013297 Bacteria 2582
242 Ga0157378_10115124 3300013297 Bacteria 2471
243 Ga0157378_10237312 3300013297 Bacteria 1740
244 Ga0157378_10274718 3300013297 Bacteria 1622
245 Ga0157378_10295752 3300013297 Bacteria 1565
246 Ga0163162_10018224 3300013306 Bacteria 6876
247 Ga0163162_10207002 3300013306 Bacteria 2091
248 Ga0163162_10419140 3300013306 Bacteria 1471
249 Ga0163162_11348922 3300013306 Bacteria 811
250 Ga0157372_10027681 3300013307 Bacteria 6177
251 Ga0157372_10079972 3300013307 Bacteria 3697
252 Ga0157372_10685394 3300013307 Bacteria 1193
253 Ga0157375_10060295 3300013308 Bacteria 3762
254 Ga0157375_10427793 3300013308 Bacteria 1490
255 Ga0157375_12281166 3300013308 Bacteria 645
256 Ga0157375_12583621 3300013308 Bacteria 607
257 Ga0163163_10000749 3300014325 Bacteria 27674
258 Ga0163163_10227498 3300014325 Bacteria 1914
259 Ga0163163_10363567 3300014325 Bacteria 1504
260 Ga0163163_11356446 3300014325 Bacteria 773
261 Ga0157380_10150009 3300014326 Bacteria 2014
262 Ga0157380_11311957 3300014326 Bacteria 771
263 Ga0182008_10071439 3300014497 Bacteria 1708
264 Ga0157379_10003278 3300014968 Bacteria 13713
265 Ga0157379_10013204 3300014968 Bacteria 7232
266 Ga0157379_10031373 3300014968 Bacteria 4733
267 Ga0157379_10066395 3300014968 Bacteria 3225
268 Ga0157376_10007605 3300014969 Bacteria 7754
269 Ga0157376_10325231 3300014969 Bacteria 1463
270 Ga0157376_10469763 3300014969 Bacteria 1231
271 Ga0157376_10590660 3300014969 Bacteria 1104
272 Ga0182007_10032755 3300015262 Bacteria 1764
273 Ga0163161_10003667 3300017792 Bacteria 10773
274 Ga0163161_10781785 3300017792 Bacteria 801
275 Ga0206353_11572703 3300020082 Bacteria 621
276 Ga0213874_10000398 3300021377 Bacteria 8634
277 Ga0213876_10000201 3300021384 Bacteria 61091
278 Ga0224712_10050003 3300022467 Bacteria 1622
279 Ga0207427_125719 3300025231 Bacteria 512
280 Ga0209233_1000015 3300025261 Bacteria 980563
281 Ga0209233_1002328 3300025261 Bacteria 7079
282 Ga0209758_1000013 3300025297 Bacteria 873003
283 Ga0209758_1066181 3300025297 Bacteria 1162
284 Ga0207656_10060916 3300025321 Bacteria 1655
285 Ga0207682_10456249 3300025893 Bacteria 605
286 Ga0207710_10388400 3300025900 Unclassified 715
287 Ga0207688_10021217 3300025901 Bacteria 3549
288 Ga0207680_10002043 3300025903 Bacteria 9453
289 Ga0207680_10113860 3300025903 Bacteria 1759
290 Ga0207699_10011324 3300025906 Bacteria 4500
291 Ga0207645_10094033 3300025907 Bacteria 1929
292 Ga0207643_10093791 3300025908 Bacteria 1753
293 Ga0207643_10415861 3300025908 Bacteria 852
294 Ga0207705_10000391 3300025909 Bacteria 38775
295 Ga0207705_10001089 3300025909 Bacteria 22089
296 Ga0207705_10187835 3300025909 Bacteria 1561
297 Ga0207705_10328805 3300025909 Bacteria 1175
298 Ga0207654_10008441 3300025911 Bacteria 5208
299 Ga0207654_10258215 3300025911 Bacteria 1170
300 Ga0207654_10370710 3300025911 Bacteria 990
301 Ga0207654_10813977 3300025911 Bacteria 675
302 Ga0207654_11033159 3300025911 Unclassified 598
303 Ga0207707_10000001 3300025912 Bacteria 1212482
304 Ga0207707_10054666 3300025912 Bacteria 3475
305 Ga0207707_10197383 3300025912 Bacteria 1755
306 Ga0207707_10268445 3300025912 Bacteria 1479
307 Ga0207707_10354735 3300025912 Bacteria 1263
308 Ga0207695_10000173 3300025913 Bacteria 189050
309 Ga0207695_10010920 3300025913 Bacteria 11046
310 Ga0207695_10032634 3300025913 Bacteria 5695
311 Ga0207695_10035110 3300025913 Bacteria 5442
312 Ga0207695_10138851 3300025913 Bacteria 2381
313 Ga0207695_10140690 3300025913 Bacteria 2362
314 Ga0207695_10150313 3300025913 Bacteria 2268
315 Ga0207695_10258049 3300025913 Bacteria 1641
316 Ga0207695_11684213 3300025913 Bacteria 515
317 Ga0207671_10015697 3300025914 Bacteria 5920
318 Ga0207671_10044806 3300025914 Bacteria 3271
319 Ga0207671_10115634 3300025914 Bacteria 2045
320 Ga0207671_10214011 3300025914 Bacteria 1508
321 Ga0207671_10215863 3300025914 Bacteria 1502
322 Ga0207671_10368082 3300025914 Unclassified 1141
323 Ga0207671_10375240 3300025914 Bacteria 1129
324 Ga0207693_10000163 3300025915 Bacteria 59871
325 Ga0207693_10001708 3300025915 Bacteria 19323
326 Ga0207693_10249012 3300025915 Bacteria 1394
327 Ga0207693_10763882 3300025915 Bacteria 746
328 Ga0207663_10156930 3300025916 Bacteria 1602
329 Ga0207663_10304756 3300025916 Bacteria 1191
330 Ga0207660_10001819 3300025917 Bacteria 14214
331 Ga0207660_10009435 3300025917 Bacteria 6316
332 Ga0207660_10073518 3300025917 Bacteria 2492
333 Ga0207660_10173152 3300025917 Bacteria 1672
334 Ga0207660_10246901 3300025917 Bacteria 1408
335 Ga0207657_10011605 3300025919 Bacteria 8739
336 Ga0207657_10025202 3300025919 Bacteria 5488
337 Ga0207657_10087811 3300025919 Bacteria 2600
338 Ga0207657_10194574 3300025919 Bacteria 1634
339 Ga0207649_10000153 3300025920 Bacteria 56646
340 Ga0207649_10073775 3300025920 Bacteria 2187
341 Ga0207649_10183766 3300025920 Bacteria 1465
342 Ga0207649_10213004 3300025920 Unclassified 1372
343 Ga0207649_10681171 3300025920 Bacteria 796
344 Ga0207649_10780515 3300025920 Bacteria 745
345 Ga0207649_11012793 3300025920 Bacteria 654
346 Ga0207652_10000419 3300025921 Bacteria 44102
347 Ga0207652_10010126 3300025921 Bacteria 7595
348 Ga0207652_10024819 3300025921 Bacteria 4975
349 Ga0207652_10081972 3300025921 Bacteria 2822
350 Ga0207652_10145113 3300025921 Bacteria 2124
351 Ga0207652_10756682 3300025921 Bacteria 864
352 Ga0207694_10000005 3300025924 Bacteria 823704
353 Ga0207694_10025854 3300025924 Bacteria 4464
354 Ga0207694_10031445 3300025924 Bacteria 4054
355 Ga0207694_11105735 3300025924 Bacteria 671
356 Ga0207694_11887334 3300025924 Bacteria 501
357 Ga0207650_10239518 3300025925 Bacteria 1466
358 Ga0207659_11256989 3300025926 Bacteria 636
359 Ga0207687_10075870 3300025927 Bacteria 2413
360 Ga0207687_10317268 3300025927 Bacteria 1260
361 Ga0207687_10978445 3300025927 Bacteria 725
362 Ga0207700_10000011 3300025928 Bacteria 266323
363 Ga0207700_10046961 3300025928 Bacteria 3198
364 Ga0207700_10239471 3300025928 Bacteria 1546
365 Ga0207700_11249638 3300025928 Bacteria 662
366 Ga0207664_10103678 3300025929 Bacteria 2354
367 Ga0207664_10168344 3300025929 Bacteria 1874
368 Ga0207644_10175828 3300025931 Bacteria 1675
369 Ga0207644_10281339 3300025931 Bacteria 1336
370 Ga0207690_10028467 3300025932 Bacteria 3542
371 Ga0207690_10615486 3300025932 Bacteria 887
372 Ga0207706_10644279 3300025933 Bacteria 908
373 Ga0207706_10755812 3300025933 Bacteria 828
374 Ga0207686_10005059 3300025934 Bacteria 7096
375 Ga0207686_10017234 3300025934 Bacteria 4067
376 Ga0207686_10296044 3300025934 Bacteria 1200
377 Ga0207686_10531157 3300025934 Bacteria 917
378 Ga0207709_10070859 3300025935 Bacteria 2212
379 Ga0207670_10307701 3300025936 Bacteria 1243
380 Ga0207704_10002288 3300025938 Bacteria 8609
381 Ga0207704_10154288 3300025938 Bacteria 1625
382 Ga0207704_10354204 3300025938 Bacteria 1144
383 Ga0207665_10105393 3300025939 Bacteria 1974
384 Ga0207691_10069799 3300025940 Bacteria 3173
385 Ga0207691_10476763 3300025940 Bacteria 1061
386 Ga0207711_10000002 3300025941 Bacteria 1228676
387 Ga0207711_10043357 3300025941 Bacteria 3837
388 Ga0207711_10537141 3300025941 Bacteria 1090
389 Ga0207711_10687653 3300025941 Bacteria 954
390 Ga0207711_10719484 3300025941 Bacteria 931
391 Ga0207661_10036171 3300025944 Bacteria 3853
392 Ga0207679_10120435 3300025945 Bacteria 2088
393 Ga0207667_10000011 3300025949 Bacteria 447785
394 Ga0207667_10011191 3300025949 Bacteria 10442
395 Ga0207667_10029812 3300025949 Bacteria 5911
396 Ga0207667_10076783 3300025949 Bacteria 3466
397 Ga0207667_10218399 3300025949 Bacteria 1953
398 Ga0207667_10569642 3300025949 Bacteria 1144
399 Ga0207667_10914069 3300025949 Bacteria 869
400 Ga0207651_10148552 3300025960 Bacteria 1821
401 Ga0207651_10420047 3300025960 Bacteria 1141
402 Ga0207712_10594542 3300025961 Bacteria 956
403 Ga0207668_10201503 3300025972 Bacteria 1585
404 Ga0207640_10040807 3300025981 Bacteria 2947
405 Ga0207640_10880833 3300025981 Bacteria 781
406 Ga0207640_11107993 3300025981 Bacteria 701
407 Ga0207658_10014985 3300025986 Bacteria 5316
408 Ga0207677_10100309 3300026023 Bacteria 2129
409 Ga0207677_10197806 3300026023 Bacteria 1595
410 Ga0207677_10708772 3300026023 Bacteria 894
411 Ga0207677_10764443 3300026023 Bacteria 862
412 Ga0207703_10117170 3300026035 Bacteria 2281
413 Ga0207703_10435695 3300026035 Bacteria 1222
414 Ga0207639_10034281 3300026041 Bacteria 3751
415 Ga0207639_10039639 3300026041 Bacteria 3511
416 Ga0207639_10315836 3300026041 Bacteria 1386
417 Ga0207639_10330850 3300026041 Bacteria 1355
418 Ga0207639_10609839 3300026041 Bacteria 1007
419 Ga0207678_10337375 3300026067 Bacteria 1298
420 Ga0207678_10965736 3300026067 Bacteria 754
421 Ga0207678_11305186 3300026067 Bacteria 642
422 Ga0207702_10000226 3300026078 Bacteria 65919
423 Ga0207702_10008271 3300026078 Bacteria 8790
424 Ga0207702_10109377 3300026078 Bacteria 2454
425 Ga0207702_11791137 3300026078 Bacteria 606
426 Ga0207641_10806212 3300026088 Bacteria 929
427 Ga0207648_10003109 3300026089 Bacteria 17532
428 Ga0207648_10008012 3300026089 Bacteria 10295
429 Ga0207648_10118436 3300026089 Bacteria 2327
430 Ga0207676_10553043 3300026095 Bacteria 1100
431 Ga0207676_10584942 3300026095 Bacteria 1070
432 Ga0207676_11344080 3300026095 Bacteria 710
