F480300

General Info

Members Datasets Scaffolds Average Seq Length
776 312 776 335

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10012728|Ga0081539_100127282
Length 365
Sequence MAVIRDVMPAFELLQPTTVSGALELLDRHGASAWVLAGGLDSFDWLKDRIRRPSAVVDLSGIADLKGVRPWQDGVEIGAMTTVTEVVRNATVGERFGLLRQAAELVASPQIRNQGTIGGNVTQDTRCWYYRAGWSCYRAGGNICYADTPQSLNREHAILEADRCVAVSPSDTAPALVALDASMVLQSRAGERIVPAEEYFIGPGTDITRMTALRRGELLTAIRIPGTWAGAQFYFEKIRDRNVWDFALMSVASAMVLKDAAPPRPRDTVTLGDASTLPEAQQRAGVATIERIRLVVNGAAARPLRLAAVERLVAGRPRNEETATAAGALAIEGAQPLHHNAYKVPLMRNLVKRAIRGVEEGPWIS

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.48
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10012497 3300002459 Bacteria 1751
2 JGI25406J46586_10002645 3300003203 Bacteria 8438
3 Ga0065707_10041103 3300005295 Bacteria 1560
4 Ga0070676_10106260 3300005328 Bacteria 1741
5 Ga0070676_10271725 3300005328 Bacteria 1139
6 Ga0070683_100294848 3300005329 Bacteria 1542
7 Ga0070690_100111970 3300005330 Bacteria 1823
8 Ga0070670_100157523 3300005331 Bacteria 1967
9 Ga0070677_10062373 3300005333 Bacteria 1542
10 Ga0068869_100051719 3300005334 Unclassified 2980
11 Ga0068869_100061516 3300005334 Bacteria 2755
12 Ga0070680_100053213 3300005336 Unclassified 3304
13 Ga0070680_100067149 3300005336 Bacteria 2941
14 Ga0070682_100024660 3300005337 Bacteria 3581
15 Ga0070682_100340759 3300005337 Unclassified 1114
16 Ga0068868_100045403 3300005338 Bacteria 3437
17 Ga0070660_100113116 3300005339 Bacteria 2161
18 Ga0070689_100189499 3300005340 Bacteria 1674
19 Ga0070689_100235097 3300005340 Bacteria 1508
20 Ga0070691_10005581 3300005341 Bacteria 5726
21 Ga0070687_100078599 3300005343 Bacteria 1793
22 Ga0070692_10024643 3300005345 Bacteria 2958
23 Ga0070668_100065785 3300005347 Bacteria 2812
24 Ga0070668_100109683 3300005347 Bacteria 2196
25 Ga0070669_100032776 3300005353 Bacteria 3753
26 Ga0070671_100382407 3300005355 Unclassified 1203
27 Ga0070674_100003835 3300005356 Bacteria 8506
28 Ga0070673_100060792 3300005364 Unclassified 2995
29 Ga0070673_100318646 3300005364 Bacteria 1373
30 Ga0070688_100020848 3300005365 Bacteria 3819
31 Ga0070667_100022899 3300005367 Bacteria 5180
32 Ga0070667_100086958 3300005367 Bacteria 2682
33 Ga0070709_10001162 3300005434 Bacteria 14434
34 Ga0070709_10009577 3300005434 Bacteria 5348
35 Ga0070709_10018121 3300005434 Bacteria 4049
36 Ga0070709_10018523 3300005434 Bacteria 4011
37 Ga0070709_10348093 3300005434 Bacteria 1094
38 Ga0070714_100066117 3300005435 Unclassified 3116
39 Ga0070714_100194810 3300005435 Bacteria 1851
40 Ga0070713_100000476 3300005436 Bacteria 25546
41 Ga0070713_100001852 3300005436 Bacteria 13636
42 Ga0070713_100002307 3300005436 Bacteria 12414
43 Ga0070713_100014557 3300005436 Bacteria 5849
44 Ga0070713_100027599 3300005436 Bacteria 4471
45 Ga0070713_100056670 3300005436 Bacteria 3260
46 Ga0070701_10016141 3300005438 Bacteria 3464
47 Ga0070711_100000281 3300005439 Bacteria 26309
48 Ga0070711_100001229 3300005439 Bacteria 13841
49 Ga0070711_100005753 3300005439 Bacteria 7438
50 Ga0070711_100020727 3300005439 Unclassified 4241
51 Ga0070711_100030637 3300005439 Unclassified 3564
52 Ga0070711_100033648 3300005439 Bacteria 3414
53 Ga0070711_100035103 3300005439 Bacteria 3350
54 Ga0070705_100007431 3300005440 Bacteria 5390
55 Ga0070705_100072171 3300005440 Bacteria 2091
56 Ga0070700_100030983 3300005441 Bacteria 3201
57 Ga0070700_100035471 3300005441 Bacteria 3019
58 Ga0070700_100139883 3300005441 Bacteria 1644
59 Ga0070694_100000103 3300005444 Bacteria 41036
60 Ga0070694_100001652 3300005444 Bacteria 13112
61 Ga0070694_100071059 3300005444 Unclassified 2398
62 Ga0070694_100160578 3300005444 Bacteria 1649
63 Ga0070708_100003651 3300005445 Bacteria 12067
64 Ga0070708_100006273 3300005445 Bacteria 9458
65 Ga0070708_100066556 3300005445 Bacteria 3234
66 Ga0070708_100107291 3300005445 Bacteria 2564
67 Ga0070708_100340903 3300005445 Bacteria 1412
68 Ga0070678_100114027 3300005456 Bacteria 2120
69 Ga0070678_100171427 3300005456 Bacteria 1768
70 Ga0070662_100169068 3300005457 Bacteria 1716
71 Ga0070681_10001282 3300005458 Bacteria 21908
72 Ga0068867_100024565 3300005459 Bacteria 4319
73 Ga0068867_100060541 3300005459 Bacteria 2809
74 Ga0068867_100115803 3300005459 Unclassified 2065
75 Ga0068867_100150388 3300005459 Bacteria 1828
76 Ga0070685_10050585 3300005466 Unclassified 2401
77 Ga0070685_10213936 3300005466 Bacteria 1260
78 Ga0070706_100000336 3300005467 Bacteria 56986
79 Ga0070706_100002094 3300005467 Bacteria 20343
80 Ga0070706_100011620 3300005467 Bacteria 8181
81 Ga0070706_100049856 3300005467 Bacteria 3863
82 Ga0070706_100132967 3300005467 Bacteria 2322
83 Ga0070706_100167294 3300005467 Bacteria 2053
84 Ga0070707_100019771 3300005468 Bacteria 6347
85 Ga0070707_100021052 3300005468 Bacteria 6159
86 Ga0070707_100101946 3300005468 Bacteria 2781
87 Ga0070698_100003114 3300005471 Bacteria 18289
88 Ga0070698_100004515 3300005471 Bacteria 15295
89 Ga0070698_100005969 3300005471 Bacteria 13277
90 Ga0070698_100029720 3300005471 Bacteria 5672
91 Ga0070698_100283312 3300005471 Unclassified 1588
92 Ga0070699_100000432 3300005518 Bacteria 40124
93 Ga0070699_100005358 3300005518 Bacteria 11246
94 Ga0070699_100007587 3300005518 Bacteria 9431
95 Ga0070699_100104193 3300005518 Unclassified 2488
96 Ga0070699_100252862 3300005518 Bacteria 1575
97 Ga0070699_100492223 3300005518 Bacteria 1113
98 Ga0070679_100045647 3300005530 Unclassified 4366
99 Ga0070679_100120107 3300005530 Bacteria 2613
100 Ga0070684_100052651 3300005535 Bacteria 3541
101 Ga0070697_100002395 3300005536 Bacteria 14440
102 Ga0070697_100014445 3300005536 Bacteria 6201
103 Ga0070697_100016125 3300005536 Bacteria 5875
104 Ga0070697_100234582 3300005536 Bacteria 1566
105 Ga0070697_100236378 3300005536 Bacteria 1560
106 Ga0070672_100006442 3300005543 Bacteria 7888
107 Ga0070672_100264764 3300005543 Bacteria 1450
108 Ga0070686_100026496 3300005544 Bacteria 3499
109 Ga0070695_100001880 3300005545 Bacteria 11870
110 Ga0070695_100044346 3300005545 Bacteria 2831
111 Ga0070695_100050386 3300005545 Unclassified 2668
112 Ga0070695_100200851 3300005545 Bacteria 1425
113 Ga0070696_100016687 3300005546 Bacteria 4951
114 Ga0070696_100017968 3300005546 Bacteria 4776
115 Ga0070696_100023209 3300005546 Bacteria 4216
116 Ga0070696_100081946 3300005546 Bacteria 2287
117 Ga0070696_100175522 3300005546 Bacteria 1587
118 Ga0070696_100247543 3300005546 Bacteria 1347
119 Ga0070665_100013516 3300005548 Bacteria 8212
120 Ga0070665_100020037 3300005548 Bacteria 6715
121 Ga0070665_100029410 3300005548 Bacteria 5530
122 Ga0070665_100057610 3300005548 Bacteria 3895
123 Ga0070704_100038611 3300005549 Bacteria 3272
124 Ga0070704_100063407 3300005549 Bacteria 2652
125 Ga0070704_100074466 3300005549 Bacteria 2477
126 Ga0070704_100218752 3300005549 Bacteria 1547
127 Ga0068855_100000234 3300005563 Bacteria 70713
128 Ga0068855_100342867 3300005563 Bacteria 1647
129 Ga0068855_100502373 3300005563 Bacteria 1317
130 Ga0068857_100004869 3300005577 Bacteria 11390
131 Ga0068854_100132868 3300005578 Unclassified 1902
132 Ga0068856_100000062 3300005614 Bacteria 100769
133 Ga0068856_100041098 3300005614 Bacteria 4543
134 Ga0070702_100004444 3300005615 Bacteria 6402
135 Ga0070702_100020952 3300005615 Bacteria 3432
136 Ga0068852_100016336 3300005616 Bacteria 5784
137 Ga0068852_100052877 3300005616 Bacteria 3493
138 Ga0068852_100606624 3300005616 Bacteria 1099
139 Ga0068859_100053692 3300005617 Bacteria 4053
140 Ga0068859_100099523 3300005617 Unclassified 2963
141 Ga0068859_100108684 3300005617 Bacteria 2835
142 Ga0068859_100123873 3300005617 Bacteria 2652
143 Ga0068859_100398182 3300005617 Unclassified 1473
144 Ga0068864_100233499 3300005618 Bacteria 1702
145 Ga0068864_100257683 3300005618 Bacteria 1622
146 Ga0068866_10041164 3300005718 Bacteria 2291
147 Ga0068866_10075012 3300005718 Bacteria 1800
148 Ga0068870_10074661 3300005840 Bacteria 1858
149 Ga0068870_10117086 3300005840 Bacteria 1529
150 Ga0068863_100035781 3300005841 Bacteria 4728
151 Ga0068863_100093972 3300005841 Unclassified 2846
152 Ga0068863_100126468 3300005841 Unclassified 2439
153 Ga0068863_100337148 3300005841 Bacteria 1466
154 Ga0068858_100014019 3300005842 Bacteria 7563
155 Ga0068858_100059537 3300005842 Bacteria 3530
156 Ga0068858_100267454 3300005842 Bacteria 1626
157 Ga0068860_100019110 3300005843 Bacteria 6653
158 Ga0068860_100075164 3300005843 Bacteria 3213
159 Ga0068860_100285538 3300005843 Bacteria 1614
160 Ga0068860_100462530 3300005843 Bacteria 1262
161 Ga0068862_100056072 3300005844 Bacteria 3375
162 Ga0068862_100260522 3300005844 Bacteria 1583
163 Ga0068862_100266667 3300005844 Unclassified 1565
164 Ga0068862_100334264 3300005844 Bacteria 1402
165 Ga0081538_10004787 3300005981 Bacteria 12368
166 Ga0081539_10002905 3300005985 Bacteria 22664
167 Ga0081539_10012728 3300005985 Bacteria 6439
168 Ga0070717_10032853 3300006028 Bacteria 4183
169 Ga0070717_10038453 3300006028 Bacteria 3889
170 Ga0070717_10039858 3300006028 Unclassified 3824
171 Ga0070715_10000763 3300006163 Bacteria 8715
172 Ga0070716_100010159 3300006173 Unclassified 4714
173 Ga0070716_100052109 3300006173 Bacteria 2329
174 Ga0070712_100000468 3300006175 Bacteria 23267
175 Ga0070712_100001119 3300006175 Bacteria 16162
176 Ga0070712_100002849 3300006175 Bacteria 10703
177 Ga0070712_100003144 3300006175 Bacteria 10172
178 Ga0070712_100008180 3300006175 Bacteria 6569
179 Ga0070712_100008773 3300006175 Bacteria 6364
180 Ga0070712_100028949 3300006175 Bacteria 3710
181 Ga0097621_100000148 3300006237 Bacteria 42932
182 Ga0097621_100003128 3300006237 Bacteria 11355
183 Ga0097621_100004631 3300006237 Bacteria 9599
184 Ga0097621_100046515 3300006237 Bacteria 3511
185 Ga0097621_100184988 3300006237 Bacteria 1802
186 Ga0068871_100013790 3300006358 Bacteria 6009
187 Ga0068871_100030112 3300006358 Unclassified 4271
188 Ga0068871_100138845 3300006358 Bacteria 2065
189 Ga0068871_100166657 3300006358 Unclassified 1886
190 Ga0068871_100216737 3300006358 Bacteria 1657
191 Ga0068871_100221192 3300006358 Bacteria 1640
192 Ga0068871_100268950 3300006358 Bacteria 1489
193 Ga0075428_100005232 3300006844 Bacteria 14426
194 Ga0075428_100111343 3300006844 Bacteria 2983
195 Ga0075428_100130891 3300006844 Unclassified 2729
196 Ga0075428_100246604 3300006844 Unclassified 1926
197 Ga0075430_100002229 3300006846 Bacteria 16071
198 Ga0075430_100020169 3300006846 Bacteria 5671
199 Ga0075430_100221445 3300006846 Bacteria 1570
200 Ga0075430_100271501 3300006846 Unclassified 1404
201 Ga0075430_100370679 3300006846 Bacteria 1182
202 Ga0075431_100000151 3300006847 Bacteria 47382
203 Ga0075431_100039169 3300006847 Bacteria 4882
204 Ga0075431_100097179 3300006847 Bacteria 3041
205 Ga0075431_100381799 3300006847 Unclassified 1413
206 Ga0075433_10064114 3300006852 Bacteria 3220
207 Ga0075433_10094054 3300006852 Bacteria 2652
208 Ga0075433_10099342 3300006852 Bacteria 2576
209 Ga0075434_100051841 3300006871 Unclassified 4077
