F480300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 312 | 776 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10012728|Ga0081539_100127282 |
| Length | 365 |
| Sequence | MAVIRDVMPAFELLQPTTVSGALELLDRHGASAWVLAGGLDSFDWLKDRIRRPSAVVDLSGIADLKGVRPWQDGVEIGAMTTVTEVVRNATVGERFGLLRQAAELVASPQIRNQGTIGGNVTQDTRCWYYRAGWSCYRAGGNICYADTPQSLNREHAILEADRCVAVSPSDTAPALVALDASMVLQSRAGERIVPAEEYFIGPGTDITRMTALRRGELLTAIRIPGTWAGAQFYFEKIRDRNVWDFALMSVASAMVLKDAAPPRPRDTVTLGDASTLPEAQQRAGVATIERIRLVVNGAAARPLRLAAVERLVAGRPRNEETATAAGALAIEGAQPLHHNAYKVPLMRNLVKRAIRGVEEGPWIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 1.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.48 |
| Rhizosphere | 96.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10012497 | 3300002459 | Bacteria | 1751 |
| 2 | JGI25406J46586_10002645 | 3300003203 | Bacteria | 8438 |
| 3 | Ga0065707_10041103 | 3300005295 | Bacteria | 1560 |
| 4 | Ga0070676_10106260 | 3300005328 | Bacteria | 1741 |
| 5 | Ga0070676_10271725 | 3300005328 | Bacteria | 1139 |
| 6 | Ga0070683_100294848 | 3300005329 | Bacteria | 1542 |
| 7 | Ga0070690_100111970 | 3300005330 | Bacteria | 1823 |
| 8 | Ga0070670_100157523 | 3300005331 | Bacteria | 1967 |
| 9 | Ga0070677_10062373 | 3300005333 | Bacteria | 1542 |
| 10 | Ga0068869_100051719 | 3300005334 | Unclassified | 2980 |
| 11 | Ga0068869_100061516 | 3300005334 | Bacteria | 2755 |
| 12 | Ga0070680_100053213 | 3300005336 | Unclassified | 3304 |
| 13 | Ga0070680_100067149 | 3300005336 | Bacteria | 2941 |
| 14 | Ga0070682_100024660 | 3300005337 | Bacteria | 3581 |
| 15 | Ga0070682_100340759 | 3300005337 | Unclassified | 1114 |
| 16 | Ga0068868_100045403 | 3300005338 | Bacteria | 3437 |
| 17 | Ga0070660_100113116 | 3300005339 | Bacteria | 2161 |
| 18 | Ga0070689_100189499 | 3300005340 | Bacteria | 1674 |
| 19 | Ga0070689_100235097 | 3300005340 | Bacteria | 1508 |
| 20 | Ga0070691_10005581 | 3300005341 | Bacteria | 5726 |
| 21 | Ga0070687_100078599 | 3300005343 | Bacteria | 1793 |
| 22 | Ga0070692_10024643 | 3300005345 | Bacteria | 2958 |
| 23 | Ga0070668_100065785 | 3300005347 | Bacteria | 2812 |
| 24 | Ga0070668_100109683 | 3300005347 | Bacteria | 2196 |
| 25 | Ga0070669_100032776 | 3300005353 | Bacteria | 3753 |
| 26 | Ga0070671_100382407 | 3300005355 | Unclassified | 1203 |
| 27 | Ga0070674_100003835 | 3300005356 | Bacteria | 8506 |
| 28 | Ga0070673_100060792 | 3300005364 | Unclassified | 2995 |
| 29 | Ga0070673_100318646 | 3300005364 | Bacteria | 1373 |
| 30 | Ga0070688_100020848 | 3300005365 | Bacteria | 3819 |
| 31 | Ga0070667_100022899 | 3300005367 | Bacteria | 5180 |
| 32 | Ga0070667_100086958 | 3300005367 | Bacteria | 2682 |
| 33 | Ga0070709_10001162 | 3300005434 | Bacteria | 14434 |
| 34 | Ga0070709_10009577 | 3300005434 | Bacteria | 5348 |
| 35 | Ga0070709_10018121 | 3300005434 | Bacteria | 4049 |
| 36 | Ga0070709_10018523 | 3300005434 | Bacteria | 4011 |
| 37 | Ga0070709_10348093 | 3300005434 | Bacteria | 1094 |
| 38 | Ga0070714_100066117 | 3300005435 | Unclassified | 3116 |
| 39 | Ga0070714_100194810 | 3300005435 | Bacteria | 1851 |
| 40 | Ga0070713_100000476 | 3300005436 | Bacteria | 25546 |
| 41 | Ga0070713_100001852 | 3300005436 | Bacteria | 13636 |
| 42 | Ga0070713_100002307 | 3300005436 | Bacteria | 12414 |
| 43 | Ga0070713_100014557 | 3300005436 | Bacteria | 5849 |
| 44 | Ga0070713_100027599 | 3300005436 | Bacteria | 4471 |
| 45 | Ga0070713_100056670 | 3300005436 | Bacteria | 3260 |
| 46 | Ga0070701_10016141 | 3300005438 | Bacteria | 3464 |
| 47 | Ga0070711_100000281 | 3300005439 | Bacteria | 26309 |
| 48 | Ga0070711_100001229 | 3300005439 | Bacteria | 13841 |
| 49 | Ga0070711_100005753 | 3300005439 | Bacteria | 7438 |
| 50 | Ga0070711_100020727 | 3300005439 | Unclassified | 4241 |
| 51 | Ga0070711_100030637 | 3300005439 | Unclassified | 3564 |
| 52 | Ga0070711_100033648 | 3300005439 | Bacteria | 3414 |
| 53 | Ga0070711_100035103 | 3300005439 | Bacteria | 3350 |
| 54 | Ga0070705_100007431 | 3300005440 | Bacteria | 5390 |
| 55 | Ga0070705_100072171 | 3300005440 | Bacteria | 2091 |
| 56 | Ga0070700_100030983 | 3300005441 | Bacteria | 3201 |
| 57 | Ga0070700_100035471 | 3300005441 | Bacteria | 3019 |
| 58 | Ga0070700_100139883 | 3300005441 | Bacteria | 1644 |
| 59 | Ga0070694_100000103 | 3300005444 | Bacteria | 41036 |
| 60 | Ga0070694_100001652 | 3300005444 | Bacteria | 13112 |
| 61 | Ga0070694_100071059 | 3300005444 | Unclassified | 2398 |
| 62 | Ga0070694_100160578 | 3300005444 | Bacteria | 1649 |
| 63 | Ga0070708_100003651 | 3300005445 | Bacteria | 12067 |
| 64 | Ga0070708_100006273 | 3300005445 | Bacteria | 9458 |
| 65 | Ga0070708_100066556 | 3300005445 | Bacteria | 3234 |
| 66 | Ga0070708_100107291 | 3300005445 | Bacteria | 2564 |
| 67 | Ga0070708_100340903 | 3300005445 | Bacteria | 1412 |
| 68 | Ga0070678_100114027 | 3300005456 | Bacteria | 2120 |
| 69 | Ga0070678_100171427 | 3300005456 | Bacteria | 1768 |
| 70 | Ga0070662_100169068 | 3300005457 | Bacteria | 1716 |
| 71 | Ga0070681_10001282 | 3300005458 | Bacteria | 21908 |
| 72 | Ga0068867_100024565 | 3300005459 | Bacteria | 4319 |
| 73 | Ga0068867_100060541 | 3300005459 | Bacteria | 2809 |
| 74 | Ga0068867_100115803 | 3300005459 | Unclassified | 2065 |
| 75 | Ga0068867_100150388 | 3300005459 | Bacteria | 1828 |
| 76 | Ga0070685_10050585 | 3300005466 | Unclassified | 2401 |
| 77 | Ga0070685_10213936 | 3300005466 | Bacteria | 1260 |
| 78 | Ga0070706_100000336 | 3300005467 | Bacteria | 56986 |
| 79 | Ga0070706_100002094 | 3300005467 | Bacteria | 20343 |
| 80 | Ga0070706_100011620 | 3300005467 | Bacteria | 8181 |
| 81 | Ga0070706_100049856 | 3300005467 | Bacteria | 3863 |
| 82 | Ga0070706_100132967 | 3300005467 | Bacteria | 2322 |
| 83 | Ga0070706_100167294 | 3300005467 | Bacteria | 2053 |
| 84 | Ga0070707_100019771 | 3300005468 | Bacteria | 6347 |
| 85 | Ga0070707_100021052 | 3300005468 | Bacteria | 6159 |
| 86 | Ga0070707_100101946 | 3300005468 | Bacteria | 2781 |
| 87 | Ga0070698_100003114 | 3300005471 | Bacteria | 18289 |
| 88 | Ga0070698_100004515 | 3300005471 | Bacteria | 15295 |
| 89 | Ga0070698_100005969 | 3300005471 | Bacteria | 13277 |
| 90 | Ga0070698_100029720 | 3300005471 | Bacteria | 5672 |
| 91 | Ga0070698_100283312 | 3300005471 | Unclassified | 1588 |
| 92 | Ga0070699_100000432 | 3300005518 | Bacteria | 40124 |
| 93 | Ga0070699_100005358 | 3300005518 | Bacteria | 11246 |
| 94 | Ga0070699_100007587 | 3300005518 | Bacteria | 9431 |
| 95 | Ga0070699_100104193 | 3300005518 | Unclassified | 2488 |
| 96 | Ga0070699_100252862 | 3300005518 | Bacteria | 1575 |
| 97 | Ga0070699_100492223 | 3300005518 | Bacteria | 1113 |
| 98 | Ga0070679_100045647 | 3300005530 | Unclassified | 4366 |
| 99 | Ga0070679_100120107 | 3300005530 | Bacteria | 2613 |
| 100 | Ga0070684_100052651 | 3300005535 | Bacteria | 3541 |
| 101 | Ga0070697_100002395 | 3300005536 | Bacteria | 14440 |
| 102 | Ga0070697_100014445 | 3300005536 | Bacteria | 6201 |
| 103 | Ga0070697_100016125 | 3300005536 | Bacteria | 5875 |
| 104 | Ga0070697_100234582 | 3300005536 | Bacteria | 1566 |
| 105 | Ga0070697_100236378 | 3300005536 | Bacteria | 1560 |
| 106 | Ga0070672_100006442 | 3300005543 | Bacteria | 7888 |
| 107 | Ga0070672_100264764 | 3300005543 | Bacteria | 1450 |
| 108 | Ga0070686_100026496 | 3300005544 | Bacteria | 3499 |
| 109 | Ga0070695_100001880 | 3300005545 | Bacteria | 11870 |
| 110 | Ga0070695_100044346 | 3300005545 | Bacteria | 2831 |
| 111 | Ga0070695_100050386 | 3300005545 | Unclassified | 2668 |
| 112 | Ga0070695_100200851 | 3300005545 | Bacteria | 1425 |
| 113 | Ga0070696_100016687 | 3300005546 | Bacteria | 4951 |
| 114 | Ga0070696_100017968 | 3300005546 | Bacteria | 4776 |
| 115 | Ga0070696_100023209 | 3300005546 | Bacteria | 4216 |
| 116 | Ga0070696_100081946 | 3300005546 | Bacteria | 2287 |
| 117 | Ga0070696_100175522 | 3300005546 | Bacteria | 1587 |
| 118 | Ga0070696_100247543 | 3300005546 | Bacteria | 1347 |
| 119 | Ga0070665_100013516 | 3300005548 | Bacteria | 8212 |
| 120 | Ga0070665_100020037 | 3300005548 | Bacteria | 6715 |
| 121 | Ga0070665_100029410 | 3300005548 | Bacteria | 5530 |
| 122 | Ga0070665_100057610 | 3300005548 | Bacteria | 3895 |
| 123 | Ga0070704_100038611 | 3300005549 | Bacteria | 3272 |
| 124 | Ga0070704_100063407 | 3300005549 | Bacteria | 2652 |
| 125 | Ga0070704_100074466 | 3300005549 | Bacteria | 2477 |
| 126 | Ga0070704_100218752 | 3300005549 | Bacteria | 1547 |
| 127 | Ga0068855_100000234 | 3300005563 | Bacteria | 70713 |
| 128 | Ga0068855_100342867 | 3300005563 | Bacteria | 1647 |
| 129 | Ga0068855_100502373 | 3300005563 | Bacteria | 1317 |
| 130 | Ga0068857_100004869 | 3300005577 | Bacteria | 11390 |
| 131 | Ga0068854_100132868 | 3300005578 | Unclassified | 1902 |
| 132 | Ga0068856_100000062 | 3300005614 | Bacteria | 100769 |
| 133 | Ga0068856_100041098 | 3300005614 | Bacteria | 4543 |
| 134 | Ga0070702_100004444 | 3300005615 | Bacteria | 6402 |
| 135 | Ga0070702_100020952 | 3300005615 | Bacteria | 3432 |
| 136 | Ga0068852_100016336 | 3300005616 | Bacteria | 5784 |
| 137 | Ga0068852_100052877 | 3300005616 | Bacteria | 3493 |
| 138 | Ga0068852_100606624 | 3300005616 | Bacteria | 1099 |
| 139 | Ga0068859_100053692 | 3300005617 | Bacteria | 4053 |
| 140 | Ga0068859_100099523 | 3300005617 | Unclassified | 2963 |
| 141 | Ga0068859_100108684 | 3300005617 | Bacteria | 2835 |
| 142 | Ga0068859_100123873 | 3300005617 | Bacteria | 2652 |
| 143 | Ga0068859_100398182 | 3300005617 | Unclassified | 1473 |
| 144 | Ga0068864_100233499 | 3300005618 | Bacteria | 1702 |
| 145 | Ga0068864_100257683 | 3300005618 | Bacteria | 1622 |
| 146 | Ga0068866_10041164 | 3300005718 | Bacteria | 2291 |
| 147 | Ga0068866_10075012 | 3300005718 | Bacteria | 1800 |
| 148 | Ga0068870_10074661 | 3300005840 | Bacteria | 1858 |
| 149 | Ga0068870_10117086 | 3300005840 | Bacteria | 1529 |
| 150 | Ga0068863_100035781 | 3300005841 | Bacteria | 4728 |
| 151 | Ga0068863_100093972 | 3300005841 | Unclassified | 2846 |
| 152 | Ga0068863_100126468 | 3300005841 | Unclassified | 2439 |
| 153 | Ga0068863_100337148 | 3300005841 | Bacteria | 1466 |
| 154 | Ga0068858_100014019 | 3300005842 | Bacteria | 7563 |
| 155 | Ga0068858_100059537 | 3300005842 | Bacteria | 3530 |
| 156 | Ga0068858_100267454 | 3300005842 | Bacteria | 1626 |
| 157 | Ga0068860_100019110 | 3300005843 | Bacteria | 6653 |
| 158 | Ga0068860_100075164 | 3300005843 | Bacteria | 3213 |
| 159 | Ga0068860_100285538 | 3300005843 | Bacteria | 1614 |
| 160 | Ga0068860_100462530 | 3300005843 | Bacteria | 1262 |
| 161 | Ga0068862_100056072 | 3300005844 | Bacteria | 3375 |
| 162 | Ga0068862_100260522 | 3300005844 | Bacteria | 1583 |
| 163 | Ga0068862_100266667 | 3300005844 | Unclassified | 1565 |
| 164 | Ga0068862_100334264 | 3300005844 | Bacteria | 1402 |
| 165 | Ga0081538_10004787 | 3300005981 | Bacteria | 12368 |
| 166 | Ga0081539_10002905 | 3300005985 | Bacteria | 22664 |
| 167 | Ga0081539_10012728 | 3300005985 | Bacteria | 6439 |
| 168 | Ga0070717_10032853 | 3300006028 | Bacteria | 4183 |
| 169 | Ga0070717_10038453 | 3300006028 | Bacteria | 3889 |
| 170 | Ga0070717_10039858 | 3300006028 | Unclassified | 3824 |
| 171 | Ga0070715_10000763 | 3300006163 | Bacteria | 8715 |
| 172 | Ga0070716_100010159 | 3300006173 | Unclassified | 4714 |
| 173 | Ga0070716_100052109 | 3300006173 | Bacteria | 2329 |
| 174 | Ga0070712_100000468 | 3300006175 | Bacteria | 23267 |
| 175 | Ga0070712_100001119 | 3300006175 | Bacteria | 16162 |
| 176 | Ga0070712_100002849 | 3300006175 | Bacteria | 10703 |
| 177 | Ga0070712_100003144 | 3300006175 | Bacteria | 10172 |
| 178 | Ga0070712_100008180 | 3300006175 | Bacteria | 6569 |
| 179 | Ga0070712_100008773 | 3300006175 | Bacteria | 6364 |
| 180 | Ga0070712_100028949 | 3300006175 | Bacteria | 3710 |
| 181 | Ga0097621_100000148 | 3300006237 | Bacteria | 42932 |
| 182 | Ga0097621_100003128 | 3300006237 | Bacteria | 11355 |
| 183 | Ga0097621_100004631 | 3300006237 | Bacteria | 9599 |
| 184 | Ga0097621_100046515 | 3300006237 | Bacteria | 3511 |
| 185 | Ga0097621_100184988 | 3300006237 | Bacteria | 1802 |
| 186 | Ga0068871_100013790 | 3300006358 | Bacteria | 6009 |
| 187 | Ga0068871_100030112 | 3300006358 | Unclassified | 4271 |
| 188 | Ga0068871_100138845 | 3300006358 | Bacteria | 2065 |
| 189 | Ga0068871_100166657 | 3300006358 | Unclassified | 1886 |
| 190 | Ga0068871_100216737 | 3300006358 | Bacteria | 1657 |
| 191 | Ga0068871_100221192 | 3300006358 | Bacteria | 1640 |
| 192 | Ga0068871_100268950 | 3300006358 | Bacteria | 1489 |
| 193 | Ga0075428_100005232 | 3300006844 | Bacteria | 14426 |
| 194 | Ga0075428_100111343 | 3300006844 | Bacteria | 2983 |
| 195 | Ga0075428_100130891 | 3300006844 | Unclassified | 2729 |
| 196 | Ga0075428_100246604 | 3300006844 | Unclassified | 1926 |
| 197 | Ga0075430_100002229 | 3300006846 | Bacteria | 16071 |
| 198 | Ga0075430_100020169 | 3300006846 | Bacteria | 5671 |
| 199 | Ga0075430_100221445 | 3300006846 | Bacteria | 1570 |
| 200 | Ga0075430_100271501 | 3300006846 | Unclassified | 1404 |
| 201 | Ga0075430_100370679 | 3300006846 | Bacteria | 1182 |
| 202 | Ga0075431_100000151 | 3300006847 | Bacteria | 47382 |
| 203 | Ga0075431_100039169 | 3300006847 | Bacteria | 4882 |
| 204 | Ga0075431_100097179 | 3300006847 | Bacteria | 3041 |
| 205 | Ga0075431_100381799 | 3300006847 | Unclassified | 1413 |