433 Ga0207674_10000261 3300026116 Bacteria 66008
434 Ga0207674_10032897 3300026116 Bacteria 5435
435 Ga0207674_10378088 3300026116 Bacteria 1369
436 Ga0207674_10641856 3300026116 Bacteria 1025
437 Ga0207675_100331281 3300026118 Bacteria 1488
438 Ga0207675_100844587 3300026118 Bacteria 930
439 Ga0207683_10012952 3300026121 Bacteria 7121
440 Ga0207683_10030570 3300026121 Bacteria 4667
441 Ga0207683_10292888 3300026121 Bacteria 1488
442 Ga0207698_10001869 3300026142 Bacteria 12302
443 Ga0207698_10068701 3300026142 Bacteria 2799
444 Ga0207698_10161414 3300026142 Bacteria 1960
445 Ga0207698_10262598 3300026142 Bacteria 1587
446 Ga0207698_10846908 3300026142 Bacteria 919
447 Ga0268266_10000647 3300028379 Bacteria 47307
448 Ga0268266_10021413 3300028379 Bacteria 5507
449 Ga0268266_10034092 3300028379 Bacteria 4328
450 Ga0268266_10713162 3300028379 Bacteria 967
451 Ga0268265_10428451 3300028380 Bacteria 1230
452 Ga0268265_11641149 3300028380 Bacteria 648
453 Ga0268264_10222921 3300028381 Bacteria 1737
454 Ga0265334_10019977 3300028573 Bacteria 2747
455 Ga0265334_10111438 3300028573 Bacteria 983
456 Ga0265318_10000104 3300028577 Bacteria 78958
457 Ga0265318_10001589 3300028577 Bacteria 13138
458 Ga0307517_10364215 3300028786 Bacteria 779
459 Ga0265338_10000005 3300028800 Bacteria 571137
460 Ga0265338_10016587 3300028800 Bacteria 7995
461 Ga0265338_10030693 3300028800 Bacteria 5286
462 Ga0265330_10027916 3300031235 Bacteria 2547
463 Ga0265330_10134604 3300031235 Bacteria 1051
464 Ga0265330_10283295 3300031235 Bacteria 698
465 Ga0265330_10334150 3300031235 Unclassified 640
466 Ga0265332_10048019 3300031238 Bacteria 1837
467 Ga0265332_10204438 3300031238 Bacteria 820
468 Ga0265332_10337502 3300031238 Bacteria 622
469 Ga0265328_10120050 3300031239 Bacteria 980
470 Ga0265328_10188597 3300031239 Unclassified 781
471 Ga0265328_10348092 3300031239 Bacteria 577
472 Ga0265328_10392959 3300031239 Bacteria 544
473 Ga0265320_10005256 3300031240 Bacteria 8347
474 Ga0265325_10000005 3300031241 Bacteria 321343
475 Ga0265325_10000098 3300031241 Bacteria 61384
476 Ga0265325_10003316 3300031241 Bacteria 10584
477 Ga0265325_10005313 3300031241 Bacteria 7979
478 Ga0265325_10007065 3300031241 Bacteria 6759
479 Ga0265325_10028765 3300031241 Bacteria 2992
480 Ga0265329_10017187 3300031242 Bacteria 2494
481 Ga0265340_10000092 3300031247 Bacteria 42341
482 Ga0265340_10027704 3300031247 Bacteria 2855
483 Ga0265340_10064418 3300031247 Bacteria 1747
484 Ga0265340_10135698 3300031247 Bacteria 1127
485 Ga0265340_10192219 3300031247 Bacteria 920
486 Ga0265340_10286389 3300031247 Bacteria 731
487 Ga0265340_10408146 3300031247 Bacteria 599
488 Ga0265339_10001877 3300031249 Bacteria 15427
489 Ga0265339_10002558 3300031249 Bacteria 12972
490 Ga0265339_10002598 3300031249 Bacteria 12887
491 Ga0265339_10010635 3300031249 Bacteria 5705
492 Ga0265339_10078354 3300031249 Bacteria 1749
493 Ga0265339_10108605 3300031249 Bacteria 1438
494 Ga0265339_10139877 3300031249 Bacteria 1232
495 Ga0265339_10325723 3300031249 Bacteria 728
496 Ga0265339_10544561 3300031249 Bacteria 534
497 Ga0265331_10000003 3300031250 Bacteria 499358
498 Ga0265331_10011578 3300031250 Bacteria 4824
499 Ga0265331_10029215 3300031250 Bacteria 2753
500 Ga0265331_10031715 3300031250 Bacteria 2625
501 Ga0265331_10044112 3300031250 Bacteria 2157
502 Ga0265327_10000187 3300031251 Bacteria 131135
503 Ga0265316_10003669 3300031344 Bacteria 15465
504 Ga0265316_10023813 3300031344 Bacteria 5142
505 Ga0265316_10043378 3300031344 Bacteria 3585
506 Ga0265316_10131928 3300031344 Bacteria 1881
507 Ga0265316_10134135 3300031344 Bacteria 1863
508 Ga0265316_10220429 3300031344 Bacteria 1400
509 Ga0265316_10338785 3300031344 Bacteria 1090
510 Ga0265313_10001748 3300031595 Bacteria 19956
511 Ga0265313_10003640 3300031595 Bacteria 12352
512 Ga0265313_10003817 3300031595 Bacteria 11907
513 Ga0265313_10021395 3300031595 Bacteria 3538
514 Ga0265313_10028305 3300031595 Bacteria 2915
515 Ga0265313_10060125 3300031595 Bacteria 1784
516 Ga0265313_10120761 3300031595 Bacteria 1143
517 Ga0265313_10262494 3300031595 Bacteria 702
518 Ga0265313_10359720 3300031595 Bacteria 576
519 Ga0307508_10631639 3300031616 Bacteria 675
520 Ga0265314_10000125 3300031711 Bacteria 118671
521 Ga0265314_10000835 3300031711 Bacteria 36433
522 Ga0265314_10019586 3300031711 Bacteria 5240
523 Ga0265314_10040827 3300031711 Bacteria 3326
524 Ga0265314_10056084 3300031711 Bacteria 2714
525 Ga0265314_10061149 3300031711 Bacteria 2567
526 Ga0265314_10062244 3300031711 Bacteria 2537
527 Ga0265314_10074116 3300031711 Bacteria 2268
528 Ga0265314_10469287 3300031711 Bacteria 667
529 Ga0265342_10023744 3300031712 Bacteria 3876
530 Ga0265342_10030086 3300031712 Bacteria 3368
531 Ga0265342_10046434 3300031712 Bacteria 2610
532 Ga0265342_10057095 3300031712 Bacteria 2311
533 Ga0265342_10090739 3300031712 Bacteria 1752
534 Ga0265342_10138175 3300031712 Bacteria 1361
535 Ga0265342_10321162 3300031712 Bacteria 811
536 Ga0265342_10350710 3300031712 Bacteria 769
537 Ga0265342_10352258 3300031712 Bacteria 766
538 Ga0265342_10489448 3300031712 Unclassified 628
539 Ga0307516_10094863 3300031730 Bacteria 2807
540 Ga0307516_10200220 3300031730 Bacteria 1717
541 Ga0373923_0109988 3300035111 Bacteria 1223
542 Ga0373932_0202524 3300035112 Bacteria 706
543 Ga0373957_0123275 3300035120 Bacteria 1050
544 Ga0373957_0165100 3300035120 Bacteria 913
545 Ga0373957_0308564 3300035120 Bacteria 672
546 Ga0373955_0132113 3300035172 Bacteria 1458
547 Ga0373955_0333394 3300035172 Bacteria 917
548 Ga0373942_0116873 3300035207 Bacteria 830
549 Ga0373935_0669881 3300035692 Bacteria 762
550 Ga0373927_0321531 3300035695 Bacteria 1019
551 Ga0373933_0032349 3300035724 Bacteria 3040
552 Ga0373933_0397218 3300035724 Bacteria 899
553 Ga0373937_0004668 3300036401 Bacteria 11637
554 Ga0373937_0162549 3300036401 Bacteria 2093
555 Ga0373937_0492173 3300036401 Bacteria 1165
556 Ga0373937_0496128 3300036401 Bacteria 1160
557 Ga0373937_0642063 3300036401 Bacteria 1007
558 Ga0373925_0068645 3300037068 Bacteria 2677
559 Ga0373925_0817886 3300037068 Bacteria 768
560 Ga0395900_0418422 3300037418 Bacteria 1301
561 Ga0395900_1264769 3300037418 Bacteria 652
562 Ga0395898_0079034 3300037466 Bacteria 3173
563 Ga0395898_0292683 3300037466 Bacteria 1553
564 Ga0395905_1746383 3300037471 Bacteria 528
565 Ga0395901_0202057 3300038443 Bacteria 2083
566 Ga0395901_0227683 3300038443 Bacteria 1947
567 Ga0436365_0092617 3300039437 Bacteria 973
568 Ga0436365_0495986 3300039437 Bacteria 71581
569 Ga0436365_0906980 3300039437 Bacteria 3529
570 Ga0436365_1052743 3300039437 Bacteria 736
571 Ga0436365_1073490 3300039437 Bacteria 73987
572 Ga0436365_1896990 3300039437 Bacteria 652
573 Ga0436360_0541761 3300039438 Bacteria 1178
574 Ga0436360_0728540 3300039438 Bacteria 657
575 Ga0436361_0821138 3300039447 Bacteria 855
576 Ga0436363_0027061 3300039450 Bacteria 1440
577 Ga0436363_0386683 3300039450 Bacteria 740
578 Ga0436363_0399751 3300039450 Bacteria 20052
579 Ga0436363_1061920 3300039450 Bacteria 1439
580 Ga0436362_0803129 3300039453 Bacteria 849
581 Ga0436362_1209966 3300039453 Bacteria 1293
582 Ga0451787_288411 3300041441 Bacteria 982
583 Ga0451789_0954795 3300041443 Bacteria 843
584 Ga0451795_0469109 3300041456 Bacteria 705
585 Ga0451802_0453160 3300041460 Bacteria 1285
586 Ga0451837_1219519 3300041494 Bacteria 520
587 Ga0451839_1546439 3300041496 Bacteria 704
588 Ga0451853_0937228 3300041512 Bacteria 612
589 Ga0466957_0096925 3300044842 Bacteria 1854
590 Ga0495592_0165908 3300046454 Bacteria 1516
591 Ga0495592_0659461 3300046454 Bacteria 633
592 Ga0495651_0239059 3300046462 Bacteria 1247
593 Ga0495651_0323469 3300046462 Bacteria 1027
594 Ga0495664_0026635 3300046477 Bacteria 3368
595 Ga0495616_0086486 3300046513 Bacteria 1491
596 Ga0495628_0062693 3300046516 Bacteria 2914
597 Ga0495628_1152791 3300046516 Bacteria 528
598 Ga0495652_0046452 3300046529 Bacteria 3729
599 Ga0495654_0202066 3300046530 Bacteria 850
600 Ga0495586_0227444 3300046535 Bacteria 1061
601 Ga0495587_0414874 3300046536 Bacteria 748
602 Ga0495587_0616704 3300046536 Bacteria 597
603 Ga0495645_0002362 3300046543 Bacteria 12802
604 Ga0495622_0006512 3300046557 Bacteria 5416
605 Ga0495633_0369149 3300046558 Bacteria 650
606 Ga0495625_0269624 3300046660 Bacteria 1099
607 Ga0495646_0575361 3300046680 Bacteria 574
608 Ga0495613_0729317 3300046689 Bacteria 651
609 Ga0495670_0447428 3300046691 Bacteria 700
610 Ga0495600_0361350 3300046809 Bacteria 908
611 Ga0495600_0610153 3300046809 Unclassified 662
612 Ga0495676_0394025 3300047321 Bacteria 920
613 Ga0495675_0062083 3300047444 Bacteria 2366
614 Ga0495675_0319396 3300047444 Bacteria 919
615 Ga0495675_0430237 3300047444 Bacteria 766
616 Ga0495684_0322563 3300047471 Bacteria 1104
617 Ga0495602_0048635 3300048088 Bacteria 3809
618 Ga0495602_0171887 3300048088 Bacteria 1681
619 Ga0496102_1003319 3300048905 Bacteria 755
620 Ga0496106_1136727 3300048909 Bacteria 611
621 Ga0496108_0880785 3300048911 Bacteria 769
622 Ga0496111_0644297 3300048914 Bacteria 773
623 Ga0496126_0000498 3300048929 Bacteria 77619
624 Ga0496126_0053473 3300048929 Bacteria 3664
625 Ga0495682_0003854 3300049460 Bacteria 6574