210 Ga0075434_100139418 3300006871 Bacteria 2444
211 Ga0075434_100165708 3300006871 Bacteria 2230
212 Ga0075434_100179894 3300006871 Bacteria 2134
213 Ga0075434_100411402 3300006871 Bacteria 1374
214 Ga0075429_100001317 3300006880 Bacteria 20253
215 Ga0075429_100293880 3300006880 Unclassified 1423
216 Ga0068865_100001782 3300006881 Bacteria 12632
217 Ga0068865_100002043 3300006881 Bacteria 11917
218 Ga0068865_100075093 3300006881 Unclassified 2409
219 Ga0068865_100301566 3300006881 Bacteria 1282
220 Ga0075436_100183262 3300006914 Bacteria 1480
221 Ga0097620_100053692 3300006931 Bacteria 4053
222 Ga0097620_100099524 3300006931 Unclassified 2963
223 Ga0097620_100108683 3300006931 Bacteria 2835
224 Ga0097620_100123888 3300006931 Bacteria 2652
225 Ga0097620_100398149 3300006931 Unclassified 1473
226 Ga0075435_100013494 3300007076 Bacteria 6079
227 Ga0075435_100198789 3300007076 Bacteria 1698
228 Ga0099794_10000004 3300007265 Bacteria 134462
229 Ga0099794_10080883 3300007265 Unclassified 1603
230 Ga0105240_10014149 3300009093 Bacteria 10900
231 Ga0105240_10064120 3300009093 Bacteria 4567
232 Ga0105240_10095577 3300009093 Unclassified 3623
233 Ga0105240_10111346 3300009093 Bacteria 3312
234 Ga0105240_10124643 3300009093 Bacteria 3098
235 Ga0105240_10314013 3300009093 Unclassified 1789
236 Ga0105240_10407530 3300009093 Unclassified 1530
237 Ga0105240_10425824 3300009093 Bacteria 1490
238 Ga0111539_10040991 3300009094 Bacteria 5570
239 Ga0111539_10106234 3300009094 Bacteria 3293
240 Ga0105245_10044159 3300009098 Bacteria 3977
241 Ga0105245_10194206 3300009098 Bacteria 1946
242 Ga0105245_10380129 3300009098 Bacteria 1406
243 Ga0105247_10073837 3300009101 Bacteria 2138
244 Ga0105247_10089641 3300009101 Unclassified 1950
245 Ga0114129_10022667 3300009147 Bacteria 8906
246 Ga0114129_10031867 3300009147 Bacteria 7452
247 Ga0114129_10059432 3300009147 Bacteria 5344
248 Ga0114129_10059769 3300009147 Bacteria 5329
249 Ga0114129_10077848 3300009147 Bacteria 4612
250 Ga0114129_10136073 3300009147 Bacteria 3371
251 Ga0114129_10458430 3300009147 Bacteria 1671
252 Ga0105243_10017234 3300009148 Bacteria 5463
253 Ga0105243_10073335 3300009148 Unclassified 2773
254 Ga0105243_10138160 3300009148 Bacteria 2076
255 Ga0105241_10007930 3300009174 Bacteria 7807
256 Ga0105241_10071635 3300009174 Bacteria 2691
257 Ga0105241_10109271 3300009174 Bacteria 2211
258 Ga0105241_10110955 3300009174 Unclassified 2195
259 Ga0105241_10159802 3300009174 Bacteria 1851
260 Ga0105242_10024634 3300009176 Bacteria 4754
261 Ga0105242_10045455 3300009176 Bacteria 3559
262 Ga0105242_10070983 3300009176 Bacteria 2889
263 Ga0105242_10096891 3300009176 Bacteria 2493
264 Ga0105248_10002269 3300009177 Bacteria 21276
265 Ga0105248_10007399 3300009177 Bacteria 12048
266 Ga0105248_10067590 3300009177 Bacteria 4013
267 Ga0105248_10105558 3300009177 Bacteria 3176
268 Ga0105248_10109692 3300009177 Bacteria 3112
269 Ga0105248_10194570 3300009177 Bacteria 2285
270 Ga0105248_10644322 3300009177 Bacteria 1195
271 Ga0105248_10674830 3300009177 Bacteria 1166
272 Ga0105237_10017405 3300009545 Bacteria 7451
273 Ga0105237_10089226 3300009545 Bacteria 3073
274 Ga0105238_10000609 3300009551 Bacteria 37550
275 Ga0105238_10004737 3300009551 Bacteria 13456
276 Ga0105238_10024029 3300009551 Bacteria 6215
277 Ga0105249_10006270 3300009553 Bacteria 10329
278 Ga0105249_10189879 3300009553 Bacteria 2005
279 Ga0099796_10000427 3300010159 Bacteria 6985
280 Ga0099796_10036617 3300010159 Unclassified 1635
281 Ga0105239_10039316 3300010375 Bacteria 5183
282 Ga0105239_10076765 3300010375 Unclassified 3675
283 Ga0105239_10198827 3300010375 Bacteria 2245
284 Ga0105239_10211951 3300010375 Unclassified 2172
285 Ga0105239_10274232 3300010375 Unclassified 1898
286 Ga0157371_10024243 3300013102 Bacteria 4433
287 Ga0157369_10000159 3300013105 Bacteria 95759
288 Ga0157374_10000338 3300013296 Bacteria 43326
289 Ga0157374_10016801 3300013296 Bacteria 6439
290 Ga0157374_10021505 3300013296 Bacteria 5742
291 Ga0157374_10037981 3300013296 Bacteria 4423
292 Ga0157374_10078051 3300013296 Bacteria 3135
293 Ga0157374_10139114 3300013296 Unclassified 2356
294 Ga0157378_10005749 3300013297 Bacteria 10860
295 Ga0157378_10006834 3300013297 Bacteria 9951
296 Ga0157378_10055952 3300013297 Unclassified 3514
297 Ga0157378_10085504 3300013297 Bacteria 2857
298 Ga0157378_10123896 3300013297 Bacteria 2385
299 Ga0157378_10323570 3300013297 Unclassified 1499
300 Ga0163162_10152424 3300013306 Bacteria 2430
301 Ga0163162_10228965 3300013306 Bacteria 1989
302 Ga0163162_10650297 3300013306 Unclassified 1178
303 Ga0157372_10003611 3300013307 Bacteria 16654
304 Ga0157372_10019861 3300013307 Bacteria 7240
305 Ga0157375_10132829 3300013308 Bacteria 2610
306 Ga0157375_10199382 3300013308 Bacteria 2157
307 Ga0157375_10270714 3300013308 Bacteria 1860
308 Ga0157375_10439648 3300013308 Bacteria 1470
309 Ga0163163_10001395 3300014325 Bacteria 20392
310 Ga0163163_10158191 3300014325 Bacteria 2310
311 Ga0163163_10276342 3300014325 Bacteria 1731
312 Ga0157380_10001814 3300014326 Bacteria 14105
313 Ga0157380_10066459 3300014326 Bacteria 2900
314 Ga0157377_10165501 3300014745 Bacteria 1378
315 Ga0157379_10004208 3300014968 Bacteria 12288
316 Ga0157379_10009128 3300014968 Bacteria 8635
317 Ga0157379_10051201 3300014968 Bacteria 3688
318 Ga0157379_10285656 3300014968 Bacteria 1502
319 Ga0157376_10007509 3300014969 Bacteria 7790
320 Ga0157376_10034776 3300014969 Bacteria 4071
321 Ga0157376_10038471 3300014969 Unclassified 3893
322 Ga0157376_10058953 3300014969 Bacteria 3218
323 Ga0157376_10069513 3300014969 Unclassified 2985
324 Ga0157376_10192467 3300014969 Bacteria 1871
325 Ga0157376_10245154 3300014969 Bacteria 1671
326 Ga0182005_1056525 3300015265 Bacteria 1069
327 Ga0163161_10156399 3300017792 Bacteria 1736
328 Ga0224569_100615 3300022732 Bacteria 3071
329 Ga0228598_1000044 3300024227 Bacteria 17465
330 Ga0228598_1000070 3300024227 Bacteria 15225
331 Ga0207656_10077074 3300025321 Unclassified 1492
332 Ga0207682_10007428 3300025893 Bacteria 4367
333 Ga0207692_10013451 3300025898 Bacteria 3551
334 Ga0207642_10121428 3300025899 Bacteria 1348
335 Ga0207710_10034751 3300025900 Bacteria 2216
336 Ga0207647_10016923 3300025904 Unclassified 4965
337 Ga0207647_10139048 3300025904 Bacteria 1424
338 Ga0207685_10001682 3300025905 Bacteria 4771
339 Ga0207699_10008849 3300025906 Bacteria 4987
340 Ga0207699_10047766 3300025906 Bacteria 2511
341 Ga0207645_10003579 3300025907 Bacteria 11750
342 Ga0207645_10163194 3300025907 Bacteria 1458
343 Ga0207645_10233247 3300025907 Bacteria 1215
344 Ga0207684_10000320 3300025910 Bacteria 68296
345 Ga0207684_10004878 3300025910 Bacteria 12535
346 Ga0207684_10203795 3300025910 Bacteria 1706
347 Ga0207684_10398996 3300025910 Bacteria 1182
348 Ga0207654_10004482 3300025911 Bacteria 7050
349 Ga0207654_10011627 3300025911 Bacteria 4491
350 Ga0207707_10001452 3300025912 Bacteria 21916
351 Ga0207707_10060733 3300025912 Bacteria 3288
352 Ga0207695_10089433 3300025913 Bacteria 3096
353 Ga0207671_10157951 3300025914 Unclassified 1755
354 Ga0207693_10000008 3300025915 Bacteria 171049
355 Ga0207693_10001167 3300025915 Bacteria 23425
356 Ga0207693_10002431 3300025915 Bacteria 16175
357 Ga0207693_10007049 3300025915 Bacteria 9275
358 Ga0207693_10009953 3300025915 Bacteria 7729
359 Ga0207693_10015202 3300025915 Bacteria 6177
360 Ga0207693_10026238 3300025915 Bacteria 4612
361 Ga0207693_10315284 3300025915 Bacteria 1224
362 Ga0207663_10000111 3300025916 Bacteria 39513
363 Ga0207663_10010876 3300025916 Bacteria 4860
364 Ga0207663_10019281 3300025916 Unclassified 3838
365 Ga0207663_10036341 3300025916 Bacteria 2963
366 Ga0207663_10047053 3300025916 Bacteria 2661
367 Ga0207663_10121603 3300025916 Bacteria 1789
368 Ga0207657_10002009 3300025919 Bacteria 21997
369 Ga0207652_10023725 3300025921 Bacteria 5085
370 Ga0207652_10050957 3300025921 Bacteria 3548
371 Ga0207652_10312195 3300025921 Bacteria 1419
372 Ga0207646_10073817 3300025922 Bacteria 3047
373 Ga0207646_10167024 3300025922 Unclassified 1987
374 Ga0207681_10009128 3300025923 Bacteria 6057
375 Ga0207681_10270665 3300025923 Bacteria 1333
376 Ga0207694_10003298 3300025924 Bacteria 12840
377 Ga0207694_10004655 3300025924 Bacteria 10681
378 Ga0207694_10005997 3300025924 Bacteria 9303
379 Ga0207694_10036471 3300025924 Unclassified 3774
380 Ga0207659_10280684 3300025926 Bacteria 1362
381 Ga0207659_10432750 3300025926 Bacteria 1105
382 Ga0207687_10030526 3300025927 Unclassified 3635
383 Ga0207687_10045413 3300025927 Bacteria 3036
384 Ga0207687_10111801 3300025927 Bacteria 2029
385 Ga0207687_10155357 3300025927 Unclassified 1750
386 Ga0207700_10000107 3300025928 Bacteria 49976
387 Ga0207700_10006279 3300025928 Bacteria 7172
388 Ga0207700_10067729 3300025928 Bacteria 2734
389 Ga0207644_10062526 3300025931 Unclassified 2701
390 Ga0207644_10067598 3300025931 Bacteria 2605
391 Ga0207706_10000641 3300025933 Bacteria 37090
392 Ga0207706_10047199 3300025933 Bacteria 3811
393 Ga0207706_10147805 3300025933 Bacteria 2067
394 Ga0207686_10162839 3300025934 Unclassified 1565
395 Ga0207709_10024100 3300025935 Bacteria 3471
396 Ga0207709_10027923 3300025935 Bacteria 3258
397 Ga0207670_10169622 3300025936 Bacteria 1635
398 Ga0207669_10107684 3300025937 Bacteria 1859
399 Ga0207669_10257995 3300025937 Unclassified 1302
400 Ga0207704_10007997 3300025938 Bacteria 5029
401 Ga0207704_10012937 3300025938 Unclassified 4158
402 Ga0207704_10019036 3300025938 Bacteria 3598
403 Ga0207704_10036682 3300025938 Bacteria 2822
404 Ga0207704_10174037 3300025938 Unclassified 1548
405 Ga0207665_10016930 3300025939 Unclassified 4785
406 Ga0207665_10039155 3300025939 Bacteria 3159
407 Ga0207665_10047783 3300025939 Bacteria 2870
408 Ga0207665_10072766 3300025939 Bacteria 2349
409 Ga0207665_10149142 3300025939 Bacteria 1674
410 Ga0207691_10019785 3300025940 Bacteria 6367
411 Ga0207691_10093246 3300025940 Bacteria 2697
412 Ga0207691_10096303 3300025940 Bacteria 2646
413 Ga0207711_10012633 3300025941 Bacteria 7013
414 Ga0207711_10018198 3300025941 Bacteria 5840
415 Ga0207711_10038043 3300025941 Bacteria 4091
416 Ga0207711_10066415 3300025941 Bacteria 3119
417 Ga0207711_10115070 3300025941 Bacteria 2396
418 Ga0207689_10003694 3300025942 Bacteria 13950
419 Ga0207661_10040859 3300025944 Bacteria 3649
420 Ga0207679_10133818 3300025945 Bacteria 1993
421 Ga0207667_10000465 3300025949 Bacteria 54509
422 Ga0207667_10055236 3300025949 Bacteria 4175
423 Ga0207667_10290154 3300025949 Bacteria 1671
424 Ga0207651_10224885 3300025960 Bacteria 1520
425 Ga0207712_10157044 3300025961 Bacteria 1763
426 Ga0207668_10016766 3300025972 Bacteria 4580
427 Ga0207668_10096727 3300025972 Bacteria 2183
428 Ga0207640_10034171 3300025981 Bacteria 3170
429 Ga0207658_10021006 3300025986 Bacteria 4527
430 Ga0207658_10054958 3300025986 Unclassified 2948
431 Ga0207658_10070337 3300025986 Bacteria 2647
432 Ga0207677_10022255 3300026023 Unclassified 3892