| 206 | Ga0075433_10064114 | 3300006852 | Bacteria | 3220 |
| 207 | Ga0075433_10094054 | 3300006852 | Bacteria | 2652 |
| 208 | Ga0075433_10099342 | 3300006852 | Bacteria | 2576 |
| 209 | Ga0075434_100051841 | 3300006871 | Unclassified | 4077 |
| 210 | Ga0075434_100139418 | 3300006871 | Bacteria | 2444 |
| 211 | Ga0075434_100165708 | 3300006871 | Bacteria | 2230 |
| 212 | Ga0075434_100179894 | 3300006871 | Bacteria | 2134 |
| 213 | Ga0075434_100411402 | 3300006871 | Bacteria | 1374 |
| 214 | Ga0075429_100001317 | 3300006880 | Bacteria | 20253 |
| 215 | Ga0075429_100293880 | 3300006880 | Unclassified | 1423 |
| 216 | Ga0068865_100001782 | 3300006881 | Bacteria | 12632 |
| 217 | Ga0068865_100002043 | 3300006881 | Bacteria | 11917 |
| 218 | Ga0068865_100075093 | 3300006881 | Unclassified | 2409 |
| 219 | Ga0068865_100301566 | 3300006881 | Bacteria | 1282 |
| 220 | Ga0075436_100183262 | 3300006914 | Bacteria | 1480 |
| 221 | Ga0097620_100053692 | 3300006931 | Bacteria | 4053 |
| 222 | Ga0097620_100099524 | 3300006931 | Unclassified | 2963 |
| 223 | Ga0097620_100108683 | 3300006931 | Bacteria | 2835 |
| 224 | Ga0097620_100123888 | 3300006931 | Bacteria | 2652 |
| 225 | Ga0097620_100398149 | 3300006931 | Unclassified | 1473 |
| 226 | Ga0075435_100013494 | 3300007076 | Bacteria | 6079 |
| 227 | Ga0075435_100198789 | 3300007076 | Bacteria | 1698 |
| 228 | Ga0099794_10000004 | 3300007265 | Bacteria | 134462 |
| 229 | Ga0099794_10080883 | 3300007265 | Unclassified | 1603 |
| 230 | Ga0105240_10014149 | 3300009093 | Bacteria | 10900 |
| 231 | Ga0105240_10064120 | 3300009093 | Bacteria | 4567 |
| 232 | Ga0105240_10095577 | 3300009093 | Unclassified | 3623 |
| 233 | Ga0105240_10111346 | 3300009093 | Bacteria | 3312 |
| 234 | Ga0105240_10124643 | 3300009093 | Bacteria | 3098 |
| 235 | Ga0105240_10314013 | 3300009093 | Unclassified | 1789 |
| 236 | Ga0105240_10407530 | 3300009093 | Unclassified | 1530 |
| 237 | Ga0105240_10425824 | 3300009093 | Bacteria | 1490 |
| 238 | Ga0111539_10040991 | 3300009094 | Bacteria | 5570 |
| 239 | Ga0111539_10106234 | 3300009094 | Bacteria | 3293 |
| 240 | Ga0105245_10044159 | 3300009098 | Bacteria | 3977 |
| 241 | Ga0105245_10194206 | 3300009098 | Bacteria | 1946 |
| 242 | Ga0105245_10380129 | 3300009098 | Bacteria | 1406 |
| 243 | Ga0105247_10073837 | 3300009101 | Bacteria | 2138 |
| 244 | Ga0105247_10089641 | 3300009101 | Unclassified | 1950 |
| 245 | Ga0114129_10022667 | 3300009147 | Bacteria | 8906 |
| 246 | Ga0114129_10031867 | 3300009147 | Bacteria | 7452 |
| 247 | Ga0114129_10059432 | 3300009147 | Bacteria | 5344 |
| 248 | Ga0114129_10059769 | 3300009147 | Bacteria | 5329 |
| 249 | Ga0114129_10077848 | 3300009147 | Bacteria | 4612 |
| 250 | Ga0114129_10136073 | 3300009147 | Bacteria | 3371 |
| 251 | Ga0114129_10458430 | 3300009147 | Bacteria | 1671 |
| 252 | Ga0105243_10017234 | 3300009148 | Bacteria | 5463 |
| 253 | Ga0105243_10073335 | 3300009148 | Unclassified | 2773 |
| 254 | Ga0105243_10138160 | 3300009148 | Bacteria | 2076 |
| 255 | Ga0105241_10007930 | 3300009174 | Bacteria | 7807 |
| 256 | Ga0105241_10071635 | 3300009174 | Bacteria | 2691 |
| 257 | Ga0105241_10109271 | 3300009174 | Bacteria | 2211 |
| 258 | Ga0105241_10110955 | 3300009174 | Unclassified | 2195 |
| 259 | Ga0105241_10159802 | 3300009174 | Bacteria | 1851 |
| 260 | Ga0105242_10024634 | 3300009176 | Bacteria | 4754 |
| 261 | Ga0105242_10045455 | 3300009176 | Bacteria | 3559 |
| 262 | Ga0105242_10070983 | 3300009176 | Bacteria | 2889 |
| 263 | Ga0105242_10096891 | 3300009176 | Bacteria | 2493 |
| 264 | Ga0105248_10002269 | 3300009177 | Bacteria | 21276 |
| 265 | Ga0105248_10007399 | 3300009177 | Bacteria | 12048 |
| 266 | Ga0105248_10067590 | 3300009177 | Bacteria | 4013 |
| 267 | Ga0105248_10105558 | 3300009177 | Bacteria | 3176 |
| 268 | Ga0105248_10109692 | 3300009177 | Bacteria | 3112 |
| 269 | Ga0105248_10194570 | 3300009177 | Bacteria | 2285 |
| 270 | Ga0105248_10644322 | 3300009177 | Bacteria | 1195 |
| 271 | Ga0105248_10674830 | 3300009177 | Bacteria | 1166 |
| 272 | Ga0105237_10017405 | 3300009545 | Bacteria | 7451 |
| 273 | Ga0105237_10089226 | 3300009545 | Bacteria | 3073 |
| 274 | Ga0105238_10000609 | 3300009551 | Bacteria | 37550 |
| 275 | Ga0105238_10004737 | 3300009551 | Bacteria | 13456 |
| 276 | Ga0105238_10024029 | 3300009551 | Bacteria | 6215 |
| 277 | Ga0105249_10006270 | 3300009553 | Bacteria | 10329 |
| 278 | Ga0105249_10189879 | 3300009553 | Bacteria | 2005 |
| 279 | Ga0099796_10000427 | 3300010159 | Bacteria | 6985 |
| 280 | Ga0099796_10036617 | 3300010159 | Unclassified | 1635 |
| 281 | Ga0105239_10039316 | 3300010375 | Bacteria | 5183 |
| 282 | Ga0105239_10076765 | 3300010375 | Unclassified | 3675 |
| 283 | Ga0105239_10198827 | 3300010375 | Bacteria | 2245 |
| 284 | Ga0105239_10211951 | 3300010375 | Unclassified | 2172 |
| 285 | Ga0105239_10274232 | 3300010375 | Unclassified | 1898 |
| 286 | Ga0157371_10024243 | 3300013102 | Bacteria | 4433 |
| 287 | Ga0157369_10000159 | 3300013105 | Bacteria | 95759 |
| 288 | Ga0157374_10000338 | 3300013296 | Bacteria | 43326 |
| 289 | Ga0157374_10016801 | 3300013296 | Bacteria | 6439 |
| 290 | Ga0157374_10021505 | 3300013296 | Bacteria | 5742 |
| 291 | Ga0157374_10037981 | 3300013296 | Bacteria | 4423 |
| 292 | Ga0157374_10078051 | 3300013296 | Bacteria | 3135 |
| 293 | Ga0157374_10139114 | 3300013296 | Unclassified | 2356 |
| 294 | Ga0157378_10005749 | 3300013297 | Bacteria | 10860 |
| 295 | Ga0157378_10006834 | 3300013297 | Bacteria | 9951 |
| 296 | Ga0157378_10055952 | 3300013297 | Unclassified | 3514 |
| 297 | Ga0157378_10085504 | 3300013297 | Bacteria | 2857 |
| 298 | Ga0157378_10123896 | 3300013297 | Bacteria | 2385 |
| 299 | Ga0157378_10323570 | 3300013297 | Unclassified | 1499 |
| 300 | Ga0163162_10152424 | 3300013306 | Bacteria | 2430 |
| 301 | Ga0163162_10228965 | 3300013306 | Bacteria | 1989 |
| 302 | Ga0163162_10650297 | 3300013306 | Unclassified | 1178 |
| 303 | Ga0157372_10003611 | 3300013307 | Bacteria | 16654 |
| 304 | Ga0157372_10019861 | 3300013307 | Bacteria | 7240 |
| 305 | Ga0157375_10132829 | 3300013308 | Bacteria | 2610 |
| 306 | Ga0157375_10199382 | 3300013308 | Bacteria | 2157 |
| 307 | Ga0157375_10270714 | 3300013308 | Bacteria | 1860 |
| 308 | Ga0157375_10439648 | 3300013308 | Bacteria | 1470 |
| 309 | Ga0163163_10001395 | 3300014325 | Bacteria | 20392 |
| 310 | Ga0163163_10158191 | 3300014325 | Bacteria | 2310 |
| 311 | Ga0163163_10276342 | 3300014325 | Bacteria | 1731 |
| 312 | Ga0157380_10001814 | 3300014326 | Bacteria | 14105 |
| 313 | Ga0157380_10066459 | 3300014326 | Bacteria | 2900 |
| 314 | Ga0157377_10165501 | 3300014745 | Bacteria | 1378 |
| 315 | Ga0157379_10004208 | 3300014968 | Bacteria | 12288 |
| 316 | Ga0157379_10009128 | 3300014968 | Bacteria | 8635 |
| 317 | Ga0157379_10051201 | 3300014968 | Bacteria | 3688 |
| 318 | Ga0157379_10285656 | 3300014968 | Bacteria | 1502 |
| 319 | Ga0157376_10007509 | 3300014969 | Bacteria | 7790 |
| 320 | Ga0157376_10034776 | 3300014969 | Bacteria | 4071 |
| 321 | Ga0157376_10038471 | 3300014969 | Unclassified | 3893 |
| 322 | Ga0157376_10058953 | 3300014969 | Bacteria | 3218 |
| 323 | Ga0157376_10069513 | 3300014969 | Unclassified | 2985 |
| 324 | Ga0157376_10192467 | 3300014969 | Bacteria | 1871 |
| 325 | Ga0157376_10245154 | 3300014969 | Bacteria | 1671 |
| 326 | Ga0182005_1056525 | 3300015265 | Bacteria | 1069 |
| 327 | Ga0163161_10156399 | 3300017792 | Bacteria | 1736 |
| 328 | Ga0224569_100615 | 3300022732 | Bacteria | 3071 |
| 329 | Ga0228598_1000044 | 3300024227 | Bacteria | 17465 |
| 330 | Ga0228598_1000070 | 3300024227 | Bacteria | 15225 |
| 331 | Ga0207656_10077074 | 3300025321 | Unclassified | 1492 |
| 332 | Ga0207682_10007428 | 3300025893 | Bacteria | 4367 |
| 333 | Ga0207692_10013451 | 3300025898 | Bacteria | 3551 |
| 334 | Ga0207642_10121428 | 3300025899 | Bacteria | 1348 |
| 335 | Ga0207710_10034751 | 3300025900 | Bacteria | 2216 |
| 336 | Ga0207647_10016923 | 3300025904 | Unclassified | 4965 |
| 337 | Ga0207647_10139048 | 3300025904 | Bacteria | 1424 |
| 338 | Ga0207685_10001682 | 3300025905 | Bacteria | 4771 |
| 339 | Ga0207699_10008849 | 3300025906 | Bacteria | 4987 |
| 340 | Ga0207699_10047766 | 3300025906 | Bacteria | 2511 |
| 341 | Ga0207645_10003579 | 3300025907 | Bacteria | 11750 |
| 342 | Ga0207645_10163194 | 3300025907 | Bacteria | 1458 |
| 343 | Ga0207645_10233247 | 3300025907 | Bacteria | 1215 |
| 344 | Ga0207684_10000320 | 3300025910 | Bacteria | 68296 |
| 345 | Ga0207684_10004878 | 3300025910 | Bacteria | 12535 |
| 346 | Ga0207684_10203795 | 3300025910 | Bacteria | 1706 |
| 347 | Ga0207684_10398996 | 3300025910 | Bacteria | 1182 |
| 348 | Ga0207654_10004482 | 3300025911 | Bacteria | 7050 |
| 349 | Ga0207654_10011627 | 3300025911 | Bacteria | 4491 |
| 350 | Ga0207707_10001452 | 3300025912 | Bacteria | 21916 |
| 351 | Ga0207707_10060733 | 3300025912 | Bacteria | 3288 |
| 352 | Ga0207695_10089433 | 3300025913 | Bacteria | 3096 |
| 353 | Ga0207671_10157951 | 3300025914 | Unclassified | 1755 |
| 354 | Ga0207693_10000008 | 3300025915 | Bacteria | 171049 |
| 355 | Ga0207693_10001167 | 3300025915 | Bacteria | 23425 |
| 356 | Ga0207693_10002431 | 3300025915 | Bacteria | 16175 |
| 357 | Ga0207693_10007049 | 3300025915 | Bacteria | 9275 |
| 358 | Ga0207693_10009953 | 3300025915 | Bacteria | 7729 |
| 359 | Ga0207693_10015202 | 3300025915 | Bacteria | 6177 |
| 360 | Ga0207693_10026238 | 3300025915 | Bacteria | 4612 |
| 361 | Ga0207693_10315284 | 3300025915 | Bacteria | 1224 |
| 362 | Ga0207663_10000111 | 3300025916 | Bacteria | 39513 |
| 363 | Ga0207663_10010876 | 3300025916 | Bacteria | 4860 |
| 364 | Ga0207663_10019281 | 3300025916 | Unclassified | 3838 |
| 365 | Ga0207663_10036341 | 3300025916 | Bacteria | 2963 |
| 366 | Ga0207663_10047053 | 3300025916 | Bacteria | 2661 |
| 367 | Ga0207663_10121603 | 3300025916 | Bacteria | 1789 |
| 368 | Ga0207657_10002009 | 3300025919 | Bacteria | 21997 |
| 369 | Ga0207652_10023725 | 3300025921 | Bacteria | 5085 |
| 370 | Ga0207652_10050957 | 3300025921 | Bacteria | 3548 |
| 371 | Ga0207652_10312195 | 3300025921 | Bacteria | 1419 |
| 372 | Ga0207646_10073817 | 3300025922 | Bacteria | 3047 |
| 373 | Ga0207646_10167024 | 3300025922 | Unclassified | 1987 |
| 374 | Ga0207681_10009128 | 3300025923 | Bacteria | 6057 |
| 375 | Ga0207681_10270665 | 3300025923 | Bacteria | 1333 |
| 376 | Ga0207694_10003298 | 3300025924 | Bacteria | 12840 |
| 377 | Ga0207694_10004655 | 3300025924 | Bacteria | 10681 |
| 378 | Ga0207694_10005997 | 3300025924 | Bacteria | 9303 |
| 379 | Ga0207694_10036471 | 3300025924 | Unclassified | 3774 |
| 380 | Ga0207659_10280684 | 3300025926 | Bacteria | 1362 |
| 381 | Ga0207659_10432750 | 3300025926 | Bacteria | 1105 |
| 382 | Ga0207687_10030526 | 3300025927 | Unclassified | 3635 |
| 383 | Ga0207687_10045413 | 3300025927 | Bacteria | 3036 |
| 384 | Ga0207687_10111801 | 3300025927 | Bacteria | 2029 |
| 385 | Ga0207687_10155357 | 3300025927 | Unclassified | 1750 |
| 386 | Ga0207700_10000107 | 3300025928 | Bacteria | 49976 |
| 387 | Ga0207700_10006279 | 3300025928 | Bacteria | 7172 |
| 388 | Ga0207700_10067729 | 3300025928 | Bacteria | 2734 |
| 389 | Ga0207644_10062526 | 3300025931 | Unclassified | 2701 |
| 390 | Ga0207644_10067598 | 3300025931 | Bacteria | 2605 |
| 391 | Ga0207706_10000641 | 3300025933 | Bacteria | 37090 |
| 392 | Ga0207706_10047199 | 3300025933 | Bacteria | 3811 |
| 393 | Ga0207706_10147805 | 3300025933 | Bacteria | 2067 |
| 394 | Ga0207686_10162839 | 3300025934 | Unclassified | 1565 |
| 395 | Ga0207709_10024100 | 3300025935 | Bacteria | 3471 |
| 396 | Ga0207709_10027923 | 3300025935 | Bacteria | 3258 |
| 397 | Ga0207670_10169622 | 3300025936 | Bacteria | 1635 |
| 398 | Ga0207669_10107684 | 3300025937 | Bacteria | 1859 |
| 399 | Ga0207669_10257995 | 3300025937 | Unclassified | 1302 |
| 400 | Ga0207704_10007997 | 3300025938 | Bacteria | 5029 |
| 401 | Ga0207704_10012937 | 3300025938 | Unclassified | 4158 |
| 402 | Ga0207704_10019036 | 3300025938 | Bacteria | 3598 |
| 403 | Ga0207704_10036682 | 3300025938 | Bacteria | 2822 |
| 404 | Ga0207704_10174037 | 3300025938 | Unclassified | 1548 |
| 405 | Ga0207665_10016930 | 3300025939 | Unclassified | 4785 |
| 406 | Ga0207665_10039155 | 3300025939 | Bacteria | 3159 |
| 407 | Ga0207665_10047783 | 3300025939 | Bacteria | 2870 |
| 408 | Ga0207665_10072766 | 3300025939 | Bacteria | 2349 |
| 409 | Ga0207665_10149142 | 3300025939 | Bacteria | 1674 |
| 410 | Ga0207691_10019785 | 3300025940 | Bacteria | 6367 |
| 411 | Ga0207691_10093246 | 3300025940 | Bacteria | 2697 |
| 412 | Ga0207691_10096303 | 3300025940 | Bacteria | 2646 |
| 413 | Ga0207711_10012633 | 3300025941 | Bacteria | 7013 |
| 414 | Ga0207711_10018198 | 3300025941 | Bacteria | 5840 |
| 415 | Ga0207711_10038043 | 3300025941 | Bacteria | 4091 |
| 416 | Ga0207711_10066415 | 3300025941 | Bacteria | 3119 |
| 417 | Ga0207711_10115070 | 3300025941 | Bacteria | 2396 |
| 418 | Ga0207689_10003694 | 3300025942 | Bacteria | 13950 |
| 419 | Ga0207661_10040859 | 3300025944 | Bacteria | 3649 |
| 420 | Ga0207679_10133818 | 3300025945 | Bacteria | 1993 |
| 421 | Ga0207667_10000465 | 3300025949 | Bacteria | 54509 |
| 422 | Ga0207667_10055236 | 3300025949 | Bacteria | 4175 |
| 423 | Ga0207667_10290154 | 3300025949 | Bacteria | 1671 |