626 Ga0495682_0374942 3300049460 Bacteria 501
627 Ga0501031_0005788 3300049568 Bacteria 8056
628 Ga0501031_0218402 3300049568 Bacteria 1242
629 Ga0501031_0622085 3300049568 Bacteria 694
630 Ga0501032_0008519 3300049569 Bacteria 7476
631 Ga0501032_0116827 3300049569 Bacteria 1764
632 Ga0501032_0156000 3300049569 Bacteria 1500
633 Ga0501032_0269207 3300049569 Bacteria 1104
634 Ga0501033_0020678 3300049570 Bacteria 4973
635 Ga0501033_0024643 3300049570 Bacteria 4537
636 Ga0501033_0030976 3300049570 Bacteria 4020
637 Ga0501033_0031252 3300049570 Bacteria 4002
638 Ga0501033_0052738 3300049570 Bacteria 3014
639 Ga0501033_0134629 3300049570 Bacteria 1788
640 Ga0501033_0182168 3300049570 Bacteria 1505
641 Ga0501033_0750930 3300049570 Bacteria 661
642 Ga0501034_0001885 3300049571 Bacteria 26587
643 Ga0501034_0016559 3300049571 Bacteria 7559
644 Ga0501034_0063624 3300049571 Bacteria 3703
645 Ga0501034_0125059 3300049571 Bacteria 2557
646 Ga0501034_0554744 3300049571 Bacteria 1058
647 Ga0501036_0022094 3300049572 Bacteria 5351
648 Ga0501036_0066074 3300049572 Bacteria 3060
649 Ga0501036_0163458 3300049572 Bacteria 1876
650 Ga0501036_0590314 3300049572 Bacteria 922
651 Ga0501036_0644289 3300049572 Bacteria 877
652 Ga0501037_0015196 3300049573 Bacteria 5664
653 Ga0501037_0083255 3300049573 Bacteria 2318
654 Ga0501037_0096500 3300049573 Bacteria 2137
655 Ga0501037_0206922 3300049573 Bacteria 1385
656 Ga0501037_0725636 3300049573 Bacteria 660
657 Ga0501038_0005734 3300049574 Bacteria 11507
658 Ga0501038_0112540 3300049574 Bacteria 2253
659 Ga0501038_0531747 3300049574 Bacteria 896
660 Ga0501039_0477958 3300049575 Bacteria 978
661 Ga0501039_1302835 3300049575 Bacteria 560
662 Ga0501040_0688167 3300049576 Bacteria 739
663 Ga0501042_0030584 3300049578 Bacteria 3804
664 Ga0501042_0239301 3300049578 Bacteria 1310
665 Ga0501043_0088740 3300049579 Bacteria 2430
666 Ga0501043_0153798 3300049579 Bacteria 1799
667 Ga0501043_0179083 3300049579 Bacteria 1652
668 Ga0501043_0201910 3300049579 Bacteria 1543
669 Ga0501043_0353577 3300049579 Bacteria 1116
670 Ga0501043_0441777 3300049579 Bacteria 979
671 Ga0501046_0008695 3300049580 Bacteria 8825
672 Ga0501046_0053148 3300049580 Bacteria 3191
673 Ga0501046_0188205 3300049580 Bacteria 1541
674 Ga0501046_0453446 3300049580 Bacteria 922
675 Ga0501046_0894298 3300049580 Unclassified 620
676 Ga0501046_1174943 3300049580 Bacteria 528
677 Ga0501047_0012566 3300049581 Bacteria 8019
678 Ga0501047_0013767 3300049581 Bacteria 7682
679 Ga0501047_0013897 3300049581 Bacteria 7645
680 Ga0501047_0015474 3300049581 Bacteria 7269
681 Ga0501047_0043833 3300049581 Bacteria 4321
682 Ga0501047_0119204 3300049581 Bacteria 2521
683 Ga0501047_0186059 3300049581 Bacteria 1942
684 Ga0501047_0244246 3300049581 Bacteria 1645
685 Ga0501048_0005128 3300049582 Bacteria 9980
686 Ga0501048_0050571 3300049582 Bacteria 2960
687 Ga0501048_1069953 3300049582 Bacteria 580
688 Ga0501067_0000980 3300049583 Bacteria 15317
689 Ga0501067_0073927 3300049583 Bacteria 1888
690 Ga0501068_0055183 3300049584 Bacteria 2407
691 Ga0501068_0229085 3300049584 Bacteria 1182
692 Ga0501069_0005058 3300049585 Bacteria 6838
693 Ga0501069_0227791 3300049585 Bacteria 1085
694 Ga0501070_0000002 3300049586 Bacteria 347524
695 Ga0501070_0023231 3300049586 Bacteria 5194
696 Ga0501070_0224089 3300049586 Bacteria 1541
697 Ga0501070_0456051 3300049586 Bacteria 1030
698 Ga0501070_0696583 3300049586 Bacteria 804
699 Ga0501070_0840399 3300049586 Bacteria 719
700 Ga0501070_1083924 3300049586 Bacteria 618
701 Ga0501071_0074730 3300049587 Bacteria 2474
702 Ga0501073_0000591 3300049589 Bacteria 25613
703 Ga0501073_0013808 3300049589 Bacteria 5873
704 Ga0501073_0056012 3300049589 Bacteria 2758
705 Ga0501073_0715772 3300049589 Bacteria 691
706 Ga0501074_0151359 3300049590 Bacteria 1658
707 Ga0501074_0851853 3300049590 Bacteria 642
708 Ga0501074_0948069 3300049590 Bacteria 605
709 Ga0501079_0007012 3300049741 Bacteria 8498
710 Ga0501079_0009069 3300049741 Bacteria 7533
711 Ga0501080_0019069 3300049742 Bacteria 6350
712 Ga0501080_0021579 3300049742 Bacteria 5960
713 Ga0501080_0022421 3300049742 Bacteria 5850
714 Ga0501080_0114163 3300049742 Bacteria 2504
715 Ga0501080_0146898 3300049742 Bacteria 2179
716 Ga0501080_0228160 3300049742 Bacteria 1702
717 Ga0501080_0243284 3300049742 Bacteria 1642
718 Ga0501081_0108911 3300049743 Bacteria 1965
719 Ga0501083_0187173 3300049744 Bacteria 1351
720 Ga0501083_0302853 3300049744 Bacteria 1040
721 Ga0501083_0472986 3300049744 Bacteria 816
722 Ga0501083_0560191 3300049744 Bacteria 744
723 Ga0501035_0029713 3300049822 Bacteria 4984
724 Ga0501035_0037128 3300049822 Bacteria 4413
725 Ga0501035_0046055 3300049822 Bacteria 3923
726 Ga0501035_0190858 3300049822 Bacteria 1761
727 Ga0501035_0259818 3300049822 Bacteria 1472
728 Ga0501035_0338384 3300049822 Bacteria 1261
729 Ga0501035_0528879 3300049822 Bacteria 968
730 Ga0501035_0684787 3300049822 Bacteria 828
731 Ga0501035_0936617 3300049822 Bacteria 684
732 Ga0501035_0959340 3300049822 Bacteria 674
733 Ga0501044_0000378 3300049823 Bacteria 55508
734 Ga0501044_0001938 3300049823 Bacteria 23937
735 Ga0501044_0014944 3300049823 Bacteria 8370
736 Ga0501044_0025516 3300049823 Bacteria 6265
737 Ga0501044_0029793 3300049823 Bacteria 5754
738 Ga0501044_0072205 3300049823 Bacteria 3509
739 Ga0501044_0138616 3300049823 Bacteria 2422
740 Ga0501044_0338778 3300049823 Bacteria 1425
741 Ga0501044_0354356 3300049823 Bacteria 1386
742 Ga0501044_0432555 3300049823 Bacteria 1225
743 Ga0501044_0899537 3300049823 Bacteria 760
744 Ga0501044_1112392 3300049823 Bacteria 659
745 Ga0501045_0427038 3300049824 Bacteria 986
746 Ga0501045_0850001 3300049824 Bacteria 671
747 nmdc:mga03n38_224569_c1 3300050490 Bacteria 982
748 nmdc:mga07m45_314895_c1 3300050496 Bacteria 910
749 nmdc:mga0n895_99325_c1 3300050512 Bacteria 2919
750 nmdc:mga0rr50_986899_c1 3300050513 Bacteria 718
751 nmdc:mga08x19_129_c1 3300050514 Bacteria 66982
752 nmdc:mga08x19_44031_c1 3300050514 Bacteria 2848
753 Ga0495601_0672152 3300053077 Bacteria 662
754 Ga0500635_0102338 3300053080 Bacteria 1055
755 Ga0500643_000003 3300053087 Bacteria 876659
756 Ga0500641_0010391 3300053096 Bacteria 3363
757 Ga0500572_064930 3300053111 Bacteria 1117
758 Ga0500594_0060504 3300053118 Bacteria 1091
759 Ga0500595_000529 3300053119 Bacteria 23020
760 Ga0500595_006042 3300053119 Bacteria 5200
761 Ga0500595_015050 3300053119 Bacteria 2916
762 Ga0500655_127362 3300053133 Bacteria 542
763 Ga0500559_0035318 3300053136 Bacteria 2159
764 Ga0500568_0100091 3300053139 Bacteria 1088
765 Ga0500573_0000008 3300053140 Bacteria 237795
766 Ga0500604_0106236 3300053151 Bacteria 929
767 Ga0500639_018148 3300053163 Bacteria 3712
768 Ga0500611_091443 3300053727 Bacteria 775
769 Ga0501084_0000017 3300054114 Bacteria 148659
770 Ga0501084_0006291 3300054114 Bacteria 9760
771 Ga0501084_0135930 3300054114 Bacteria 2069
772 Ga0501084_1481446 3300054114 Bacteria 568
773 Ga0501082_0050887 3300060353 Bacteria 3572
774 Ga0501082_0314265 3300060353 Bacteria 1364
775 Ga0501082_0912024 3300060353 Bacteria 768
776 Ga0501082_1204059 3300060353 Unclassified 662

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10001920 Ga0070666_100019202 120
2 3300009177 Ga0105248_10069202 Ga0105248_100692025 120
3 3300025903 Ga0207680_10002043 Ga0207680_100020438 120
4 3300025941 Ga0207711_10043357 Ga0207711_100433575 120
5 3300048905 Ga0496102_1003319 Ga0496102_1003319_276_647 120
6 3300028800 Ga0265338_10016587 Ga0265338_100165878 121
7 3300005331 Ga0070670_100202734 Ga0070670_1002027343 122
8 3300005347 Ga0070668_100212340 Ga0070668_1002123402 122
9 3300005364 Ga0070673_100430740 Ga0070673_1004307401 122
10 3300005435 Ga0070714_100115342 Ga0070714_1001153421 122
11 3300005455 Ga0070663_100772314 Ga0070663_1007723142 122
12 3300005577 Ga0068857_100435493 Ga0068857_1004354933 122
13 3300005578 Ga0068854_100501685 Ga0068854_1005016852 122
14 3300005719 Ga0068861_100849070 Ga0068861_1008490702 122
15 3300006195 Ga0075366_10119983 Ga0075366_101199831 122
16 3300006353 Ga0075370_10056252 Ga0075370_100562524 122
17 3300025907 Ga0207645_10094033 Ga0207645_100940332 122
18 3300025925 Ga0207650_10239518 Ga0207650_102395183 122
19 3300025929 Ga0207664_10103678 Ga0207664_101036782 122
20 3300025933 Ga0207706_10644279 Ga0207706_106442791 122
21 3300025961 Ga0207712_10594542 Ga0207712_105945421 122
22 3300025972 Ga0207668_10201503 Ga0207668_102015032 122
23 3300025981 Ga0207640_11107993 Ga0207640_111079932 122
24 3300026118 Ga0207675_100844587 Ga0207675_1008445872 122
25 3300039438 Ga0436360_0541761 Ga0436360_0541761_307_684 122
26 3300039453 Ga0436362_0803129 Ga0436362_0803129_431_808 122
27 3300049572 Ga0501036_0163458 Ga0501036_0163458_1261_1647 122
28 3300049586 Ga0501070_0456051 Ga0501070_0456051_247_633 122
29 3300050490 nmdc:mga03n38_224569_c1 nmdc:mga03n38_224569_c1_385_768 122
30 3300050496 nmdc:mga07m45_314895_c1 nmdc:mga07m45_314895_c1_13_396 122
31 3300005546 Ga0070696_100064429 Ga0070696_1000644293 123
32 3300006175 Ga0070712_100071161 Ga0070712_1000711613 123
33 3300009093 Ga0105240_10036213 Ga0105240_100362133 123
34 3300009176 Ga0105242_10690670 Ga0105242_106906701 123
35 3300009551 Ga0105238_10262790 Ga0105238_102627903 123