433 Ga0207677_10071854 3300026023 Bacteria 2444
434 Ga0207703_10032794 3300026035 Bacteria 4113
435 Ga0207703_10122731 3300026035 Unclassified 2232
436 Ga0207703_10131182 3300026035 Bacteria 2164
437 Ga0207639_10040615 3300026041 Unclassified 3473
438 Ga0207639_10278753 3300026041 Bacteria 1469
439 Ga0207639_10426691 3300026041 Bacteria 1200
440 Ga0207678_10008144 3300026067 Bacteria 9241
441 Ga0207708_10038732 3300026075 Bacteria 3632
442 Ga0207708_10069389 3300026075 Bacteria 2699
443 Ga0207708_10215499 3300026075 Bacteria 1536
444 Ga0207702_10001096 3300026078 Bacteria 27672
445 Ga0207702_10062555 3300026078 Bacteria 3179
446 Ga0207641_10000811 3300026088 Bacteria 33300
447 Ga0207641_10062885 3300026088 Bacteria 3169
448 Ga0207641_10133099 3300026088 Unclassified 2235
449 Ga0207641_10145416 3300026088 Bacteria 2143
450 Ga0207648_10017102 3300026089 Bacteria 6609
451 Ga0207648_10039098 3300026089 Bacteria 4171
452 Ga0207648_10066006 3300026089 Bacteria 3156
453 Ga0207648_10091877 3300026089 Unclassified 2654
454 Ga0207648_10219365 3300026089 Bacteria 1690
455 Ga0207648_10288232 3300026089 Unclassified 1469
456 Ga0207676_10096526 3300026095 Bacteria 2440
457 Ga0207676_10215505 3300026095 Bacteria 1706
458 Ga0207674_10005293 3300026116 Bacteria 15350
459 Ga0207674_10007441 3300026116 Bacteria 12762
460 Ga0207674_10077447 3300026116 Bacteria 3331
461 Ga0207674_10103444 3300026116 Bacteria 2827
462 Ga0207674_10614282 3300026116 Bacteria 1050
463 Ga0207675_100011936 3300026118 Bacteria 8117
464 Ga0207675_100087096 3300026118 Bacteria 2933
465 Ga0207675_100292694 3300026118 Bacteria 1584
466 Ga0207683_10033950 3300026121 Bacteria 4433
467 Ga0207683_10263742 3300026121 Bacteria 1573
468 Ga0207698_10089175 3300026142 Bacteria 2518
469 Ga0207698_10352519 3300026142 Bacteria 1391
470 Ga0207698_10528255 3300026142 Unclassified 1153
471 Ga0209588_1000001 3300027671 Bacteria 705877
472 Ga0209588_1025839 3300027671 Bacteria 1861
473 Ga0207428_10010140 3300027907 Bacteria 8425
474 Ga0207428_10011592 3300027907 Bacteria 7781
475 Ga0207428_10025198 3300027907 Bacteria 4981
476 Ga0207428_10037675 3300027907 Bacteria 3934
477 Ga0265354_1000756 3300028016 Bacteria 5272
478 Ga0268266_10010487 3300028379 Bacteria 8098
479 Ga0268266_10030899 3300028379 Bacteria 4548
480 Ga0268265_10048009 3300028380 Bacteria 3202
481 Ga0268265_10215261 3300028380 Bacteria 1677
482 Ga0268265_10219611 3300028380 Bacteria 1662
483 Ga0268265_10255832 3300028380 Unclassified 1554
484 Ga0268264_10014069 3300028381 Bacteria 6577
485 Ga0268264_10172422 3300028381 Bacteria 1957
486 Ga0268264_10209600 3300028381 Bacteria 1788
487 Ga0265319_1008171 3300028563 Unclassified 4613
488 Ga0265318_10001629 3300028577 Bacteria 12967
489 Ga0265762_1000130 3300030760 Bacteria 11334
490 Ga0265762_1016014 3300030760 Unclassified 1359
491 Ga0265770_1000180 3300030878 Bacteria 8227
492 Ga0265765_1000179 3300030879 Bacteria 4180
493 Ga0265760_10001544 3300031090 Bacteria 6793
494 Ga0265760_10011422 3300031090 Bacteria 2537
495 Ga0265325_10003325 3300031241 Bacteria 10570
496 Ga0265325_10004980 3300031241 Bacteria 8277
497 Ga0265325_10067854 3300031241 Bacteria 1796
498 Ga0265329_10003450 3300031242 Bacteria 6883
499 Ga0265340_10005071 3300031247 Bacteria 7321
500 Ga0265339_10005514 3300031249 Bacteria 8427
501 Ga0265339_10033361 3300031249 Bacteria 2899
502 Ga0265331_10000094 3300031250 Bacteria 122448
503 Ga0265331_10012844 3300031250 Bacteria 4520
504 Ga0265331_10067347 3300031250 Unclassified 1680
505 Ga0265316_10005655 3300031344 Bacteria 12097
506 Ga0265316_10006792 3300031344 Bacteria 10883
507 Ga0265316_10012133 3300031344 Bacteria 7736
508 Ga0265316_10014330 3300031344 Bacteria 6984
509 Ga0265316_10019254 3300031344 Bacteria 5842
510 Ga0307408_100036619 3300031548 Bacteria 3451
511 Ga0265313_10003181 3300031595 Bacteria 13530
512 Ga0265314_10000509 3300031711 Bacteria 50279
513 Ga0265314_10015181 3300031711 Bacteria 6120
514 Ga0265314_10022657 3300031711 Bacteria 4809
515 Ga0265314_10033167 3300031711 Bacteria 3790
516 Ga0265342_10002054 3300031712 Bacteria 17876
517 Ga0307406_10120344 3300031901 Bacteria 1824
518 Ga0307409_100051269 3300031995 Bacteria 3157
519 Ga0307416_100087246 3300032002 Bacteria 2663
520 Ga0373959_0022988 3300034820 Bacteria 1209
521 Ga0373934_0015463 3300035086 Bacteria 2895
522 Ga0373940_0027178 3300035088 Bacteria 1502
523 Ga0373949_0011290 3300035090 Bacteria 1966
524 Ga0373951_0041672 3300035091 Bacteria 1109
525 Ga0373923_0039980 3300035111 Bacteria 1928
526 Ga0373923_0049113 3300035111 Bacteria 1764
527 Ga0373932_0064742 3300035112 Bacteria 1120
528 Ga0373936_0050788 3300035113 Bacteria 1678
529 Ga0373941_0062463 3300035115 Bacteria 1216
530 Ga0373954_0071738 3300035118 Bacteria 1646
531 Ga0373957_0040808 3300035120 Unclassified 1746
532 Ga0373943_0059686 3300035170 Bacteria 1902
533 Ga0373943_0116366 3300035170 Bacteria 1416
534 Ga0373955_0016771 3300035172 Bacteria 3611
535 Ga0373955_0041648 3300035172 Bacteria 2463
536 Ga0373955_0118284 3300035172 Bacteria 1538
537 Ga0373924_0121364 3300035410 Bacteria 1134
538 Ga0373931_0026882 3300035691 Bacteria 2933
539 Ga0373931_0048317 3300035691 Bacteria 2255
540 Ga0373931_0091344 3300035691 Bacteria 1697
541 Ga0373935_0004101 3300035692 Bacteria 8523
542 Ga0373935_0197304 3300035692 Unclassified 1389
543 Ga0373935_0212053 3300035692 Bacteria 1342
544 Ga0373927_0002147 3300035695 Bacteria 14499
545 Ga0373927_0093605 3300035695 Bacteria 1952
546 Ga0373933_0126705 3300035724 Bacteria 1603
547 Ga0373933_0187530 3300035724 Unclassified 1320
548 Ga0373947_0024378 3300035725 Bacteria 3525
549 Ga0373947_0039201 3300035725 Bacteria 2818
550 Ga0373947_0126295 3300035725 Bacteria 1629
551 Ga0373937_0004324 3300036401 Bacteria 12052
552 Ga0373937_0010129 3300036401 Bacteria 8223
553 Ga0373937_0046916 3300036401 Bacteria 3952
554 Ga0373937_0059939 3300036401 Bacteria 3498
555 Ga0373937_0071265 3300036401 Bacteria 3205
556 Ga0373937_0139010 3300036401 Bacteria 2272
557 Ga0373937_0144431 3300036401 Bacteria 2227
558 Ga0373937_0491063 3300036401 Unclassified 1166
559 Ga0373925_0037190 3300037068 Bacteria 3593
560 Ga0373925_0063162 3300037068 Unclassified 2786
561 Ga0373925_0075260 3300037068 Bacteria 2558
562 Ga0373925_0152596 3300037068 Bacteria 1815
563 Ga0373925_0177721 3300037068 Bacteria 1683
564 Ga0373925_0244813 3300037068 Bacteria 1437
565 Ga0436364_0703870 3300037853 Bacteria 4877
566 Ga0436365_1220175 3300039437 Bacteria 3205
567 Ga0439446_0002000 3300042156 Bacteria 4821
568 Ga0439460_0026167 3300042461 Bacteria 1630
569 Ga0453683_0002798 3300044673 Bacteria 13268
570 Ga0453683_0006940 3300044673 Bacteria 7721
571 Ga0453684_0022220 3300044712 Bacteria 9427
572 Ga0451576_0039470 3300045051 Bacteria 4997
573 Ga0451576_0106407 3300045051 Bacteria 2919
574 Ga0466967_0431028 3300045976 Bacteria 1286
575 Ga0495592_0027262 3300046454 Bacteria 4332
576 Ga0495592_0044085 3300046454 Unclassified 3334
577 Ga0495603_0014257 3300046455 Bacteria 4808
578 Ga0495603_0069122 3300046455 Bacteria 2078
579 Ga0495629_0026931 3300046459 Bacteria 4083
580 Ga0495629_0043630 3300046459 Bacteria 3148
581 Ga0495629_0047921 3300046459 Bacteria 2997
582 Ga0495651_0001373 3300046462 Bacteria 18863
583 Ga0495651_0009991 3300046462 Bacteria 7296
584 Ga0495653_0014801 3300046463 Bacteria 6361
585 Ga0495653_0025407 3300046463 Unclassified 4761
586 Ga0495580_0002181 3300046472 Bacteria 17133
587 Ga0495580_0002545 3300046472 Bacteria 15889
588 Ga0495580_0010201 3300046472 Bacteria 7333
589 Ga0495580_0018437 3300046472 Bacteria 5195
590 Ga0495580_0019663 3300046472 Bacteria 5015
591 Ga0495580_0032582 3300046472 Unclassified 3760
592 Ga0495580_0075770 3300046472 Bacteria 2347
593 Ga0495582_0012347 3300046473 Bacteria 4705
594 Ga0495582_0226859 3300046473 Bacteria 1069
595 Ga0495664_0017972 3300046477 Unclassified 4044
596 Ga0495664_0046996 3300046477 Bacteria 2561
597 Ga0495664_0099347 3300046477 Bacteria 1752
598 Ga0495594_0016429 3300046499 Bacteria 3900
599 Ga0495608_0011346 3300046511 Bacteria 6202
600 Ga0495608_0037447 3300046511 Bacteria 3262
601 Ga0495608_0218285 3300046511 Bacteria 1197
602 Ga0495618_0002982 3300046514 Bacteria 10698
603 Ga0495628_0000439 3300046516 Bacteria 37888
604 Ga0495628_0067925 3300046516 Bacteria 2782
605 Ga0495628_0090427 3300046516 Bacteria 2370
606 Ga0495628_0163944 3300046516 Bacteria 1688
607 Ga0495630_0004015 3300046517 Bacteria 10297
608 Ga0495630_0018098 3300046517 Bacteria 5171
609 Ga0495630_0032428 3300046517 Bacteria 3893
610 Ga0495663_0002941 3300046525 Bacteria 5012
611 Ga0495642_0003861 3300046528 Bacteria 5874
612 Ga0495652_0008144 3300046529 Bacteria 9585
613 Ga0495665_0002479 3300046531 Bacteria 9972
614 Ga0495586_0021362 3300046535 Bacteria 3449
615 Ga0495586_0038360 3300046535 Bacteria 2573
616 Ga0495587_0012312 3300046536 Bacteria 5390
617 Ga0495587_0083059 3300046536 Bacteria 1856
618 Ga0495609_0058207 3300046538 Bacteria 1709
619 Ga0495621_0002181 3300046539 Bacteria 5210
620 Ga0495621_0048686 3300046539 Bacteria 1510
621 Ga0495621_0062662 3300046539 Bacteria 1353
622 Ga0495621_0101640 3300046539 Bacteria 1095
623 Ga0495645_0000296 3300046543 Bacteria 36239
624 Ga0495645_0002510 3300046543 Bacteria 12456
625 Ga0495645_0009221 3300046543 Bacteria 6896
626 Ga0495645_0030542 3300046543 Bacteria 3924
627 Ga0495645_0064030 3300046543 Unclassified 2661
628 Ga0495645_0087172 3300046543 Bacteria 2233
629 Ga0495667_0003132 3300046559 Bacteria 11094
630 Ga0495667_0014988 3300046559 Bacteria 5236
631 Ga0495667_0026654 3300046559 Bacteria 3895
632 Ga0495667_0137646 3300046559 Bacteria 1574
633 Ga0495667_0145953 3300046559 Bacteria 1524
634 Ga0495656_0121520 3300046615 Bacteria 1233
635 Ga0495635_0006770 3300046663 Bacteria 8007
636 Ga0495635_0076315 3300046663 Bacteria 2297
637 Ga0495635_0111852 3300046663 Bacteria 1865
638 Ga0495657_0006893 3300046675 Bacteria 8827
639 Ga0495657_0009162 3300046675 Bacteria 7518
640 Ga0495657_0034723 3300046675 Bacteria 3500
641 Ga0495599_0012100 3300046678 Bacteria 5311
642 Ga0495623_0020396 3300046679 Bacteria 4283
643 Ga0495623_0146903 3300046679 Bacteria 1397
644 Ga0495646_0003971 3300046680 Bacteria 9253
645 Ga0495646_0067227 3300046680 Unclassified 2119
646 Ga0495646_0134784 3300046680 Bacteria 1387
647 Ga0495658_0019092 3300046683 Bacteria 3574
648 Ga0495658_0024014 3300046683 Bacteria 3242
649 Ga0495658_0052459 3300046683 Bacteria 2313
650 Ga0495613_0163562 3300046689 Unclassified 1582
651 Ga0495613_0258038 3300046689 Unclassified 1215
652 Ga0495624_0005250 3300046690 Bacteria 9351
653 Ga0495624_0140459 3300046690 Bacteria 1480
654 Ga0495604_0004754 3300047317 Bacteria 10757
655 Ga0495604_0008380 3300047317 Bacteria 8175
656 Ga0495604_0158549 3300047317 Bacteria 1601
657 Ga0495674_0012275 3300047319 Bacteria 8075
658 Ga0495674_0032047 3300047319 Bacteria 4771
659 Ga0495674_0058171 3300047319 Bacteria 3381