| 424 | Ga0207651_10224885 | 3300025960 | Bacteria | 1520 |
| 425 | Ga0207712_10157044 | 3300025961 | Bacteria | 1763 |
| 426 | Ga0207668_10016766 | 3300025972 | Bacteria | 4580 |
| 427 | Ga0207668_10096727 | 3300025972 | Bacteria | 2183 |
| 428 | Ga0207640_10034171 | 3300025981 | Bacteria | 3170 |
| 429 | Ga0207658_10021006 | 3300025986 | Bacteria | 4527 |
| 430 | Ga0207658_10054958 | 3300025986 | Unclassified | 2948 |
| 431 | Ga0207658_10070337 | 3300025986 | Bacteria | 2647 |
| 432 | Ga0207677_10022255 | 3300026023 | Unclassified | 3892 |
| 433 | Ga0207677_10071854 | 3300026023 | Bacteria | 2444 |
| 434 | Ga0207703_10032794 | 3300026035 | Bacteria | 4113 |
| 435 | Ga0207703_10122731 | 3300026035 | Unclassified | 2232 |
| 436 | Ga0207703_10131182 | 3300026035 | Bacteria | 2164 |
| 437 | Ga0207639_10040615 | 3300026041 | Unclassified | 3473 |
| 438 | Ga0207639_10278753 | 3300026041 | Bacteria | 1469 |
| 439 | Ga0207639_10426691 | 3300026041 | Bacteria | 1200 |
| 440 | Ga0207678_10008144 | 3300026067 | Bacteria | 9241 |
| 441 | Ga0207708_10038732 | 3300026075 | Bacteria | 3632 |
| 442 | Ga0207708_10069389 | 3300026075 | Bacteria | 2699 |
| 443 | Ga0207708_10215499 | 3300026075 | Bacteria | 1536 |
| 444 | Ga0207702_10001096 | 3300026078 | Bacteria | 27672 |
| 445 | Ga0207702_10062555 | 3300026078 | Bacteria | 3179 |
| 446 | Ga0207641_10000811 | 3300026088 | Bacteria | 33300 |
| 447 | Ga0207641_10062885 | 3300026088 | Bacteria | 3169 |
| 448 | Ga0207641_10133099 | 3300026088 | Unclassified | 2235 |
| 449 | Ga0207641_10145416 | 3300026088 | Bacteria | 2143 |
| 450 | Ga0207648_10017102 | 3300026089 | Bacteria | 6609 |
| 451 | Ga0207648_10039098 | 3300026089 | Bacteria | 4171 |
| 452 | Ga0207648_10066006 | 3300026089 | Bacteria | 3156 |
| 453 | Ga0207648_10091877 | 3300026089 | Unclassified | 2654 |
| 454 | Ga0207648_10219365 | 3300026089 | Bacteria | 1690 |
| 455 | Ga0207648_10288232 | 3300026089 | Unclassified | 1469 |
| 456 | Ga0207676_10096526 | 3300026095 | Bacteria | 2440 |
| 457 | Ga0207676_10215505 | 3300026095 | Bacteria | 1706 |
| 458 | Ga0207674_10005293 | 3300026116 | Bacteria | 15350 |
| 459 | Ga0207674_10007441 | 3300026116 | Bacteria | 12762 |
| 460 | Ga0207674_10077447 | 3300026116 | Bacteria | 3331 |
| 461 | Ga0207674_10103444 | 3300026116 | Bacteria | 2827 |
| 462 | Ga0207674_10614282 | 3300026116 | Bacteria | 1050 |
| 463 | Ga0207675_100011936 | 3300026118 | Bacteria | 8117 |
| 464 | Ga0207675_100087096 | 3300026118 | Bacteria | 2933 |
| 465 | Ga0207675_100292694 | 3300026118 | Bacteria | 1584 |
| 466 | Ga0207683_10033950 | 3300026121 | Bacteria | 4433 |
| 467 | Ga0207683_10263742 | 3300026121 | Bacteria | 1573 |
| 468 | Ga0207698_10089175 | 3300026142 | Bacteria | 2518 |
| 469 | Ga0207698_10352519 | 3300026142 | Bacteria | 1391 |
| 470 | Ga0207698_10528255 | 3300026142 | Unclassified | 1153 |
| 471 | Ga0209588_1000001 | 3300027671 | Bacteria | 705877 |
| 472 | Ga0209588_1025839 | 3300027671 | Bacteria | 1861 |
| 473 | Ga0207428_10010140 | 3300027907 | Bacteria | 8425 |
| 474 | Ga0207428_10011592 | 3300027907 | Bacteria | 7781 |
| 475 | Ga0207428_10025198 | 3300027907 | Bacteria | 4981 |
| 476 | Ga0207428_10037675 | 3300027907 | Bacteria | 3934 |
| 477 | Ga0265354_1000756 | 3300028016 | Bacteria | 5272 |
| 478 | Ga0268266_10010487 | 3300028379 | Bacteria | 8098 |
| 479 | Ga0268266_10030899 | 3300028379 | Bacteria | 4548 |
| 480 | Ga0268265_10048009 | 3300028380 | Bacteria | 3202 |
| 481 | Ga0268265_10215261 | 3300028380 | Bacteria | 1677 |
| 482 | Ga0268265_10219611 | 3300028380 | Bacteria | 1662 |
| 483 | Ga0268265_10255832 | 3300028380 | Unclassified | 1554 |
| 484 | Ga0268264_10014069 | 3300028381 | Bacteria | 6577 |
| 485 | Ga0268264_10172422 | 3300028381 | Bacteria | 1957 |
| 486 | Ga0268264_10209600 | 3300028381 | Bacteria | 1788 |
| 487 | Ga0265319_1008171 | 3300028563 | Unclassified | 4613 |
| 488 | Ga0265318_10001629 | 3300028577 | Bacteria | 12967 |
| 489 | Ga0265762_1000130 | 3300030760 | Bacteria | 11334 |
| 490 | Ga0265762_1016014 | 3300030760 | Unclassified | 1359 |
| 491 | Ga0265770_1000180 | 3300030878 | Bacteria | 8227 |
| 492 | Ga0265765_1000179 | 3300030879 | Bacteria | 4180 |
| 493 | Ga0265760_10001544 | 3300031090 | Bacteria | 6793 |
| 494 | Ga0265760_10011422 | 3300031090 | Bacteria | 2537 |
| 495 | Ga0265325_10003325 | 3300031241 | Bacteria | 10570 |
| 496 | Ga0265325_10004980 | 3300031241 | Bacteria | 8277 |
| 497 | Ga0265325_10067854 | 3300031241 | Bacteria | 1796 |
| 498 | Ga0265329_10003450 | 3300031242 | Bacteria | 6883 |
| 499 | Ga0265340_10005071 | 3300031247 | Bacteria | 7321 |
| 500 | Ga0265339_10005514 | 3300031249 | Bacteria | 8427 |
| 501 | Ga0265339_10033361 | 3300031249 | Bacteria | 2899 |
| 502 | Ga0265331_10000094 | 3300031250 | Bacteria | 122448 |
| 503 | Ga0265331_10012844 | 3300031250 | Bacteria | 4520 |
| 504 | Ga0265331_10067347 | 3300031250 | Unclassified | 1680 |
| 505 | Ga0265316_10005655 | 3300031344 | Bacteria | 12097 |
| 506 | Ga0265316_10006792 | 3300031344 | Bacteria | 10883 |
| 507 | Ga0265316_10012133 | 3300031344 | Bacteria | 7736 |
| 508 | Ga0265316_10014330 | 3300031344 | Bacteria | 6984 |
| 509 | Ga0265316_10019254 | 3300031344 | Bacteria | 5842 |
| 510 | Ga0307408_100036619 | 3300031548 | Bacteria | 3451 |
| 511 | Ga0265313_10003181 | 3300031595 | Bacteria | 13530 |
| 512 | Ga0265314_10000509 | 3300031711 | Bacteria | 50279 |
| 513 | Ga0265314_10015181 | 3300031711 | Bacteria | 6120 |
| 514 | Ga0265314_10022657 | 3300031711 | Bacteria | 4809 |
| 515 | Ga0265314_10033167 | 3300031711 | Bacteria | 3790 |
| 516 | Ga0265342_10002054 | 3300031712 | Bacteria | 17876 |
| 517 | Ga0307406_10120344 | 3300031901 | Bacteria | 1824 |
| 518 | Ga0307409_100051269 | 3300031995 | Bacteria | 3157 |
| 519 | Ga0307416_100087246 | 3300032002 | Bacteria | 2663 |
| 520 | Ga0373959_0022988 | 3300034820 | Bacteria | 1209 |
| 521 | Ga0373934_0015463 | 3300035086 | Bacteria | 2895 |
| 522 | Ga0373940_0027178 | 3300035088 | Bacteria | 1502 |
| 523 | Ga0373949_0011290 | 3300035090 | Bacteria | 1966 |
| 524 | Ga0373951_0041672 | 3300035091 | Bacteria | 1109 |
| 525 | Ga0373923_0039980 | 3300035111 | Bacteria | 1928 |
| 526 | Ga0373923_0049113 | 3300035111 | Bacteria | 1764 |
| 527 | Ga0373932_0064742 | 3300035112 | Bacteria | 1120 |
| 528 | Ga0373936_0050788 | 3300035113 | Bacteria | 1678 |
| 529 | Ga0373941_0062463 | 3300035115 | Bacteria | 1216 |
| 530 | Ga0373954_0071738 | 3300035118 | Bacteria | 1646 |
| 531 | Ga0373957_0040808 | 3300035120 | Unclassified | 1746 |
| 532 | Ga0373943_0059686 | 3300035170 | Bacteria | 1902 |
| 533 | Ga0373943_0116366 | 3300035170 | Bacteria | 1416 |
| 534 | Ga0373955_0016771 | 3300035172 | Bacteria | 3611 |
| 535 | Ga0373955_0041648 | 3300035172 | Bacteria | 2463 |
| 536 | Ga0373955_0118284 | 3300035172 | Bacteria | 1538 |
| 537 | Ga0373924_0121364 | 3300035410 | Bacteria | 1134 |
| 538 | Ga0373931_0026882 | 3300035691 | Bacteria | 2933 |
| 539 | Ga0373931_0048317 | 3300035691 | Bacteria | 2255 |
| 540 | Ga0373931_0091344 | 3300035691 | Bacteria | 1697 |
| 541 | Ga0373935_0004101 | 3300035692 | Bacteria | 8523 |
| 542 | Ga0373935_0197304 | 3300035692 | Unclassified | 1389 |
| 543 | Ga0373935_0212053 | 3300035692 | Bacteria | 1342 |
| 544 | Ga0373927_0002147 | 3300035695 | Bacteria | 14499 |
| 545 | Ga0373927_0093605 | 3300035695 | Bacteria | 1952 |
| 546 | Ga0373933_0126705 | 3300035724 | Bacteria | 1603 |
| 547 | Ga0373933_0187530 | 3300035724 | Unclassified | 1320 |
| 548 | Ga0373947_0024378 | 3300035725 | Bacteria | 3525 |
| 549 | Ga0373947_0039201 | 3300035725 | Bacteria | 2818 |
| 550 | Ga0373947_0126295 | 3300035725 | Bacteria | 1629 |
| 551 | Ga0373937_0004324 | 3300036401 | Bacteria | 12052 |
| 552 | Ga0373937_0010129 | 3300036401 | Bacteria | 8223 |
| 553 | Ga0373937_0046916 | 3300036401 | Bacteria | 3952 |
| 554 | Ga0373937_0059939 | 3300036401 | Bacteria | 3498 |
| 555 | Ga0373937_0071265 | 3300036401 | Bacteria | 3205 |
| 556 | Ga0373937_0139010 | 3300036401 | Bacteria | 2272 |
| 557 | Ga0373937_0144431 | 3300036401 | Bacteria | 2227 |
| 558 | Ga0373937_0491063 | 3300036401 | Unclassified | 1166 |
| 559 | Ga0373925_0037190 | 3300037068 | Bacteria | 3593 |
| 560 | Ga0373925_0063162 | 3300037068 | Unclassified | 2786 |
| 561 | Ga0373925_0075260 | 3300037068 | Bacteria | 2558 |
| 562 | Ga0373925_0152596 | 3300037068 | Bacteria | 1815 |
| 563 | Ga0373925_0177721 | 3300037068 | Bacteria | 1683 |
| 564 | Ga0373925_0244813 | 3300037068 | Bacteria | 1437 |
| 565 | Ga0436364_0703870 | 3300037853 | Bacteria | 4877 |
| 566 | Ga0436365_1220175 | 3300039437 | Bacteria | 3205 |
| 567 | Ga0439446_0002000 | 3300042156 | Bacteria | 4821 |
| 568 | Ga0439460_0026167 | 3300042461 | Bacteria | 1630 |
| 569 | Ga0453683_0002798 | 3300044673 | Bacteria | 13268 |
| 570 | Ga0453683_0006940 | 3300044673 | Bacteria | 7721 |
| 571 | Ga0453684_0022220 | 3300044712 | Bacteria | 9427 |
| 572 | Ga0451576_0039470 | 3300045051 | Bacteria | 4997 |
| 573 | Ga0451576_0106407 | 3300045051 | Bacteria | 2919 |
| 574 | Ga0466967_0431028 | 3300045976 | Bacteria | 1286 |
| 575 | Ga0495592_0027262 | 3300046454 | Bacteria | 4332 |
| 576 | Ga0495592_0044085 | 3300046454 | Unclassified | 3334 |
| 577 | Ga0495603_0014257 | 3300046455 | Bacteria | 4808 |
| 578 | Ga0495603_0069122 | 3300046455 | Bacteria | 2078 |
| 579 | Ga0495629_0026931 | 3300046459 | Bacteria | 4083 |
| 580 | Ga0495629_0043630 | 3300046459 | Bacteria | 3148 |
| 581 | Ga0495629_0047921 | 3300046459 | Bacteria | 2997 |
| 582 | Ga0495651_0001373 | 3300046462 | Bacteria | 18863 |
| 583 | Ga0495651_0009991 | 3300046462 | Bacteria | 7296 |
| 584 | Ga0495653_0014801 | 3300046463 | Bacteria | 6361 |
| 585 | Ga0495653_0025407 | 3300046463 | Unclassified | 4761 |
| 586 | Ga0495580_0002181 | 3300046472 | Bacteria | 17133 |
| 587 | Ga0495580_0002545 | 3300046472 | Bacteria | 15889 |
| 588 | Ga0495580_0010201 | 3300046472 | Bacteria | 7333 |
| 589 | Ga0495580_0018437 | 3300046472 | Bacteria | 5195 |
| 590 | Ga0495580_0019663 | 3300046472 | Bacteria | 5015 |
| 591 | Ga0495580_0032582 | 3300046472 | Unclassified | 3760 |
| 592 | Ga0495580_0075770 | 3300046472 | Bacteria | 2347 |
| 593 | Ga0495582_0012347 | 3300046473 | Bacteria | 4705 |
| 594 | Ga0495582_0226859 | 3300046473 | Bacteria | 1069 |
| 595 | Ga0495664_0017972 | 3300046477 | Unclassified | 4044 |
| 596 | Ga0495664_0046996 | 3300046477 | Bacteria | 2561 |
| 597 | Ga0495664_0099347 | 3300046477 | Bacteria | 1752 |
| 598 | Ga0495594_0016429 | 3300046499 | Bacteria | 3900 |
| 599 | Ga0495608_0011346 | 3300046511 | Bacteria | 6202 |
| 600 | Ga0495608_0037447 | 3300046511 | Bacteria | 3262 |
| 601 | Ga0495608_0218285 | 3300046511 | Bacteria | 1197 |
| 602 | Ga0495618_0002982 | 3300046514 | Bacteria | 10698 |
| 603 | Ga0495628_0000439 | 3300046516 | Bacteria | 37888 |
| 604 | Ga0495628_0067925 | 3300046516 | Bacteria | 2782 |
| 605 | Ga0495628_0090427 | 3300046516 | Bacteria | 2370 |
| 606 | Ga0495628_0163944 | 3300046516 | Bacteria | 1688 |
| 607 | Ga0495630_0004015 | 3300046517 | Bacteria | 10297 |
| 608 | Ga0495630_0018098 | 3300046517 | Bacteria | 5171 |
| 609 | Ga0495630_0032428 | 3300046517 | Bacteria | 3893 |
| 610 | Ga0495663_0002941 | 3300046525 | Bacteria | 5012 |
| 611 | Ga0495642_0003861 | 3300046528 | Bacteria | 5874 |
| 612 | Ga0495652_0008144 | 3300046529 | Bacteria | 9585 |
| 613 | Ga0495665_0002479 | 3300046531 | Bacteria | 9972 |
| 614 | Ga0495586_0021362 | 3300046535 | Bacteria | 3449 |
| 615 | Ga0495586_0038360 | 3300046535 | Bacteria | 2573 |
| 616 | Ga0495587_0012312 | 3300046536 | Bacteria | 5390 |
| 617 | Ga0495587_0083059 | 3300046536 | Bacteria | 1856 |
| 618 | Ga0495609_0058207 | 3300046538 | Bacteria | 1709 |
| 619 | Ga0495621_0002181 | 3300046539 | Bacteria | 5210 |
| 620 | Ga0495621_0048686 | 3300046539 | Bacteria | 1510 |
| 621 | Ga0495621_0062662 | 3300046539 | Bacteria | 1353 |
| 622 | Ga0495621_0101640 | 3300046539 | Bacteria | 1095 |
| 623 | Ga0495645_0000296 | 3300046543 | Bacteria | 36239 |
| 624 | Ga0495645_0002510 | 3300046543 | Bacteria | 12456 |
| 625 | Ga0495645_0009221 | 3300046543 | Bacteria | 6896 |
| 626 | Ga0495645_0030542 | 3300046543 | Bacteria | 3924 |
| 627 | Ga0495645_0064030 | 3300046543 | Unclassified | 2661 |
| 628 | Ga0495645_0087172 | 3300046543 | Bacteria | 2233 |
| 629 | Ga0495667_0003132 | 3300046559 | Bacteria | 11094 |
| 630 | Ga0495667_0014988 | 3300046559 | Bacteria | 5236 |
| 631 | Ga0495667_0026654 | 3300046559 | Bacteria | 3895 |
| 632 | Ga0495667_0137646 | 3300046559 | Bacteria | 1574 |
| 633 | Ga0495667_0145953 | 3300046559 | Bacteria | 1524 |
| 634 | Ga0495656_0121520 | 3300046615 | Bacteria | 1233 |
| 635 | Ga0495635_0006770 | 3300046663 | Bacteria | 8007 |
| 636 | Ga0495635_0076315 | 3300046663 | Bacteria | 2297 |
| 637 | Ga0495635_0111852 | 3300046663 | Bacteria | 1865 |
| 638 | Ga0495657_0006893 | 3300046675 | Bacteria | 8827 |
| 639 | Ga0495657_0009162 | 3300046675 | Bacteria | 7518 |
| 640 | Ga0495657_0034723 | 3300046675 | Bacteria | 3500 |
| 641 | Ga0495599_0012100 | 3300046678 | Bacteria | 5311 |
| 642 | Ga0495623_0020396 | 3300046679 | Bacteria | 4283 |
| 643 | Ga0495623_0146903 | 3300046679 | Bacteria | 1397 |
| 644 | Ga0495646_0003971 | 3300046680 | Bacteria | 9253 |