36 3300010375 Ga0105239_10006709 Ga0105239_1000670912 123
37 3300013297 Ga0157378_10071178 Ga0157378_100711783 123
38 3300014968 Ga0157379_10031373 Ga0157379_100313731 123
39 3300021384 Ga0213876_10000201 Ga0213876_1000020111 123
40 3300025913 Ga0207695_10140690 Ga0207695_101406903 123
41 3300025914 Ga0207671_10375240 Ga0207671_103752401 123
42 3300025915 Ga0207693_10249012 Ga0207693_102490123 123
43 3300035207 Ga0373942_0116873 Ga0373942_0116873_389_760 123
44 3300039437 Ga0436365_1073490 Ga0436365_1073490_21004_21381 123
45 3300046809 Ga0495600_0361350 Ga0495600_0361350_17_400 123
46 3300049460 Ga0495682_0374942 Ga0495682_0374942_10_381 123
47 3300005327 Ga0070658_10032522 Ga0070658_100325222 124
48 3300005327 Ga0070658_11041750 Ga0070658_110417501 124
49 3300005337 Ga0070682_101253696 Ga0070682_1012536961 124
50 3300005339 Ga0070660_100776722 Ga0070660_1007767222 124
51 3300005347 Ga0070668_101145674 Ga0070668_1011456741 124
52 3300005367 Ga0070667_100993977 Ga0070667_1009939772 124
53 3300005530 Ga0070679_100018143 Ga0070679_1000181436 124
54 3300005539 Ga0068853_100569657 Ga0068853_1005696572 124
55 3300005563 Ga0068855_100018471 Ga0068855_1000184717 124
56 3300005577 Ga0068857_101260539 Ga0068857_1012605392 124
57 3300006237 Ga0097621_100691182 Ga0097621_1006911822 124
58 3300009093 Ga0105240_10174368 Ga0105240_101743684 124
59 3300009174 Ga0105241_12417831 Ga0105241_124178312 124
60 3300009551 Ga0105238_10228957 Ga0105238_102289573 124
61 3300009551 Ga0105238_10428462 Ga0105238_104284622 124
62 3300013104 Ga0157370_11274873 Ga0157370_112748732 124
63 3300013308 Ga0157375_12583621 Ga0157375_125836212 124
64 3300014325 Ga0163163_11356446 Ga0163163_113564462 124
65 3300014969 Ga0157376_10469763 Ga0157376_104697633 124
66 3300025909 Ga0207705_10187835 Ga0207705_101878353 124
67 3300025913 Ga0207695_10010920 Ga0207695_100109209 124
68 3300025913 Ga0207695_10138851 Ga0207695_101388513 124
69 3300025913 Ga0207695_10150313 Ga0207695_101503133 124
70 3300025914 Ga0207671_10044806 Ga0207671_100448063 124
71 3300025914 Ga0207671_10368082 Ga0207671_103680822 124
72 3300025920 Ga0207649_10213004 Ga0207649_102130042 124
73 3300025920 Ga0207649_11012793 Ga0207649_110127931 124
74 3300025924 Ga0207694_10025854 Ga0207694_100258544 124
75 3300025949 Ga0207667_10076783 Ga0207667_100767834 124
76 3300025949 Ga0207667_10218399 Ga0207667_102183993 124
77 3300026116 Ga0207674_10032897 Ga0207674_100328975 124
78 3300026116 Ga0207674_10641856 Ga0207674_106418563 124
79 3300031235 Ga0265330_10027916 Ga0265330_100279162 124
80 3300031238 Ga0265332_10337502 Ga0265332_103375022 124
81 3300031239 Ga0265328_10348092 Ga0265328_103480922 124
82 3300031241 Ga0265325_10028765 Ga0265325_100287653 124
83 3300031247 Ga0265340_10000092 Ga0265340_1000009219 124
84 3300031250 Ga0265331_10031715 Ga0265331_100317152 124
85 3300031344 Ga0265316_10003669 Ga0265316_1000366910 124
86 3300031344 Ga0265316_10043378 Ga0265316_100433784 124
87 3300031344 Ga0265316_10220429 Ga0265316_102204292 124
88 3300031595 Ga0265313_10028305 Ga0265313_100283054 124
89 3300031595 Ga0265313_10262494 Ga0265313_102624942 124
90 3300031711 Ga0265314_10056084 Ga0265314_100560843 124
91 3300031712 Ga0265342_10030086 Ga0265342_100300864 124
92 3300031712 Ga0265342_10138175 Ga0265342_101381752 124
93 3300039437 Ga0436365_1896990 Ga0436365_1896990_74_448 124
94 3300039447 Ga0436361_0821138 Ga0436361_0821138_371_766 124
95 3300039450 Ga0436363_0027061 Ga0436363_0027061_478_852 124
96 3300046513 Ga0495616_0086486 Ga0495616_0086486_947_1345 124
97 3300047444 Ga0495675_0319396 Ga0495675_0319396_509_895 124
98 3300031235 Ga0265330_10134604 Ga0265330_101346043 125
99 3300031238 Ga0265332_10204438 Ga0265332_102044382 125
100 3300031241 Ga0265325_10005313 Ga0265325_100053137 125
101 3300031247 Ga0265340_10064418 Ga0265340_100644182 125
102 3300031247 Ga0265340_10286389 Ga0265340_102863892 125
103 3300031249 Ga0265339_10001877 Ga0265339_1000187711 125
104 3300031249 Ga0265339_10108605 Ga0265339_101086052 125
105 3300031249 Ga0265339_10139877 Ga0265339_101398773 125
106 3300031249 Ga0265339_10325723 Ga0265339_103257231 125
107 3300031344 Ga0265316_10134135 Ga0265316_101341353 125
108 3300031595 Ga0265313_10359720 Ga0265313_103597202 125
109 3300031711 Ga0265314_10000125 Ga0265314_1000012558 125
110 3300031712 Ga0265342_10046434 Ga0265342_100464343 125
111 3300031712 Ga0265342_10321162 Ga0265342_103211622 125
112 3300039438 Ga0436360_0728540 Ga0436360_0728540_18_395 125
113 3300046462 Ga0495651_0239059 Ga0495651_0239059_91_474 125
114 3300046516 Ga0495628_1152791 Ga0495628_1152791_81_464 125
115 3300049570 Ga0501033_0052738 Ga0501033_0052738_1944_2339 125
116 3300049571 Ga0501034_0554744 Ga0501034_0554744_91_480 125
117 3300049581 Ga0501047_0043833 Ga0501047_0043833_2036_2425 125
118 3300049583 Ga0501067_0000980 Ga0501067_0000980_13451_13840 125
119 3300049589 Ga0501073_0013808 Ga0501073_0013808_360_749 125
120 3300049742 Ga0501080_0021579 Ga0501080_0021579_2930_3319 125
121 3300049823 Ga0501044_0338778 Ga0501044_0338778_960_1355 125
122 3300060353 Ga0501082_1204059 Ga0501082_1204059_239_628 125
123 3300003215 JGI25153J46596_10000852 JGI25153J46596_1000085214 126
124 3300003320 rootH2_10011227 rootH2_100112277 126
125 3300005327 Ga0070658_10117330 Ga0070658_101173304 126
126 3300005327 Ga0070658_11513954 Ga0070658_115139542 126
127 3300005328 Ga0070676_10172592 Ga0070676_101725923 126
128 3300005329 Ga0070683_101794710 Ga0070683_1017947101 126
129 3300005330 Ga0070690_100023601 Ga0070690_1000236013 126
130 3300005331 Ga0070670_100352546 Ga0070670_1003525463 126
131 3300005335 Ga0070666_10015384 Ga0070666_100153844 126
132 3300005335 Ga0070666_10429985 Ga0070666_104299851 126
133 3300005336 Ga0070680_100000110 Ga0070680_10000011036 126
134 3300005336 Ga0070680_100018543 Ga0070680_1000185434 126
135 3300005338 Ga0068868_100209435 Ga0068868_1002094352 126
136 3300005338 Ga0068868_100353727 Ga0068868_1003537271 126
137 3300005338 Ga0068868_100801850 Ga0068868_1008018501 126
138 3300005339 Ga0070660_100246913 Ga0070660_1002469132 126
139 3300005344 Ga0070661_100000148 Ga0070661_10000014816 126
140 3300005344 Ga0070661_100277232 Ga0070661_1002772321 126
141 3300005344 Ga0070661_100743143 Ga0070661_1007431432 126
142 3300005354 Ga0070675_100047404 Ga0070675_1000474044 126
143 3300005364 Ga0070673_100184616 Ga0070673_1001846161 126
144 3300005364 Ga0070673_101073552 Ga0070673_1010735522 126
145 3300005365 Ga0070688_100475366 Ga0070688_1004753663 126
146 3300005365 Ga0070688_100845421 Ga0070688_1008454211 126
147 3300005366 Ga0070659_100027939 Ga0070659_1000279391 126
148 3300005367 Ga0070667_100009798 Ga0070667_1000097987 126
149 3300005434 Ga0070709_10979865 Ga0070709_109798652 126
150 3300005436 Ga0070713_100168380 Ga0070713_1001683801 126
151 3300005455 Ga0070663_100235686 Ga0070663_1002356863 126
152 3300005457 Ga0070662_101117780 Ga0070662_1011177801 126
153 3300005458 Ga0070681_10000001 Ga0070681_10000001393 126
154 3300005458 Ga0070681_10145807 Ga0070681_101458074 126
155 3300005459 Ga0068867_100940892 Ga0068867_1009408922 126
156 3300005530 Ga0070679_100000032 Ga0070679_1000000327 126
157 3300005530 Ga0070679_100032379 Ga0070679_1000323795 126
158 3300005530 Ga0070679_100058169 Ga0070679_1000581696 126
159 3300005530 Ga0070679_100323328 Ga0070679_1003233282 126
160 3300005535 Ga0070684_100501884 Ga0070684_1005018843 126
161 3300005539 Ga0068853_100466567 Ga0068853_1004665671 126
162 3300005539 Ga0068853_100828826 Ga0068853_1008288262 126
163 3300005543 Ga0070672_100387686 Ga0070672_1003876862 126
164 3300005547 Ga0070693_100691545 Ga0070693_1006915452 126
165 3300005548 Ga0070665_100000879 Ga0070665_10000087913 126
166 3300005548 Ga0070665_100014442 Ga0070665_1000144421 126
167 3300005548 Ga0070665_100114106 Ga0070665_1001141064 126
168 3300005548 Ga0070665_100512780 Ga0070665_1005127803 126
169 3300005548 Ga0070665_100961041 Ga0070665_1009610413 126
170 3300005563 Ga0068855_100000111 Ga0068855_10000011123 126
171 3300005563 Ga0068855_100101800 Ga0068855_1001018002 126
172 3300005563 Ga0068855_100147934 Ga0068855_1001479344 126
173 3300005577 Ga0068857_100091519 Ga0068857_1000915194 126
174 3300005578 Ga0068854_100652413 Ga0068854_1006524131 126
175 3300005614 Ga0068856_102586492 Ga0068856_1025864922 126
176 3300005615 Ga0070702_100303165 Ga0070702_1003031653 126
177 3300005616 Ga0068852_100157245 Ga0068852_1001572453 126
178 3300005617 Ga0068859_100283647 Ga0068859_1002836474 126
179 3300005618 Ga0068864_100091729 Ga0068864_1000917293 126
180 3300005618 Ga0068864_100166760 Ga0068864_1001667603 126
181 3300005834 Ga0068851_10093146 Ga0068851_100931464 126
182 3300005840 Ga0068870_10100066 Ga0068870_101000662 126
183 3300005840 Ga0068870_10427403 Ga0068870_104274032 126
184 3300005842 Ga0068858_100027867 Ga0068858_1000278674 126
185 3300005843 Ga0068860_100048418 Ga0068860_1000484184 126
186 3300005843 Ga0068860_100571799 Ga0068860_1005717992 126
187 3300006175 Ga0070712_101924055 Ga0070712_1019240552 126
188 3300006237 Ga0097621_100036850 Ga0097621_1000368505 126
189 3300006237 Ga0097621_100053991 Ga0097621_1000539912 126
190 3300006237 Ga0097621_100274388 Ga0097621_1002743883 126