660 Ga0495674_0075174 3300047319 Unclassified 2908
661 Ga0495674_0387772 3300047319 Bacteria 1129
662 Ga0495676_0034952 3300047321 Bacteria 4210
663 Ga0495680_0002590 3300047322 Bacteria 18401
664 Ga0495680_0019539 3300047322 Bacteria 5716
665 Ga0495680_0091426 3300047322 Bacteria 2281
666 Ga0495675_0000155 3300047444 Bacteria 48300
667 Ga0495675_0010545 3300047444 Bacteria 5776
668 Ga0495675_0019031 3300047444 Unclassified 4361
669 Ga0495675_0028417 3300047444 Bacteria 3565
670 Ga0495677_0066111 3300047445 Bacteria 1344
671 Ga0495684_0007480 3300047471 Bacteria 8461
672 Ga0495684_0008283 3300047471 Bacteria 8051
673 Ga0495684_0014680 3300047471 Bacteria 6027
674 Ga0495684_0042570 3300047471 Bacteria 3478
675 Ga0495593_0054240 3300047673 Unclassified 2114
676 Ga0495593_0077538 3300047673 Bacteria 1721
677 Ga0495602_0024740 3300048088 Bacteria 5823
678 Ga0495602_0120840 3300048088 Unclassified 2108
679 Ga0495602_0168621 3300048088 Bacteria 1701
680 Ga0495602_0220599 3300048088 Bacteria 1432
681 Ga0495614_0065798 3300048089 Bacteria 1559
682 Ga0496100_0006702 3300048903 Bacteria 6303
683 Ga0496101_0057455 3300048904 Unclassified 2814
684 Ga0496102_0031150 3300048905 Bacteria 4782
685 Ga0496102_0050682 3300048905 Unclassified 3781
686 Ga0496102_0408465 3300048905 Unclassified 1276
687 Ga0496103_0001075 3300048906 Bacteria 19076
688 Ga0496103_0053198 3300048906 Bacteria 2509
689 Ga0496104_0007903 3300048907 Bacteria 9429
690 Ga0496104_0011300 3300048907 Bacteria 7993
691 Ga0496105_0005363 3300048908 Bacteria 9720
692 Ga0496106_0018302 3300048909 Bacteria 5177
693 Ga0496107_0086072 3300048910 Unclassified 2294
694 Ga0496107_0100740 3300048910 Bacteria 2118
695 Ga0496107_0130354 3300048910 Bacteria 1856
696 Ga0496108_0161805 3300048911 Bacteria 1935
697 Ga0496108_0311816 3300048911 Unclassified 1371
698 Ga0496109_0465400 3300048912 Bacteria 1194
699 Ga0496112_0001729 3300048915 Bacteria 17084
700 Ga0496112_0001787 3300048915 Bacteria 16907
701 Ga0496112_0060610 3300048915 Unclassified 3729
702 Ga0496112_0119703 3300048915 Bacteria 2603
703 Ga0496112_0196180 3300048915 Bacteria 1979
704 Ga0496114_0031238 3300048917 Bacteria 4382
705 Ga0496114_0062970 3300048917 Unclassified 3105
706 Ga0496114_0275905 3300048917 Bacteria 1482
707 Ga0496115_0002823 3300048918 Bacteria 12490
708 Ga0496115_0006852 3300048918 Bacteria 8364
709 Ga0501036_0471764 3300049572 Bacteria 1045
710 Ga0501039_0039552 3300049575 Bacteria 3642
711 Ga0501040_0273120 3300049576 Bacteria 1207
712 Ga0501042_0015930 3300049578 Bacteria 5155
713 Ga0501046_0298384 3300049580 Unclassified 1177
714 Ga0501048_0021943 3300049582 Bacteria 4674
715 Ga0501069_0072196 3300049585 Bacteria 1935
716 Ga0501071_0045159 3300049587 Bacteria 3162
717 Ga0501073_0111320 3300049589 Bacteria 1899
718 Ga0501074_0148729 3300049590 Bacteria 1675
719 Ga0501074_0152127 3300049590 Bacteria 1654
720 Ga0501075_0174401 3300049591 Bacteria 1641
721 Ga0501075_0274379 3300049591 Bacteria 1285
722 Ga0501076_0029062 3300049592 Bacteria 4297
723 Ga0501077_0047521 3300049593 Bacteria 2727
724 Ga0501077_0102311 3300049593 Bacteria 1815
725 Ga0501077_0164176 3300049593 Bacteria 1410
726 Ga0501081_0004305 3300049743 Bacteria 9123
727 Ga0501081_0286599 3300049743 Unclassified 1207
728 Ga0501045_0028847 3300049824 Bacteria 4006
729 nmdc:mga05p37_171860_c1 3300050507 Bacteria 2643
730 nmdc:mga05p37_18915_c1 3300050507 Bacteria 8327
731 nmdc:mga05p37_276667_c1 3300050507 Bacteria 2004
732 nmdc:mga05p37_48416_c1 3300050507 Bacteria 5228
733 nmdc:mga05p37_50333_c1 3300050507 Bacteria 5123
734 nmdc:mga05p37_59198_c1 3300050507 Bacteria 4717
735 nmdc:mga05p37_59730_c1 3300050507 Bacteria 4695
736 nmdc:mga05p37_627030_c1 3300050507 Bacteria 1209
737 nmdc:mga05p37_64498_c1 3300050507 Bacteria 4507
738 nmdc:mga05p37_95864_c1 3300050507 Bacteria 3655
739 nmdc:mga09592_268085_c1 3300050508 Bacteria 1481
740 nmdc:mga09592_783_c1 3300050508 Bacteria 24586
741 nmdc:mga0qj67_142083_c1 3300050509 Bacteria 1946
742 nmdc:mga0qj67_304852_c1 3300050509 Unclassified 1290
743 nmdc:mga0qj67_86574_c1 3300050509 Bacteria 2514
744 nmdc:mga06r32_10852_c1 3300050510 Bacteria 8203
745 nmdc:mga06r32_8100_c1 3300050510 Bacteria 9453
746 nmdc:mga08y16_139061_c1 3300050511 Bacteria 2525
747 nmdc:mga08y16_2444_c1 3300050511 Bacteria 19075
748 nmdc:mga0n895_110690_c1 3300050512 Bacteria 2762
749 nmdc:mga0n895_124865_c1 3300050512 Bacteria 2597
750 nmdc:mga0n895_13298_c1 3300050512 Bacteria 7420
751 nmdc:mga0n895_185585_c1 3300050512 Bacteria 2111
752 nmdc:mga0n895_185826_c1 3300050512 Bacteria 2109
753 nmdc:mga0n895_512991_c1 3300050512 Bacteria 1207
754 nmdc:mga0n895_590810_c1 3300050512 Unclassified 1113
755 nmdc:mga0rr50_107149_c1 3300050513 Bacteria 2206
756 nmdc:mga0rr50_126767_c1 3300050513 Bacteria 2039
757 nmdc:mga0rr50_18049_c1 3300050513 Bacteria 4730
758 nmdc:mga0rr50_229909_c1 3300050513 Bacteria 1534
759 nmdc:mga0rr50_65112_c1 3300050513 Bacteria 2760
760 nmdc:mga08x19_196241_c1 3300050514 Bacteria 1382
761 nmdc:mga0a205_113598_c1 3300050515 Bacteria 2607
762 nmdc:mga0a205_73805_c1 3300050515 Bacteria 3296
763 Ga0495601_0021247 3300053077 Unclassified 3973
764 Ga0495601_0111439 3300053077 Bacteria 1772
765 Ga0495601_0113111 3300053077 Unclassified 1759
766 Ga0495612_0003688 3300053078 Bacteria 6355
767 Ga0495595_0052823 3300053084 Bacteria 1887
768 Ga0495619_0044662 3300053085 Bacteria 2909
769 Ga0495619_0061392 3300053085 Bacteria 2501
770 Ga0495619_0122330 3300053085 Bacteria 1785
771 Ga0501084_0056642 3300054114 Bacteria 3279
772 Ga0501084_0124924 3300054114 Bacteria 2165
773 Ga0587077_003386 3300059493 Bacteria 2000
774 Ga0587107_000680 3300059652 Bacteria 2390
775 Ga0501082_0308472 3300060353 Bacteria 1378
776 Ga0530510_0058176 3300061734 Bacteria 2795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0067925 Ga0495628_0067925_125_1015 278
2 3300047673 Ga0495593_0077538 Ga0495593_0077538_29_928 281
3 3300049572 Ga0501036_0471764 Ga0501036_0471764_128_1030 282
4 3300046455 Ga0495603_0014257 Ga0495603_0014257_2304_3209 283
5 3300050511 nmdc:mga08y16_139061_c1 nmdc:mga08y16_139061_c1_1597_2502 283
6 3300005434 Ga0070709_10348093 Ga0070709_103480931 285
7 3300025916 Ga0207663_10121603 Ga0207663_101216031 285
8 3300026075 Ga0207708_10215499 Ga0207708_102154991 285
9 3300035115 Ga0373941_0062463 Ga0373941_0062463_66_977 285
10 3300046543 Ga0495645_0087172 Ga0495645_0087172_587_1498 285
11 3300048088 Ga0495602_0120840 Ga0495602_0120840_59_988 291
12 3300046473 Ga0495582_0226859 Ga0495582_0226859_13_993 294
13 3300009093 Ga0105240_10064120 Ga0105240_100641202 297
14 3300036401 Ga0373937_0491063 Ga0373937_0491063_12_968 299
15 3300006846 Ga0075430_100370679 Ga0075430_1003706791 301
16 3300050509 nmdc:mga0qj67_142083_c1 nmdc:mga0qj67_142083_c1_280_1296 302
17 3300005456 Ga0070678_100171427 Ga0070678_1001714272 304
18 3300005467 Ga0070706_100049856 Ga0070706_1000498562 304
19 3300005471 Ga0070698_100029720 Ga0070698_1000297204 304
20 3300046472 Ga0495580_0002181 Ga0495580_0002181_2360_3376 306
21 3300009147 Ga0114129_10458430 Ga0114129_104584302 309
22 3300009148 Ga0105243_10138160 Ga0105243_101381602 309
23 3300046499 Ga0495594_0016429 Ga0495594_0016429_2796_3782 309
24 3300046528 Ga0495642_0003861 Ga0495642_0003861_3388_4374 309
25 3300046538 Ga0495609_0058207 Ga0495609_0058207_71_1057 309
26 3300046539 Ga0495621_0002181 Ga0495621_0002181_3055_4041 309
27 3300046615 Ga0495656_0121520 Ga0495656_0121520_225_1211 309
28 3300047445 Ga0495677_0066111 Ga0495677_0066111_180_1166 309
29 3300050507 nmdc:mga05p37_627030_c1 nmdc:mga05p37_627030_c1_155_1141 309
30 3300050512 nmdc:mga0n895_185585_c1 nmdc:mga0n895_185585_c1_550_1536 309
31 3300050513 nmdc:mga0rr50_229909_c1 nmdc:mga0rr50_229909_c1_56_1042 309
32 3300050515 nmdc:mga0a205_73805_c1 nmdc:mga0a205_73805_c1_1068_2054 309
33 3300036401 Ga0373937_0144431 Ga0373937_0144431_243_1235 310
34 3300046459 Ga0495629_0047921 Ga0495629_0047921_359_1351 310
35 3300048908 Ga0496105_0005363 Ga0496105_0005363_4091_5077 310
36 3300049593 Ga0501077_0102311 Ga0501077_0102311_676_1701 310
37 3300009147 Ga0114129_10077848 Ga0114129_100778487 311
38 3300013296 Ga0157374_10078051 Ga0157374_100780514 311
39 3300013308 Ga0157375_10270714 Ga0157375_102707142 311
40 3300014326 Ga0157380_10001814 Ga0157380_1000181412 311
41 3300014969 Ga0157376_10058953 Ga0157376_100589533 311
42 3300015265 Ga0182005_1056525 Ga0182005_10565251 311
43 3300027907 Ga0207428_10037675 Ga0207428_100376752 311
44 3300031901 Ga0307406_10120344 Ga0307406_101203442 311
45 3300031995 Ga0307409_100051269 Ga0307409_1000512692 311
46 3300035088 Ga0373940_0027178 Ga0373940_0027178_301_1290 311
47 3300045051 Ga0451576_0106407 Ga0451576_0106407_437_1426 311
48 3300046539 Ga0495621_0101640 Ga0495621_0101640_11_1000 311
49 3300047321 Ga0495676_0034952 Ga0495676_0034952_680_1672 311
50 3300050511 nmdc:mga08y16_2444_c1 nmdc:mga08y16_2444_c1_3969_4958 311
51 3300059493 Ga0587077_003386 Ga0587077_003386_188_1177 311
52 3300059652 Ga0587107_000680 Ga0587107_000680_212_1201 311
53 3300009093 Ga0105240_10111346 Ga0105240_101113464 312
54 3300014969 Ga0157376_10069513 Ga0157376_100695132 312
55 3300025936 Ga0207670_10169622 Ga0207670_101696222 312
56 3300035086 Ga0373934_0015463 Ga0373934_0015463_507_1502 312
57 3300035111 Ga0373923_0039980 Ga0373923_0039980_392_1387 312
58 3300035111 Ga0373923_0049113 Ga0373923_0049113_368_1360 312
59 3300035118 Ga0373954_0071738 Ga0373954_0071738_612_1607 312
60 3300035692 Ga0373935_0197304 Ga0373935_0197304_360_1355 312
61 3300035695 Ga0373927_0093605 Ga0373927_0093605_933_1925 312
62 3300035724 Ga0373933_0187530 Ga0373933_0187530_66_1061 312
63 3300035725 Ga0373947_0024378 Ga0373947_0024378_2262_3254 312
64 3300036401 Ga0373937_0010129 Ga0373937_0010129_934_1929 312
65 3300037068 Ga0373925_0037190 Ga0373925_0037190_1693_2685 312
66 3300037068 Ga0373925_0075260 Ga0373925_0075260_1080_2075 312
67 3300046472 Ga0495580_0075770 Ga0495580_0075770_550_1542 312
68 3300046517 Ga0495630_0032428 Ga0495630_0032428_1163_2155 312
69 3300046559 Ga0495667_0145953 Ga0495667_0145953_458_1450 312
70 3300046663 Ga0495635_0076315 Ga0495635_0076315_458_1450 312
71 3300046680 Ga0495646_0134784 Ga0495646_0134784_201_1193 312
72 3300046690 Ga0495624_0140459 Ga0495624_0140459_55_1047 312
73 3300047317 Ga0495604_0158549 Ga0495604_0158549_446_1438 312
74 3300047319 Ga0495674_0387772 Ga0495674_0387772_23_1015 312
75 3300047471 Ga0495684_0008283 Ga0495684_0008283_5073_6068 312
76 3300048088 Ga0495602_0220599 Ga0495602_0220599_172_1164 312
77 3300048089 Ga0495614_0065798 Ga0495614_0065798_502_1494 312
78 3300053085 Ga0495619_0122330 Ga0495619_0122330_79_1071 312
79 3300006358 Ga0068871_100221192 Ga0068871_1002211922 313
80 3300007265 Ga0099794_10000004 Ga0099794_100000042 313
81 3300007265 Ga0099794_10080883 Ga0099794_100808832 313
82 3300009093 Ga0105240_10407530 Ga0105240_104075302 313
83 3300009098 Ga0105245_10194206 Ga0105245_101942062 313