| 645 | Ga0495646_0067227 | 3300046680 | Unclassified | 2119 |
| 646 | Ga0495646_0134784 | 3300046680 | Bacteria | 1387 |
| 647 | Ga0495658_0019092 | 3300046683 | Bacteria | 3574 |
| 648 | Ga0495658_0024014 | 3300046683 | Bacteria | 3242 |
| 649 | Ga0495658_0052459 | 3300046683 | Bacteria | 2313 |
| 650 | Ga0495613_0163562 | 3300046689 | Unclassified | 1582 |
| 651 | Ga0495613_0258038 | 3300046689 | Unclassified | 1215 |
| 652 | Ga0495624_0005250 | 3300046690 | Bacteria | 9351 |
| 653 | Ga0495624_0140459 | 3300046690 | Bacteria | 1480 |
| 654 | Ga0495604_0004754 | 3300047317 | Bacteria | 10757 |
| 655 | Ga0495604_0008380 | 3300047317 | Bacteria | 8175 |
| 656 | Ga0495604_0158549 | 3300047317 | Bacteria | 1601 |
| 657 | Ga0495674_0012275 | 3300047319 | Bacteria | 8075 |
| 658 | Ga0495674_0032047 | 3300047319 | Bacteria | 4771 |
| 659 | Ga0495674_0058171 | 3300047319 | Bacteria | 3381 |
| 660 | Ga0495674_0075174 | 3300047319 | Unclassified | 2908 |
| 661 | Ga0495674_0387772 | 3300047319 | Bacteria | 1129 |
| 662 | Ga0495676_0034952 | 3300047321 | Bacteria | 4210 |
| 663 | Ga0495680_0002590 | 3300047322 | Bacteria | 18401 |
| 664 | Ga0495680_0019539 | 3300047322 | Bacteria | 5716 |
| 665 | Ga0495680_0091426 | 3300047322 | Bacteria | 2281 |
| 666 | Ga0495675_0000155 | 3300047444 | Bacteria | 48300 |
| 667 | Ga0495675_0010545 | 3300047444 | Bacteria | 5776 |
| 668 | Ga0495675_0019031 | 3300047444 | Unclassified | 4361 |
| 669 | Ga0495675_0028417 | 3300047444 | Bacteria | 3565 |
| 670 | Ga0495677_0066111 | 3300047445 | Bacteria | 1344 |
| 671 | Ga0495684_0007480 | 3300047471 | Bacteria | 8461 |
| 672 | Ga0495684_0008283 | 3300047471 | Bacteria | 8051 |
| 673 | Ga0495684_0014680 | 3300047471 | Bacteria | 6027 |
| 674 | Ga0495684_0042570 | 3300047471 | Bacteria | 3478 |
| 675 | Ga0495593_0054240 | 3300047673 | Unclassified | 2114 |
| 676 | Ga0495593_0077538 | 3300047673 | Bacteria | 1721 |
| 677 | Ga0495602_0024740 | 3300048088 | Bacteria | 5823 |
| 678 | Ga0495602_0120840 | 3300048088 | Unclassified | 2108 |
| 679 | Ga0495602_0168621 | 3300048088 | Bacteria | 1701 |
| 680 | Ga0495602_0220599 | 3300048088 | Bacteria | 1432 |
| 681 | Ga0495614_0065798 | 3300048089 | Bacteria | 1559 |
| 682 | Ga0496100_0006702 | 3300048903 | Bacteria | 6303 |
| 683 | Ga0496101_0057455 | 3300048904 | Unclassified | 2814 |
| 684 | Ga0496102_0031150 | 3300048905 | Bacteria | 4782 |
| 685 | Ga0496102_0050682 | 3300048905 | Unclassified | 3781 |
| 686 | Ga0496102_0408465 | 3300048905 | Unclassified | 1276 |
| 687 | Ga0496103_0001075 | 3300048906 | Bacteria | 19076 |
| 688 | Ga0496103_0053198 | 3300048906 | Bacteria | 2509 |
| 689 | Ga0496104_0007903 | 3300048907 | Bacteria | 9429 |
| 690 | Ga0496104_0011300 | 3300048907 | Bacteria | 7993 |
| 691 | Ga0496105_0005363 | 3300048908 | Bacteria | 9720 |
| 692 | Ga0496106_0018302 | 3300048909 | Bacteria | 5177 |
| 693 | Ga0496107_0086072 | 3300048910 | Unclassified | 2294 |
| 694 | Ga0496107_0100740 | 3300048910 | Bacteria | 2118 |
| 695 | Ga0496107_0130354 | 3300048910 | Bacteria | 1856 |
| 696 | Ga0496108_0161805 | 3300048911 | Bacteria | 1935 |
| 697 | Ga0496108_0311816 | 3300048911 | Unclassified | 1371 |
| 698 | Ga0496109_0465400 | 3300048912 | Bacteria | 1194 |
| 699 | Ga0496112_0001729 | 3300048915 | Bacteria | 17084 |
| 700 | Ga0496112_0001787 | 3300048915 | Bacteria | 16907 |
| 701 | Ga0496112_0060610 | 3300048915 | Unclassified | 3729 |
| 702 | Ga0496112_0119703 | 3300048915 | Bacteria | 2603 |
| 703 | Ga0496112_0196180 | 3300048915 | Bacteria | 1979 |
| 704 | Ga0496114_0031238 | 3300048917 | Bacteria | 4382 |
| 705 | Ga0496114_0062970 | 3300048917 | Unclassified | 3105 |
| 706 | Ga0496114_0275905 | 3300048917 | Bacteria | 1482 |
| 707 | Ga0496115_0002823 | 3300048918 | Bacteria | 12490 |
| 708 | Ga0496115_0006852 | 3300048918 | Bacteria | 8364 |
| 709 | Ga0501036_0471764 | 3300049572 | Bacteria | 1045 |
| 710 | Ga0501039_0039552 | 3300049575 | Bacteria | 3642 |
| 711 | Ga0501040_0273120 | 3300049576 | Bacteria | 1207 |
| 712 | Ga0501042_0015930 | 3300049578 | Bacteria | 5155 |
| 713 | Ga0501046_0298384 | 3300049580 | Unclassified | 1177 |
| 714 | Ga0501048_0021943 | 3300049582 | Bacteria | 4674 |
| 715 | Ga0501069_0072196 | 3300049585 | Bacteria | 1935 |
| 716 | Ga0501071_0045159 | 3300049587 | Bacteria | 3162 |
| 717 | Ga0501073_0111320 | 3300049589 | Bacteria | 1899 |
| 718 | Ga0501074_0148729 | 3300049590 | Bacteria | 1675 |
| 719 | Ga0501074_0152127 | 3300049590 | Bacteria | 1654 |
| 720 | Ga0501075_0174401 | 3300049591 | Bacteria | 1641 |
| 721 | Ga0501075_0274379 | 3300049591 | Bacteria | 1285 |
| 722 | Ga0501076_0029062 | 3300049592 | Bacteria | 4297 |
| 723 | Ga0501077_0047521 | 3300049593 | Bacteria | 2727 |
| 724 | Ga0501077_0102311 | 3300049593 | Bacteria | 1815 |
| 725 | Ga0501077_0164176 | 3300049593 | Bacteria | 1410 |
| 726 | Ga0501081_0004305 | 3300049743 | Bacteria | 9123 |
| 727 | Ga0501081_0286599 | 3300049743 | Unclassified | 1207 |
| 728 | Ga0501045_0028847 | 3300049824 | Bacteria | 4006 |
| 729 | nmdc:mga05p37_171860_c1 | 3300050507 | Bacteria | 2643 |
| 730 | nmdc:mga05p37_18915_c1 | 3300050507 | Bacteria | 8327 |
| 731 | nmdc:mga05p37_276667_c1 | 3300050507 | Bacteria | 2004 |
| 732 | nmdc:mga05p37_48416_c1 | 3300050507 | Bacteria | 5228 |
| 733 | nmdc:mga05p37_50333_c1 | 3300050507 | Bacteria | 5123 |
| 734 | nmdc:mga05p37_59198_c1 | 3300050507 | Bacteria | 4717 |
| 735 | nmdc:mga05p37_59730_c1 | 3300050507 | Bacteria | 4695 |
| 736 | nmdc:mga05p37_627030_c1 | 3300050507 | Bacteria | 1209 |
| 737 | nmdc:mga05p37_64498_c1 | 3300050507 | Bacteria | 4507 |
| 738 | nmdc:mga05p37_95864_c1 | 3300050507 | Bacteria | 3655 |
| 739 | nmdc:mga09592_268085_c1 | 3300050508 | Bacteria | 1481 |
| 740 | nmdc:mga09592_783_c1 | 3300050508 | Bacteria | 24586 |
| 741 | nmdc:mga0qj67_142083_c1 | 3300050509 | Bacteria | 1946 |
| 742 | nmdc:mga0qj67_304852_c1 | 3300050509 | Unclassified | 1290 |
| 743 | nmdc:mga0qj67_86574_c1 | 3300050509 | Bacteria | 2514 |
| 744 | nmdc:mga06r32_10852_c1 | 3300050510 | Bacteria | 8203 |
| 745 | nmdc:mga06r32_8100_c1 | 3300050510 | Bacteria | 9453 |
| 746 | nmdc:mga08y16_139061_c1 | 3300050511 | Bacteria | 2525 |
| 747 | nmdc:mga08y16_2444_c1 | 3300050511 | Bacteria | 19075 |
| 748 | nmdc:mga0n895_110690_c1 | 3300050512 | Bacteria | 2762 |
| 749 | nmdc:mga0n895_124865_c1 | 3300050512 | Bacteria | 2597 |
| 750 | nmdc:mga0n895_13298_c1 | 3300050512 | Bacteria | 7420 |
| 751 | nmdc:mga0n895_185585_c1 | 3300050512 | Bacteria | 2111 |
| 752 | nmdc:mga0n895_185826_c1 | 3300050512 | Bacteria | 2109 |
| 753 | nmdc:mga0n895_512991_c1 | 3300050512 | Bacteria | 1207 |
| 754 | nmdc:mga0n895_590810_c1 | 3300050512 | Unclassified | 1113 |
| 755 | nmdc:mga0rr50_107149_c1 | 3300050513 | Bacteria | 2206 |
| 756 | nmdc:mga0rr50_126767_c1 | 3300050513 | Bacteria | 2039 |
| 757 | nmdc:mga0rr50_18049_c1 | 3300050513 | Bacteria | 4730 |
| 758 | nmdc:mga0rr50_229909_c1 | 3300050513 | Bacteria | 1534 |
| 759 | nmdc:mga0rr50_65112_c1 | 3300050513 | Bacteria | 2760 |
| 760 | nmdc:mga08x19_196241_c1 | 3300050514 | Bacteria | 1382 |
| 761 | nmdc:mga0a205_113598_c1 | 3300050515 | Bacteria | 2607 |
| 762 | nmdc:mga0a205_73805_c1 | 3300050515 | Bacteria | 3296 |
| 763 | Ga0495601_0021247 | 3300053077 | Unclassified | 3973 |
| 764 | Ga0495601_0111439 | 3300053077 | Bacteria | 1772 |
| 765 | Ga0495601_0113111 | 3300053077 | Unclassified | 1759 |
| 766 | Ga0495612_0003688 | 3300053078 | Bacteria | 6355 |
| 767 | Ga0495595_0052823 | 3300053084 | Bacteria | 1887 |
| 768 | Ga0495619_0044662 | 3300053085 | Bacteria | 2909 |
| 769 | Ga0495619_0061392 | 3300053085 | Bacteria | 2501 |
| 770 | Ga0495619_0122330 | 3300053085 | Bacteria | 1785 |
| 771 | Ga0501084_0056642 | 3300054114 | Bacteria | 3279 |
| 772 | Ga0501084_0124924 | 3300054114 | Bacteria | 2165 |
| 773 | Ga0587077_003386 | 3300059493 | Bacteria | 2000 |
| 774 | Ga0587107_000680 | 3300059652 | Bacteria | 2390 |
| 775 | Ga0501082_0308472 | 3300060353 | Bacteria | 1378 |
| 776 | Ga0530510_0058176 | 3300061734 | Bacteria | 2795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0067925 | Ga0495628_0067925_125_1015 | 278 |
| 2 | 3300047673 | Ga0495593_0077538 | Ga0495593_0077538_29_928 | 281 |
| 3 | 3300049572 | Ga0501036_0471764 | Ga0501036_0471764_128_1030 | 282 |
| 4 | 3300046455 | Ga0495603_0014257 | Ga0495603_0014257_2304_3209 | 283 |
| 5 | 3300050511 | nmdc:mga08y16_139061_c1 | nmdc:mga08y16_139061_c1_1597_2502 | 283 |
| 6 | 3300005434 | Ga0070709_10348093 | Ga0070709_103480931 | 285 |
| 7 | 3300025916 | Ga0207663_10121603 | Ga0207663_101216031 | 285 |
| 8 | 3300026075 | Ga0207708_10215499 | Ga0207708_102154991 | 285 |
| 9 | 3300035115 | Ga0373941_0062463 | Ga0373941_0062463_66_977 | 285 |
| 10 | 3300046543 | Ga0495645_0087172 | Ga0495645_0087172_587_1498 | 285 |
| 11 | 3300048088 | Ga0495602_0120840 | Ga0495602_0120840_59_988 | 291 |
| 12 | 3300046473 | Ga0495582_0226859 | Ga0495582_0226859_13_993 | 294 |
| 13 | 3300009093 | Ga0105240_10064120 | Ga0105240_100641202 | 297 |
| 14 | 3300036401 | Ga0373937_0491063 | Ga0373937_0491063_12_968 | 299 |
| 15 | 3300006846 | Ga0075430_100370679 | Ga0075430_1003706791 | 301 |
| 16 | 3300050509 | nmdc:mga0qj67_142083_c1 | nmdc:mga0qj67_142083_c1_280_1296 | 302 |
| 17 | 3300005456 | Ga0070678_100171427 | Ga0070678_1001714272 | 304 |
| 18 | 3300005467 | Ga0070706_100049856 | Ga0070706_1000498562 | 304 |
| 19 | 3300005471 | Ga0070698_100029720 | Ga0070698_1000297204 | 304 |
| 20 | 3300046472 | Ga0495580_0002181 | Ga0495580_0002181_2360_3376 | 306 |
| 21 | 3300009147 | Ga0114129_10458430 | Ga0114129_104584302 | 309 |
| 22 | 3300009148 | Ga0105243_10138160 | Ga0105243_101381602 | 309 |
| 23 | 3300046499 | Ga0495594_0016429 | Ga0495594_0016429_2796_3782 | 309 |
| 24 | 3300046528 | Ga0495642_0003861 | Ga0495642_0003861_3388_4374 | 309 |
| 25 | 3300046538 | Ga0495609_0058207 | Ga0495609_0058207_71_1057 | 309 |
| 26 | 3300046539 | Ga0495621_0002181 | Ga0495621_0002181_3055_4041 | 309 |
| 27 | 3300046615 | Ga0495656_0121520 | Ga0495656_0121520_225_1211 | 309 |
| 28 | 3300047445 | Ga0495677_0066111 | Ga0495677_0066111_180_1166 | 309 |
| 29 | 3300050507 | nmdc:mga05p37_627030_c1 | nmdc:mga05p37_627030_c1_155_1141 | 309 |
| 30 | 3300050512 | nmdc:mga0n895_185585_c1 | nmdc:mga0n895_185585_c1_550_1536 | 309 |
| 31 | 3300050513 | nmdc:mga0rr50_229909_c1 | nmdc:mga0rr50_229909_c1_56_1042 | 309 |
| 32 | 3300050515 | nmdc:mga0a205_73805_c1 | nmdc:mga0a205_73805_c1_1068_2054 | 309 |
| 33 | 3300036401 | Ga0373937_0144431 | Ga0373937_0144431_243_1235 | 310 |
| 34 | 3300046459 | Ga0495629_0047921 | Ga0495629_0047921_359_1351 | 310 |
| 35 | 3300048908 | Ga0496105_0005363 | Ga0496105_0005363_4091_5077 | 310 |
| 36 | 3300049593 | Ga0501077_0102311 | Ga0501077_0102311_676_1701 | 310 |
| 37 | 3300009147 | Ga0114129_10077848 | Ga0114129_100778487 | 311 |
| 38 | 3300013296 | Ga0157374_10078051 | Ga0157374_100780514 | 311 |
| 39 | 3300013308 | Ga0157375_10270714 | Ga0157375_102707142 | 311 |
| 40 | 3300014326 | Ga0157380_10001814 | Ga0157380_1000181412 | 311 |
| 41 | 3300014969 | Ga0157376_10058953 | Ga0157376_100589533 | 311 |
| 42 | 3300015265 | Ga0182005_1056525 | Ga0182005_10565251 | 311 |
| 43 | 3300027907 | Ga0207428_10037675 | Ga0207428_100376752 | 311 |
| 44 | 3300031901 | Ga0307406_10120344 | Ga0307406_101203442 | 311 |
| 45 | 3300031995 | Ga0307409_100051269 | Ga0307409_1000512692 | 311 |
| 46 | 3300035088 | Ga0373940_0027178 | Ga0373940_0027178_301_1290 | 311 |
| 47 | 3300045051 | Ga0451576_0106407 | Ga0451576_0106407_437_1426 | 311 |
| 48 | 3300046539 | Ga0495621_0101640 | Ga0495621_0101640_11_1000 | 311 |
| 49 | 3300047321 | Ga0495676_0034952 | Ga0495676_0034952_680_1672 | 311 |
| 50 | 3300050511 | nmdc:mga08y16_2444_c1 | nmdc:mga08y16_2444_c1_3969_4958 | 311 |
| 51 | 3300059493 | Ga0587077_003386 | Ga0587077_003386_188_1177 | 311 |
| 52 | 3300059652 | Ga0587107_000680 | Ga0587107_000680_212_1201 | 311 |
| 53 | 3300009093 | Ga0105240_10111346 | Ga0105240_101113464 | 312 |
| 54 | 3300014969 | Ga0157376_10069513 | Ga0157376_100695132 | 312 |
| 55 | 3300025936 | Ga0207670_10169622 | Ga0207670_101696222 | 312 |
| 56 | 3300035086 | Ga0373934_0015463 | Ga0373934_0015463_507_1502 | 312 |
| 57 | 3300035111 | Ga0373923_0039980 | Ga0373923_0039980_392_1387 | 312 |
| 58 | 3300035111 | Ga0373923_0049113 | Ga0373923_0049113_368_1360 | 312 |
| 59 | 3300035118 | Ga0373954_0071738 | Ga0373954_0071738_612_1607 | 312 |
| 60 | 3300035692 | Ga0373935_0197304 | Ga0373935_0197304_360_1355 | 312 |
| 61 | 3300035695 | Ga0373927_0093605 | Ga0373927_0093605_933_1925 | 312 |
| 62 | 3300035724 | Ga0373933_0187530 | Ga0373933_0187530_66_1061 | 312 |
| 63 | 3300035725 | Ga0373947_0024378 | Ga0373947_0024378_2262_3254 | 312 |
| 64 | 3300036401 | Ga0373937_0010129 | Ga0373937_0010129_934_1929 | 312 |
| 65 | 3300037068 | Ga0373925_0037190 | Ga0373925_0037190_1693_2685 | 312 |
| 66 | 3300037068 | Ga0373925_0075260 | Ga0373925_0075260_1080_2075 | 312 |
| 67 | 3300046472 | Ga0495580_0075770 | Ga0495580_0075770_550_1542 | 312 |
| 68 | 3300046517 | Ga0495630_0032428 | Ga0495630_0032428_1163_2155 | 312 |
| 69 | 3300046559 | Ga0495667_0145953 | Ga0495667_0145953_458_1450 | 312 |
| 70 | 3300046663 | Ga0495635_0076315 | Ga0495635_0076315_458_1450 | 312 |