191 3300006237 Ga0097621_100781342 Ga0097621_1007813421 126
192 3300006358 Ga0068871_100080526 Ga0068871_1000805261 126
193 3300006358 Ga0068871_100152545 Ga0068871_1001525453 126
194 3300006931 Ga0097620_100283649 Ga0097620_1002836494 126
195 3300009092 Ga0105250_10414351 Ga0105250_104143512 126
196 3300009093 Ga0105240_10010372 Ga0105240_100103728 126
197 3300009093 Ga0105240_10056349 Ga0105240_100563497 126
198 3300009093 Ga0105240_10520835 Ga0105240_105208353 126
199 3300009093 Ga0105240_11124682 Ga0105240_111246822 126
200 3300009093 Ga0105240_11404993 Ga0105240_114049932 126
201 3300009093 Ga0105240_11978203 Ga0105240_119782032 126
202 3300009098 Ga0105245_10043251 Ga0105245_100432514 126
203 3300009101 Ga0105247_10020883 Ga0105247_100208835 126
204 3300009101 Ga0105247_10530822 Ga0105247_105308222 126
205 3300009148 Ga0105243_10129897 Ga0105243_101298972 126
206 3300009174 Ga0105241_10217101 Ga0105241_102171013 126
207 3300009174 Ga0105241_10246115 Ga0105241_102461152 126
208 3300009174 Ga0105241_11535403 Ga0105241_115354031 126
209 3300009176 Ga0105242_10006404 Ga0105242_100064046 126
210 3300009177 Ga0105248_10035752 Ga0105248_100357525 126
211 3300009177 Ga0105248_10703387 Ga0105248_107033872 126
212 3300009545 Ga0105237_12281037 Ga0105237_122810372 126
213 3300009551 Ga0105238_10046152 Ga0105238_100461523 126
214 3300009551 Ga0105238_10161348 Ga0105238_101613484 126
215 3300009551 Ga0105238_10446022 Ga0105238_104460221 126
216 3300009551 Ga0105238_10644374 Ga0105238_106443742 126
217 3300009551 Ga0105238_11648951 Ga0105238_116489512 126
218 3300009553 Ga0105249_10789086 Ga0105249_107890862 126
219 3300009553 Ga0105249_11839004 Ga0105249_118390042 126
220 3300010375 Ga0105239_10001485 Ga0105239_100014859 126
221 3300010375 Ga0105239_10005268 Ga0105239_1000526812 126
222 3300010375 Ga0105239_10104157 Ga0105239_101041574 126
223 3300010375 Ga0105239_10167342 Ga0105239_101673422 126
224 3300010375 Ga0105239_10298200 Ga0105239_102982002 126
225 3300011119 Ga0105246_10559406 Ga0105246_105594062 126
226 3300013100 Ga0157373_10642832 Ga0157373_106428322 126
227 3300013104 Ga0157370_10039363 Ga0157370_100393634 126
228 3300013105 Ga0157369_10199393 Ga0157369_101993931 126
229 3300013105 Ga0157369_10238599 Ga0157369_102385991 126
230 3300013105 Ga0157369_10375409 Ga0157369_103754091 126
231 3300013105 Ga0157369_11291216 Ga0157369_112912162 126
232 3300013296 Ga0157374_10012434 Ga0157374_100124345 126
233 3300013297 Ga0157378_10105031 Ga0157378_101050314 126
234 3300013297 Ga0157378_10237312 Ga0157378_102373123 126
235 3300013297 Ga0157378_10295752 Ga0157378_102957523 126
236 3300013306 Ga0163162_10207002 Ga0163162_102070023 126
237 3300013307 Ga0157372_10685394 Ga0157372_106853941 126
238 3300013308 Ga0157375_10427793 Ga0157375_104277933 126
239 3300013308 Ga0157375_12281166 Ga0157375_122811662 126
240 3300014325 Ga0163163_10227498 Ga0163163_102274983 126
241 3300014326 Ga0157380_10150009 Ga0157380_101500094 126
242 3300014326 Ga0157380_11311957 Ga0157380_113119572 126
243 3300014968 Ga0157379_10003278 Ga0157379_100032784 126
244 3300014969 Ga0157376_10325231 Ga0157376_103252312 126
245 3300017792 Ga0163161_10781785 Ga0163161_107817852 126
246 3300021377 Ga0213874_10000398 Ga0213874_100003987 126
247 3300025297 Ga0209758_1000013 Ga0209758_1000013317 126
248 3300025297 Ga0209758_1066181 Ga0209758_10661811 126
249 3300025321 Ga0207656_10060916 Ga0207656_100609162 126
250 3300025900 Ga0207710_10388400 Ga0207710_103884002 126
251 3300025903 Ga0207680_10113860 Ga0207680_101138602 126
252 3300025908 Ga0207643_10093791 Ga0207643_100937912 126
253 3300025908 Ga0207643_10415861 Ga0207643_104158612 126
254 3300025909 Ga0207705_10001089 Ga0207705_1000108921 126
255 3300025909 Ga0207705_10328805 Ga0207705_103288053 126
256 3300025911 Ga0207654_10370710 Ga0207654_103707102 126
257 3300025911 Ga0207654_11033159 Ga0207654_110331592 126
258 3300025912 Ga0207707_10000001 Ga0207707_1000000180 126
259 3300025912 Ga0207707_10197383 Ga0207707_101973832 126
260 3300025912 Ga0207707_10354735 Ga0207707_103547352 126
261 3300025913 Ga0207695_10000173 Ga0207695_10000173161 126
262 3300025913 Ga0207695_10258049 Ga0207695_102580493 126
263 3300025913 Ga0207695_11684213 Ga0207695_116842132 126
264 3300025914 Ga0207671_10214011 Ga0207671_102140111 126
265 3300025914 Ga0207671_10215863 Ga0207671_102158634 126
266 3300025915 Ga0207693_10763882 Ga0207693_107638822 126
267 3300025916 Ga0207663_10156930 Ga0207663_101569301 126
268 3300025917 Ga0207660_10001819 Ga0207660_100018197 126
269 3300025917 Ga0207660_10009435 Ga0207660_100094355 126
270 3300025917 Ga0207660_10246901 Ga0207660_102469013 126
271 3300025919 Ga0207657_10025202 Ga0207657_100252022 126
272 3300025919 Ga0207657_10194574 Ga0207657_101945742 126
273 3300025920 Ga0207649_10000153 Ga0207649_1000015319 126
274 3300025920 Ga0207649_10073775 Ga0207649_100737754 126
275 3300025920 Ga0207649_10183766 Ga0207649_101837662 126
276 3300025921 Ga0207652_10000419 Ga0207652_100004198 126
277 3300025921 Ga0207652_10010126 Ga0207652_100101265 126
278 3300025921 Ga0207652_10145113 Ga0207652_101451133 126
279 3300025921 Ga0207652_10756682 Ga0207652_107566821 126
280 3300025924 Ga0207694_10000005 Ga0207694_10000005415 126
281 3300025924 Ga0207694_10031445 Ga0207694_100314451 126
282 3300025924 Ga0207694_11887334 Ga0207694_118873342 126
283 3300025927 Ga0207687_10317268 Ga0207687_103172683 126
284 3300025927 Ga0207687_10978445 Ga0207687_109784451 126
285 3300025928 Ga0207700_10046961 Ga0207700_100469612 126
286 3300025928 Ga0207700_11249638 Ga0207700_112496381 126
287 3300025931 Ga0207644_10175828 Ga0207644_101758283 126
288 3300025932 Ga0207690_10028467 Ga0207690_100284674 126
289 3300025933 Ga0207706_10755812 Ga0207706_107558122 126
290 3300025934 Ga0207686_10005059 Ga0207686_100050596 126
291 3300025934 Ga0207686_10296044 Ga0207686_102960443 126
292 3300025935 Ga0207709_10070859 Ga0207709_100708594 126
293 3300025936 Ga0207670_10307701 Ga0207670_103077013 126
294 3300025940 Ga0207691_10069799 Ga0207691_100697993 126
295 3300025941 Ga0207711_10537141 Ga0207711_105371413 126
296 3300025941 Ga0207711_10719484 Ga0207711_107194842 126
297 3300025944 Ga0207661_10036171 Ga0207661_100361714 126
298 3300025949 Ga0207667_10000011 Ga0207667_10000011168 126
299 3300025949 Ga0207667_10029812 Ga0207667_100298122 126
300 3300025949 Ga0207667_10569642 Ga0207667_105696423 126
301 3300025960 Ga0207651_10148552 Ga0207651_101485521 126
302 3300025981 Ga0207640_10040807 Ga0207640_100408074 126
303 3300025986 Ga0207658_10014985 Ga0207658_100149853 126
304 3300026023 Ga0207677_10197806 Ga0207677_101978062 126
305 3300026023 Ga0207677_10708772 Ga0207677_107087722 126
306 3300026023 Ga0207677_10764443 Ga0207677_107644432 126
307 3300026035 Ga0207703_10117170 Ga0207703_101171703 126
308 3300026041 Ga0207639_10315836 Ga0207639_103158363 126
309 3300026041 Ga0207639_10330850 Ga0207639_103308502 126
310 3300026041 Ga0207639_10609839 Ga0207639_106098393 126
311 3300026067 Ga0207678_10337375 Ga0207678_103373752 126
312 3300026067 Ga0207678_10965736 Ga0207678_109657362 126
313 3300026078 Ga0207702_10109377 Ga0207702_101093774 126
314 3300026078 Ga0207702_11791137 Ga0207702_117911371 126
315 3300026089 Ga0207648_10008012 Ga0207648_100080129 126
316 3300026095 Ga0207676_10584942 Ga0207676_105849422 126
317 3300026095 Ga0207676_11344080 Ga0207676_113440802 126
318 3300026116 Ga0207674_10378088 Ga0207674_103780883 126
319 3300026118 Ga0207675_100331281 Ga0207675_1003312814 126
320 3300026121 Ga0207683_10292888 Ga0207683_102928882 126
321 3300026142 Ga0207698_10001869 Ga0207698_1000186910 126
322 3300026142 Ga0207698_10068701 Ga0207698_100687014 126
323 3300026142 Ga0207698_10846908 Ga0207698_108469082 126
324 3300028379 Ga0268266_10000647 Ga0268266_1000064729 126
325 3300028379 Ga0268266_10021413 Ga0268266_100214137 126
326 3300028379 Ga0268266_10034092 Ga0268266_100340922 126
327 3300028379 Ga0268266_10713162 Ga0268266_107131622 126
328 3300028380 Ga0268265_10428451 Ga0268265_104284513 126
329 3300028380 Ga0268265_11641149 Ga0268265_116411492 126
330 3300028381 Ga0268264_10222921 Ga0268264_102229212 126
331 3300028786 Ga0307517_10364215 Ga0307517_103642152 126
332 3300028800 Ga0265338_10030693 Ga0265338_100306933 126
333 3300031235 Ga0265330_10334150 Ga0265330_103341502 126
334 3300031239 Ga0265328_10392959 Ga0265328_103929591 126
335 3300031240 Ga0265320_10005256 Ga0265320_100052561 126
336 3300031241 Ga0265325_10003316 Ga0265325_100033165 126
337 3300031241 Ga0265325_10007065 Ga0265325_100070654 126
338 3300031247 Ga0265340_10027704 Ga0265340_100277043 126
339 3300031247 Ga0265340_10135698 Ga0265340_101356983 126
340 3300031249 Ga0265339_10002558 Ga0265339_100025587 126
341 3300031249 Ga0265339_10544561 Ga0265339_105445612 126
342 3300031250 Ga0265331_10000003 Ga0265331_10000003144 126
343 3300031250 Ga0265331_10029215 Ga0265331_100292152 126
344 3300031595 Ga0265313_10001748 Ga0265313_1000174810 126
345 3300031595 Ga0265313_10120761 Ga0265313_101207612 126
346 3300031616 Ga0307508_10631639 Ga0307508_106316392 126
347 3300031711 Ga0265314_10019586 Ga0265314_100195863 126
348 3300031711 Ga0265314_10061149 Ga0265314_100611492 126