84 3300009101 Ga0105247_10073837 Ga0105247_100738372 313
85 3300009174 Ga0105241_10007930 Ga0105241_100079305 313
86 3300009174 Ga0105241_10071635 Ga0105241_100716352 313
87 3300009176 Ga0105242_10070983 Ga0105242_100709832 313
88 3300009176 Ga0105242_10096891 Ga0105242_100968912 313
89 3300009177 Ga0105248_10105558 Ga0105248_101055582 313
90 3300009551 Ga0105238_10024029 Ga0105238_100240292 313
91 3300009553 Ga0105249_10006270 Ga0105249_100062706 313
92 3300010159 Ga0099796_10000427 Ga0099796_100004273 313
93 3300013102 Ga0157371_10024243 Ga0157371_100242432 313
94 3300013296 Ga0157374_10016801 Ga0157374_100168016 313
95 3300013296 Ga0157374_10021505 Ga0157374_100215052 313
96 3300013297 Ga0157378_10085504 Ga0157378_100855043 313
97 3300013297 Ga0157378_10123896 Ga0157378_101238962 313
98 3300013306 Ga0163162_10152424 Ga0163162_101524242 313
99 3300013307 Ga0157372_10019861 Ga0157372_100198617 313
100 3300014968 Ga0157379_10004208 Ga0157379_100042085 313
101 3300014968 Ga0157379_10051201 Ga0157379_100512012 313
102 3300014969 Ga0157376_10245154 Ga0157376_102451542 313
103 3300035090 Ga0373949_0011290 Ga0373949_0011290_362_1357 313
104 3300035170 Ga0373943_0059686 Ga0373943_0059686_213_1211 313
105 3300035170 Ga0373943_0116366 Ga0373943_0116366_303_1298 313
106 3300035172 Ga0373955_0016771 Ga0373955_0016771_2347_3345 313
107 3300035410 Ga0373924_0121364 Ga0373924_0121364_82_1080 313
108 3300035691 Ga0373931_0026882 Ga0373931_0026882_1527_2522 313
109 3300035692 Ga0373935_0212053 Ga0373935_0212053_43_1041 313
110 3300035695 Ga0373927_0002147 Ga0373927_0002147_36_1034 313
111 3300036401 Ga0373937_0071265 Ga0373937_0071265_1319_2317 313
112 3300044673 Ga0453683_0002798 Ga0453683_0002798_8270_9265 313
113 3300044673 Ga0453683_0006940 Ga0453683_0006940_2716_3711 313
114 3300044712 Ga0453684_0022220 Ga0453684_0022220_1099_2094 313
115 3300046472 Ga0495580_0010201 Ga0495580_0010201_205_1200 313
116 3300046473 Ga0495582_0012347 Ga0495582_0012347_1059_2054 313
117 3300046477 Ga0495664_0046996 Ga0495664_0046996_441_1436 313
118 3300046511 Ga0495608_0218285 Ga0495608_0218285_69_1067 313
119 3300046543 Ga0495645_0002510 Ga0495645_0002510_9551_10546 313
120 3300046689 Ga0495613_0258038 Ga0495613_0258038_55_1053 313
121 3300047673 Ga0495593_0054240 Ga0495593_0054240_1091_2086 313
122 3300048903 Ga0496100_0006702 Ga0496100_0006702_2554_3549 313
123 3300048904 Ga0496101_0057455 Ga0496101_0057455_678_1673 313
124 3300048905 Ga0496102_0031150 Ga0496102_0031150_2620_3615 313
125 3300048905 Ga0496102_0408465 Ga0496102_0408465_162_1157 313
126 3300048906 Ga0496103_0001075 Ga0496103_0001075_7689_8684 313
127 3300048906 Ga0496103_0053198 Ga0496103_0053198_1145_2140 313
128 3300048907 Ga0496104_0007903 Ga0496104_0007903_6812_7807 313
129 3300048909 Ga0496106_0018302 Ga0496106_0018302_3796_4791 313
130 3300048910 Ga0496107_0086072 Ga0496107_0086072_615_1610 313
131 3300048910 Ga0496107_0100740 Ga0496107_0100740_1076_2071 313
132 3300048910 Ga0496107_0130354 Ga0496107_0130354_530_1525 313
133 3300048911 Ga0496108_0311816 Ga0496108_0311816_202_1197 313
134 3300048915 Ga0496112_0060610 Ga0496112_0060610_1198_2193 313
135 3300048917 Ga0496114_0275905 Ga0496114_0275905_303_1298 313
136 3300048918 Ga0496115_0002823 Ga0496115_0002823_7447_8442 313
137 3300048918 Ga0496115_0006852 Ga0496115_0006852_5876_6871 313
138 3300050512 nmdc:mga0n895_110690_c1 nmdc:mga0n895_110690_c1_817_1812 313
139 3300050512 nmdc:mga0n895_124865_c1 nmdc:mga0n895_124865_c1_310_1305 313
140 3300050513 nmdc:mga0rr50_107149_c1 nmdc:mga0rr50_107149_c1_348_1343 313
141 3300050514 nmdc:mga08x19_196241_c1 nmdc:mga08x19_196241_c1_88_1083 313
142 3300053077 Ga0495601_0021247 Ga0495601_0021247_281_1276 313
143 3300061734 Ga0530510_0058176 Ga0530510_0058176_1199_2194 313
144 3300005545 Ga0070695_100050386 Ga0070695_1000503861 314
145 3300035172 Ga0373955_0118284 Ga0373955_0118284_215_1231 314
146 3300036401 Ga0373937_0059939 Ga0373937_0059939_1280_2296 314
147 3300046543 Ga0495645_0000296 Ga0495645_0000296_22258_23274 314
148 3300046559 Ga0495667_0137646 Ga0495667_0137646_45_1061 314
149 3300046663 Ga0495635_0111852 Ga0495635_0111852_293_1309 314
150 3300046683 Ga0495658_0024014 Ga0495658_0024014_1343_2359 314
151 3300048917 Ga0496114_0031238 Ga0496114_0031238_1831_2847 314
152 3300053077 Ga0495601_0111439 Ga0495601_0111439_91_1107 314
153 3300053084 Ga0495595_0052823 Ga0495595_0052823_716_1732 314
154 3300053085 Ga0495619_0044662 Ga0495619_0044662_727_1743 314
155 3300005434 Ga0070709_10018523 Ga0070709_100185232 315
156 3300005436 Ga0070713_100027599 Ga0070713_1000275992 315
157 3300005563 Ga0068855_100342867 Ga0068855_1003428672 315
158 3300006846 Ga0075430_100020169 Ga0075430_1000201696 315
159 3300006847 Ga0075431_100039169 Ga0075431_1000391692 315
160 3300009093 Ga0105240_10314013 Ga0105240_103140132 315
161 3300009098 Ga0105245_10044159 Ga0105245_100441594 315
162 3300009101 Ga0105247_10089641 Ga0105247_100896412 315
163 3300013296 Ga0157374_10037981 Ga0157374_100379812 315
164 3300013297 Ga0157378_10006834 Ga0157378_100068347 315
165 3300025927 Ga0207687_10155357 Ga0207687_101553572 315
166 3300025928 Ga0207700_10067729 Ga0207700_100677292 315
167 3300025949 Ga0207667_10290154 Ga0207667_102901542 315
168 3300035113 Ga0373936_0050788 Ga0373936_0050788_656_1657 315
169 3300035120 Ga0373957_0040808 Ga0373957_0040808_514_1515 315
170 3300035172 Ga0373955_0041648 Ga0373955_0041648_537_1538 315
171 3300035692 Ga0373935_0004101 Ga0373935_0004101_6005_7006 315
172 3300035725 Ga0373947_0039201 Ga0373947_0039201_1256_2257 315
173 3300036401 Ga0373937_0004324 Ga0373937_0004324_10237_11238 315
174 3300037068 Ga0373925_0152596 Ga0373925_0152596_397_1398 315
175 3300046454 Ga0495592_0027262 Ga0495592_0027262_2841_3842 315
176 3300046454 Ga0495592_0044085 Ga0495592_0044085_2122_3123 315
177 3300046459 Ga0495629_0043630 Ga0495629_0043630_413_1429 315
178 3300046462 Ga0495651_0001373 Ga0495651_0001373_590_1591 315
179 3300046462 Ga0495651_0009991 Ga0495651_0009991_529_1530 315
180 3300046463 Ga0495653_0014801 Ga0495653_0014801_816_1817 315
181 3300046463 Ga0495653_0025407 Ga0495653_0025407_1788_2789 315
182 3300046472 Ga0495580_0002545 Ga0495580_0002545_6409_7410 315
183 3300046477 Ga0495664_0017972 Ga0495664_0017972_428_1429 315
184 3300046511 Ga0495608_0011346 Ga0495608_0011346_1068_2069 315
185 3300046511 Ga0495608_0037447 Ga0495608_0037447_1545_2546 315
186 3300046514 Ga0495618_0002982 Ga0495618_0002982_6469_7470 315
187 3300046516 Ga0495628_0000439 Ga0495628_0000439_9025_10026 315
188 3300046516 Ga0495628_0090427 Ga0495628_0090427_37_1038 315
189 3300046517 Ga0495630_0018098 Ga0495630_0018098_2634_3635 315
190 3300046529 Ga0495652_0008144 Ga0495652_0008144_7267_8268 315
191 3300046531 Ga0495665_0002479 Ga0495665_0002479_8508_9509 315
192 3300046535 Ga0495586_0021362 Ga0495586_0021362_1265_2266 315
193 3300046535 Ga0495586_0038360 Ga0495586_0038360_282_1283 315
194 3300046536 Ga0495587_0012312 Ga0495587_0012312_1316_2317 315
195 3300046536 Ga0495587_0083059 Ga0495587_0083059_175_1176 315
196 3300046543 Ga0495645_0009221 Ga0495645_0009221_5703_6704 315
197 3300046543 Ga0495645_0064030 Ga0495645_0064030_1389_2390 315
198 3300046559 Ga0495667_0003132 Ga0495667_0003132_6265_7266 315
199 3300046559 Ga0495667_0014988 Ga0495667_0014988_1707_2708 315
200 3300046559 Ga0495667_0026654 Ga0495667_0026654_915_1916 315
201 3300046663 Ga0495635_0006770 Ga0495635_0006770_1431_2432 315
202 3300046675 Ga0495657_0006893 Ga0495657_0006893_2087_3088 315
203 3300046675 Ga0495657_0009162 Ga0495657_0009162_6450_7451 315
204 3300046675 Ga0495657_0034723 Ga0495657_0034723_2169_3170 315
205 3300046678 Ga0495599_0012100 Ga0495599_0012100_3739_4740 315
206 3300046679 Ga0495623_0020396 Ga0495623_0020396_1374_2375 315
207 3300046679 Ga0495623_0146903 Ga0495623_0146903_326_1327 315
208 3300046680 Ga0495646_0003971 Ga0495646_0003971_2564_3565 315
209 3300046680 Ga0495646_0067227 Ga0495646_0067227_515_1516 315
210 3300046689 Ga0495613_0163562 Ga0495613_0163562_49_1050 315
211 3300046690 Ga0495624_0005250 Ga0495624_0005250_1186_2187 315
212 3300047317 Ga0495604_0004754 Ga0495604_0004754_569_1570 315
213 3300047317 Ga0495604_0008380 Ga0495604_0008380_2341_3342 315
214 3300047319 Ga0495674_0012275 Ga0495674_0012275_5228_6229 315
215 3300047319 Ga0495674_0075174 Ga0495674_0075174_756_1757 315
216 3300047322 Ga0495680_0002590 Ga0495680_0002590_11073_12074 315
217 3300047322 Ga0495680_0019539 Ga0495680_0019539_3268_4269 315
218 3300047322 Ga0495680_0091426 Ga0495680_0091426_932_1933 315
219 3300047444 Ga0495675_0000155 Ga0495675_0000155_31543_32544 315
220 3300047444 Ga0495675_0010545 Ga0495675_0010545_1511_2512 315
221 3300047444 Ga0495675_0019031 Ga0495675_0019031_866_1867 315
222 3300047471 Ga0495684_0007480 Ga0495684_0007480_6699_7700 315
223 3300047471 Ga0495684_0014680 Ga0495684_0014680_3105_4106 315
224 3300047471 Ga0495684_0042570 Ga0495684_0042570_1108_2109 315
225 3300048088 Ga0495602_0024740 Ga0495602_0024740_394_1395 315
226 3300049575 Ga0501039_0039552 Ga0501039_0039552_1929_2930 315
227 3300049578 Ga0501042_0015930 Ga0501042_0015930_3490_4491 315
228 3300049582 Ga0501048_0021943 Ga0501048_0021943_216_1217 315
229 3300049587 Ga0501071_0045159 Ga0501071_0045159_409_1410 315
230 3300049589 Ga0501073_0111320 Ga0501073_0111320_145_1146 315
231 3300049592 Ga0501076_0029062 Ga0501076_0029062_2152_3153 315
232 3300049593 Ga0501077_0047521 Ga0501077_0047521_915_1916 315
233 3300049743 Ga0501081_0004305 Ga0501081_0004305_4883_5884 315
234 3300049824 Ga0501045_0028847 Ga0501045_0028847_615_1616 315
235 3300050509 nmdc:mga0qj67_86574_c1 nmdc:mga0qj67_86574_c1_41_1042 315
236 3300053078 Ga0495612_0003688 Ga0495612_0003688_1224_2225 315
237 3300054114 Ga0501084_0056642 Ga0501084_0056642_68_1069 315
238 3300060353 Ga0501082_0308472 Ga0501082_0308472_72_1073 315
239 3300005345 Ga0070692_10024643 Ga0070692_100246433 316
240 3300005365 Ga0070688_100020848 Ga0070688_1000208482 316
241 3300005440 Ga0070705_100007431 Ga0070705_1000074314 316
242 3300005440 Ga0070705_100072171 Ga0070705_1000721712 316
243 3300005444 Ga0070694_100000103 Ga0070694_10000010311 316
244 3300005444 Ga0070694_100001652 Ga0070694_1000016525 316
245 3300005471 Ga0070698_100003114 Ga0070698_1000031144 316
246 3300005471 Ga0070698_100004515 Ga0070698_10000451512 316
247 3300005518 Ga0070699_100000432 Ga0070699_1000004329 316
248 3300005518 Ga0070699_100492223 Ga0070699_1004922231 316
249 3300005545 Ga0070695_100001880 Ga0070695_1000018807 316
250 3300005546 Ga0070696_100016687 Ga0070696_1000166872 316
251 3300005546 Ga0070696_100017968 Ga0070696_1000179683 316
252 3300005549 Ga0070704_100074466 Ga0070704_1000744662 316
253 3300005615 Ga0070702_100004444 Ga0070702_1000044445 316
254 3300005616 Ga0068852_100606624 Ga0068852_1006066241 316
255 3300005842 Ga0068858_100059537 Ga0068858_1000595375 316
256 3300006852 Ga0075433_10094054 Ga0075433_100940542 316