| 71 | 3300046680 | Ga0495646_0134784 | Ga0495646_0134784_201_1193 | 312 |
| 72 | 3300046690 | Ga0495624_0140459 | Ga0495624_0140459_55_1047 | 312 |
| 73 | 3300047317 | Ga0495604_0158549 | Ga0495604_0158549_446_1438 | 312 |
| 74 | 3300047319 | Ga0495674_0387772 | Ga0495674_0387772_23_1015 | 312 |
| 75 | 3300047471 | Ga0495684_0008283 | Ga0495684_0008283_5073_6068 | 312 |
| 76 | 3300048088 | Ga0495602_0220599 | Ga0495602_0220599_172_1164 | 312 |
| 77 | 3300048089 | Ga0495614_0065798 | Ga0495614_0065798_502_1494 | 312 |
| 78 | 3300053085 | Ga0495619_0122330 | Ga0495619_0122330_79_1071 | 312 |
| 79 | 3300006358 | Ga0068871_100221192 | Ga0068871_1002211922 | 313 |
| 80 | 3300007265 | Ga0099794_10000004 | Ga0099794_100000042 | 313 |
| 81 | 3300007265 | Ga0099794_10080883 | Ga0099794_100808832 | 313 |
| 82 | 3300009093 | Ga0105240_10407530 | Ga0105240_104075302 | 313 |
| 83 | 3300009098 | Ga0105245_10194206 | Ga0105245_101942062 | 313 |
| 84 | 3300009101 | Ga0105247_10073837 | Ga0105247_100738372 | 313 |
| 85 | 3300009174 | Ga0105241_10007930 | Ga0105241_100079305 | 313 |
| 86 | 3300009174 | Ga0105241_10071635 | Ga0105241_100716352 | 313 |
| 87 | 3300009176 | Ga0105242_10070983 | Ga0105242_100709832 | 313 |
| 88 | 3300009176 | Ga0105242_10096891 | Ga0105242_100968912 | 313 |
| 89 | 3300009177 | Ga0105248_10105558 | Ga0105248_101055582 | 313 |
| 90 | 3300009551 | Ga0105238_10024029 | Ga0105238_100240292 | 313 |
| 91 | 3300009553 | Ga0105249_10006270 | Ga0105249_100062706 | 313 |
| 92 | 3300010159 | Ga0099796_10000427 | Ga0099796_100004273 | 313 |
| 93 | 3300013102 | Ga0157371_10024243 | Ga0157371_100242432 | 313 |
| 94 | 3300013296 | Ga0157374_10016801 | Ga0157374_100168016 | 313 |
| 95 | 3300013296 | Ga0157374_10021505 | Ga0157374_100215052 | 313 |
| 96 | 3300013297 | Ga0157378_10085504 | Ga0157378_100855043 | 313 |
| 97 | 3300013297 | Ga0157378_10123896 | Ga0157378_101238962 | 313 |
| 98 | 3300013306 | Ga0163162_10152424 | Ga0163162_101524242 | 313 |
| 99 | 3300013307 | Ga0157372_10019861 | Ga0157372_100198617 | 313 |
| 100 | 3300014968 | Ga0157379_10004208 | Ga0157379_100042085 | 313 |
| 101 | 3300014968 | Ga0157379_10051201 | Ga0157379_100512012 | 313 |
| 102 | 3300014969 | Ga0157376_10245154 | Ga0157376_102451542 | 313 |
| 103 | 3300035090 | Ga0373949_0011290 | Ga0373949_0011290_362_1357 | 313 |
| 104 | 3300035170 | Ga0373943_0059686 | Ga0373943_0059686_213_1211 | 313 |
| 105 | 3300035170 | Ga0373943_0116366 | Ga0373943_0116366_303_1298 | 313 |
| 106 | 3300035172 | Ga0373955_0016771 | Ga0373955_0016771_2347_3345 | 313 |
| 107 | 3300035410 | Ga0373924_0121364 | Ga0373924_0121364_82_1080 | 313 |
| 108 | 3300035691 | Ga0373931_0026882 | Ga0373931_0026882_1527_2522 | 313 |
| 109 | 3300035692 | Ga0373935_0212053 | Ga0373935_0212053_43_1041 | 313 |
| 110 | 3300035695 | Ga0373927_0002147 | Ga0373927_0002147_36_1034 | 313 |
| 111 | 3300036401 | Ga0373937_0071265 | Ga0373937_0071265_1319_2317 | 313 |
| 112 | 3300044673 | Ga0453683_0002798 | Ga0453683_0002798_8270_9265 | 313 |
| 113 | 3300044673 | Ga0453683_0006940 | Ga0453683_0006940_2716_3711 | 313 |
| 114 | 3300044712 | Ga0453684_0022220 | Ga0453684_0022220_1099_2094 | 313 |
| 115 | 3300046472 | Ga0495580_0010201 | Ga0495580_0010201_205_1200 | 313 |
| 116 | 3300046473 | Ga0495582_0012347 | Ga0495582_0012347_1059_2054 | 313 |
| 117 | 3300046477 | Ga0495664_0046996 | Ga0495664_0046996_441_1436 | 313 |
| 118 | 3300046511 | Ga0495608_0218285 | Ga0495608_0218285_69_1067 | 313 |
| 119 | 3300046543 | Ga0495645_0002510 | Ga0495645_0002510_9551_10546 | 313 |
| 120 | 3300046689 | Ga0495613_0258038 | Ga0495613_0258038_55_1053 | 313 |
| 121 | 3300047673 | Ga0495593_0054240 | Ga0495593_0054240_1091_2086 | 313 |
| 122 | 3300048903 | Ga0496100_0006702 | Ga0496100_0006702_2554_3549 | 313 |
| 123 | 3300048904 | Ga0496101_0057455 | Ga0496101_0057455_678_1673 | 313 |
| 124 | 3300048905 | Ga0496102_0031150 | Ga0496102_0031150_2620_3615 | 313 |
| 125 | 3300048905 | Ga0496102_0408465 | Ga0496102_0408465_162_1157 | 313 |
| 126 | 3300048906 | Ga0496103_0001075 | Ga0496103_0001075_7689_8684 | 313 |
| 127 | 3300048906 | Ga0496103_0053198 | Ga0496103_0053198_1145_2140 | 313 |
| 128 | 3300048907 | Ga0496104_0007903 | Ga0496104_0007903_6812_7807 | 313 |
| 129 | 3300048909 | Ga0496106_0018302 | Ga0496106_0018302_3796_4791 | 313 |
| 130 | 3300048910 | Ga0496107_0086072 | Ga0496107_0086072_615_1610 | 313 |
| 131 | 3300048910 | Ga0496107_0100740 | Ga0496107_0100740_1076_2071 | 313 |
| 132 | 3300048910 | Ga0496107_0130354 | Ga0496107_0130354_530_1525 | 313 |
| 133 | 3300048911 | Ga0496108_0311816 | Ga0496108_0311816_202_1197 | 313 |
| 134 | 3300048915 | Ga0496112_0060610 | Ga0496112_0060610_1198_2193 | 313 |
| 135 | 3300048917 | Ga0496114_0275905 | Ga0496114_0275905_303_1298 | 313 |
| 136 | 3300048918 | Ga0496115_0002823 | Ga0496115_0002823_7447_8442 | 313 |
| 137 | 3300048918 | Ga0496115_0006852 | Ga0496115_0006852_5876_6871 | 313 |
| 138 | 3300050512 | nmdc:mga0n895_110690_c1 | nmdc:mga0n895_110690_c1_817_1812 | 313 |
| 139 | 3300050512 | nmdc:mga0n895_124865_c1 | nmdc:mga0n895_124865_c1_310_1305 | 313 |
| 140 | 3300050513 | nmdc:mga0rr50_107149_c1 | nmdc:mga0rr50_107149_c1_348_1343 | 313 |
| 141 | 3300050514 | nmdc:mga08x19_196241_c1 | nmdc:mga08x19_196241_c1_88_1083 | 313 |
| 142 | 3300053077 | Ga0495601_0021247 | Ga0495601_0021247_281_1276 | 313 |
| 143 | 3300061734 | Ga0530510_0058176 | Ga0530510_0058176_1199_2194 | 313 |
| 144 | 3300005545 | Ga0070695_100050386 | Ga0070695_1000503861 | 314 |
| 145 | 3300035172 | Ga0373955_0118284 | Ga0373955_0118284_215_1231 | 314 |
| 146 | 3300036401 | Ga0373937_0059939 | Ga0373937_0059939_1280_2296 | 314 |
| 147 | 3300046543 | Ga0495645_0000296 | Ga0495645_0000296_22258_23274 | 314 |
| 148 | 3300046559 | Ga0495667_0137646 | Ga0495667_0137646_45_1061 | 314 |
| 149 | 3300046663 | Ga0495635_0111852 | Ga0495635_0111852_293_1309 | 314 |
| 150 | 3300046683 | Ga0495658_0024014 | Ga0495658_0024014_1343_2359 | 314 |
| 151 | 3300048917 | Ga0496114_0031238 | Ga0496114_0031238_1831_2847 | 314 |
| 152 | 3300053077 | Ga0495601_0111439 | Ga0495601_0111439_91_1107 | 314 |
| 153 | 3300053084 | Ga0495595_0052823 | Ga0495595_0052823_716_1732 | 314 |
| 154 | 3300053085 | Ga0495619_0044662 | Ga0495619_0044662_727_1743 | 314 |
| 155 | 3300005434 | Ga0070709_10018523 | Ga0070709_100185232 | 315 |
| 156 | 3300005436 | Ga0070713_100027599 | Ga0070713_1000275992 | 315 |
| 157 | 3300005563 | Ga0068855_100342867 | Ga0068855_1003428672 | 315 |
| 158 | 3300006846 | Ga0075430_100020169 | Ga0075430_1000201696 | 315 |
| 159 | 3300006847 | Ga0075431_100039169 | Ga0075431_1000391692 | 315 |
| 160 | 3300009093 | Ga0105240_10314013 | Ga0105240_103140132 | 315 |
| 161 | 3300009098 | Ga0105245_10044159 | Ga0105245_100441594 | 315 |
| 162 | 3300009101 | Ga0105247_10089641 | Ga0105247_100896412 | 315 |
| 163 | 3300013296 | Ga0157374_10037981 | Ga0157374_100379812 | 315 |
| 164 | 3300013297 | Ga0157378_10006834 | Ga0157378_100068347 | 315 |
| 165 | 3300025927 | Ga0207687_10155357 | Ga0207687_101553572 | 315 |
| 166 | 3300025928 | Ga0207700_10067729 | Ga0207700_100677292 | 315 |
| 167 | 3300025949 | Ga0207667_10290154 | Ga0207667_102901542 | 315 |
| 168 | 3300035113 | Ga0373936_0050788 | Ga0373936_0050788_656_1657 | 315 |
| 169 | 3300035120 | Ga0373957_0040808 | Ga0373957_0040808_514_1515 | 315 |
| 170 | 3300035172 | Ga0373955_0041648 | Ga0373955_0041648_537_1538 | 315 |
| 171 | 3300035692 | Ga0373935_0004101 | Ga0373935_0004101_6005_7006 | 315 |
| 172 | 3300035725 | Ga0373947_0039201 | Ga0373947_0039201_1256_2257 | 315 |
| 173 | 3300036401 | Ga0373937_0004324 | Ga0373937_0004324_10237_11238 | 315 |
| 174 | 3300037068 | Ga0373925_0152596 | Ga0373925_0152596_397_1398 | 315 |
| 175 | 3300046454 | Ga0495592_0027262 | Ga0495592_0027262_2841_3842 | 315 |
| 176 | 3300046454 | Ga0495592_0044085 | Ga0495592_0044085_2122_3123 | 315 |
| 177 | 3300046459 | Ga0495629_0043630 | Ga0495629_0043630_413_1429 | 315 |
| 178 | 3300046462 | Ga0495651_0001373 | Ga0495651_0001373_590_1591 | 315 |
| 179 | 3300046462 | Ga0495651_0009991 | Ga0495651_0009991_529_1530 | 315 |
| 180 | 3300046463 | Ga0495653_0014801 | Ga0495653_0014801_816_1817 | 315 |
| 181 | 3300046463 | Ga0495653_0025407 | Ga0495653_0025407_1788_2789 | 315 |
| 182 | 3300046472 | Ga0495580_0002545 | Ga0495580_0002545_6409_7410 | 315 |
| 183 | 3300046477 | Ga0495664_0017972 | Ga0495664_0017972_428_1429 | 315 |
| 184 | 3300046511 | Ga0495608_0011346 | Ga0495608_0011346_1068_2069 | 315 |
| 185 | 3300046511 | Ga0495608_0037447 | Ga0495608_0037447_1545_2546 | 315 |
| 186 | 3300046514 | Ga0495618_0002982 | Ga0495618_0002982_6469_7470 | 315 |
| 187 | 3300046516 | Ga0495628_0000439 | Ga0495628_0000439_9025_10026 | 315 |
| 188 | 3300046516 | Ga0495628_0090427 | Ga0495628_0090427_37_1038 | 315 |
| 189 | 3300046517 | Ga0495630_0018098 | Ga0495630_0018098_2634_3635 | 315 |
| 190 | 3300046529 | Ga0495652_0008144 | Ga0495652_0008144_7267_8268 | 315 |
| 191 | 3300046531 | Ga0495665_0002479 | Ga0495665_0002479_8508_9509 | 315 |
| 192 | 3300046535 | Ga0495586_0021362 | Ga0495586_0021362_1265_2266 | 315 |
| 193 | 3300046535 | Ga0495586_0038360 | Ga0495586_0038360_282_1283 | 315 |
| 194 | 3300046536 | Ga0495587_0012312 | Ga0495587_0012312_1316_2317 | 315 |
| 195 | 3300046536 | Ga0495587_0083059 | Ga0495587_0083059_175_1176 | 315 |
| 196 | 3300046543 | Ga0495645_0009221 | Ga0495645_0009221_5703_6704 | 315 |
| 197 | 3300046543 | Ga0495645_0064030 | Ga0495645_0064030_1389_2390 | 315 |
| 198 | 3300046559 | Ga0495667_0003132 | Ga0495667_0003132_6265_7266 | 315 |
| 199 | 3300046559 | Ga0495667_0014988 | Ga0495667_0014988_1707_2708 | 315 |
| 200 | 3300046559 | Ga0495667_0026654 | Ga0495667_0026654_915_1916 | 315 |
| 201 | 3300046663 | Ga0495635_0006770 | Ga0495635_0006770_1431_2432 | 315 |
| 202 | 3300046675 | Ga0495657_0006893 | Ga0495657_0006893_2087_3088 | 315 |
| 203 | 3300046675 | Ga0495657_0009162 | Ga0495657_0009162_6450_7451 | 315 |
| 204 | 3300046675 | Ga0495657_0034723 | Ga0495657_0034723_2169_3170 | 315 |
| 205 | 3300046678 | Ga0495599_0012100 | Ga0495599_0012100_3739_4740 | 315 |
| 206 | 3300046679 | Ga0495623_0020396 | Ga0495623_0020396_1374_2375 | 315 |
| 207 | 3300046679 | Ga0495623_0146903 | Ga0495623_0146903_326_1327 | 315 |
| 208 | 3300046680 | Ga0495646_0003971 | Ga0495646_0003971_2564_3565 | 315 |
| 209 | 3300046680 | Ga0495646_0067227 | Ga0495646_0067227_515_1516 | 315 |
| 210 | 3300046689 | Ga0495613_0163562 | Ga0495613_0163562_49_1050 | 315 |
| 211 | 3300046690 | Ga0495624_0005250 | Ga0495624_0005250_1186_2187 | 315 |
| 212 | 3300047317 | Ga0495604_0004754 | Ga0495604_0004754_569_1570 | 315 |
| 213 | 3300047317 | Ga0495604_0008380 | Ga0495604_0008380_2341_3342 | 315 |
| 214 | 3300047319 | Ga0495674_0012275 | Ga0495674_0012275_5228_6229 | 315 |
| 215 | 3300047319 | Ga0495674_0075174 | Ga0495674_0075174_756_1757 | 315 |
| 216 | 3300047322 | Ga0495680_0002590 | Ga0495680_0002590_11073_12074 | 315 |
| 217 | 3300047322 | Ga0495680_0019539 | Ga0495680_0019539_3268_4269 | 315 |
| 218 | 3300047322 | Ga0495680_0091426 | Ga0495680_0091426_932_1933 | 315 |
| 219 | 3300047444 | Ga0495675_0000155 | Ga0495675_0000155_31543_32544 | 315 |
| 220 | 3300047444 | Ga0495675_0010545 | Ga0495675_0010545_1511_2512 | 315 |
| 221 | 3300047444 | Ga0495675_0019031 | Ga0495675_0019031_866_1867 | 315 |
| 222 | 3300047471 | Ga0495684_0007480 | Ga0495684_0007480_6699_7700 | 315 |
| 223 | 3300047471 | Ga0495684_0014680 | Ga0495684_0014680_3105_4106 | 315 |
| 224 | 3300047471 | Ga0495684_0042570 | Ga0495684_0042570_1108_2109 | 315 |
| 225 | 3300048088 | Ga0495602_0024740 | Ga0495602_0024740_394_1395 | 315 |
| 226 | 3300049575 | Ga0501039_0039552 | Ga0501039_0039552_1929_2930 | 315 |
| 227 | 3300049578 | Ga0501042_0015930 | Ga0501042_0015930_3490_4491 | 315 |
| 228 | 3300049582 | Ga0501048_0021943 | Ga0501048_0021943_216_1217 | 315 |
| 229 | 3300049587 | Ga0501071_0045159 | Ga0501071_0045159_409_1410 | 315 |
| 230 | 3300049589 | Ga0501073_0111320 | Ga0501073_0111320_145_1146 | 315 |
| 231 | 3300049592 | Ga0501076_0029062 | Ga0501076_0029062_2152_3153 | 315 |
| 232 | 3300049593 | Ga0501077_0047521 | Ga0501077_0047521_915_1916 | 315 |
| 233 | 3300049743 | Ga0501081_0004305 | Ga0501081_0004305_4883_5884 | 315 |
| 234 | 3300049824 | Ga0501045_0028847 | Ga0501045_0028847_615_1616 | 315 |
| 235 | 3300050509 | nmdc:mga0qj67_86574_c1 | nmdc:mga0qj67_86574_c1_41_1042 | 315 |
| 236 | 3300053078 | Ga0495612_0003688 | Ga0495612_0003688_1224_2225 | 315 |
| 237 | 3300054114 | Ga0501084_0056642 | Ga0501084_0056642_68_1069 | 315 |
| 238 | 3300060353 | Ga0501082_0308472 | Ga0501082_0308472_72_1073 | 315 |
| 239 | 3300005345 | Ga0070692_10024643 | Ga0070692_100246433 | 316 |
| 240 | 3300005365 | Ga0070688_100020848 | Ga0070688_1000208482 | 316 |
| 241 | 3300005440 | Ga0070705_100007431 | Ga0070705_1000074314 | 316 |
| 242 | 3300005440 | Ga0070705_100072171 | Ga0070705_1000721712 | 316 |
| 243 | 3300005444 | Ga0070694_100000103 | Ga0070694_10000010311 | 316 |
| 244 | 3300005444 | Ga0070694_100001652 | Ga0070694_1000016525 | 316 |
| 245 | 3300005471 | Ga0070698_100003114 | Ga0070698_1000031144 | 316 |
| 246 | 3300005471 | Ga0070698_100004515 | Ga0070698_10000451512 | 316 |