349 3300031711 Ga0265314_10062244 Ga0265314_100622444 126
350 3300031711 Ga0265314_10074116 Ga0265314_100741163 126
351 3300031712 Ga0265342_10023744 Ga0265342_100237442 126
352 3300031712 Ga0265342_10489448 Ga0265342_104894482 126
353 3300031730 Ga0307516_10094863 Ga0307516_100948632 126
354 3300031730 Ga0307516_10200220 Ga0307516_102002203 126
355 3300035120 Ga0373957_0123275 Ga0373957_0123275_532_918 126
356 3300035724 Ga0373933_0397218 Ga0373933_0397218_191_577 126
357 3300036401 Ga0373937_0496128 Ga0373937_0496128_635_1021 126
358 3300037418 Ga0395900_0418422 Ga0395900_0418422_635_1027 126
359 3300037466 Ga0395898_0292683 Ga0395898_0292683_1031_1423 126
360 3300037471 Ga0395905_1746383 Ga0395905_1746383_82_462 126
361 3300038443 Ga0395901_0202057 Ga0395901_0202057_271_663 126
362 3300039437 Ga0436365_0092617 Ga0436365_0092617_191_571 126
363 3300039450 Ga0436363_0386683 Ga0436363_0386683_101_481 126
364 3300039450 Ga0436363_0399751 Ga0436363_0399751_11823_12209 126
365 3300041441 Ga0451787_288411 Ga0451787_288411_544_924 126
366 3300041443 Ga0451789_0954795 Ga0451789_0954795_367_747 126
367 3300041456 Ga0451795_0469109 Ga0451795_0469109_267_653 126
368 3300041460 Ga0451802_0453160 Ga0451802_0453160_775_1155 126
369 3300041494 Ga0451837_1219519 Ga0451837_1219519_126_506 126
370 3300046454 Ga0495592_0165908 Ga0495592_0165908_495_881 126
371 3300046454 Ga0495592_0659461 Ga0495592_0659461_55_435 126
372 3300046477 Ga0495664_0026635 Ga0495664_0026635_2963_3349 126
373 3300046516 Ga0495628_0062693 Ga0495628_0062693_1058_1444 126
374 3300046529 Ga0495652_0046452 Ga0495652_0046452_419_805 126
375 3300046530 Ga0495654_0202066 Ga0495654_0202066_330_710 126
376 3300046536 Ga0495587_0616704 Ga0495587_0616704_36_416 126
377 3300046543 Ga0495645_0002362 Ga0495645_0002362_8016_8402 126
378 3300046557 Ga0495622_0006512 Ga0495622_0006512_2507_2887 126
379 3300046558 Ga0495633_0369149 Ga0495633_0369149_114_494 126
380 3300046691 Ga0495670_0447428 Ga0495670_0447428_223_603 126
381 3300047444 Ga0495675_0062083 Ga0495675_0062083_393_779 126
382 3300049460 Ga0495682_0003854 Ga0495682_0003854_1941_2327 126
383 3300049568 Ga0501031_0005788 Ga0501031_0005788_6574_6957 126
384 3300049568 Ga0501031_0218402 Ga0501031_0218402_691_1089 126
385 3300049569 Ga0501032_0008519 Ga0501032_0008519_782_1165 126
386 3300049569 Ga0501032_0269207 Ga0501032_0269207_651_1034 126
387 3300049570 Ga0501033_0030976 Ga0501033_0030976_3414_3794 126
388 3300049570 Ga0501033_0031252 Ga0501033_0031252_985_1383 126
389 3300049571 Ga0501034_0001885 Ga0501034_0001885_18226_18609 126
390 3300049571 Ga0501034_0063624 Ga0501034_0063624_3070_3453 126
391 3300049572 Ga0501036_0022094 Ga0501036_0022094_1131_1514 126
392 3300049572 Ga0501036_0590314 Ga0501036_0590314_71_466 126
393 3300049573 Ga0501037_0015196 Ga0501037_0015196_4310_4693 126
394 3300049573 Ga0501037_0083255 Ga0501037_0083255_656_1036 126
395 3300049573 Ga0501037_0206922 Ga0501037_0206922_209_607 126
396 3300049574 Ga0501038_0005734 Ga0501038_0005734_4704_5087 126
397 3300049574 Ga0501038_0531747 Ga0501038_0531747_257_652 126
398 3300049575 Ga0501039_0477958 Ga0501039_0477958_50_433 126
399 3300049575 Ga0501039_1302835 Ga0501039_1302835_18_401 126
400 3300049576 Ga0501040_0688167 Ga0501040_0688167_105_488 126
401 3300049578 Ga0501042_0030584 Ga0501042_0030584_1717_2100 126
402 3300049579 Ga0501043_0153798 Ga0501043_0153798_635_1018 126
403 3300049579 Ga0501043_0201910 Ga0501043_0201910_315_695 126
404 3300049579 Ga0501043_0441777 Ga0501043_0441777_82_465 126
405 3300049580 Ga0501046_0008695 Ga0501046_0008695_8236_8619 126
406 3300049580 Ga0501046_0053148 Ga0501046_0053148_1352_1732 126
407 3300049580 Ga0501046_0453446 Ga0501046_0453446_47_433 126
408 3300049580 Ga0501046_0894298 Ga0501046_0894298_92_487 126
409 3300049581 Ga0501047_0012566 Ga0501047_0012566_5349_5729 126
410 3300049581 Ga0501047_0013767 Ga0501047_0013767_2271_2669 126
411 3300049581 Ga0501047_0015474 Ga0501047_0015474_6312_6695 126
412 3300049581 Ga0501047_0186059 Ga0501047_0186059_617_1012 126
413 3300049582 Ga0501048_0005128 Ga0501048_0005128_6563_6946 126
414 3300049582 Ga0501048_0050571 Ga0501048_0050571_1059_1442 126
415 3300049582 Ga0501048_1069953 Ga0501048_1069953_158_538 126
416 3300049583 Ga0501067_0073927 Ga0501067_0073927_1381_1764 126
417 3300049584 Ga0501068_0055183 Ga0501068_0055183_162_545 126
418 3300049584 Ga0501068_0229085 Ga0501068_0229085_533_913 126
419 3300049586 Ga0501070_0023231 Ga0501070_0023231_1120_1503 126
420 3300049586 Ga0501070_1083924 Ga0501070_1083924_58_441 126
421 3300049589 Ga0501073_0000591 Ga0501073_0000591_23941_24324 126
422 3300049590 Ga0501074_0151359 Ga0501074_0151359_141_524 126
423 3300049590 Ga0501074_0851853 Ga0501074_0851853_80_463 126
424 3300049741 Ga0501079_0007012 Ga0501079_0007012_93_476 126
425 3300049742 Ga0501080_0022421 Ga0501080_0022421_1020_1406 126
426 3300049742 Ga0501080_0228160 Ga0501080_0228160_1290_1673 126
427 3300049742 Ga0501080_0243284 Ga0501080_0243284_961_1356 126
428 3300049743 Ga0501081_0108911 Ga0501081_0108911_368_760 126
429 3300049744 Ga0501083_0187173 Ga0501083_0187173_552_935 126
430 3300049744 Ga0501083_0302853 Ga0501083_0302853_586_978 126
431 3300049822 Ga0501035_0029713 Ga0501035_0029713_4011_4409 126
432 3300049822 Ga0501035_0037128 Ga0501035_0037128_782_1165 126
433 3300049822 Ga0501035_0046055 Ga0501035_0046055_1726_2106 126
434 3300049822 Ga0501035_0259818 Ga0501035_0259818_752_1147 126
435 3300049822 Ga0501035_0528879 Ga0501035_0528879_524_922 126
436 3300049822 Ga0501035_0936617 Ga0501035_0936617_173_556 126
437 3300049823 Ga0501044_0001938 Ga0501044_0001938_12319_12699 126
438 3300049823 Ga0501044_0014944 Ga0501044_0014944_4713_5111 126
439 3300049823 Ga0501044_0025516 Ga0501044_0025516_4692_5075 126
440 3300049823 Ga0501044_0072205 Ga0501044_0072205_819_1214 126
441 3300049823 Ga0501044_0138616 Ga0501044_0138616_977_1375 126
442 3300049823 Ga0501044_0432555 Ga0501044_0432555_823_1206 126
443 3300049823 Ga0501044_0899537 Ga0501044_0899537_338_721 126
444 3300049823 Ga0501044_1112392 Ga0501044_1112392_81_479 126
445 3300049824 Ga0501045_0427038 Ga0501045_0427038_214_597 126
446 3300049824 Ga0501045_0850001 Ga0501045_0850001_58_438 126
447 3300053080 Ga0500635_0102338 Ga0500635_0102338_569_949 126
448 3300053096 Ga0500641_0010391 Ga0500641_0010391_1455_1835 126
449 3300053118 Ga0500594_0060504 Ga0500594_0060504_342_722 126
450 3300053119 Ga0500595_006042 Ga0500595_006042_1472_1852 126
451 3300053133 Ga0500655_127362 Ga0500655_127362_43_429 126
452 3300053136 Ga0500559_0035318 Ga0500559_0035318_1673_2068 126
453 3300053140 Ga0500573_0000008 Ga0500573_0000008_229617_230000 126
454 3300053151 Ga0500604_0106236 Ga0500604_0106236_328_708 126
455 3300053163 Ga0500639_018148 Ga0500639_018148_1452_1832 126
456 3300054114 Ga0501084_0006291 Ga0501084_0006291_1135_1518 126
457 3300054114 Ga0501084_1481446 Ga0501084_1481446_24_404 126
458 3300060353 Ga0501082_0314265 Ga0501082_0314265_914_1294 126
459 3300060353 Ga0501082_0912024 Ga0501082_0912024_141_524 126
460 3300003214 JGI25165J46597_1000036 JGI25165J46597_100003630 127
461 3300005327 Ga0070658_10102858 Ga0070658_101028582 127
462 3300005334 Ga0068869_100547244 Ga0068869_1005472441 127
463 3300005336 Ga0070680_100072469 Ga0070680_1000724694 127
464 3300005337 Ga0070682_100250601 Ga0070682_1002506012 127
465 3300005339 Ga0070660_100260202 Ga0070660_1002602021 127
466 3300005339 Ga0070660_101397091 Ga0070660_1013970911 127
467 3300005341 Ga0070691_10001038 Ga0070691_100010385 127
468 3300005341 Ga0070691_10037486 Ga0070691_100374864 127
469 3300005344 Ga0070661_100975057 Ga0070661_1009750571 127
470 3300005434 Ga0070709_10001050 Ga0070709_100010504 127
471 3300005434 Ga0070709_10035060 Ga0070709_100350603 127
472 3300005435 Ga0070714_100047577 Ga0070714_1000475773 127
473 3300005435 Ga0070714_101451768 Ga0070714_1014517682 127
474 3300005436 Ga0070713_100000004 Ga0070713_100000004174 127
475 3300005436 Ga0070713_100269457 Ga0070713_1002694572 127
476 3300005439 Ga0070711_100004994 Ga0070711_1000049949 127
477 3300005444 Ga0070694_100508823 Ga0070694_1005088232 127
478 3300005455 Ga0070663_101435082 Ga0070663_1014350821 127
479 3300005455 Ga0070663_101998640 Ga0070663_1019986401 127
480 3300005456 Ga0070678_100003363 Ga0070678_1000033635 127
481 3300005456 Ga0070678_100222930 Ga0070678_1002229302 127
482 3300005458 Ga0070681_10197855 Ga0070681_101978553 127
483 3300005458 Ga0070681_11176577 Ga0070681_111765771 127
484 3300005459 Ga0068867_100008753 Ga0068867_1000087533 127
485 3300005530 Ga0070679_100179253 Ga0070679_1001792533 127
486 3300005530 Ga0070679_100273622 Ga0070679_1002736222 127
487 3300005535 Ga0070684_100414432 Ga0070684_1004144321 127
488 3300005539 Ga0068853_100037181 Ga0068853_1000371812 127
489 3300005539 Ga0068853_100204305 Ga0068853_1002043051 127
490 3300005545 Ga0070695_100291022 Ga0070695_1002910222 127
491 3300005547 Ga0070693_100291274 Ga0070693_1002912741 127
492 3300005547 Ga0070693_100496561 Ga0070693_1004965611 127
493 3300005548 Ga0070665_100758309 Ga0070665_1007583092 127
494 3300005563 Ga0068855_100014305 Ga0068855_10001430512 127
495 3300005564 Ga0070664_100113906 Ga0070664_1001139062 127