257 3300006852 Ga0075433_10099342 Ga0075433_100993422 316
258 3300009147 Ga0114129_10022667 Ga0114129_100226675 316
259 3300009177 Ga0105248_10194570 Ga0105248_101945702 316
260 3300013297 Ga0157378_10323570 Ga0157378_103235702 316
261 3300025926 Ga0207659_10280684 Ga0207659_102806842 316
262 3300025931 Ga0207644_10062526 Ga0207644_100625262 316
263 3300025935 Ga0207709_10024100 Ga0207709_100241002 316
264 3300025937 Ga0207669_10257995 Ga0207669_102579952 316
265 3300025940 Ga0207691_10096303 Ga0207691_100963033 316
266 3300026035 Ga0207703_10032794 Ga0207703_100327942 316
267 3300046525 Ga0495663_0002941 Ga0495663_0002941_1978_2985 316
268 3300046539 Ga0495621_0062662 Ga0495621_0062662_176_1183 316
269 3300005340 Ga0070689_100235097 Ga0070689_1002350972 317
270 3300006028 Ga0070717_10039858 Ga0070717_100398582 317
271 3300009147 Ga0114129_10031867 Ga0114129_100318672 317
272 3300009177 Ga0105248_10002269 Ga0105248_1000226916 317
273 3300014325 Ga0163163_10276342 Ga0163163_102763423 317
274 3300025941 Ga0207711_10066415 Ga0207711_100664154 317
275 3300026118 Ga0207675_100292694 Ga0207675_1002926942 317
276 3300036401 Ga0373937_0139010 Ga0373937_0139010_1188_2198 317
277 3300046516 Ga0495628_0163944 Ga0495628_0163944_573_1583 317
278 3300046517 Ga0495630_0004015 Ga0495630_0004015_1474_2481 317
279 3300047319 Ga0495674_0032047 Ga0495674_0032047_2725_3732 317
280 3300047444 Ga0495675_0028417 Ga0495675_0028417_353_1360 317
281 3300048088 Ga0495602_0168621 Ga0495602_0168621_542_1549 317
282 3300049576 Ga0501040_0273120 Ga0501040_0273120_125_1132 317
283 3300049585 Ga0501069_0072196 Ga0501069_0072196_709_1716 317
284 3300049590 Ga0501074_0152127 Ga0501074_0152127_493_1500 317
285 3300049591 Ga0501075_0274379 Ga0501075_0274379_203_1210 317
286 3300050507 nmdc:mga05p37_18915_c1 nmdc:mga05p37_18915_c1_3188_4195 317
287 3300005330 Ga0070690_100111970 Ga0070690_1001119702 318
288 3300005333 Ga0070677_10062373 Ga0070677_100623732 318
289 3300005341 Ga0070691_10005581 Ga0070691_100055816 318
290 3300005343 Ga0070687_100078599 Ga0070687_1000785992 318
291 3300005347 Ga0070668_100109683 Ga0070668_1001096832 318
292 3300005356 Ga0070674_100003835 Ga0070674_1000038354 318
293 3300005438 Ga0070701_10016141 Ga0070701_100161412 318
294 3300005441 Ga0070700_100030983 Ga0070700_1000309834 318
295 3300005441 Ga0070700_100035471 Ga0070700_1000354712 318
296 3300005441 Ga0070700_100139883 Ga0070700_1001398832 318
297 3300005536 Ga0070697_100234582 Ga0070697_1002345822 318
298 3300005545 Ga0070695_100044346 Ga0070695_1000443463 318
299 3300005546 Ga0070696_100081946 Ga0070696_1000819462 318
300 3300005549 Ga0070704_100038611 Ga0070704_1000386111 318
301 3300005549 Ga0070704_100063407 Ga0070704_1000634072 318
302 3300005615 Ga0070702_100020952 Ga0070702_1000209524 318
303 3300005718 Ga0068866_10075012 Ga0068866_100750122 318
304 3300005844 Ga0068862_100334264 Ga0068862_1003342641 318
305 3300006237 Ga0097621_100184988 Ga0097621_1001849882 318
306 3300006358 Ga0068871_100216737 Ga0068871_1002167372 318
307 3300006847 Ga0075431_100097179 Ga0075431_1000971792 318
308 3300006847 Ga0075431_100381799 Ga0075431_1003817992 318
309 3300006871 Ga0075434_100139418 Ga0075434_1001394183 318
310 3300006871 Ga0075434_100411402 Ga0075434_1004114021 318
311 3300009148 Ga0105243_10017234 Ga0105243_100172341 318
312 3300009553 Ga0105249_10189879 Ga0105249_101898792 318
313 3300014326 Ga0157380_10066459 Ga0157380_100664592 318
314 3300025899 Ga0207642_10121428 Ga0207642_101214282 318
315 3300025923 Ga0207681_10270665 Ga0207681_102706651 318
316 3300025935 Ga0207709_10027923 Ga0207709_100279232 318
317 3300025937 Ga0207669_10107684 Ga0207669_101076842 318
318 3300025938 Ga0207704_10036682 Ga0207704_100366821 318
319 3300025939 Ga0207665_10149142 Ga0207665_101491422 318
320 3300025961 Ga0207712_10157044 Ga0207712_101570442 318
321 3300025972 Ga0207668_10016766 Ga0207668_100167661 318
322 3300026075 Ga0207708_10038732 Ga0207708_100387322 318
323 3300026075 Ga0207708_10069389 Ga0207708_100693893 318
324 3300026089 Ga0207648_10219365 Ga0207648_102193651 318
325 3300026118 Ga0207675_100011936 Ga0207675_1000119365 318
326 3300026142 Ga0207698_10352519 Ga0207698_103525191 318
327 3300027907 Ga0207428_10011592 Ga0207428_100115924 318
328 3300028380 Ga0268265_10048009 Ga0268265_100480092 318
329 3300028381 Ga0268264_10172422 Ga0268264_101724222 318
330 3300046459 Ga0495629_0026931 Ga0495629_0026931_3004_4017 318
331 3300046539 Ga0495621_0048686 Ga0495621_0048686_59_1072 318
332 3300049593 Ga0501077_0164176 Ga0501077_0164176_228_1238 318
333 3300050510 nmdc:mga06r32_10852_c1 nmdc:mga06r32_10852_c1_5874_6884 318
334 3300050512 nmdc:mga0n895_512991_c1 nmdc:mga0n895_512991_c1_26_1036 318
335 3300054114 Ga0501084_0124924 Ga0501084_0124924_200_1210 318
336 3300003203 JGI25406J46586_10002645 JGI25406J46586_100026454 319
337 3300005295 Ga0065707_10041103 Ga0065707_100411032 319
338 3300005328 Ga0070676_10106260 Ga0070676_101062602 319
339 3300005328 Ga0070676_10271725 Ga0070676_102717251 319
340 3300005329 Ga0070683_100294848 Ga0070683_1002948482 319
341 3300005334 Ga0068869_100051719 Ga0068869_1000517192 319
342 3300005336 Ga0070680_100053213 Ga0070680_1000532132 319
343 3300005337 Ga0070682_100340759 Ga0070682_1003407591 319
344 3300005338 Ga0068868_100045403 Ga0068868_1000454032 319
345 3300005355 Ga0070671_100382407 Ga0070671_1003824071 319
346 3300005364 Ga0070673_100060792 Ga0070673_1000607925 319
347 3300005364 Ga0070673_100318646 Ga0070673_1003186461 319
348 3300005367 Ga0070667_100022899 Ga0070667_1000228992 319
349 3300005434 Ga0070709_10001162 Ga0070709_100011625 319
350 3300005434 Ga0070709_10009577 Ga0070709_100095772 319
351 3300005434 Ga0070709_10018121 Ga0070709_100181212 319
352 3300005435 Ga0070714_100066117 Ga0070714_1000661172 319
353 3300005436 Ga0070713_100001852 Ga0070713_10000185210 319
354 3300005436 Ga0070713_100002307 Ga0070713_1000023073 319
355 3300005439 Ga0070711_100030637 Ga0070711_1000306372 319
356 3300005444 Ga0070694_100160578 Ga0070694_1001605781 319
357 3300005458 Ga0070681_10001282 Ga0070681_100012826 319
358 3300005459 Ga0068867_100024565 Ga0068867_1000245654 319
359 3300005459 Ga0068867_100115803 Ga0068867_1001158032 319
360 3300005467 Ga0070706_100132967 Ga0070706_1001329672 319
361 3300005468 Ga0070707_100101946 Ga0070707_1001019462 319
362 3300005518 Ga0070699_100252862 Ga0070699_1002528622 319
363 3300005530 Ga0070679_100045647 Ga0070679_1000456472 319
364 3300005535 Ga0070684_100052651 Ga0070684_1000526514 319
365 3300005543 Ga0070672_100006442 Ga0070672_1000064425 319
366 3300005545 Ga0070695_100200851 Ga0070695_1002008512 319
367 3300005548 Ga0070665_100020037 Ga0070665_1000200376 319
368 3300005548 Ga0070665_100057610 Ga0070665_1000576102 319
369 3300005563 Ga0068855_100000234 Ga0068855_10000023426 319
370 3300005577 Ga0068857_100004869 Ga0068857_1000048694 319
371 3300005578 Ga0068854_100132868 Ga0068854_1001328682 319
372 3300005614 Ga0068856_100000062 Ga0068856_10000006214 319
373 3300005616 Ga0068852_100016336 Ga0068852_1000163364 319
374 3300005617 Ga0068859_100099523 Ga0068859_1000995232 319
375 3300005617 Ga0068859_100108684 Ga0068859_1001086842 319
376 3300005617 Ga0068859_100398182 Ga0068859_1003981822 319
377 3300005841 Ga0068863_100093972 Ga0068863_1000939722 319
378 3300005842 Ga0068858_100014019 Ga0068858_1000140192 319
379 3300005843 Ga0068860_100019110 Ga0068860_1000191106 319
380 3300005843 Ga0068860_100285538 Ga0068860_1002855381 319
381 3300005844 Ga0068862_100260522 Ga0068862_1002605222 319
382 3300005844 Ga0068862_100266667 Ga0068862_1002666672 319
383 3300005985 Ga0081539_10002905 Ga0081539_100029057 319
384 3300006175 Ga0070712_100001119 Ga0070712_10000111913 319
385 3300006175 Ga0070712_100028949 Ga0070712_1000289492 319
386 3300006237 Ga0097621_100000148 Ga0097621_1000001482 319
387 3300006237 Ga0097621_100003128 Ga0097621_1000031283 319
388 3300006358 Ga0068871_100030112 Ga0068871_1000301123 319
389 3300006358 Ga0068871_100166657 Ga0068871_1001666572 319
390 3300006844 Ga0075428_100005232 Ga0075428_10000523213 319
391 3300006844 Ga0075428_100111343 Ga0075428_1001113435 319
392 3300006844 Ga0075428_100246604 Ga0075428_1002466042 319
393 3300006846 Ga0075430_100002229 Ga0075430_10000222913 319
394 3300006846 Ga0075430_100271501 Ga0075430_1002715012 319
395 3300006847 Ga0075431_100000151 Ga0075431_10000015126 319
396 3300006852 Ga0075433_10064114 Ga0075433_100641142 319
397 3300006871 Ga0075434_100165708 Ga0075434_1001657082 319
398 3300006880 Ga0075429_100001317 Ga0075429_1000013176 319
399 3300006880 Ga0075429_100293880 Ga0075429_1002938802 319
400 3300006881 Ga0068865_100002043 Ga0068865_1000020438 319
401 3300006881 Ga0068865_100075093 Ga0068865_1000750933 319
402 3300006881 Ga0068865_100301566 Ga0068865_1003015662 319
403 3300006931 Ga0097620_100099524 Ga0097620_1000995242 319
404 3300006931 Ga0097620_100108683 Ga0097620_1001086832 319
405 3300006931 Ga0097620_100398149 Ga0097620_1003981492 319
406 3300009093 Ga0105240_10014149 Ga0105240_100141492 319
407 3300009093 Ga0105240_10095577 Ga0105240_100955772 319
408 3300009093 Ga0105240_10425824 Ga0105240_104258242 319
409 3300009094 Ga0111539_10106234 Ga0111539_101062342 319
410 3300009148 Ga0105243_10073335 Ga0105243_100733353 319
411 3300009174 Ga0105241_10109271 Ga0105241_101092712 319
412 3300009174 Ga0105241_10159802 Ga0105241_101598022 319
413 3300009176 Ga0105242_10024634 Ga0105242_100246342 319
414 3300009177 Ga0105248_10007399 Ga0105248_1000739912 319
415 3300009177 Ga0105248_10109692 Ga0105248_101096922 319
416 3300009177 Ga0105248_10674830 Ga0105248_106748301 319
417 3300009545 Ga0105237_10017405 Ga0105237_100174052 319
418 3300009551 Ga0105238_10000609 Ga0105238_1000060917 319
419 3300009551 Ga0105238_10004737 Ga0105238_100047373 319
420 3300010159 Ga0099796_10036617 Ga0099796_100366172 319
421 3300010375 Ga0105239_10039316 Ga0105239_100393165 319
422 3300010375 Ga0105239_10076765 Ga0105239_100767652 319
423 3300010375 Ga0105239_10198827 Ga0105239_101988272 319
424 3300010375 Ga0105239_10211951 Ga0105239_102119513 319
425 3300010375 Ga0105239_10274232 Ga0105239_102742322 319
426 3300013105 Ga0157369_10000159 Ga0157369_1000015960 319
427 3300013296 Ga0157374_10000338 Ga0157374_1000033816 319
428 3300013296 Ga0157374_10139114 Ga0157374_101391142 319
429 3300013297 Ga0157378_10005749 Ga0157378_100057498 319
430 3300013297 Ga0157378_10055952 Ga0157378_100559522 319
431 3300013306 Ga0163162_10228965 Ga0163162_102289652 319
432 3300013306 Ga0163162_10650297 Ga0163162_106502971 319
433 3300013307 Ga0157372_10003611 Ga0157372_1000361116 319
434 3300013308 Ga0157375_10132829 Ga0157375_101328292 319
435 3300013308 Ga0157375_10439648 Ga0157375_104396482 319
436 3300014325 Ga0163163_10001395 Ga0163163_100013952 319
437 3300014325 Ga0163163_10158191 Ga0163163_101581912 319
438 3300014968 Ga0157379_10009128 Ga0157379_100091286 319