| 247 | 3300005518 | Ga0070699_100000432 | Ga0070699_1000004329 | 316 |
| 248 | 3300005518 | Ga0070699_100492223 | Ga0070699_1004922231 | 316 |
| 249 | 3300005545 | Ga0070695_100001880 | Ga0070695_1000018807 | 316 |
| 250 | 3300005546 | Ga0070696_100016687 | Ga0070696_1000166872 | 316 |
| 251 | 3300005546 | Ga0070696_100017968 | Ga0070696_1000179683 | 316 |
| 252 | 3300005549 | Ga0070704_100074466 | Ga0070704_1000744662 | 316 |
| 253 | 3300005615 | Ga0070702_100004444 | Ga0070702_1000044445 | 316 |
| 254 | 3300005616 | Ga0068852_100606624 | Ga0068852_1006066241 | 316 |
| 255 | 3300005842 | Ga0068858_100059537 | Ga0068858_1000595375 | 316 |
| 256 | 3300006852 | Ga0075433_10094054 | Ga0075433_100940542 | 316 |
| 257 | 3300006852 | Ga0075433_10099342 | Ga0075433_100993422 | 316 |
| 258 | 3300009147 | Ga0114129_10022667 | Ga0114129_100226675 | 316 |
| 259 | 3300009177 | Ga0105248_10194570 | Ga0105248_101945702 | 316 |
| 260 | 3300013297 | Ga0157378_10323570 | Ga0157378_103235702 | 316 |
| 261 | 3300025926 | Ga0207659_10280684 | Ga0207659_102806842 | 316 |
| 262 | 3300025931 | Ga0207644_10062526 | Ga0207644_100625262 | 316 |
| 263 | 3300025935 | Ga0207709_10024100 | Ga0207709_100241002 | 316 |
| 264 | 3300025937 | Ga0207669_10257995 | Ga0207669_102579952 | 316 |
| 265 | 3300025940 | Ga0207691_10096303 | Ga0207691_100963033 | 316 |
| 266 | 3300026035 | Ga0207703_10032794 | Ga0207703_100327942 | 316 |
| 267 | 3300046525 | Ga0495663_0002941 | Ga0495663_0002941_1978_2985 | 316 |
| 268 | 3300046539 | Ga0495621_0062662 | Ga0495621_0062662_176_1183 | 316 |
| 269 | 3300005340 | Ga0070689_100235097 | Ga0070689_1002350972 | 317 |
| 270 | 3300006028 | Ga0070717_10039858 | Ga0070717_100398582 | 317 |
| 271 | 3300009147 | Ga0114129_10031867 | Ga0114129_100318672 | 317 |
| 272 | 3300009177 | Ga0105248_10002269 | Ga0105248_1000226916 | 317 |
| 273 | 3300014325 | Ga0163163_10276342 | Ga0163163_102763423 | 317 |
| 274 | 3300025941 | Ga0207711_10066415 | Ga0207711_100664154 | 317 |
| 275 | 3300026118 | Ga0207675_100292694 | Ga0207675_1002926942 | 317 |
| 276 | 3300036401 | Ga0373937_0139010 | Ga0373937_0139010_1188_2198 | 317 |
| 277 | 3300046516 | Ga0495628_0163944 | Ga0495628_0163944_573_1583 | 317 |
| 278 | 3300046517 | Ga0495630_0004015 | Ga0495630_0004015_1474_2481 | 317 |
| 279 | 3300047319 | Ga0495674_0032047 | Ga0495674_0032047_2725_3732 | 317 |
| 280 | 3300047444 | Ga0495675_0028417 | Ga0495675_0028417_353_1360 | 317 |
| 281 | 3300048088 | Ga0495602_0168621 | Ga0495602_0168621_542_1549 | 317 |
| 282 | 3300049576 | Ga0501040_0273120 | Ga0501040_0273120_125_1132 | 317 |
| 283 | 3300049585 | Ga0501069_0072196 | Ga0501069_0072196_709_1716 | 317 |
| 284 | 3300049590 | Ga0501074_0152127 | Ga0501074_0152127_493_1500 | 317 |
| 285 | 3300049591 | Ga0501075_0274379 | Ga0501075_0274379_203_1210 | 317 |
| 286 | 3300050507 | nmdc:mga05p37_18915_c1 | nmdc:mga05p37_18915_c1_3188_4195 | 317 |
| 287 | 3300005330 | Ga0070690_100111970 | Ga0070690_1001119702 | 318 |
| 288 | 3300005333 | Ga0070677_10062373 | Ga0070677_100623732 | 318 |
| 289 | 3300005341 | Ga0070691_10005581 | Ga0070691_100055816 | 318 |
| 290 | 3300005343 | Ga0070687_100078599 | Ga0070687_1000785992 | 318 |
| 291 | 3300005347 | Ga0070668_100109683 | Ga0070668_1001096832 | 318 |
| 292 | 3300005356 | Ga0070674_100003835 | Ga0070674_1000038354 | 318 |
| 293 | 3300005438 | Ga0070701_10016141 | Ga0070701_100161412 | 318 |
| 294 | 3300005441 | Ga0070700_100030983 | Ga0070700_1000309834 | 318 |
| 295 | 3300005441 | Ga0070700_100035471 | Ga0070700_1000354712 | 318 |
| 296 | 3300005441 | Ga0070700_100139883 | Ga0070700_1001398832 | 318 |
| 297 | 3300005536 | Ga0070697_100234582 | Ga0070697_1002345822 | 318 |
| 298 | 3300005545 | Ga0070695_100044346 | Ga0070695_1000443463 | 318 |
| 299 | 3300005546 | Ga0070696_100081946 | Ga0070696_1000819462 | 318 |
| 300 | 3300005549 | Ga0070704_100038611 | Ga0070704_1000386111 | 318 |
| 301 | 3300005549 | Ga0070704_100063407 | Ga0070704_1000634072 | 318 |
| 302 | 3300005615 | Ga0070702_100020952 | Ga0070702_1000209524 | 318 |
| 303 | 3300005718 | Ga0068866_10075012 | Ga0068866_100750122 | 318 |
| 304 | 3300005844 | Ga0068862_100334264 | Ga0068862_1003342641 | 318 |
| 305 | 3300006237 | Ga0097621_100184988 | Ga0097621_1001849882 | 318 |
| 306 | 3300006358 | Ga0068871_100216737 | Ga0068871_1002167372 | 318 |
| 307 | 3300006847 | Ga0075431_100097179 | Ga0075431_1000971792 | 318 |
| 308 | 3300006847 | Ga0075431_100381799 | Ga0075431_1003817992 | 318 |
| 309 | 3300006871 | Ga0075434_100139418 | Ga0075434_1001394183 | 318 |
| 310 | 3300006871 | Ga0075434_100411402 | Ga0075434_1004114021 | 318 |
| 311 | 3300009148 | Ga0105243_10017234 | Ga0105243_100172341 | 318 |
| 312 | 3300009553 | Ga0105249_10189879 | Ga0105249_101898792 | 318 |
| 313 | 3300014326 | Ga0157380_10066459 | Ga0157380_100664592 | 318 |
| 314 | 3300025899 | Ga0207642_10121428 | Ga0207642_101214282 | 318 |
| 315 | 3300025923 | Ga0207681_10270665 | Ga0207681_102706651 | 318 |
| 316 | 3300025935 | Ga0207709_10027923 | Ga0207709_100279232 | 318 |
| 317 | 3300025937 | Ga0207669_10107684 | Ga0207669_101076842 | 318 |
| 318 | 3300025938 | Ga0207704_10036682 | Ga0207704_100366821 | 318 |
| 319 | 3300025939 | Ga0207665_10149142 | Ga0207665_101491422 | 318 |
| 320 | 3300025961 | Ga0207712_10157044 | Ga0207712_101570442 | 318 |
| 321 | 3300025972 | Ga0207668_10016766 | Ga0207668_100167661 | 318 |
| 322 | 3300026075 | Ga0207708_10038732 | Ga0207708_100387322 | 318 |
| 323 | 3300026075 | Ga0207708_10069389 | Ga0207708_100693893 | 318 |
| 324 | 3300026089 | Ga0207648_10219365 | Ga0207648_102193651 | 318 |
| 325 | 3300026118 | Ga0207675_100011936 | Ga0207675_1000119365 | 318 |
| 326 | 3300026142 | Ga0207698_10352519 | Ga0207698_103525191 | 318 |
| 327 | 3300027907 | Ga0207428_10011592 | Ga0207428_100115924 | 318 |
| 328 | 3300028380 | Ga0268265_10048009 | Ga0268265_100480092 | 318 |
| 329 | 3300028381 | Ga0268264_10172422 | Ga0268264_101724222 | 318 |
| 330 | 3300046459 | Ga0495629_0026931 | Ga0495629_0026931_3004_4017 | 318 |
| 331 | 3300046539 | Ga0495621_0048686 | Ga0495621_0048686_59_1072 | 318 |
| 332 | 3300049593 | Ga0501077_0164176 | Ga0501077_0164176_228_1238 | 318 |
| 333 | 3300050510 | nmdc:mga06r32_10852_c1 | nmdc:mga06r32_10852_c1_5874_6884 | 318 |
| 334 | 3300050512 | nmdc:mga0n895_512991_c1 | nmdc:mga0n895_512991_c1_26_1036 | 318 |
| 335 | 3300054114 | Ga0501084_0124924 | Ga0501084_0124924_200_1210 | 318 |
| 336 | 3300003203 | JGI25406J46586_10002645 | JGI25406J46586_100026454 | 319 |
| 337 | 3300005295 | Ga0065707_10041103 | Ga0065707_100411032 | 319 |
| 338 | 3300005328 | Ga0070676_10106260 | Ga0070676_101062602 | 319 |
| 339 | 3300005328 | Ga0070676_10271725 | Ga0070676_102717251 | 319 |
| 340 | 3300005329 | Ga0070683_100294848 | Ga0070683_1002948482 | 319 |
| 341 | 3300005334 | Ga0068869_100051719 | Ga0068869_1000517192 | 319 |
| 342 | 3300005336 | Ga0070680_100053213 | Ga0070680_1000532132 | 319 |
| 343 | 3300005337 | Ga0070682_100340759 | Ga0070682_1003407591 | 319 |
| 344 | 3300005338 | Ga0068868_100045403 | Ga0068868_1000454032 | 319 |
| 345 | 3300005355 | Ga0070671_100382407 | Ga0070671_1003824071 | 319 |
| 346 | 3300005364 | Ga0070673_100060792 | Ga0070673_1000607925 | 319 |
| 347 | 3300005364 | Ga0070673_100318646 | Ga0070673_1003186461 | 319 |
| 348 | 3300005367 | Ga0070667_100022899 | Ga0070667_1000228992 | 319 |
| 349 | 3300005434 | Ga0070709_10001162 | Ga0070709_100011625 | 319 |
| 350 | 3300005434 | Ga0070709_10009577 | Ga0070709_100095772 | 319 |
| 351 | 3300005434 | Ga0070709_10018121 | Ga0070709_100181212 | 319 |
| 352 | 3300005435 | Ga0070714_100066117 | Ga0070714_1000661172 | 319 |
| 353 | 3300005436 | Ga0070713_100001852 | Ga0070713_10000185210 | 319 |
| 354 | 3300005436 | Ga0070713_100002307 | Ga0070713_1000023073 | 319 |
| 355 | 3300005439 | Ga0070711_100030637 | Ga0070711_1000306372 | 319 |
| 356 | 3300005444 | Ga0070694_100160578 | Ga0070694_1001605781 | 319 |
| 357 | 3300005458 | Ga0070681_10001282 | Ga0070681_100012826 | 319 |
| 358 | 3300005459 | Ga0068867_100024565 | Ga0068867_1000245654 | 319 |
| 359 | 3300005459 | Ga0068867_100115803 | Ga0068867_1001158032 | 319 |
| 360 | 3300005467 | Ga0070706_100132967 | Ga0070706_1001329672 | 319 |
| 361 | 3300005468 | Ga0070707_100101946 | Ga0070707_1001019462 | 319 |
| 362 | 3300005518 | Ga0070699_100252862 | Ga0070699_1002528622 | 319 |
| 363 | 3300005530 | Ga0070679_100045647 | Ga0070679_1000456472 | 319 |
| 364 | 3300005535 | Ga0070684_100052651 | Ga0070684_1000526514 | 319 |
| 365 | 3300005543 | Ga0070672_100006442 | Ga0070672_1000064425 | 319 |
| 366 | 3300005545 | Ga0070695_100200851 | Ga0070695_1002008512 | 319 |
| 367 | 3300005548 | Ga0070665_100020037 | Ga0070665_1000200376 | 319 |
| 368 | 3300005548 | Ga0070665_100057610 | Ga0070665_1000576102 | 319 |
| 369 | 3300005563 | Ga0068855_100000234 | Ga0068855_10000023426 | 319 |
| 370 | 3300005577 | Ga0068857_100004869 | Ga0068857_1000048694 | 319 |
| 371 | 3300005578 | Ga0068854_100132868 | Ga0068854_1001328682 | 319 |
| 372 | 3300005614 | Ga0068856_100000062 | Ga0068856_10000006214 | 319 |
| 373 | 3300005616 | Ga0068852_100016336 | Ga0068852_1000163364 | 319 |
| 374 | 3300005617 | Ga0068859_100099523 | Ga0068859_1000995232 | 319 |
| 375 | 3300005617 | Ga0068859_100108684 | Ga0068859_1001086842 | 319 |
| 376 | 3300005617 | Ga0068859_100398182 | Ga0068859_1003981822 | 319 |
| 377 | 3300005841 | Ga0068863_100093972 | Ga0068863_1000939722 | 319 |
| 378 | 3300005842 | Ga0068858_100014019 | Ga0068858_1000140192 | 319 |
| 379 | 3300005843 | Ga0068860_100019110 | Ga0068860_1000191106 | 319 |
| 380 | 3300005843 | Ga0068860_100285538 | Ga0068860_1002855381 | 319 |
| 381 | 3300005844 | Ga0068862_100260522 | Ga0068862_1002605222 | 319 |
| 382 | 3300005844 | Ga0068862_100266667 | Ga0068862_1002666672 | 319 |
| 383 | 3300005985 | Ga0081539_10002905 | Ga0081539_100029057 | 319 |
| 384 | 3300006175 | Ga0070712_100001119 | Ga0070712_10000111913 | 319 |
| 385 | 3300006175 | Ga0070712_100028949 | Ga0070712_1000289492 | 319 |
| 386 | 3300006237 | Ga0097621_100000148 | Ga0097621_1000001482 | 319 |
| 387 | 3300006237 | Ga0097621_100003128 | Ga0097621_1000031283 | 319 |
| 388 | 3300006358 | Ga0068871_100030112 | Ga0068871_1000301123 | 319 |
| 389 | 3300006358 | Ga0068871_100166657 | Ga0068871_1001666572 | 319 |
| 390 | 3300006844 | Ga0075428_100005232 | Ga0075428_10000523213 | 319 |
| 391 | 3300006844 | Ga0075428_100111343 | Ga0075428_1001113435 | 319 |
| 392 | 3300006844 | Ga0075428_100246604 | Ga0075428_1002466042 | 319 |
| 393 | 3300006846 | Ga0075430_100002229 | Ga0075430_10000222913 | 319 |
| 394 | 3300006846 | Ga0075430_100271501 | Ga0075430_1002715012 | 319 |
| 395 | 3300006847 | Ga0075431_100000151 | Ga0075431_10000015126 | 319 |
| 396 | 3300006852 | Ga0075433_10064114 | Ga0075433_100641142 | 319 |
| 397 | 3300006871 | Ga0075434_100165708 | Ga0075434_1001657082 | 319 |
| 398 | 3300006880 | Ga0075429_100001317 | Ga0075429_1000013176 | 319 |
| 399 | 3300006880 | Ga0075429_100293880 | Ga0075429_1002938802 | 319 |
| 400 | 3300006881 | Ga0068865_100002043 | Ga0068865_1000020438 | 319 |
| 401 | 3300006881 | Ga0068865_100075093 | Ga0068865_1000750933 | 319 |
| 402 | 3300006881 | Ga0068865_100301566 | Ga0068865_1003015662 | 319 |
| 403 | 3300006931 | Ga0097620_100099524 | Ga0097620_1000995242 | 319 |
| 404 | 3300006931 | Ga0097620_100108683 | Ga0097620_1001086832 | 319 |
| 405 | 3300006931 | Ga0097620_100398149 | Ga0097620_1003981492 | 319 |
| 406 | 3300009093 | Ga0105240_10014149 | Ga0105240_100141492 | 319 |
| 407 | 3300009093 | Ga0105240_10095577 | Ga0105240_100955772 | 319 |
| 408 | 3300009093 | Ga0105240_10425824 | Ga0105240_104258242 | 319 |
| 409 | 3300009094 | Ga0111539_10106234 | Ga0111539_101062342 | 319 |
| 410 | 3300009148 | Ga0105243_10073335 | Ga0105243_100733353 | 319 |
| 411 | 3300009174 | Ga0105241_10109271 | Ga0105241_101092712 | 319 |
| 412 | 3300009174 | Ga0105241_10159802 | Ga0105241_101598022 | 319 |
| 413 | 3300009176 | Ga0105242_10024634 | Ga0105242_100246342 | 319 |
| 414 | 3300009177 | Ga0105248_10007399 | Ga0105248_1000739912 | 319 |
| 415 | 3300009177 | Ga0105248_10109692 | Ga0105248_101096922 | 319 |
| 416 | 3300009177 | Ga0105248_10674830 | Ga0105248_106748301 | 319 |
| 417 | 3300009545 | Ga0105237_10017405 | Ga0105237_100174052 | 319 |
| 418 | 3300009551 | Ga0105238_10000609 | Ga0105238_1000060917 | 319 |
| 419 | 3300009551 | Ga0105238_10004737 | Ga0105238_100047373 | 319 |
| 420 | 3300010159 | Ga0099796_10036617 | Ga0099796_100366172 | 319 |
| 421 | 3300010375 | Ga0105239_10039316 | Ga0105239_100393165 | 319 |
| 422 | 3300010375 | Ga0105239_10076765 | Ga0105239_100767652 | 319 |
| 423 | 3300010375 | Ga0105239_10198827 | Ga0105239_101988272 | 319 |
| 424 | 3300010375 | Ga0105239_10211951 | Ga0105239_102119513 | 319 |
| 425 | 3300010375 | Ga0105239_10274232 | Ga0105239_102742322 | 319 |
| 426 | 3300013105 | Ga0157369_10000159 | Ga0157369_1000015960 | 319 |
| 427 | 3300013296 | Ga0157374_10000338 | Ga0157374_1000033816 | 319 |
| 428 | 3300013296 | Ga0157374_10139114 | Ga0157374_101391142 | 319 |
| 429 | 3300013297 | Ga0157378_10005749 | Ga0157378_100057498 | 319 |
| 430 | 3300013297 | Ga0157378_10055952 | Ga0157378_100559522 | 319 |