496 3300005577 Ga0068857_100000944 Ga0068857_1000009442 127
497 3300005578 Ga0068854_100921864 Ga0068854_1009218642 127
498 3300005614 Ga0068856_100000144 Ga0068856_10000014434 127
499 3300005614 Ga0068856_100008455 Ga0068856_1000084554 127
500 3300005616 Ga0068852_100005341 Ga0068852_1000053415 127
501 3300005618 Ga0068864_101944153 Ga0068864_1019441531 127
502 3300005618 Ga0068864_102555927 Ga0068864_1025559272 127
503 3300005842 Ga0068858_100398009 Ga0068858_1003980093 127
504 3300005842 Ga0068858_100578048 Ga0068858_1005780482 127
505 3300006173 Ga0070716_100004517 Ga0070716_1000045177 127
506 3300006175 Ga0070712_100000293 Ga0070712_1000002938 127
507 3300006175 Ga0070712_100000567 Ga0070712_10000056711 127
508 3300006237 Ga0097621_100031007 Ga0097621_1000310075 127
509 3300006353 Ga0075370_10946794 Ga0075370_109467941 127
510 3300006358 Ga0068871_100002461 Ga0068871_1000024615 127
511 3300006358 Ga0068871_100047905 Ga0068871_1000479055 127
512 3300006358 Ga0068871_100778371 Ga0068871_1007783712 127
513 3300006871 Ga0075434_100068597 Ga0075434_1000685971 127
514 3300006881 Ga0068865_100003070 Ga0068865_1000030706 127
515 3300006881 Ga0068865_100268072 Ga0068865_1002680722 127
516 3300006881 Ga0068865_102125099 Ga0068865_1021250991 127
517 3300006914 Ga0075436_100000574 Ga0075436_10000057416 127
518 3300009093 Ga0105240_10006228 Ga0105240_100062286 127
519 3300009093 Ga0105240_10013961 Ga0105240_100139615 127
520 3300009093 Ga0105240_10027753 Ga0105240_100277536 127
521 3300009093 Ga0105240_10059899 Ga0105240_100598997 127
522 3300009098 Ga0105245_10123480 Ga0105245_101234803 127
523 3300009098 Ga0105245_10457093 Ga0105245_104570933 127
524 3300009148 Ga0105243_10377019 Ga0105243_103770193 127
525 3300009174 Ga0105241_10001171 Ga0105241_1000117119 127
526 3300009174 Ga0105241_10034332 Ga0105241_100343323 127
527 3300009174 Ga0105241_10139417 Ga0105241_101394173 127
528 3300009174 Ga0105241_12082036 Ga0105241_120820361 127
529 3300009176 Ga0105242_10040101 Ga0105242_100401014 127
530 3300009177 Ga0105248_10000005 Ga0105248_10000005534 127
531 3300009177 Ga0105248_10148288 Ga0105248_101482883 127
532 3300009545 Ga0105237_10016366 Ga0105237_100163664 127
533 3300009545 Ga0105237_10017309 Ga0105237_100173095 127
534 3300009545 Ga0105237_10116422 Ga0105237_101164222 127
535 3300009545 Ga0105237_10581763 Ga0105237_105817633 127
536 3300009551 Ga0105238_10000847 Ga0105238_1000084717 127
537 3300009551 Ga0105238_10006764 Ga0105238_100067647 127
538 3300009551 Ga0105238_10077477 Ga0105238_100774775 127
539 3300009553 Ga0105249_12674259 Ga0105249_126742591 127
540 3300010375 Ga0105239_10026010 Ga0105239_100260103 127
541 3300010375 Ga0105239_12377441 Ga0105239_123774412 127
542 3300010375 Ga0105239_13452461 Ga0105239_134524612 127
543 3300011119 Ga0105246_10020517 Ga0105246_100205174 127
544 3300013100 Ga0157373_10001245 Ga0157373_1000124516 127
545 3300013100 Ga0157373_10425485 Ga0157373_104254852 127
546 3300013100 Ga0157373_10441226 Ga0157373_104412262 127
547 3300013100 Ga0157373_11313114 Ga0157373_113131141 127
548 3300013104 Ga0157370_10124379 Ga0157370_101243794 127
549 3300013104 Ga0157370_10151238 Ga0157370_101512383 127
550 3300013105 Ga0157369_10010560 Ga0157369_100105607 127
551 3300013105 Ga0157369_10258050 Ga0157369_102580502 127
552 3300013296 Ga0157374_10017187 Ga0157374_100171871 127
553 3300013296 Ga0157374_10201534 Ga0157374_102015344 127
554 3300013296 Ga0157374_10547475 Ga0157374_105474752 127
555 3300013297 Ga0157378_10115124 Ga0157378_101151243 127
556 3300013297 Ga0157378_10274718 Ga0157378_102747182 127
557 3300013306 Ga0163162_10018224 Ga0163162_100182244 127
558 3300013306 Ga0163162_10419140 Ga0163162_104191401 127
559 3300013306 Ga0163162_11348922 Ga0163162_113489222 127
560 3300013307 Ga0157372_10027681 Ga0157372_100276816 127
561 3300013307 Ga0157372_10079972 Ga0157372_100799724 127
562 3300013308 Ga0157375_10060295 Ga0157375_100602953 127
563 3300014325 Ga0163163_10000749 Ga0163163_1000074912 127
564 3300014325 Ga0163163_10363567 Ga0163163_103635672 127
565 3300014497 Ga0182008_10071439 Ga0182008_100714394 127
566 3300014968 Ga0157379_10013204 Ga0157379_100132043 127
567 3300014968 Ga0157379_10066395 Ga0157379_100663953 127
568 3300014969 Ga0157376_10007605 Ga0157376_100076056 127
569 3300014969 Ga0157376_10590660 Ga0157376_105906602 127
570 3300015262 Ga0182007_10032755 Ga0182007_100327552 127
571 3300017792 Ga0163161_10003667 Ga0163161_100036676 127
572 3300020082 Ga0206353_11572703 Ga0206353_115727032 127
573 3300022467 Ga0224712_10050003 Ga0224712_100500033 127
574 3300025231 Ga0207427_125719 Ga0207427_1257192 127
575 3300025261 Ga0209233_1000015 Ga0209233_1000015808 127
576 3300025261 Ga0209233_1002328 Ga0209233_10023288 127
577 3300025893 Ga0207682_10456249 Ga0207682_104562491 127
578 3300025901 Ga0207688_10021217 Ga0207688_100212172 127
579 3300025906 Ga0207699_10011324 Ga0207699_100113243 127
580 3300025909 Ga0207705_10000391 Ga0207705_100003919 127
581 3300025911 Ga0207654_10008441 Ga0207654_100084414 127
582 3300025911 Ga0207654_10258215 Ga0207654_102582152 127
583 3300025911 Ga0207654_10813977 Ga0207654_108139771 127
584 3300025912 Ga0207707_10054666 Ga0207707_100546663 127
585 3300025912 Ga0207707_10268445 Ga0207707_102684451 127
586 3300025913 Ga0207695_10032634 Ga0207695_100326344 127
587 3300025913 Ga0207695_10035110 Ga0207695_100351105 127
588 3300025914 Ga0207671_10015697 Ga0207671_100156972 127
589 3300025914 Ga0207671_10115634 Ga0207671_101156344 127
590 3300025915 Ga0207693_10000163 Ga0207693_100001639 127
591 3300025915 Ga0207693_10001708 Ga0207693_100017085 127
592 3300025916 Ga0207663_10304756 Ga0207663_103047562 127
593 3300025917 Ga0207660_10073518 Ga0207660_100735181 127
594 3300025917 Ga0207660_10173152 Ga0207660_101731522 127
595 3300025919 Ga0207657_10011605 Ga0207657_1001160512 127
596 3300025919 Ga0207657_10087811 Ga0207657_100878113 127
597 3300025920 Ga0207649_10681171 Ga0207649_106811712 127
598 3300025920 Ga0207649_10780515 Ga0207649_107805152 127
599 3300025921 Ga0207652_10024819 Ga0207652_100248191 127
600 3300025921 Ga0207652_10081972 Ga0207652_100819724 127
601 3300025924 Ga0207694_11105735 Ga0207694_111057352 127
602 3300025926 Ga0207659_11256989 Ga0207659_112569891 127
603 3300025927 Ga0207687_10075870 Ga0207687_100758703 127
604 3300025928 Ga0207700_10000011 Ga0207700_10000011133 127
605 3300025928 Ga0207700_10239471 Ga0207700_102394712 127
606 3300025929 Ga0207664_10168344 Ga0207664_101683444 127
607 3300025931 Ga0207644_10281339 Ga0207644_102813393 127
608 3300025932 Ga0207690_10615486 Ga0207690_106154862 127
609 3300025934 Ga0207686_10017234 Ga0207686_100172343 127
610 3300025934 Ga0207686_10531157 Ga0207686_105311572 127
611 3300025938 Ga0207704_10002288 Ga0207704_100022885 127
612 3300025938 Ga0207704_10154288 Ga0207704_101542884 127
613 3300025938 Ga0207704_10354204 Ga0207704_103542041 127
614 3300025939 Ga0207665_10105393 Ga0207665_101053932 127
615 3300025940 Ga0207691_10476763 Ga0207691_104767632 127
616 3300025941 Ga0207711_10000002 Ga0207711_10000002531 127
617 3300025941 Ga0207711_10687653 Ga0207711_106876532 127
618 3300025945 Ga0207679_10120435 Ga0207679_101204353 127
619 3300025949 Ga0207667_10011191 Ga0207667_100111916 127
620 3300025949 Ga0207667_10914069 Ga0207667_109140692 127
621 3300025960 Ga0207651_10420047 Ga0207651_104200472 127
622 3300025981 Ga0207640_10880833 Ga0207640_108808332 127
623 3300026023 Ga0207677_10100309 Ga0207677_101003092 127
624 3300026035 Ga0207703_10435695 Ga0207703_104356952 127
625 3300026041 Ga0207639_10034281 Ga0207639_100342814 127
626 3300026041 Ga0207639_10039639 Ga0207639_100396394 127
627 3300026067 Ga0207678_11305186 Ga0207678_113051861 127
628 3300026078 Ga0207702_10000226 Ga0207702_1000022626 127
629 3300026078 Ga0207702_10008271 Ga0207702_100082717 127
630 3300026088 Ga0207641_10806212 Ga0207641_108062121 127
631 3300026089 Ga0207648_10003109 Ga0207648_100031097 127
632 3300026089 Ga0207648_10118436 Ga0207648_101184364 127
633 3300026095 Ga0207676_10553043 Ga0207676_105530432 127
634 3300026116 Ga0207674_10000261 Ga0207674_1000026151 127
635 3300026121 Ga0207683_10012952 Ga0207683_100129522 127
636 3300026121 Ga0207683_10030570 Ga0207683_100305702 127
637 3300026142 Ga0207698_10161414 Ga0207698_101614143 127
638 3300026142 Ga0207698_10262598 Ga0207698_102625982 127
639 3300028573 Ga0265334_10019977 Ga0265334_100199774 127
640 3300028573 Ga0265334_10111438 Ga0265334_101114381 127
641 3300028577 Ga0265318_10000104 Ga0265318_1000010466 127
642 3300028577 Ga0265318_10001589 Ga0265318_100015895 127
643 3300028800 Ga0265338_10000005 Ga0265338_10000005364 127
644 3300031235 Ga0265330_10283295 Ga0265330_102832952 127
645 3300031238 Ga0265332_10048019 Ga0265332_100480192 127
646 3300031239 Ga0265328_10120050 Ga0265328_101200503 127
647 3300031239 Ga0265328_10188597 Ga0265328_101885972 127
648 3300031241 Ga0265325_10000005 Ga0265325_10000005153 127
649 3300031241 Ga0265325_10000098 Ga0265325_1000009819 127
650 3300031242 Ga0265329_10017187 Ga0265329_100171872 127
651 3300031247 Ga0265340_10192219 Ga0265340_101922192 127
652 3300031247 Ga0265340_10408146 Ga0265340_104081461 127