439 3300014969 Ga0157376_10007509 Ga0157376_100075099 319
440 3300014969 Ga0157376_10038471 Ga0157376_100384712 319
441 3300025893 Ga0207682_10007428 Ga0207682_100074282 319
442 3300025904 Ga0207647_10016923 Ga0207647_100169232 319
443 3300025906 Ga0207699_10008849 Ga0207699_100088493 319
444 3300025907 Ga0207645_10163194 Ga0207645_101631942 319
445 3300025907 Ga0207645_10233247 Ga0207645_102332471 319
446 3300025911 Ga0207654_10011627 Ga0207654_100116273 319
447 3300025912 Ga0207707_10001452 Ga0207707_1000145218 319
448 3300025913 Ga0207695_10089433 Ga0207695_100894333 319
449 3300025915 Ga0207693_10002431 Ga0207693_100024316 319
450 3300025915 Ga0207693_10026238 Ga0207693_100262384 319
451 3300025915 Ga0207693_10315284 Ga0207693_103152842 319
452 3300025921 Ga0207652_10023725 Ga0207652_100237255 319
453 3300025924 Ga0207694_10003298 Ga0207694_100032986 319
454 3300025924 Ga0207694_10004655 Ga0207694_100046557 319
455 3300025924 Ga0207694_10005997 Ga0207694_100059972 319
456 3300025926 Ga0207659_10432750 Ga0207659_104327501 319
457 3300025927 Ga0207687_10030526 Ga0207687_100305262 319
458 3300025927 Ga0207687_10045413 Ga0207687_100454132 319
459 3300025928 Ga0207700_10006279 Ga0207700_100062794 319
460 3300025931 Ga0207644_10067598 Ga0207644_100675983 319
461 3300025933 Ga0207706_10047199 Ga0207706_100471992 319
462 3300025934 Ga0207686_10162839 Ga0207686_101628392 319
463 3300025938 Ga0207704_10007997 Ga0207704_100079971 319
464 3300025938 Ga0207704_10012937 Ga0207704_100129374 319
465 3300025938 Ga0207704_10174037 Ga0207704_101740371 319
466 3300025939 Ga0207665_10047783 Ga0207665_100477832 319
467 3300025940 Ga0207691_10019785 Ga0207691_100197855 319
468 3300025941 Ga0207711_10038043 Ga0207711_100380432 319
469 3300025941 Ga0207711_10115070 Ga0207711_101150701 319
470 3300025942 Ga0207689_10003694 Ga0207689_100036944 319
471 3300025944 Ga0207661_10040859 Ga0207661_100408592 319
472 3300025949 Ga0207667_10000465 Ga0207667_1000046520 319
473 3300025986 Ga0207658_10021006 Ga0207658_100210062 319
474 3300025986 Ga0207658_10054958 Ga0207658_100549583 319
475 3300026023 Ga0207677_10022255 Ga0207677_100222553 319
476 3300026035 Ga0207703_10122731 Ga0207703_101227311 319
477 3300026041 Ga0207639_10040615 Ga0207639_100406152 319
478 3300026041 Ga0207639_10426691 Ga0207639_104266911 319
479 3300026078 Ga0207702_10001096 Ga0207702_100010967 319
480 3300026078 Ga0207702_10062555 Ga0207702_100625552 319
481 3300026088 Ga0207641_10062885 Ga0207641_100628853 319
482 3300026088 Ga0207641_10133099 Ga0207641_101330992 319
483 3300026088 Ga0207641_10145416 Ga0207641_101454162 319
484 3300026089 Ga0207648_10066006 Ga0207648_100660062 319
485 3300026089 Ga0207648_10091877 Ga0207648_100918773 319
486 3300026095 Ga0207676_10215505 Ga0207676_102155052 319
487 3300026116 Ga0207674_10005293 Ga0207674_100052933 319
488 3300026116 Ga0207674_10007441 Ga0207674_100074419 319
489 3300026116 Ga0207674_10077447 Ga0207674_100774472 319
490 3300026116 Ga0207674_10103444 Ga0207674_101034442 319
491 3300026118 Ga0207675_100087096 Ga0207675_1000870962 319
492 3300026121 Ga0207683_10263742 Ga0207683_102637422 319
493 3300027671 Ga0209588_1025839 Ga0209588_10258392 319
494 3300027907 Ga0207428_10025198 Ga0207428_100251982 319
495 3300028379 Ga0268266_10010487 Ga0268266_100104874 319
496 3300028380 Ga0268265_10215261 Ga0268265_102152612 319
497 3300028380 Ga0268265_10219611 Ga0268265_102196112 319
498 3300028380 Ga0268265_10255832 Ga0268265_102558322 319
499 3300028381 Ga0268264_10014069 Ga0268264_100140696 319
500 3300028381 Ga0268264_10209600 Ga0268264_102096002 319
501 3300028563 Ga0265319_1008171 Ga0265319_10081712 319
502 3300028577 Ga0265318_10001629 Ga0265318_100016296 319
503 3300031241 Ga0265325_10067854 Ga0265325_100678542 319
504 3300031242 Ga0265329_10003450 Ga0265329_100034505 319
505 3300031247 Ga0265340_10005071 Ga0265340_100050714 319
506 3300031249 Ga0265339_10005514 Ga0265339_100055142 319
507 3300031250 Ga0265331_10000094 Ga0265331_1000009419 319
508 3300031344 Ga0265316_10012133 Ga0265316_100121334 319
509 3300031344 Ga0265316_10019254 Ga0265316_100192542 319
510 3300031548 Ga0307408_100036619 Ga0307408_1000366192 319
511 3300031711 Ga0265314_10015181 Ga0265314_100151813 319
512 3300031711 Ga0265314_10022657 Ga0265314_100226572 319
513 3300031712 Ga0265342_10002054 Ga0265342_100020545 319
514 3300032002 Ga0307416_100087246 Ga0307416_1000872462 319
515 3300035691 Ga0373931_0091344 Ga0373931_0091344_449_1462 319
516 3300037068 Ga0373925_0063162 Ga0373925_0063162_223_1236 319
517 3300037068 Ga0373925_0177721 Ga0373925_0177721_466_1479 319
518 3300042156 Ga0439446_0002000 Ga0439446_0002000_651_1670 319
519 3300042461 Ga0439460_0026167 Ga0439460_0026167_92_1108 319
520 3300045051 Ga0451576_0039470 Ga0451576_0039470_2333_3346 319
521 3300045976 Ga0466967_0431028 Ga0466967_0431028_125_1138 319
522 3300046472 Ga0495580_0032582 Ga0495580_0032582_550_1563 319
523 3300046683 Ga0495658_0019092 Ga0495658_0019092_927_1940 319
524 3300048905 Ga0496102_0050682 Ga0496102_0050682_1489_2505 319
525 3300048915 Ga0496112_0001729 Ga0496112_0001729_10873_11889 319
526 3300048915 Ga0496112_0001787 Ga0496112_0001787_15400_16413 319
527 3300049580 Ga0501046_0298384 Ga0501046_0298384_144_1157 319
528 3300049590 Ga0501074_0148729 Ga0501074_0148729_565_1578 319
529 3300049591 Ga0501075_0174401 Ga0501075_0174401_616_1629 319
530 3300049743 Ga0501081_0286599 Ga0501081_0286599_121_1134 319
531 3300050508 nmdc:mga09592_783_c1 nmdc:mga09592_783_c1_17399_18412 319
532 3300050509 nmdc:mga0qj67_304852_c1 nmdc:mga0qj67_304852_c1_122_1138 319
533 3300050510 nmdc:mga06r32_8100_c1 nmdc:mga06r32_8100_c1_5617_6630 319
534 3300050512 nmdc:mga0n895_185826_c1 nmdc:mga0n895_185826_c1_510_1523 319
535 3300050513 nmdc:mga0rr50_18049_c1 nmdc:mga0rr50_18049_c1_927_1940 319
536 3300002459 JGI24751J29686_10012497 JGI24751J29686_100124971 320
537 3300005331 Ga0070670_100157523 Ga0070670_1001575232 320
538 3300005334 Ga0068869_100061516 Ga0068869_1000615162 320
539 3300005336 Ga0070680_100067149 Ga0070680_1000671492 320
540 3300005337 Ga0070682_100024660 Ga0070682_1000246604 320
541 3300005339 Ga0070660_100113116 Ga0070660_1001131163 320
542 3300005340 Ga0070689_100189499 Ga0070689_1001894991 320
543 3300005347 Ga0070668_100065785 Ga0070668_1000657852 320
544 3300005353 Ga0070669_100032776 Ga0070669_1000327762 320
545 3300005367 Ga0070667_100086958 Ga0070667_1000869582 320
546 3300005435 Ga0070714_100194810 Ga0070714_1001948101 320
547 3300005436 Ga0070713_100000476 Ga0070713_10000047610 320
548 3300005436 Ga0070713_100014557 Ga0070713_1000145572 320
549 3300005436 Ga0070713_100056670 Ga0070713_1000566702 320
550 3300005439 Ga0070711_100000281 Ga0070711_1000002816 320
551 3300005439 Ga0070711_100001229 Ga0070711_10000122910 320
552 3300005439 Ga0070711_100005753 Ga0070711_1000057532 320
553 3300005439 Ga0070711_100020727 Ga0070711_1000207272 320
554 3300005439 Ga0070711_100033648 Ga0070711_1000336482 320
555 3300005439 Ga0070711_100035103 Ga0070711_1000351032 320
556 3300005444 Ga0070694_100071059 Ga0070694_1000710592 320
557 3300005445 Ga0070708_100003651 Ga0070708_1000036514 320
558 3300005445 Ga0070708_100006273 Ga0070708_1000062738 320
559 3300005445 Ga0070708_100066556 Ga0070708_1000665562 320
560 3300005445 Ga0070708_100107291 Ga0070708_1001072913 320
561 3300005445 Ga0070708_100340903 Ga0070708_1003409031 320
562 3300005456 Ga0070678_100114027 Ga0070678_1001140272 320
563 3300005457 Ga0070662_100169068 Ga0070662_1001690682 320
564 3300005459 Ga0068867_100060541 Ga0068867_1000605412 320
565 3300005459 Ga0068867_100150388 Ga0068867_1001503882 320
566 3300005466 Ga0070685_10050585 Ga0070685_100505852 320
567 3300005466 Ga0070685_10213936 Ga0070685_102139362 320
568 3300005467 Ga0070706_100000336 Ga0070706_10000033621 320
569 3300005467 Ga0070706_100002094 Ga0070706_1000020946 320
570 3300005467 Ga0070706_100011620 Ga0070706_1000116204 320
571 3300005467 Ga0070706_100167294 Ga0070706_1001672942 320
572 3300005468 Ga0070707_100019771 Ga0070707_1000197713 320
573 3300005468 Ga0070707_100021052 Ga0070707_1000210522 320
574 3300005471 Ga0070698_100005969 Ga0070698_10000596911 320
575 3300005471 Ga0070698_100283312 Ga0070698_1002833122 320
576 3300005518 Ga0070699_100005358 Ga0070699_1000053582 320
577 3300005518 Ga0070699_100007587 Ga0070699_1000075872 320
578 3300005518 Ga0070699_100104193 Ga0070699_1001041932 320
579 3300005530 Ga0070679_100120107 Ga0070679_1001201071 320
580 3300005536 Ga0070697_100002395 Ga0070697_1000023955 320
581 3300005536 Ga0070697_100014445 Ga0070697_1000144452 320
582 3300005536 Ga0070697_100016125 Ga0070697_1000161257 320
583 3300005536 Ga0070697_100236378 Ga0070697_1002363781 320
584 3300005543 Ga0070672_100264764 Ga0070672_1002647641 320
585 3300005544 Ga0070686_100026496 Ga0070686_1000264962 320
586 3300005546 Ga0070696_100023209 Ga0070696_1000232092 320
587 3300005546 Ga0070696_100175522 Ga0070696_1001755222 320
588 3300005546 Ga0070696_100247543 Ga0070696_1002475432 320
589 3300005548 Ga0070665_100013516 Ga0070665_1000135169 320
590 3300005548 Ga0070665_100029410 Ga0070665_1000294106 320
591 3300005549 Ga0070704_100218752 Ga0070704_1002187521 320
592 3300005563 Ga0068855_100502373 Ga0068855_1005023732 320
593 3300005614 Ga0068856_100041098 Ga0068856_1000410984 320
594 3300005616 Ga0068852_100052877 Ga0068852_1000528773 320
595 3300005617 Ga0068859_100053692 Ga0068859_1000536922 320
596 3300005617 Ga0068859_100123873 Ga0068859_1001238732 320
597 3300005618 Ga0068864_100233499 Ga0068864_1002334992 320
598 3300005618 Ga0068864_100257683 Ga0068864_1002576832 320
599 3300005718 Ga0068866_10041164 Ga0068866_100411642 320
600 3300005840 Ga0068870_10074661 Ga0068870_100746612 320
601 3300005840 Ga0068870_10117086 Ga0068870_101170862 320
602 3300005841 Ga0068863_100035781 Ga0068863_1000357813 320
603 3300005841 Ga0068863_100126468 Ga0068863_1001264682 320
604 3300005841 Ga0068863_100337148 Ga0068863_1003371482 320
605 3300005842 Ga0068858_100267454 Ga0068858_1002674542 320
606 3300005843 Ga0068860_100075164 Ga0068860_1000751643 320
607 3300005843 Ga0068860_100462530 Ga0068860_1004625301 320
608 3300005844 Ga0068862_100056072 Ga0068862_1000560722 320
609 3300005981 Ga0081538_10004787 Ga0081538_100047877 320
610 3300005985 Ga0081539_10012728 Ga0081539_100127282 320
611 3300006028 Ga0070717_10032853 Ga0070717_100328532 320
612 3300006028 Ga0070717_10038453 Ga0070717_100384533 320
613 3300006163 Ga0070715_10000763 Ga0070715_100007632 320
614 3300006173 Ga0070716_100010159 Ga0070716_1000101592 320
615 3300006173 Ga0070716_100052109 Ga0070716_1000521091 320
616 3300006175 Ga0070712_100000468 Ga0070712_10000046818 320
617 3300006175 Ga0070712_100002849 Ga0070712_1000028494 320
618 3300006175 Ga0070712_100003144 Ga0070712_1000031442 320
619 3300006175 Ga0070712_100008180 Ga0070712_1000081803 320
620 3300006175 Ga0070712_100008773 Ga0070712_1000087738 320