| 431 | 3300013306 | Ga0163162_10228965 | Ga0163162_102289652 | 319 |
| 432 | 3300013306 | Ga0163162_10650297 | Ga0163162_106502971 | 319 |
| 433 | 3300013307 | Ga0157372_10003611 | Ga0157372_1000361116 | 319 |
| 434 | 3300013308 | Ga0157375_10132829 | Ga0157375_101328292 | 319 |
| 435 | 3300013308 | Ga0157375_10439648 | Ga0157375_104396482 | 319 |
| 436 | 3300014325 | Ga0163163_10001395 | Ga0163163_100013952 | 319 |
| 437 | 3300014325 | Ga0163163_10158191 | Ga0163163_101581912 | 319 |
| 438 | 3300014968 | Ga0157379_10009128 | Ga0157379_100091286 | 319 |
| 439 | 3300014969 | Ga0157376_10007509 | Ga0157376_100075099 | 319 |
| 440 | 3300014969 | Ga0157376_10038471 | Ga0157376_100384712 | 319 |
| 441 | 3300025893 | Ga0207682_10007428 | Ga0207682_100074282 | 319 |
| 442 | 3300025904 | Ga0207647_10016923 | Ga0207647_100169232 | 319 |
| 443 | 3300025906 | Ga0207699_10008849 | Ga0207699_100088493 | 319 |
| 444 | 3300025907 | Ga0207645_10163194 | Ga0207645_101631942 | 319 |
| 445 | 3300025907 | Ga0207645_10233247 | Ga0207645_102332471 | 319 |
| 446 | 3300025911 | Ga0207654_10011627 | Ga0207654_100116273 | 319 |
| 447 | 3300025912 | Ga0207707_10001452 | Ga0207707_1000145218 | 319 |
| 448 | 3300025913 | Ga0207695_10089433 | Ga0207695_100894333 | 319 |
| 449 | 3300025915 | Ga0207693_10002431 | Ga0207693_100024316 | 319 |
| 450 | 3300025915 | Ga0207693_10026238 | Ga0207693_100262384 | 319 |
| 451 | 3300025915 | Ga0207693_10315284 | Ga0207693_103152842 | 319 |
| 452 | 3300025921 | Ga0207652_10023725 | Ga0207652_100237255 | 319 |
| 453 | 3300025924 | Ga0207694_10003298 | Ga0207694_100032986 | 319 |
| 454 | 3300025924 | Ga0207694_10004655 | Ga0207694_100046557 | 319 |
| 455 | 3300025924 | Ga0207694_10005997 | Ga0207694_100059972 | 319 |
| 456 | 3300025926 | Ga0207659_10432750 | Ga0207659_104327501 | 319 |
| 457 | 3300025927 | Ga0207687_10030526 | Ga0207687_100305262 | 319 |
| 458 | 3300025927 | Ga0207687_10045413 | Ga0207687_100454132 | 319 |
| 459 | 3300025928 | Ga0207700_10006279 | Ga0207700_100062794 | 319 |
| 460 | 3300025931 | Ga0207644_10067598 | Ga0207644_100675983 | 319 |
| 461 | 3300025933 | Ga0207706_10047199 | Ga0207706_100471992 | 319 |
| 462 | 3300025934 | Ga0207686_10162839 | Ga0207686_101628392 | 319 |
| 463 | 3300025938 | Ga0207704_10007997 | Ga0207704_100079971 | 319 |
| 464 | 3300025938 | Ga0207704_10012937 | Ga0207704_100129374 | 319 |
| 465 | 3300025938 | Ga0207704_10174037 | Ga0207704_101740371 | 319 |
| 466 | 3300025939 | Ga0207665_10047783 | Ga0207665_100477832 | 319 |
| 467 | 3300025940 | Ga0207691_10019785 | Ga0207691_100197855 | 319 |
| 468 | 3300025941 | Ga0207711_10038043 | Ga0207711_100380432 | 319 |
| 469 | 3300025941 | Ga0207711_10115070 | Ga0207711_101150701 | 319 |
| 470 | 3300025942 | Ga0207689_10003694 | Ga0207689_100036944 | 319 |
| 471 | 3300025944 | Ga0207661_10040859 | Ga0207661_100408592 | 319 |
| 472 | 3300025949 | Ga0207667_10000465 | Ga0207667_1000046520 | 319 |
| 473 | 3300025986 | Ga0207658_10021006 | Ga0207658_100210062 | 319 |
| 474 | 3300025986 | Ga0207658_10054958 | Ga0207658_100549583 | 319 |
| 475 | 3300026023 | Ga0207677_10022255 | Ga0207677_100222553 | 319 |
| 476 | 3300026035 | Ga0207703_10122731 | Ga0207703_101227311 | 319 |
| 477 | 3300026041 | Ga0207639_10040615 | Ga0207639_100406152 | 319 |
| 478 | 3300026041 | Ga0207639_10426691 | Ga0207639_104266911 | 319 |
| 479 | 3300026078 | Ga0207702_10001096 | Ga0207702_100010967 | 319 |
| 480 | 3300026078 | Ga0207702_10062555 | Ga0207702_100625552 | 319 |
| 481 | 3300026088 | Ga0207641_10062885 | Ga0207641_100628853 | 319 |
| 482 | 3300026088 | Ga0207641_10133099 | Ga0207641_101330992 | 319 |
| 483 | 3300026088 | Ga0207641_10145416 | Ga0207641_101454162 | 319 |
| 484 | 3300026089 | Ga0207648_10066006 | Ga0207648_100660062 | 319 |
| 485 | 3300026089 | Ga0207648_10091877 | Ga0207648_100918773 | 319 |
| 486 | 3300026095 | Ga0207676_10215505 | Ga0207676_102155052 | 319 |
| 487 | 3300026116 | Ga0207674_10005293 | Ga0207674_100052933 | 319 |
| 488 | 3300026116 | Ga0207674_10007441 | Ga0207674_100074419 | 319 |
| 489 | 3300026116 | Ga0207674_10077447 | Ga0207674_100774472 | 319 |
| 490 | 3300026116 | Ga0207674_10103444 | Ga0207674_101034442 | 319 |
| 491 | 3300026118 | Ga0207675_100087096 | Ga0207675_1000870962 | 319 |
| 492 | 3300026121 | Ga0207683_10263742 | Ga0207683_102637422 | 319 |
| 493 | 3300027671 | Ga0209588_1025839 | Ga0209588_10258392 | 319 |
| 494 | 3300027907 | Ga0207428_10025198 | Ga0207428_100251982 | 319 |
| 495 | 3300028379 | Ga0268266_10010487 | Ga0268266_100104874 | 319 |
| 496 | 3300028380 | Ga0268265_10215261 | Ga0268265_102152612 | 319 |
| 497 | 3300028380 | Ga0268265_10219611 | Ga0268265_102196112 | 319 |
| 498 | 3300028380 | Ga0268265_10255832 | Ga0268265_102558322 | 319 |
| 499 | 3300028381 | Ga0268264_10014069 | Ga0268264_100140696 | 319 |
| 500 | 3300028381 | Ga0268264_10209600 | Ga0268264_102096002 | 319 |
| 501 | 3300028563 | Ga0265319_1008171 | Ga0265319_10081712 | 319 |
| 502 | 3300028577 | Ga0265318_10001629 | Ga0265318_100016296 | 319 |
| 503 | 3300031241 | Ga0265325_10067854 | Ga0265325_100678542 | 319 |
| 504 | 3300031242 | Ga0265329_10003450 | Ga0265329_100034505 | 319 |
| 505 | 3300031247 | Ga0265340_10005071 | Ga0265340_100050714 | 319 |
| 506 | 3300031249 | Ga0265339_10005514 | Ga0265339_100055142 | 319 |
| 507 | 3300031250 | Ga0265331_10000094 | Ga0265331_1000009419 | 319 |
| 508 | 3300031344 | Ga0265316_10012133 | Ga0265316_100121334 | 319 |
| 509 | 3300031344 | Ga0265316_10019254 | Ga0265316_100192542 | 319 |
| 510 | 3300031548 | Ga0307408_100036619 | Ga0307408_1000366192 | 319 |
| 511 | 3300031711 | Ga0265314_10015181 | Ga0265314_100151813 | 319 |
| 512 | 3300031711 | Ga0265314_10022657 | Ga0265314_100226572 | 319 |
| 513 | 3300031712 | Ga0265342_10002054 | Ga0265342_100020545 | 319 |
| 514 | 3300032002 | Ga0307416_100087246 | Ga0307416_1000872462 | 319 |
| 515 | 3300035691 | Ga0373931_0091344 | Ga0373931_0091344_449_1462 | 319 |
| 516 | 3300037068 | Ga0373925_0063162 | Ga0373925_0063162_223_1236 | 319 |
| 517 | 3300037068 | Ga0373925_0177721 | Ga0373925_0177721_466_1479 | 319 |
| 518 | 3300042156 | Ga0439446_0002000 | Ga0439446_0002000_651_1670 | 319 |
| 519 | 3300042461 | Ga0439460_0026167 | Ga0439460_0026167_92_1108 | 319 |
| 520 | 3300045051 | Ga0451576_0039470 | Ga0451576_0039470_2333_3346 | 319 |
| 521 | 3300045976 | Ga0466967_0431028 | Ga0466967_0431028_125_1138 | 319 |
| 522 | 3300046472 | Ga0495580_0032582 | Ga0495580_0032582_550_1563 | 319 |
| 523 | 3300046683 | Ga0495658_0019092 | Ga0495658_0019092_927_1940 | 319 |
| 524 | 3300048905 | Ga0496102_0050682 | Ga0496102_0050682_1489_2505 | 319 |
| 525 | 3300048915 | Ga0496112_0001729 | Ga0496112_0001729_10873_11889 | 319 |
| 526 | 3300048915 | Ga0496112_0001787 | Ga0496112_0001787_15400_16413 | 319 |
| 527 | 3300049580 | Ga0501046_0298384 | Ga0501046_0298384_144_1157 | 319 |
| 528 | 3300049590 | Ga0501074_0148729 | Ga0501074_0148729_565_1578 | 319 |
| 529 | 3300049591 | Ga0501075_0174401 | Ga0501075_0174401_616_1629 | 319 |
| 530 | 3300049743 | Ga0501081_0286599 | Ga0501081_0286599_121_1134 | 319 |
| 531 | 3300050508 | nmdc:mga09592_783_c1 | nmdc:mga09592_783_c1_17399_18412 | 319 |
| 532 | 3300050509 | nmdc:mga0qj67_304852_c1 | nmdc:mga0qj67_304852_c1_122_1138 | 319 |
| 533 | 3300050510 | nmdc:mga06r32_8100_c1 | nmdc:mga06r32_8100_c1_5617_6630 | 319 |
| 534 | 3300050512 | nmdc:mga0n895_185826_c1 | nmdc:mga0n895_185826_c1_510_1523 | 319 |
| 535 | 3300050513 | nmdc:mga0rr50_18049_c1 | nmdc:mga0rr50_18049_c1_927_1940 | 319 |
| 536 | 3300002459 | JGI24751J29686_10012497 | JGI24751J29686_100124971 | 320 |
| 537 | 3300005331 | Ga0070670_100157523 | Ga0070670_1001575232 | 320 |
| 538 | 3300005334 | Ga0068869_100061516 | Ga0068869_1000615162 | 320 |
| 539 | 3300005336 | Ga0070680_100067149 | Ga0070680_1000671492 | 320 |
| 540 | 3300005337 | Ga0070682_100024660 | Ga0070682_1000246604 | 320 |
| 541 | 3300005339 | Ga0070660_100113116 | Ga0070660_1001131163 | 320 |
| 542 | 3300005340 | Ga0070689_100189499 | Ga0070689_1001894991 | 320 |
| 543 | 3300005347 | Ga0070668_100065785 | Ga0070668_1000657852 | 320 |
| 544 | 3300005353 | Ga0070669_100032776 | Ga0070669_1000327762 | 320 |
| 545 | 3300005367 | Ga0070667_100086958 | Ga0070667_1000869582 | 320 |
| 546 | 3300005435 | Ga0070714_100194810 | Ga0070714_1001948101 | 320 |
| 547 | 3300005436 | Ga0070713_100000476 | Ga0070713_10000047610 | 320 |
| 548 | 3300005436 | Ga0070713_100014557 | Ga0070713_1000145572 | 320 |
| 549 | 3300005436 | Ga0070713_100056670 | Ga0070713_1000566702 | 320 |
| 550 | 3300005439 | Ga0070711_100000281 | Ga0070711_1000002816 | 320 |
| 551 | 3300005439 | Ga0070711_100001229 | Ga0070711_10000122910 | 320 |
| 552 | 3300005439 | Ga0070711_100005753 | Ga0070711_1000057532 | 320 |
| 553 | 3300005439 | Ga0070711_100020727 | Ga0070711_1000207272 | 320 |
| 554 | 3300005439 | Ga0070711_100033648 | Ga0070711_1000336482 | 320 |
| 555 | 3300005439 | Ga0070711_100035103 | Ga0070711_1000351032 | 320 |
| 556 | 3300005444 | Ga0070694_100071059 | Ga0070694_1000710592 | 320 |
| 557 | 3300005445 | Ga0070708_100003651 | Ga0070708_1000036514 | 320 |
| 558 | 3300005445 | Ga0070708_100006273 | Ga0070708_1000062738 | 320 |
| 559 | 3300005445 | Ga0070708_100066556 | Ga0070708_1000665562 | 320 |
| 560 | 3300005445 | Ga0070708_100107291 | Ga0070708_1001072913 | 320 |
| 561 | 3300005445 | Ga0070708_100340903 | Ga0070708_1003409031 | 320 |
| 562 | 3300005456 | Ga0070678_100114027 | Ga0070678_1001140272 | 320 |
| 563 | 3300005457 | Ga0070662_100169068 | Ga0070662_1001690682 | 320 |
| 564 | 3300005459 | Ga0068867_100060541 | Ga0068867_1000605412 | 320 |
| 565 | 3300005459 | Ga0068867_100150388 | Ga0068867_1001503882 | 320 |
| 566 | 3300005466 | Ga0070685_10050585 | Ga0070685_100505852 | 320 |
| 567 | 3300005466 | Ga0070685_10213936 | Ga0070685_102139362 | 320 |
| 568 | 3300005467 | Ga0070706_100000336 | Ga0070706_10000033621 | 320 |
| 569 | 3300005467 | Ga0070706_100002094 | Ga0070706_1000020946 | 320 |
| 570 | 3300005467 | Ga0070706_100011620 | Ga0070706_1000116204 | 320 |
| 571 | 3300005467 | Ga0070706_100167294 | Ga0070706_1001672942 | 320 |
| 572 | 3300005468 | Ga0070707_100019771 | Ga0070707_1000197713 | 320 |
| 573 | 3300005468 | Ga0070707_100021052 | Ga0070707_1000210522 | 320 |
| 574 | 3300005471 | Ga0070698_100005969 | Ga0070698_10000596911 | 320 |
| 575 | 3300005471 | Ga0070698_100283312 | Ga0070698_1002833122 | 320 |
| 576 | 3300005518 | Ga0070699_100005358 | Ga0070699_1000053582 | 320 |
| 577 | 3300005518 | Ga0070699_100007587 | Ga0070699_1000075872 | 320 |
| 578 | 3300005518 | Ga0070699_100104193 | Ga0070699_1001041932 | 320 |
| 579 | 3300005530 | Ga0070679_100120107 | Ga0070679_1001201071 | 320 |
| 580 | 3300005536 | Ga0070697_100002395 | Ga0070697_1000023955 | 320 |
| 581 | 3300005536 | Ga0070697_100014445 | Ga0070697_1000144452 | 320 |
| 582 | 3300005536 | Ga0070697_100016125 | Ga0070697_1000161257 | 320 |
| 583 | 3300005536 | Ga0070697_100236378 | Ga0070697_1002363781 | 320 |
| 584 | 3300005543 | Ga0070672_100264764 | Ga0070672_1002647641 | 320 |
| 585 | 3300005544 | Ga0070686_100026496 | Ga0070686_1000264962 | 320 |
| 586 | 3300005546 | Ga0070696_100023209 | Ga0070696_1000232092 | 320 |
| 587 | 3300005546 | Ga0070696_100175522 | Ga0070696_1001755222 | 320 |
| 588 | 3300005546 | Ga0070696_100247543 | Ga0070696_1002475432 | 320 |
| 589 | 3300005548 | Ga0070665_100013516 | Ga0070665_1000135169 | 320 |
| 590 | 3300005548 | Ga0070665_100029410 | Ga0070665_1000294106 | 320 |
| 591 | 3300005549 | Ga0070704_100218752 | Ga0070704_1002187521 | 320 |
| 592 | 3300005563 | Ga0068855_100502373 | Ga0068855_1005023732 | 320 |
| 593 | 3300005614 | Ga0068856_100041098 | Ga0068856_1000410984 | 320 |
| 594 | 3300005616 | Ga0068852_100052877 | Ga0068852_1000528773 | 320 |
| 595 | 3300005617 | Ga0068859_100053692 | Ga0068859_1000536922 | 320 |
| 596 | 3300005617 | Ga0068859_100123873 | Ga0068859_1001238732 | 320 |
| 597 | 3300005618 | Ga0068864_100233499 | Ga0068864_1002334992 | 320 |
| 598 | 3300005618 | Ga0068864_100257683 | Ga0068864_1002576832 | 320 |
| 599 | 3300005718 | Ga0068866_10041164 | Ga0068866_100411642 | 320 |
| 600 | 3300005840 | Ga0068870_10074661 | Ga0068870_100746612 | 320 |
| 601 | 3300005840 | Ga0068870_10117086 | Ga0068870_101170862 | 320 |
| 602 | 3300005841 | Ga0068863_100035781 | Ga0068863_1000357813 | 320 |
| 603 | 3300005841 | Ga0068863_100126468 | Ga0068863_1001264682 | 320 |
| 604 | 3300005841 | Ga0068863_100337148 | Ga0068863_1003371482 | 320 |
| 605 | 3300005842 | Ga0068858_100267454 | Ga0068858_1002674542 | 320 |
| 606 | 3300005843 | Ga0068860_100075164 | Ga0068860_1000751643 | 320 |
| 607 | 3300005843 | Ga0068860_100462530 | Ga0068860_1004625301 | 320 |
| 608 | 3300005844 | Ga0068862_100056072 | Ga0068862_1000560722 | 320 |
| 609 | 3300005981 | Ga0081538_10004787 | Ga0081538_100047877 | 320 |
| 610 | 3300005985 | Ga0081539_10012728 | Ga0081539_100127282 | 320 |
| 611 | 3300006028 | Ga0070717_10032853 | Ga0070717_100328532 | 320 |
| 612 | 3300006028 | Ga0070717_10038453 | Ga0070717_100384533 | 320 |
| 613 | 3300006163 | Ga0070715_10000763 | Ga0070715_100007632 | 320 |
| 614 | 3300006173 | Ga0070716_100010159 | Ga0070716_1000101592 | 320 |
| 615 | 3300006173 | Ga0070716_100052109 | Ga0070716_1000521091 | 320 |