653 3300031249 Ga0265339_10002598 Ga0265339_100025989 127
654 3300031249 Ga0265339_10010635 Ga0265339_100106353 127
655 3300031249 Ga0265339_10078354 Ga0265339_100783544 127
656 3300031250 Ga0265331_10011578 Ga0265331_100115785 127
657 3300031250 Ga0265331_10044112 Ga0265331_100441122 127
658 3300031251 Ga0265327_10000187 Ga0265327_1000018759 127
659 3300031344 Ga0265316_10023813 Ga0265316_100238132 127
660 3300031344 Ga0265316_10131928 Ga0265316_101319282 127
661 3300031344 Ga0265316_10338785 Ga0265316_103387852 127
662 3300031595 Ga0265313_10003640 Ga0265313_100036405 127
663 3300031595 Ga0265313_10003817 Ga0265313_100038175 127
664 3300031595 Ga0265313_10021395 Ga0265313_100213956 127
665 3300031595 Ga0265313_10060125 Ga0265313_100601252 127
666 3300031711 Ga0265314_10000835 Ga0265314_1000083519 127
667 3300031711 Ga0265314_10040827 Ga0265314_100408276 127
668 3300031711 Ga0265314_10469287 Ga0265314_104692871 127
669 3300031712 Ga0265342_10057095 Ga0265342_100570954 127
670 3300031712 Ga0265342_10090739 Ga0265342_100907393 127
671 3300031712 Ga0265342_10350710 Ga0265342_103507101 127
672 3300031712 Ga0265342_10352258 Ga0265342_103522582 127
673 3300035111 Ga0373923_0109988 Ga0373923_0109988_443_835 127
674 3300035112 Ga0373932_0202524 Ga0373932_0202524_43_435 127
675 3300035120 Ga0373957_0165100 Ga0373957_0165100_511_903 127
676 3300035120 Ga0373957_0308564 Ga0373957_0308564_55_444 127
677 3300035172 Ga0373955_0132113 Ga0373955_0132113_371_763 127
678 3300035172 Ga0373955_0333394 Ga0373955_0333394_107_499 127
679 3300035692 Ga0373935_0669881 Ga0373935_0669881_169_561 127
680 3300035695 Ga0373927_0321531 Ga0373927_0321531_195_587 127
681 3300035724 Ga0373933_0032349 Ga0373933_0032349_2058_2450 127
682 3300036401 Ga0373937_0004668 Ga0373937_0004668_4605_4997 127
683 3300036401 Ga0373937_0162549 Ga0373937_0162549_1370_1762 127
684 3300036401 Ga0373937_0492173 Ga0373937_0492173_168_572 127
685 3300036401 Ga0373937_0642063 Ga0373937_0642063_81_470 127
686 3300037068 Ga0373925_0068645 Ga0373925_0068645_1065_1457 127
687 3300037068 Ga0373925_0817886 Ga0373925_0817886_34_426 127
688 3300037418 Ga0395900_1264769 Ga0395900_1264769_105_503 127
689 3300037466 Ga0395898_0079034 Ga0395898_0079034_2394_2792 127
690 3300038443 Ga0395901_0227683 Ga0395901_0227683_1184_1582 127
691 3300039437 Ga0436365_0495986 Ga0436365_0495986_45186_45620 127
692 3300039437 Ga0436365_0906980 Ga0436365_0906980_1096_1503 127
693 3300039437 Ga0436365_1052743 Ga0436365_1052743_33_422 127
694 3300039450 Ga0436363_1061920 Ga0436363_1061920_261_656 127
695 3300039453 Ga0436362_1209966 Ga0436362_1209966_245_652 127
696 3300041496 Ga0451839_1546439 Ga0451839_1546439_12_401 127
697 3300041512 Ga0451853_0937228 Ga0451853_0937228_178_561 127
698 3300044842 Ga0466957_0096925 Ga0466957_0096925_877_1260 127
699 3300046462 Ga0495651_0323469 Ga0495651_0323469_435_824 127
700 3300046535 Ga0495586_0227444 Ga0495586_0227444_649_1038 127
701 3300046536 Ga0495587_0414874 Ga0495587_0414874_76_468 127
702 3300046660 Ga0495625_0269624 Ga0495625_0269624_271_654 127
703 3300046680 Ga0495646_0575361 Ga0495646_0575361_148_546 127
704 3300046689 Ga0495613_0729317 Ga0495613_0729317_175_558 127
705 3300046809 Ga0495600_0610153 Ga0495600_0610153_183_587 127
706 3300047321 Ga0495676_0394025 Ga0495676_0394025_357_752 127
707 3300047444 Ga0495675_0430237 Ga0495675_0430237_109_501 127
708 3300047471 Ga0495684_0322563 Ga0495684_0322563_692_1087 127
709 3300048088 Ga0495602_0048635 Ga0495602_0048635_996_1388 127
710 3300048088 Ga0495602_0171887 Ga0495602_0171887_575_979 127
711 3300048909 Ga0496106_1136727 Ga0496106_1136727_144_536 127
712 3300048911 Ga0496108_0880785 Ga0496108_0880785_69_461 127
713 3300048914 Ga0496111_0644297 Ga0496111_0644297_351_743 127
714 3300048929 Ga0496126_0000498 Ga0496126_0000498_35909_36304 127
715 3300048929 Ga0496126_0053473 Ga0496126_0053473_2920_3303 127
716 3300049568 Ga0501031_0622085 Ga0501031_0622085_207_596 127
717 3300049569 Ga0501032_0116827 Ga0501032_0116827_36_425 127
718 3300049569 Ga0501032_0156000 Ga0501032_0156000_950_1339 127
719 3300049570 Ga0501033_0020678 Ga0501033_0020678_3514_3900 127
720 3300049570 Ga0501033_0024643 Ga0501033_0024643_3832_4221 127
721 3300049570 Ga0501033_0134629 Ga0501033_0134629_73_474 127
722 3300049570 Ga0501033_0182168 Ga0501033_0182168_40_441 127
723 3300049570 Ga0501033_0750930 Ga0501033_0750930_64_468 127
724 3300049571 Ga0501034_0016559 Ga0501034_0016559_753_1142 127
725 3300049571 Ga0501034_0125059 Ga0501034_0125059_100_486 127
726 3300049572 Ga0501036_0066074 Ga0501036_0066074_960_1349 127
727 3300049572 Ga0501036_0644289 Ga0501036_0644289_10_399 127
728 3300049573 Ga0501037_0096500 Ga0501037_0096500_1378_1767 127
729 3300049573 Ga0501037_0725636 Ga0501037_0725636_246_635 127
730 3300049574 Ga0501038_0112540 Ga0501038_0112540_46_435 127
731 3300049578 Ga0501042_0239301 Ga0501042_0239301_725_1114 127
732 3300049579 Ga0501043_0088740 Ga0501043_0088740_317_706 127
733 3300049579 Ga0501043_0179083 Ga0501043_0179083_981_1382 127
734 3300049579 Ga0501043_0353577 Ga0501043_0353577_290_679 127
735 3300049580 Ga0501046_0188205 Ga0501046_0188205_1039_1428 127
736 3300049580 Ga0501046_1174943 Ga0501046_1174943_123_512 127
737 3300049581 Ga0501047_0013897 Ga0501047_0013897_3317_3706 127
738 3300049581 Ga0501047_0119204 Ga0501047_0119204_1702_2091 127
739 3300049581 Ga0501047_0244246 Ga0501047_0244246_1176_1580 127
740 3300049585 Ga0501069_0005058 Ga0501069_0005058_4953_5342 127
741 3300049585 Ga0501069_0227791 Ga0501069_0227791_52_441 127
742 3300049586 Ga0501070_0000002 Ga0501070_0000002_238273_238662 127
743 3300049586 Ga0501070_0224089 Ga0501070_0224089_865_1254 127
744 3300049586 Ga0501070_0696583 Ga0501070_0696583_115_519 127
745 3300049586 Ga0501070_0840399 Ga0501070_0840399_12_401 127
746 3300049587 Ga0501071_0074730 Ga0501071_0074730_1058_1447 127
747 3300049589 Ga0501073_0056012 Ga0501073_0056012_1604_1993 127
748 3300049589 Ga0501073_0715772 Ga0501073_0715772_225_614 127
749 3300049590 Ga0501074_0948069 Ga0501074_0948069_46_435 127
750 3300049741 Ga0501079_0009069 Ga0501079_0009069_6392_6781 127
751 3300049742 Ga0501080_0019069 Ga0501080_0019069_4880_5269 127
752 3300049742 Ga0501080_0114163 Ga0501080_0114163_2060_2461 127
753 3300049742 Ga0501080_0146898 Ga0501080_0146898_1025_1414 127
754 3300049744 Ga0501083_0472986 Ga0501083_0472986_124_513 127
755 3300049744 Ga0501083_0560191 Ga0501083_0560191_212_601 127
756 3300049822 Ga0501035_0190858 Ga0501035_0190858_333_722 127
757 3300049822 Ga0501035_0338384 Ga0501035_0338384_764_1168 127
758 3300049822 Ga0501035_0684787 Ga0501035_0684787_44_445 127
759 3300049822 Ga0501035_0959340 Ga0501035_0959340_203_586 127
760 3300049823 Ga0501044_0000378 Ga0501044_0000378_226_621 127
761 3300049823 Ga0501044_0029793 Ga0501044_0029793_680_1069 127
762 3300049823 Ga0501044_0354356 Ga0501044_0354356_489_890 127
763 3300050512 nmdc:mga0n895_99325_c1 nmdc:mga0n895_99325_c1_34_426 127
764 3300050513 nmdc:mga0rr50_986899_c1 nmdc:mga0rr50_986899_c1_70_462 127
765 3300050514 nmdc:mga08x19_129_c1 nmdc:mga08x19_129_c1_38174_38566 127
766 3300050514 nmdc:mga08x19_44031_c1 nmdc:mga08x19_44031_c1_271_663 127
767 3300053077 Ga0495601_0672152 Ga0495601_0672152_209_604 127
768 3300053087 Ga0500643_000003 Ga0500643_000003_564566_564949 127
769 3300053111 Ga0500572_064930 Ga0500572_064930_350_733 127
770 3300053119 Ga0500595_000529 Ga0500595_000529_1567_1950 127
771 3300053119 Ga0500595_015050 Ga0500595_015050_880_1263 127
772 3300053139 Ga0500568_0100091 Ga0500568_0100091_209_592 127
773 3300053727 Ga0500611_091443 Ga0500611_091443_145_528 127
774 3300054114 Ga0501084_0000017 Ga0501084_0000017_106768_107163 127
775 3300054114 Ga0501084_0135930 Ga0501084_0135930_669_1058 127
776 3300060353 Ga0501082_0050887 Ga0501082_0050887_787_1176 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

19

122

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.9003 14 110
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9001 16 109
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8994 16 111
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8835 14 110
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8736 16 111
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9001 16 109 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8994 16 111 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8976 16 118 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8936 16 99 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8819 16 109 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9134 16 111 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A354F7K9-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.902 15 107 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A1Z9F9J3-F1-model_v4 deleted 0.8973 14 118
AF-A0A7V7T2I1-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8966 16 118 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A1S3PKP3-F1-model_v4 Iron-sulfur cluster assembly 1 homolog, mitochondrial 0.8959 16 118 GO:0005739
GO:0016226
GO:0051537
GO:0097428

Feature Viewer

pLDDT pTM Quality
81 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map