621 3300006237 Ga0097621_100004631 Ga0097621_1000046316 320
622 3300006237 Ga0097621_100046515 Ga0097621_1000465154 320
623 3300006358 Ga0068871_100013790 Ga0068871_1000137904 320
624 3300006358 Ga0068871_100138845 Ga0068871_1001388452 320
625 3300006358 Ga0068871_100268950 Ga0068871_1002689501 320
626 3300006844 Ga0075428_100130891 Ga0075428_1001308912 320
627 3300006846 Ga0075430_100221445 Ga0075430_1002214451 320
628 3300006871 Ga0075434_100051841 Ga0075434_1000518414 320
629 3300006871 Ga0075434_100179894 Ga0075434_1001798942 320
630 3300006881 Ga0068865_100001782 Ga0068865_1000017823 320
631 3300006914 Ga0075436_100183262 Ga0075436_1001832622 320
632 3300006931 Ga0097620_100053692 Ga0097620_1000536922 320
633 3300006931 Ga0097620_100123888 Ga0097620_1001238883 320
634 3300007076 Ga0075435_100013494 Ga0075435_1000134947 320
635 3300007076 Ga0075435_100198789 Ga0075435_1001987892 320
636 3300009093 Ga0105240_10124643 Ga0105240_101246432 320
637 3300009094 Ga0111539_10040991 Ga0111539_100409915 320
638 3300009098 Ga0105245_10380129 Ga0105245_103801291 320
639 3300009147 Ga0114129_10059432 Ga0114129_100594325 320
640 3300009147 Ga0114129_10059769 Ga0114129_100597692 320
641 3300009147 Ga0114129_10136073 Ga0114129_101360733 320
642 3300009174 Ga0105241_10110955 Ga0105241_101109552 320
643 3300009176 Ga0105242_10045455 Ga0105242_100454554 320
644 3300009177 Ga0105248_10067590 Ga0105248_100675902 320
645 3300009177 Ga0105248_10644322 Ga0105248_106443222 320
646 3300009545 Ga0105237_10089226 Ga0105237_100892262 320
647 3300013308 Ga0157375_10199382 Ga0157375_101993821 320
648 3300014745 Ga0157377_10165501 Ga0157377_101655012 320
649 3300014968 Ga0157379_10285656 Ga0157379_102856562 320
650 3300014969 Ga0157376_10034776 Ga0157376_100347762 320
651 3300014969 Ga0157376_10192467 Ga0157376_101924671 320
652 3300017792 Ga0163161_10156399 Ga0163161_101563992 320
653 3300022732 Ga0224569_100615 Ga0224569_1006155 320
654 3300024227 Ga0228598_1000044 Ga0228598_10000447 320
655 3300024227 Ga0228598_1000070 Ga0228598_10000702 320
656 3300025321 Ga0207656_10077074 Ga0207656_100770742 320
657 3300025898 Ga0207692_10013451 Ga0207692_100134512 320
658 3300025900 Ga0207710_10034751 Ga0207710_100347512 320
659 3300025904 Ga0207647_10139048 Ga0207647_101390482 320
660 3300025905 Ga0207685_10001682 Ga0207685_100016824 320
661 3300025906 Ga0207699_10047766 Ga0207699_100477662 320
662 3300025907 Ga0207645_10003579 Ga0207645_1000357913 320
663 3300025910 Ga0207684_10000320 Ga0207684_1000032031 320
664 3300025910 Ga0207684_10004878 Ga0207684_100048784 320
665 3300025910 Ga0207684_10203795 Ga0207684_102037952 320
666 3300025910 Ga0207684_10398996 Ga0207684_103989961 320
667 3300025911 Ga0207654_10004482 Ga0207654_100044822 320
668 3300025912 Ga0207707_10060733 Ga0207707_100607332 320
669 3300025914 Ga0207671_10157951 Ga0207671_101579512 320
670 3300025915 Ga0207693_10000008 Ga0207693_1000000823 320
671 3300025915 Ga0207693_10001167 Ga0207693_1000116718 320
672 3300025915 Ga0207693_10007049 Ga0207693_100070492 320
673 3300025915 Ga0207693_10009953 Ga0207693_100099536 320
674 3300025915 Ga0207693_10015202 Ga0207693_100152025 320
675 3300025916 Ga0207663_10000111 Ga0207663_100001113 320
676 3300025916 Ga0207663_10010876 Ga0207663_100108762 320
677 3300025916 Ga0207663_10019281 Ga0207663_100192812 320
678 3300025916 Ga0207663_10036341 Ga0207663_100363412 320
679 3300025916 Ga0207663_10047053 Ga0207663_100470532 320
680 3300025919 Ga0207657_10002009 Ga0207657_100020096 320
681 3300025921 Ga0207652_10050957 Ga0207652_100509572 320
682 3300025921 Ga0207652_10312195 Ga0207652_103121952 320
683 3300025922 Ga0207646_10073817 Ga0207646_100738173 320
684 3300025922 Ga0207646_10167024 Ga0207646_101670242 320
685 3300025923 Ga0207681_10009128 Ga0207681_100091283 320
686 3300025924 Ga0207694_10036471 Ga0207694_100364712 320
687 3300025927 Ga0207687_10111801 Ga0207687_101118011 320
688 3300025928 Ga0207700_10000107 Ga0207700_1000010718 320
689 3300025933 Ga0207706_10000641 Ga0207706_1000064119 320
690 3300025933 Ga0207706_10147805 Ga0207706_101478052 320
691 3300025938 Ga0207704_10019036 Ga0207704_100190364 320
692 3300025939 Ga0207665_10016930 Ga0207665_100169302 320
693 3300025939 Ga0207665_10039155 Ga0207665_100391552 320
694 3300025939 Ga0207665_10072766 Ga0207665_100727661 320
695 3300025940 Ga0207691_10093246 Ga0207691_100932461 320
696 3300025941 Ga0207711_10012633 Ga0207711_100126333 320
697 3300025941 Ga0207711_10018198 Ga0207711_100181982 320
698 3300025945 Ga0207679_10133818 Ga0207679_101338182 320
699 3300025949 Ga0207667_10055236 Ga0207667_100552362 320
700 3300025960 Ga0207651_10224885 Ga0207651_102248852 320
701 3300025972 Ga0207668_10096727 Ga0207668_100967272 320
702 3300025981 Ga0207640_10034171 Ga0207640_100341712 320
703 3300025986 Ga0207658_10070337 Ga0207658_100703372 320
704 3300026023 Ga0207677_10071854 Ga0207677_100718542 320
705 3300026035 Ga0207703_10131182 Ga0207703_101311822 320
706 3300026041 Ga0207639_10278753 Ga0207639_102787531 320
707 3300026067 Ga0207678_10008144 Ga0207678_100081445 320
708 3300026088 Ga0207641_10000811 Ga0207641_1000081123 320
709 3300026089 Ga0207648_10017102 Ga0207648_100171025 320
710 3300026089 Ga0207648_10039098 Ga0207648_100390982 320
711 3300026089 Ga0207648_10288232 Ga0207648_102882321 320
712 3300026095 Ga0207676_10096526 Ga0207676_100965262 320
713 3300026116 Ga0207674_10614282 Ga0207674_106142821 320
714 3300026121 Ga0207683_10033950 Ga0207683_100339504 320
715 3300026142 Ga0207698_10089175 Ga0207698_100891752 320
716 3300026142 Ga0207698_10528255 Ga0207698_105282552 320
717 3300027671 Ga0209588_1000001 Ga0209588_1000001296 320
718 3300027907 Ga0207428_10010140 Ga0207428_100101404 320
719 3300028016 Ga0265354_1000756 Ga0265354_10007562 320
720 3300028379 Ga0268266_10030899 Ga0268266_100308992 320
721 3300030760 Ga0265762_1000130 Ga0265762_100013012 320
722 3300030760 Ga0265762_1016014 Ga0265762_10160142 320
723 3300030878 Ga0265770_1000180 Ga0265770_10001806 320
724 3300030879 Ga0265765_1000179 Ga0265765_10001792 320
725 3300031090 Ga0265760_10001544 Ga0265760_100015443 320
726 3300031090 Ga0265760_10011422 Ga0265760_100114221 320
727 3300031241 Ga0265325_10003325 Ga0265325_100033252 320
728 3300031241 Ga0265325_10004980 Ga0265325_100049802 320
729 3300031249 Ga0265339_10033361 Ga0265339_100333612 320
730 3300031250 Ga0265331_10012844 Ga0265331_100128447 320
731 3300031250 Ga0265331_10067347 Ga0265331_100673472 320
732 3300031344 Ga0265316_10005655 Ga0265316_100056554 320
733 3300031344 Ga0265316_10006792 Ga0265316_1000679210 320
734 3300031344 Ga0265316_10014330 Ga0265316_100143305 320
735 3300031595 Ga0265313_10003181 Ga0265313_1000318111 320
736 3300031711 Ga0265314_10000509 Ga0265314_1000050910 320
737 3300031711 Ga0265314_10033167 Ga0265314_100331672 320
738 3300034820 Ga0373959_0022988 Ga0373959_0022988_167_1183 320
739 3300035091 Ga0373951_0041672 Ga0373951_0041672_67_1083 320
740 3300035112 Ga0373932_0064742 Ga0373932_0064742_74_1090 320
741 3300035691 Ga0373931_0048317 Ga0373931_0048317_245_1261 320
742 3300035724 Ga0373933_0126705 Ga0373933_0126705_249_1265 320
743 3300035725 Ga0373947_0126295 Ga0373947_0126295_256_1272 320
744 3300036401 Ga0373937_0046916 Ga0373937_0046916_1699_2715 320
745 3300037068 Ga0373925_0244813 Ga0373925_0244813_10_1029 320
746 3300037853 Ga0436364_0703870 Ga0436364_0703870_1342_2358 320
747 3300039437 Ga0436365_1220175 Ga0436365_1220175_904_1920 320
748 3300046455 Ga0495603_0069122 Ga0495603_0069122_540_1556 320
749 3300046472 Ga0495580_0018437 Ga0495580_0018437_803_1819 320
750 3300046472 Ga0495580_0019663 Ga0495580_0019663_3148_4164 320
751 3300046477 Ga0495664_0099347 Ga0495664_0099347_96_1112 320
752 3300046543 Ga0495645_0030542 Ga0495645_0030542_1519_2535 320
753 3300046683 Ga0495658_0052459 Ga0495658_0052459_88_1104 320
754 3300047319 Ga0495674_0058171 Ga0495674_0058171_46_1062 320
755 3300048907 Ga0496104_0011300 Ga0496104_0011300_5619_6635 320
756 3300048911 Ga0496108_0161805 Ga0496108_0161805_594_1610 320
757 3300048912 Ga0496109_0465400 Ga0496109_0465400_167_1183 320
758 3300048915 Ga0496112_0119703 Ga0496112_0119703_804_1820 320
759 3300048915 Ga0496112_0196180 Ga0496112_0196180_353_1369 320
760 3300048917 Ga0496114_0062970 Ga0496114_0062970_1477_2493 320
761 3300050507 nmdc:mga05p37_171860_c1 nmdc:mga05p37_171860_c1_62_1078 320
762 3300050507 nmdc:mga05p37_276667_c1 nmdc:mga05p37_276667_c1_809_1837 320
763 3300050507 nmdc:mga05p37_48416_c1 nmdc:mga05p37_48416_c1_58_1074 320
764 3300050507 nmdc:mga05p37_50333_c1 nmdc:mga05p37_50333_c1_1860_2876 320
765 3300050507 nmdc:mga05p37_59198_c1 nmdc:mga05p37_59198_c1_3252_4268 320
766 3300050507 nmdc:mga05p37_59730_c1 nmdc:mga05p37_59730_c1_3461_4477 320
767 3300050507 nmdc:mga05p37_64498_c1 nmdc:mga05p37_64498_c1_1767_2783 320
768 3300050507 nmdc:mga05p37_95864_c1 nmdc:mga05p37_95864_c1_810_1826 320
769 3300050508 nmdc:mga09592_268085_c1 nmdc:mga09592_268085_c1_444_1460 320
770 3300050512 nmdc:mga0n895_13298_c1 nmdc:mga0n895_13298_c1_6343_7359 320
771 3300050512 nmdc:mga0n895_590810_c1 nmdc:mga0n895_590810_c1_38_1054 320
772 3300050513 nmdc:mga0rr50_126767_c1 nmdc:mga0rr50_126767_c1_22_1050 320
773 3300050513 nmdc:mga0rr50_65112_c1 nmdc:mga0rr50_65112_c1_845_1861 320
774 3300050515 nmdc:mga0a205_113598_c1 nmdc:mga0a205_113598_c1_116_1132 320
775 3300053077 Ga0495601_0113111 Ga0495601_0113111_105_1121 320
776 3300053085 Ga0495619_0061392 Ga0495619_0061392_1337_2353 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

9

227

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

272

358

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8602 8 316
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.8388 7 312
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8358 7 312
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8316 7 312
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.8299 8 310
ID Description Score Start End Superfamily
4zohB01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9127 8 59 3.30.43.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9075 7 59 3.30.43.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8776 7 59 3.30.43.10
5y6qB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8717 214 316 3.30.390.50
1t3qF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8715 7 62 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A3D2WE62-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9648 168 312
AF-A0A3D5P1S2-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9562 216 311
AF-A0A3D2WE62-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9519 168 312
AF-A0A848VEX5-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9504 206 311
AF-A0A7C3Z882-F1-model_v4 FAD-dependent oxidoreductase 0.944 153 310 GO:0016491
GO:0051536
GO:0071949

Feature Viewer

pLDDT pTM Quality
85.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map