| 616 | 3300006175 | Ga0070712_100000468 | Ga0070712_10000046818 | 320 |
| 617 | 3300006175 | Ga0070712_100002849 | Ga0070712_1000028494 | 320 |
| 618 | 3300006175 | Ga0070712_100003144 | Ga0070712_1000031442 | 320 |
| 619 | 3300006175 | Ga0070712_100008180 | Ga0070712_1000081803 | 320 |
| 620 | 3300006175 | Ga0070712_100008773 | Ga0070712_1000087738 | 320 |
| 621 | 3300006237 | Ga0097621_100004631 | Ga0097621_1000046316 | 320 |
| 622 | 3300006237 | Ga0097621_100046515 | Ga0097621_1000465154 | 320 |
| 623 | 3300006358 | Ga0068871_100013790 | Ga0068871_1000137904 | 320 |
| 624 | 3300006358 | Ga0068871_100138845 | Ga0068871_1001388452 | 320 |
| 625 | 3300006358 | Ga0068871_100268950 | Ga0068871_1002689501 | 320 |
| 626 | 3300006844 | Ga0075428_100130891 | Ga0075428_1001308912 | 320 |
| 627 | 3300006846 | Ga0075430_100221445 | Ga0075430_1002214451 | 320 |
| 628 | 3300006871 | Ga0075434_100051841 | Ga0075434_1000518414 | 320 |
| 629 | 3300006871 | Ga0075434_100179894 | Ga0075434_1001798942 | 320 |
| 630 | 3300006881 | Ga0068865_100001782 | Ga0068865_1000017823 | 320 |
| 631 | 3300006914 | Ga0075436_100183262 | Ga0075436_1001832622 | 320 |
| 632 | 3300006931 | Ga0097620_100053692 | Ga0097620_1000536922 | 320 |
| 633 | 3300006931 | Ga0097620_100123888 | Ga0097620_1001238883 | 320 |
| 634 | 3300007076 | Ga0075435_100013494 | Ga0075435_1000134947 | 320 |
| 635 | 3300007076 | Ga0075435_100198789 | Ga0075435_1001987892 | 320 |
| 636 | 3300009093 | Ga0105240_10124643 | Ga0105240_101246432 | 320 |
| 637 | 3300009094 | Ga0111539_10040991 | Ga0111539_100409915 | 320 |
| 638 | 3300009098 | Ga0105245_10380129 | Ga0105245_103801291 | 320 |
| 639 | 3300009147 | Ga0114129_10059432 | Ga0114129_100594325 | 320 |
| 640 | 3300009147 | Ga0114129_10059769 | Ga0114129_100597692 | 320 |
| 641 | 3300009147 | Ga0114129_10136073 | Ga0114129_101360733 | 320 |
| 642 | 3300009174 | Ga0105241_10110955 | Ga0105241_101109552 | 320 |
| 643 | 3300009176 | Ga0105242_10045455 | Ga0105242_100454554 | 320 |
| 644 | 3300009177 | Ga0105248_10067590 | Ga0105248_100675902 | 320 |
| 645 | 3300009177 | Ga0105248_10644322 | Ga0105248_106443222 | 320 |
| 646 | 3300009545 | Ga0105237_10089226 | Ga0105237_100892262 | 320 |
| 647 | 3300013308 | Ga0157375_10199382 | Ga0157375_101993821 | 320 |
| 648 | 3300014745 | Ga0157377_10165501 | Ga0157377_101655012 | 320 |
| 649 | 3300014968 | Ga0157379_10285656 | Ga0157379_102856562 | 320 |
| 650 | 3300014969 | Ga0157376_10034776 | Ga0157376_100347762 | 320 |
| 651 | 3300014969 | Ga0157376_10192467 | Ga0157376_101924671 | 320 |
| 652 | 3300017792 | Ga0163161_10156399 | Ga0163161_101563992 | 320 |
| 653 | 3300022732 | Ga0224569_100615 | Ga0224569_1006155 | 320 |
| 654 | 3300024227 | Ga0228598_1000044 | Ga0228598_10000447 | 320 |
| 655 | 3300024227 | Ga0228598_1000070 | Ga0228598_10000702 | 320 |
| 656 | 3300025321 | Ga0207656_10077074 | Ga0207656_100770742 | 320 |
| 657 | 3300025898 | Ga0207692_10013451 | Ga0207692_100134512 | 320 |
| 658 | 3300025900 | Ga0207710_10034751 | Ga0207710_100347512 | 320 |
| 659 | 3300025904 | Ga0207647_10139048 | Ga0207647_101390482 | 320 |
| 660 | 3300025905 | Ga0207685_10001682 | Ga0207685_100016824 | 320 |
| 661 | 3300025906 | Ga0207699_10047766 | Ga0207699_100477662 | 320 |
| 662 | 3300025907 | Ga0207645_10003579 | Ga0207645_1000357913 | 320 |
| 663 | 3300025910 | Ga0207684_10000320 | Ga0207684_1000032031 | 320 |
| 664 | 3300025910 | Ga0207684_10004878 | Ga0207684_100048784 | 320 |
| 665 | 3300025910 | Ga0207684_10203795 | Ga0207684_102037952 | 320 |
| 666 | 3300025910 | Ga0207684_10398996 | Ga0207684_103989961 | 320 |
| 667 | 3300025911 | Ga0207654_10004482 | Ga0207654_100044822 | 320 |
| 668 | 3300025912 | Ga0207707_10060733 | Ga0207707_100607332 | 320 |
| 669 | 3300025914 | Ga0207671_10157951 | Ga0207671_101579512 | 320 |
| 670 | 3300025915 | Ga0207693_10000008 | Ga0207693_1000000823 | 320 |
| 671 | 3300025915 | Ga0207693_10001167 | Ga0207693_1000116718 | 320 |
| 672 | 3300025915 | Ga0207693_10007049 | Ga0207693_100070492 | 320 |
| 673 | 3300025915 | Ga0207693_10009953 | Ga0207693_100099536 | 320 |
| 674 | 3300025915 | Ga0207693_10015202 | Ga0207693_100152025 | 320 |
| 675 | 3300025916 | Ga0207663_10000111 | Ga0207663_100001113 | 320 |
| 676 | 3300025916 | Ga0207663_10010876 | Ga0207663_100108762 | 320 |
| 677 | 3300025916 | Ga0207663_10019281 | Ga0207663_100192812 | 320 |
| 678 | 3300025916 | Ga0207663_10036341 | Ga0207663_100363412 | 320 |
| 679 | 3300025916 | Ga0207663_10047053 | Ga0207663_100470532 | 320 |
| 680 | 3300025919 | Ga0207657_10002009 | Ga0207657_100020096 | 320 |
| 681 | 3300025921 | Ga0207652_10050957 | Ga0207652_100509572 | 320 |
| 682 | 3300025921 | Ga0207652_10312195 | Ga0207652_103121952 | 320 |
| 683 | 3300025922 | Ga0207646_10073817 | Ga0207646_100738173 | 320 |
| 684 | 3300025922 | Ga0207646_10167024 | Ga0207646_101670242 | 320 |
| 685 | 3300025923 | Ga0207681_10009128 | Ga0207681_100091283 | 320 |
| 686 | 3300025924 | Ga0207694_10036471 | Ga0207694_100364712 | 320 |
| 687 | 3300025927 | Ga0207687_10111801 | Ga0207687_101118011 | 320 |
| 688 | 3300025928 | Ga0207700_10000107 | Ga0207700_1000010718 | 320 |
| 689 | 3300025933 | Ga0207706_10000641 | Ga0207706_1000064119 | 320 |
| 690 | 3300025933 | Ga0207706_10147805 | Ga0207706_101478052 | 320 |
| 691 | 3300025938 | Ga0207704_10019036 | Ga0207704_100190364 | 320 |
| 692 | 3300025939 | Ga0207665_10016930 | Ga0207665_100169302 | 320 |
| 693 | 3300025939 | Ga0207665_10039155 | Ga0207665_100391552 | 320 |
| 694 | 3300025939 | Ga0207665_10072766 | Ga0207665_100727661 | 320 |
| 695 | 3300025940 | Ga0207691_10093246 | Ga0207691_100932461 | 320 |
| 696 | 3300025941 | Ga0207711_10012633 | Ga0207711_100126333 | 320 |
| 697 | 3300025941 | Ga0207711_10018198 | Ga0207711_100181982 | 320 |
| 698 | 3300025945 | Ga0207679_10133818 | Ga0207679_101338182 | 320 |
| 699 | 3300025949 | Ga0207667_10055236 | Ga0207667_100552362 | 320 |
| 700 | 3300025960 | Ga0207651_10224885 | Ga0207651_102248852 | 320 |
| 701 | 3300025972 | Ga0207668_10096727 | Ga0207668_100967272 | 320 |
| 702 | 3300025981 | Ga0207640_10034171 | Ga0207640_100341712 | 320 |
| 703 | 3300025986 | Ga0207658_10070337 | Ga0207658_100703372 | 320 |
| 704 | 3300026023 | Ga0207677_10071854 | Ga0207677_100718542 | 320 |
| 705 | 3300026035 | Ga0207703_10131182 | Ga0207703_101311822 | 320 |
| 706 | 3300026041 | Ga0207639_10278753 | Ga0207639_102787531 | 320 |
| 707 | 3300026067 | Ga0207678_10008144 | Ga0207678_100081445 | 320 |
| 708 | 3300026088 | Ga0207641_10000811 | Ga0207641_1000081123 | 320 |
| 709 | 3300026089 | Ga0207648_10017102 | Ga0207648_100171025 | 320 |
| 710 | 3300026089 | Ga0207648_10039098 | Ga0207648_100390982 | 320 |
| 711 | 3300026089 | Ga0207648_10288232 | Ga0207648_102882321 | 320 |
| 712 | 3300026095 | Ga0207676_10096526 | Ga0207676_100965262 | 320 |
| 713 | 3300026116 | Ga0207674_10614282 | Ga0207674_106142821 | 320 |
| 714 | 3300026121 | Ga0207683_10033950 | Ga0207683_100339504 | 320 |
| 715 | 3300026142 | Ga0207698_10089175 | Ga0207698_100891752 | 320 |
| 716 | 3300026142 | Ga0207698_10528255 | Ga0207698_105282552 | 320 |
| 717 | 3300027671 | Ga0209588_1000001 | Ga0209588_1000001296 | 320 |
| 718 | 3300027907 | Ga0207428_10010140 | Ga0207428_100101404 | 320 |
| 719 | 3300028016 | Ga0265354_1000756 | Ga0265354_10007562 | 320 |
| 720 | 3300028379 | Ga0268266_10030899 | Ga0268266_100308992 | 320 |
| 721 | 3300030760 | Ga0265762_1000130 | Ga0265762_100013012 | 320 |
| 722 | 3300030760 | Ga0265762_1016014 | Ga0265762_10160142 | 320 |
| 723 | 3300030878 | Ga0265770_1000180 | Ga0265770_10001806 | 320 |
| 724 | 3300030879 | Ga0265765_1000179 | Ga0265765_10001792 | 320 |
| 725 | 3300031090 | Ga0265760_10001544 | Ga0265760_100015443 | 320 |
| 726 | 3300031090 | Ga0265760_10011422 | Ga0265760_100114221 | 320 |
| 727 | 3300031241 | Ga0265325_10003325 | Ga0265325_100033252 | 320 |
| 728 | 3300031241 | Ga0265325_10004980 | Ga0265325_100049802 | 320 |
| 729 | 3300031249 | Ga0265339_10033361 | Ga0265339_100333612 | 320 |
| 730 | 3300031250 | Ga0265331_10012844 | Ga0265331_100128447 | 320 |
| 731 | 3300031250 | Ga0265331_10067347 | Ga0265331_100673472 | 320 |
| 732 | 3300031344 | Ga0265316_10005655 | Ga0265316_100056554 | 320 |
| 733 | 3300031344 | Ga0265316_10006792 | Ga0265316_1000679210 | 320 |
| 734 | 3300031344 | Ga0265316_10014330 | Ga0265316_100143305 | 320 |
| 735 | 3300031595 | Ga0265313_10003181 | Ga0265313_1000318111 | 320 |
| 736 | 3300031711 | Ga0265314_10000509 | Ga0265314_1000050910 | 320 |
| 737 | 3300031711 | Ga0265314_10033167 | Ga0265314_100331672 | 320 |
| 738 | 3300034820 | Ga0373959_0022988 | Ga0373959_0022988_167_1183 | 320 |
| 739 | 3300035091 | Ga0373951_0041672 | Ga0373951_0041672_67_1083 | 320 |
| 740 | 3300035112 | Ga0373932_0064742 | Ga0373932_0064742_74_1090 | 320 |
| 741 | 3300035691 | Ga0373931_0048317 | Ga0373931_0048317_245_1261 | 320 |
| 742 | 3300035724 | Ga0373933_0126705 | Ga0373933_0126705_249_1265 | 320 |
| 743 | 3300035725 | Ga0373947_0126295 | Ga0373947_0126295_256_1272 | 320 |
| 744 | 3300036401 | Ga0373937_0046916 | Ga0373937_0046916_1699_2715 | 320 |
| 745 | 3300037068 | Ga0373925_0244813 | Ga0373925_0244813_10_1029 | 320 |
| 746 | 3300037853 | Ga0436364_0703870 | Ga0436364_0703870_1342_2358 | 320 |
| 747 | 3300039437 | Ga0436365_1220175 | Ga0436365_1220175_904_1920 | 320 |
| 748 | 3300046455 | Ga0495603_0069122 | Ga0495603_0069122_540_1556 | 320 |
| 749 | 3300046472 | Ga0495580_0018437 | Ga0495580_0018437_803_1819 | 320 |
| 750 | 3300046472 | Ga0495580_0019663 | Ga0495580_0019663_3148_4164 | 320 |
| 751 | 3300046477 | Ga0495664_0099347 | Ga0495664_0099347_96_1112 | 320 |
| 752 | 3300046543 | Ga0495645_0030542 | Ga0495645_0030542_1519_2535 | 320 |
| 753 | 3300046683 | Ga0495658_0052459 | Ga0495658_0052459_88_1104 | 320 |
| 754 | 3300047319 | Ga0495674_0058171 | Ga0495674_0058171_46_1062 | 320 |
| 755 | 3300048907 | Ga0496104_0011300 | Ga0496104_0011300_5619_6635 | 320 |
| 756 | 3300048911 | Ga0496108_0161805 | Ga0496108_0161805_594_1610 | 320 |
| 757 | 3300048912 | Ga0496109_0465400 | Ga0496109_0465400_167_1183 | 320 |
| 758 | 3300048915 | Ga0496112_0119703 | Ga0496112_0119703_804_1820 | 320 |
| 759 | 3300048915 | Ga0496112_0196180 | Ga0496112_0196180_353_1369 | 320 |
| 760 | 3300048917 | Ga0496114_0062970 | Ga0496114_0062970_1477_2493 | 320 |
| 761 | 3300050507 | nmdc:mga05p37_171860_c1 | nmdc:mga05p37_171860_c1_62_1078 | 320 |
| 762 | 3300050507 | nmdc:mga05p37_276667_c1 | nmdc:mga05p37_276667_c1_809_1837 | 320 |
| 763 | 3300050507 | nmdc:mga05p37_48416_c1 | nmdc:mga05p37_48416_c1_58_1074 | 320 |
| 764 | 3300050507 | nmdc:mga05p37_50333_c1 | nmdc:mga05p37_50333_c1_1860_2876 | 320 |
| 765 | 3300050507 | nmdc:mga05p37_59198_c1 | nmdc:mga05p37_59198_c1_3252_4268 | 320 |
| 766 | 3300050507 | nmdc:mga05p37_59730_c1 | nmdc:mga05p37_59730_c1_3461_4477 | 320 |
| 767 | 3300050507 | nmdc:mga05p37_64498_c1 | nmdc:mga05p37_64498_c1_1767_2783 | 320 |
| 768 | 3300050507 | nmdc:mga05p37_95864_c1 | nmdc:mga05p37_95864_c1_810_1826 | 320 |
| 769 | 3300050508 | nmdc:mga09592_268085_c1 | nmdc:mga09592_268085_c1_444_1460 | 320 |
| 770 | 3300050512 | nmdc:mga0n895_13298_c1 | nmdc:mga0n895_13298_c1_6343_7359 | 320 |
| 771 | 3300050512 | nmdc:mga0n895_590810_c1 | nmdc:mga0n895_590810_c1_38_1054 | 320 |
| 772 | 3300050513 | nmdc:mga0rr50_126767_c1 | nmdc:mga0rr50_126767_c1_22_1050 | 320 |
| 773 | 3300050513 | nmdc:mga0rr50_65112_c1 | nmdc:mga0rr50_65112_c1_845_1861 | 320 |
| 774 | 3300050515 | nmdc:mga0a205_113598_c1 | nmdc:mga0a205_113598_c1_116_1132 | 320 |
| 775 | 3300053077 | Ga0495601_0113111 | Ga0495601_0113111_105_1121 | 320 |
| 776 | 3300053085 | Ga0495619_0061392 | Ga0495619_0061392_1337_2353 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5y6q-assembly1.cif.gz_B | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.8602 | 8 | 316 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.8388 | 7 | 312 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.8358 | 7 | 312 |
| 1n5w-assembly1.cif.gz_C | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.8316 | 7 | 312 |
| 4zoh-assembly1.cif.gz_B-2 | crystal structure of glyceraldehyde oxidoreductase | 0.8299 | 8 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zohB01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9127 | 8 | 59 | 3.30.43.10 |
| 1ffuF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9075 | 7 | 59 | 3.30.43.10 |
| 1ffuF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.8776 | 7 | 59 | 3.30.43.10 |
| 5y6qB02 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain | 0.8717 | 214 | 316 | 3.30.390.50 |
| 1t3qF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.8715 | 7 | 62 | 3.30.43.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2WE62-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9648 | 168 | 312 |
|
| AF-A0A3D5P1S2-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9562 | 216 | 311 |
|
| AF-A0A3D2WE62-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9519 | 168 | 312 |
|
| AF-A0A848VEX5-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9504 | 206 | 311 |
|
| AF-A0A7C3Z882-F1-model_v4 | FAD-dependent oxidoreductase | 0.944 | 153 | 310 |
GO:0016491
GO:0051536 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar