F480298

General Info

Members Datasets Scaffolds Average Seq Length
776 347 1552 185

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10304404|Ga0081455_103044042
Length 208
Sequence VPALLGLMHMLREKRVALGHIGGGLALLGSLMFMLFWGASLMEWQMVRGSADPVQMAALLDRIRVDYYGQETPLNQLSTINVPEARLLTIQPYDPSSIKSIERALQESDLGLTPSNDGKLIRLPIPQLTEERREELVKVVRHRAEEGRVAVRNVRRDCIHHLKELVRDGEVGDDEERRAEEQTQKLTDNHIAKIDEILKRKEAEILEV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
83 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 13.14
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10304404 3300005937 Bacteria 1142
2 JGI24743J22301_10063257 3300001991 Bacteria 764
3 JGI25406J46586_10034387 3300003203 Bacteria 1861
4 Ga0070658_10343741 3300005327 Bacteria 1276
5 Ga0070683_100003014 3300005329 Bacteria 13523
6 Ga0070683_100726188 3300005329 Bacteria 951
7 Ga0070670_100526919 3300005331 Bacteria 1052
8 Ga0070670_101335444 3300005331 Bacteria 657
9 Ga0070682_100008758 3300005337 Bacteria 5710
10 Ga0070682_100084214 3300005337 Bacteria 2066
11 Ga0070682_100708966 3300005337 Bacteria 808
12 Ga0068868_100505137 3300005338 Bacteria 1059
13 Ga0070660_100013030 3300005339 Bacteria 5950
14 Ga0070660_100159312 3300005339 Bacteria 1818
15 Ga0070689_100237632 3300005340 Bacteria 1500
16 Ga0070691_10210417 3300005341 Bacteria 1026
17 Ga0070661_100636543 3300005344 Bacteria 865
18 Ga0070692_10154936 3300005345 Bacteria 1308
19 Ga0070668_100042964 3300005347 Bacteria 3465
20 Ga0070671_100114415 3300005355 Bacteria 2268
21 Ga0070671_100550539 3300005355 Bacteria 995
22 Ga0070673_100566896 3300005364 Bacteria 1033
23 Ga0070673_101441389 3300005364 Bacteria 649
24 Ga0070659_100070513 3300005366 Bacteria 2776
25 Ga0070703_10194467 3300005406 Bacteria 792
26 Ga0070709_10274128 3300005434 Bacteria 1223
27 Ga0070709_10491325 3300005434 Bacteria 931
28 Ga0070714_100023226 3300005435 Bacteria 5091
29 Ga0070714_100548407 3300005435 Bacteria 1107
30 Ga0070713_100085262 3300005436 Bacteria 2705
31 Ga0070713_100116999 3300005436 Bacteria 2332
32 Ga0070713_100510578 3300005436 Bacteria 1135
33 Ga0070713_100937162 3300005436 Bacteria 834
34 Ga0070710_10177447 3300005437 Bacteria 1331
35 Ga0070710_10580525 3300005437 Bacteria 778
36 Ga0070711_100289630 3300005439 Bacteria 1298
37 Ga0070711_100597271 3300005439 Bacteria 920
38 Ga0070705_100044138 3300005440 Bacteria 2559
39 Ga0070708_100010109 3300005445 Bacteria 7636
40 Ga0070663_100049856 3300005455 Bacteria 2975
41 Ga0070663_100257678 3300005455 Bacteria 1383
42 Ga0070678_100089311 3300005456 Bacteria 2358
43 Ga0070678_101246469 3300005456 Bacteria 691
44 Ga0070662_100084293 3300005457 Bacteria 2374
45 Ga0070662_100229295 3300005457 Bacteria 1485
46 Ga0070662_100526942 3300005457 Bacteria 988
47 Ga0070681_10010617 3300005458 Bacteria 9101
48 Ga0070681_10020004 3300005458 Bacteria 6707
49 Ga0070681_10028129 3300005458 Bacteria 5652
50 Ga0070681_10206595 3300005458 Bacteria 1881
51 Ga0070685_10650418 3300005466 Bacteria 764
52 Ga0070706_100492332 3300005467 Bacteria 1141
53 Ga0070706_100771109 3300005467 Bacteria 891
54 Ga0070706_100855698 3300005467 Bacteria 841
55 Ga0070698_100162922 3300005471 Bacteria 2174
56 Ga0070698_100380701 3300005471 Bacteria 1344
57 Ga0070699_100008553 3300005518 Bacteria 8868
58 Ga0070699_100109701 3300005518 Bacteria 2422
59 Ga0070679_100019792 3300005530 Bacteria 6553
60 Ga0070679_100029031 3300005530 Bacteria 5455
61 Ga0070679_100224293 3300005530 Bacteria 1840
62 Ga0070679_100328963 3300005530 Bacteria 1477
63 Ga0070679_100817945 3300005530 Bacteria 875
64 Ga0070684_100004862 3300005535 Bacteria 10270
65 Ga0070684_100066833 3300005535 Bacteria 3156
66 Ga0070684_100172639 3300005535 Bacteria 1964
67 Ga0070684_100632693 3300005535 Bacteria 995
68 Ga0070684_100892624 3300005535 Bacteria 833
69 Ga0068853_100306084 3300005539 Bacteria 1470
70 Ga0070672_100126365 3300005543 Bacteria 2097
71 Ga0070686_100441991 3300005544 Bacteria 998
72 Ga0070693_100003389 3300005547 Bacteria 7419
73 Ga0070693_100229444 3300005547 Bacteria 1221
74 Ga0070665_100428569 3300005548 Bacteria 1331
75 Ga0070665_100894141 3300005548 Bacteria 901
76 Ga0070704_100071852 3300005549 Bacteria 2516
77 Ga0070704_100959250 3300005549 Bacteria 772
78 Ga0068855_100024333 3300005563 Bacteria 7248
79 Ga0068855_100155801 3300005563 Bacteria 2595
80 Ga0068855_100637558 3300005563 Bacteria 1146
81 Ga0070664_100497105 3300005564 Bacteria 1124
82 Ga0068857_100414187 3300005577 Bacteria 1255
83 Ga0068857_101019805 3300005577 Bacteria 797
84 Ga0068856_100162226 3300005614 Bacteria 2246
85 Ga0068856_100343762 3300005614 Bacteria 1510
86 Ga0068856_100574325 3300005614 Bacteria 1149
87 Ga0068856_100697450 3300005614 Bacteria 1035
88 Ga0068856_101627950 3300005614 Bacteria 658
89 Ga0068852_100047629 3300005616 Bacteria 3657
90 Ga0068859_100929429 3300005617 Bacteria 954
91 Ga0068864_100208213 3300005618 Bacteria 1800
92 Ga0068866_10481192 3300005718 Bacteria 818
93 Ga0068861_100001363 3300005719 Bacteria 15367
94 Ga0068870_10277864 3300005840 Bacteria 1049
95 Ga0068863_100765658 3300005841 Bacteria 962
96 Ga0068862_100982179 3300005844 Bacteria 834
97 Ga0068862_101021210 3300005844 Bacteria 819
98 Ga0081455_10099280 3300005937 Bacteria 2342
99 Ga0081539_10001263 3300005985 Bacteria 44753
100 Ga0070717_10101540 3300006028 Bacteria 2443
101 Ga0070717_10104256 3300006028 Bacteria 2412
102 Ga0075365_10266046 3300006038 Bacteria 1206
103 Ga0075432_10021754 3300006058 Bacteria 2192
104 Ga0070715_10047213 3300006163 Bacteria 1834
105 Ga0070716_100012314 3300006173 Bacteria 4332
106 Ga0070712_100409383 3300006175 Bacteria 1122
107 Ga0070712_100828484 3300006175 Bacteria 795
108 Ga0097621_100102787 3300006237 Bacteria 2406
109 Ga0068871_100026340 3300006358 Bacteria 4536
110 Ga0075428_100009035 3300006844 Bacteria 11060
111 Ga0075428_100084482 3300006844 Bacteria 3463
112 Ga0075428_100215700 3300006844 Bacteria 2073
113 Ga0075430_100011120 3300006846 Bacteria 7629
114 Ga0075430_100301449 3300006846 Bacteria 1325
115 Ga0075431_100002708 3300006847 Bacteria 17182
116 Ga0075431_100585624 3300006847 Bacteria 1101
117 Ga0075431_101246092 3300006847 Bacteria 706
118 Ga0075433_10005381 3300006852 Bacteria 10057
119 Ga0075433_10155958 3300006852 Bacteria 2031
120 Ga0075433_10289983 3300006852 Bacteria 1449
121 Ga0075434_100000119 3300006871 Bacteria 45877
122 Ga0075434_100043574 3300006871 Bacteria 4451
123 Ga0075434_100148416 3300006871 Bacteria 2365
124 Ga0075429_100013670 3300006880 Bacteria 7038
125 Ga0075429_100027684 3300006880 Bacteria 4920
126 Ga0075429_100127147 3300006880 Bacteria 2229
127 Ga0075429_100137938 3300006880 Bacteria 2135
128 Ga0097620_100929420 3300006931 Bacteria 954
129 Ga0075435_100013923 3300007076 Bacteria 5998
130 Ga0075435_100019498 3300007076 Bacteria 5183
131 Ga0075435_100058953 3300007076 Bacteria 3111
132 Ga0105240_10031263 3300009093 Bacteria 6906
133 Ga0105240_10209059 3300009093 Bacteria 2282
134 Ga0105240_10241083 3300009093 Bacteria 2096
135 Ga0111539_10315949 3300009094 Bacteria 1818
136 Ga0111539_10357882 3300009094 Bacteria 1699
137 Ga0105245_10991458 3300009098 Bacteria 884
138 Ga0114129_10023134 3300009147 Bacteria 8814
139 Ga0114129_10074244 3300009147 Bacteria 4737
140 Ga0114129_10163685 3300009147 Bacteria 3037
141 Ga0114129_11178583 3300009147 Bacteria 955
142 Ga0114129_11936319 3300009147 Bacteria 714
143 Ga0105243_10220725 3300009148 Bacteria 1675
144 Ga0105243_10321517 3300009148 Bacteria 1410
145 Ga0105243_11003184 3300009148 Bacteria 838
146 Ga0105241_10086381 3300009174 Bacteria 2467
147 Ga0105241_10229031 3300009174 Bacteria 1566
148 Ga0105242_10115337 3300009176 Bacteria 2296
149 Ga0105242_10168618 3300009176 Bacteria 1922
150 Ga0105242_10388453 3300009176 Bacteria 1299
151 Ga0105242_10467465 3300009176 Bacteria 1192
152 Ga0105238_10240837 3300009551 Bacteria 1786
153 Ga0105238_10661389 3300009551 Bacteria 1055
154 Ga0105249_10051441 3300009553 Bacteria 3758
155 Ga0105239_10063495 3300010375 Bacteria 4055
156 Ga0105246_10654402 3300011119 Bacteria 915
157 Ga0157343_1001271 3300012488 Bacteria 1203
158 Ga0157341_1004565 3300012494 Bacteria 1006
159 Ga0157373_10135400 3300013100 Bacteria 1732
160 Ga0157370_10019560 3300013104 Bacteria 6786
161 Ga0157370_10508474 3300013104 Bacteria 1106
162 Ga0157369_10001856 3300013105 Bacteria 25507
163 Ga0157369_10124289 3300013105 Bacteria 2736
164 Ga0157369_11728073 3300013105 Bacteria 636
165 Ga0163162_10039041 3300013306 Bacteria 4740
166 Ga0157372_10059751 3300013307 Bacteria 4265
167 Ga0157372_10597208 3300013307 Bacteria 1287
168 Ga0157372_10767501 3300013307 Bacteria 1121
169 Ga0157372_11582292 3300013307 Bacteria 755
170 Ga0157375_10067646 3300013308 Bacteria 3570
171 Ga0157375_10819227 3300013308 Bacteria 1079
172 Ga0163163_10003631 3300014325 Bacteria 13119
173 Ga0157380_10652129 3300014326 Bacteria 1050
174 Ga0157377_10235083 3300014745 Bacteria 1180
175 Ga0157376_10025932 3300014969 Bacteria 4624
176 Ga0182005_1238906 3300015265 Bacteria 558
177 Ga0163161_10163995 3300017792 Bacteria 1696
178 Ga0197907_10856740 3300020069 Bacteria 676
179 Ga0206354_11629680 3300020081 Bacteria 1208
180 Ga0206353_10342286 3300020082 Bacteria 1282
181 Ga0206353_11182390 3300020082 Bacteria 6192
182 Ga0154015_1093925 3300020610 Bacteria 708
183 Ga0207642_10317527 3300025899 Bacteria 909
184 Ga0207688_10255804 3300025901 Bacteria 1062
185 Ga0207680_10562360 3300025903 Bacteria 814
186 Ga0207699_10080489 3300025906 Bacteria 2019
187 Ga0207643_10306323 3300025908 Bacteria 989
188 Ga0207643_10420807 3300025908 Bacteria 847
189 Ga0207643_10799605 3300025908 Bacteria 611
190 Ga0207705_10030135 3300025909 Bacteria 3870
191 Ga0207705_10141569 3300025909 Bacteria 1797
192 Ga0207684_10162562 3300025910 Bacteria 1923
193 Ga0207684_10539474 3300025910 Bacteria 998
194 Ga0207684_10634987 3300025910 Bacteria 910
195 Ga0207707_10015097 3300025912 Bacteria 6724
196 Ga0207707_10092988 3300025912 Bacteria 2634
197 Ga0207707_10173536 3300025912 Bacteria 1884
198 Ga0207707_10243733 3300025912 Bacteria 1562
199 Ga0207695_10139731 3300025913 Bacteria 2372
200 Ga0207695_10223399 3300025913 Bacteria 1790
201 Ga0207693_10024259 3300025915 Bacteria 4815
202 Ga0207693_10325760 3300025915 Bacteria 1202
203 Ga0207693_10420738 3300025915 Bacteria 1044
204 Ga0207663_10761479 3300025916 Bacteria 769
205 Ga0207660_10017592 3300025917 Bacteria 4752
206 Ga0207657_10008781 3300025919 Bacteria 10227
207 Ga0207657_10149711 3300025919 Bacteria 1902
208 Ga0207649_10347847 3300025920 Bacteria 1096
209 Ga0207649_10560196 3300025920 Bacteria 875
210 Ga0207649_10823926 3300025920 Bacteria 725
211 Ga0207652_10010746 3300025921 Bacteria 7371
212 Ga0207652_10136449 3300025921 Bacteria 2191
213 Ga0207652_10261768 3300025921 Bacteria 1560
214 Ga0207646_10110015 3300025922 Bacteria 2472
215 Ga0207646_10224199 3300025922 Bacteria 1698
216 Ga0207646_10478957 3300025922 Bacteria 1122
217 Ga0207646_10580885 3300025922 Bacteria 1006
218 Ga0207650_10024849 3300025925 Bacteria 4264
219 Ga0207650_10381072 3300025925 Bacteria 1165
220 Ga0207659_10046096 3300025926 Bacteria 3077
221 Ga0207687_10010459 3300025927 Bacteria 6059
222 Ga0207687_10134720 3300025927 Bacteria 1867
223 Ga0207700_10080374 3300025928 Bacteria 2542
224 Ga0207700_10572774 3300025928 Bacteria 1004
225 Ga0207664_10442617 3300025929 Bacteria 1159
226 Ga0207644_10090645 3300025931 Bacteria 2278
227 Ga0207644_10945852 3300025931 Bacteria 723
228 Ga0207690_10018243 3300025932 Bacteria 4302
229 Ga0207706_10121292 3300025933 Bacteria 2299
230 Ga0207706_10391212 3300025933 Bacteria 1206
231 Ga0207686_10825510 3300025934 Bacteria 744
232 Ga0207709_10651534 3300025935 Bacteria 838
233 Ga0207709_10694553 3300025935 Bacteria 814
234 Ga0207669_10106341 3300025937 Bacteria 1869
235 Ga0207711_10471374 3300025941 Bacteria 1169
236 Ga0207689_10091397 3300025942 Bacteria 2501
237 Ga0207661_10257329 3300025944 Bacteria 1554
238 Ga0207661_10285142 3300025944 Bacteria 1477
239 Ga0207667_10017419 3300025949 Bacteria 8086
240 Ga0207667_10132905 3300025949 Bacteria 2563
241 Ga0207667_10305552 3300025949 Bacteria 1625
242 Ga0207712_10168281 3300025961 Bacteria 1711
243 Ga0207668_10033183 3300025972 Bacteria 3417
244 Ga0207677_10184879 3300026023 Bacteria 1643
245 Ga0207639_10445987 3300026041 Bacteria 1174
246 Ga0207702_10002546 3300026078 Bacteria 17159
247 Ga0207702_10319430 3300026078 Bacteria 1478
248 Ga0207702_10343373 3300026078 Bacteria 1426
249 Ga0207641_10502267 3300026088 Bacteria 1178
250 Ga0207674_10027345 3300026116 Bacteria 6036
251 Ga0207674_10263741 3300026116 Bacteria 1670
252 Ga0207675_100000541 3300026118 Bacteria 36871
253 Ga0207675_100633920 3300026118 Bacteria 1074
254 Ga0207683_10004028 3300026121 Bacteria 12708
255 Ga0207698_10248851 3300026142 Bacteria 1625
256 Ga0209998_10025190 3300027717 Bacteria 1294
257 Ga0207428_10064085 3300027907 Bacteria 2902
258 Ga0207428_10356831 3300027907 Bacteria 1075
259 Ga0268266_10412377 3300028379 Bacteria 1279
260 Ga0268265_10362848 3300028380 Bacteria 1327
261 Ga0268265_10502403 3300028380 Bacteria 1143
262 Ga0268265_11346359 3300028380 Bacteria 715
263 Ga0265326_10024345 3300028558 Bacteria 1728
264 Ga0265326_10102266 3300028558 Bacteria 813
265 Ga0265319_1002557 3300028563 Bacteria 9849
266 Ga0265319_1016353 3300028563 Bacteria 2846
267 Ga0265319_1060604 3300028563 Bacteria 1228
268 Ga0265334_10013422 3300028573 Bacteria 3430
269 Ga0265334_10165626 3300028573 Bacteria 775
270 Ga0265318_10003094 3300028577 Bacteria 8544
271 Ga0265318_10030320 3300028577 Bacteria 2105
272 Ga0265318_10030334 3300028577 Bacteria 2104
273 Ga0265322_10020839 3300028654 Bacteria 1878
274 Ga0265336_10005714 3300028666 Bacteria 4559
275 Ga0265338_10002058 3300028800 Bacteria 31087
276 Ga0265338_10054250 3300028800 Bacteria 3576
277 Ga0265338_10056315 3300028800 Bacteria 3488
278 Ga0265338_10067959 3300028800 Bacteria 3073
279 Ga0265338_10345560 3300028800 Bacteria 1071
280 Ga0265324_10044403 3300029957 Bacteria 1532
281 Ga0265330_10009834 3300031235 Bacteria 4526
282 Ga0265332_10018123 3300031238 Bacteria 3104
283 Ga0265328_10005742 3300031239 Bacteria 5299
284 Ga0265320_10010065 3300031240 Bacteria 5654
285 Ga0265320_10039231 3300031240 Bacteria 2370
286 Ga0265320_10130692 3300031240 Bacteria 1141
287 Ga0265320_10251962 3300031240 Bacteria 783
288 Ga0265325_10021903 3300031241 Bacteria 3504
289 Ga0265329_10003580 3300031242 Bacteria 6722
290 Ga0265340_10101866 3300031247 Bacteria 1334
291 Ga0265340_10122480 3300031247 Bacteria 1196
292 Ga0265339_10034627 3300031249 Bacteria 2836
293 Ga0265331_10019512 3300031250 Bacteria 3501
294 Ga0265327_10010760 3300031251 Bacteria 6383
295 Ga0265327_10017655 3300031251 Bacteria 4463
296 Ga0265327_10024357 3300031251 Bacteria 3560
297 Ga0265316_10059236 3300031344 Bacteria 2979
298 Ga0265313_10021700 3300031595 Bacteria 3504
299 Ga0265314_10037625 3300031711 Bacteria 3504
300 Ga0265342_10025656 3300031712 Bacteria 3702
301 Ga0307405_10140506 3300031731 Bacteria 1683
302 Ga0307413_10019063 3300031824 Bacteria 3615
303 Ga0307410_10369941 3300031852 Bacteria 1150
304 Ga0307410_10778351 3300031852 Bacteria 812
305 Ga0307406_10625008 3300031901 Bacteria 891
306 Ga0307406_10871192 3300031901 Bacteria 765
307 Ga0307412_10793246 3300031911 Bacteria 821
308 Ga0307409_100128572 3300031995 Bacteria 2160
309 Ga0307409_100325540 3300031995 Bacteria 1440
310 Ga0307409_100561537 3300031995 Bacteria 1122
311 Ga0307416_100308556 3300032002 Bacteria 1577
312 Ga0307416_100459785 3300032002 Bacteria 1327
313 Ga0307415_100072666 3300032126 Bacteria 2423
314 Ga0307415_100083510 3300032126 Bacteria 2289
315 Ga0373944_0004799 3300035089 Bacteria 3540
316 Ga0373944_0038715 3300035089 Bacteria 1465
317 Ga0373945_0004700 3300035116 Bacteria 4349
318 Ga0373945_0005298 3300035116 Bacteria 4128
319 Ga0373943_0000101 3300035170 Bacteria 31609
320 Ga0373943_0030594 3300035170 Bacteria 2549
321 Ga0373943_0090283 3300035170 Bacteria 1586
322 Ga0373943_0375113 3300035170 Bacteria 818
323 Ga0373946_0018922 3300035171 Bacteria 2648
324 Ga0373946_0094565 3300035171 Bacteria 1330
325 Ga0373961_0011018 3300035241 Bacteria 2238
326 Ga0373924_0096467 3300035410 Bacteria 1269
327 Ga0373935_0017891 3300035692 Bacteria 4305
328 Ga0373927_0011038 3300035695 Bacteria 6018
329 Ga0373947_0000788 3300035725 Bacteria 19051
330 Ga0373947_0014095 3300035725 Bacteria 4583
331 Ga0373947_0015882 3300035725 Bacteria 4324
332 Ga0373925_0005074 3300037068 Bacteria 9852
333 Ga0373925_0658328 3300037068 Bacteria 863
334 Ga0395899_0002082 3300037312 Bacteria 16425
335 Ga0395899_0030622 3300037312 Bacteria 4046
336 Ga0395899_0053530 3300037312 Bacteria 2988
337 Ga0395899_0063312 3300037312 Bacteria 2721
338 Ga0395899_0082236 3300037312 Bacteria 2342
339 Ga0395899_0317234 3300037312 Bacteria 1051
340 Ga0395900_0003566 3300037418 Bacteria 16741
341 Ga0395900_0003571 3300037418 Bacteria 16714
342 Ga0395900_0006173 3300037418 Bacteria 12513
343 Ga0395900_0145082 3300037418 Bacteria 2427
344 Ga0395900_0147174 3300037418 Bacteria 2408
345 Ga0395900_0300670 3300037418 Bacteria 1591
346 Ga0395900_0559999 3300037418 Bacteria 1087
347 Ga0395900_1577275 3300037418 Bacteria 568
348 Ga0395898_0001966 3300037466 Bacteria 25888
349 Ga0395898_0003782 3300037466 Bacteria 16749
350 Ga0395898_0004411 3300037466 Bacteria 15397
351 Ga0395898_0010754 3300037466 Bacteria 9558
352 Ga0395898_0050623 3300037466 Bacteria 4065
353 Ga0395898_0071610 3300037466 Bacteria 3349
354 Ga0395898_0095443 3300037466 Bacteria 2857
355 Ga0395898_0108582 3300037466 Bacteria 2661
356 Ga0395898_0131682 3300037466 Bacteria 2395
357 Ga0395898_0151970 3300037466 Bacteria 2215
358 Ga0395898_0155429 3300037466 Bacteria 2188
359 Ga0395898_0205858 3300037466 Bacteria 1877
360 Ga0395898_0582452 3300037466 Bacteria 1061
361 Ga0395898_0811592 3300037466 Bacteria 876
362 Ga0395905_0004551 3300037471 Bacteria 14359
363 Ga0395905_0007392 3300037471 Bacteria 10922
364 Ga0395905_0008109 3300037471 Bacteria 10376
365 Ga0395905_0061244 3300037471 Bacteria 3520
366 Ga0395905_0090076 3300037471 Bacteria 2875
367 Ga0395905_0181075 3300037471 Bacteria 1978
368 Ga0395901_0005629 3300038443 Bacteria 12676
369 Ga0395901_0005947 3300038443 Bacteria 12356
370 Ga0395901_0009334 3300038443 Bacteria 9945
371 Ga0395901_0025215 3300038443 Bacteria 6105
372 Ga0395901_0025603 3300038443 Bacteria 6056
373 Ga0395901_0032655 3300038443 Bacteria 5369
374 Ga0395901_0137866 3300038443 Bacteria 2564
375 Ga0395901_0156670 3300038443 Bacteria 2392
376 Ga0395901_0163335 3300038443 Bacteria 2338
377 Ga0395901_0185962 3300038443 Bacteria 2179
378 Ga0395901_0403124 3300038443 Bacteria 1405
379 Ga0395901_0474037 3300038443 Bacteria 1277
380 Ga0395901_1090955 3300038443 Unclassified 769
381 Ga0436365_1882850 3300039437 Bacteria 808
382 Ga0439436_0050841 3300041404 Bacteria 1172
383 Ga0439439_0001293 3300041406 Bacteria 4900
384 Ga0439447_051928 3300041407 Bacteria 977
385 Ga0439461_0037391 3300041410 Bacteria 1037
386 Ga0451793_1094665 3300041452 Bacteria 1819
387 Ga0451804_1171148 3300041463 Bacteria 1040
388 Ga0451853_0262434 3300041512 Bacteria 730
389 Ga0451853_1687415 3300041512 Bacteria 758
390 Ga0451853_2895983 3300041512 Bacteria 766
391 Ga0439433_0000148 3300041999 Bacteria 10791
392 Ga0439449_0076219 3300042007 Bacteria 1236
393 Ga0439454_001224 3300042011 Bacteria 2398
394 Ga0439457_077834 3300042014 Bacteria 760
395 Ga0439462_0008078 3300042015 Bacteria 2647
396 Ga0450920_014012 3300042122 Bacteria 1513
397 Ga0439446_0011502 3300042156 Bacteria 2403
398 Ga0439434_0009214 3300042435 Bacteria 2902
399 Ga0439435_0204863 3300042436 Bacteria 652
400 Ga0439459_0070956 3300042438 Bacteria 806
401 Ga0466966_0455286 3300044684 Bacteria 769
402 Ga0466963_0002476 3300044694 Bacteria 10328
403 Ga0466963_0004822 3300044694 Bacteria 7865
404 Ga0466963_0014591 3300044694 Bacteria 4848
405 Ga0466968_0095583 3300044735 Bacteria 1322
406 Ga0466968_0137802 3300044735 Bacteria 1114
407 Ga0466957_0664464 3300044842 Bacteria 733
408 Ga0466960_0116163 3300044901 Bacteria 1396
409 Ga0466959_0061683 3300045049 Bacteria 2726
410 Ga0451576_0977521 3300045051 Bacteria 887
411 Ga0466958_0013947 3300045836 Bacteria 4582
412 Ga0466958_0027857 3300045836 Bacteria 3345
413 Ga0466958_0049073 3300045836 Bacteria 2553
414 Ga0466967_0000305 3300045976 Bacteria 22092
415 Ga0466967_0014043 3300045976 Bacteria 6220
416 Ga0466967_0023465 3300045976 Bacteria 5055
417 Ga0466967_0097796 3300045976 Bacteria 2679
418 Ga0466967_0125450 3300045976 Bacteria 2377
419 Ga0466967_0638170 3300045976 Bacteria 1052
420 Ga0495592_0019083 3300046454 Bacteria 5220
421 Ga0495592_0409108 3300046454 Bacteria 858
422 Ga0495592_0532650 3300046454 Bacteria 725
423 Ga0495603_0013923 3300046455 Bacteria 4864
424 Ga0495603_0099071 3300046455 Bacteria 1702
425 Ga0495603_0131789 3300046455 Bacteria 1455
426 Ga0495603_0506114 3300046455 Bacteria 692
427 Ga0495590_0132826 3300046457 Bacteria 896
428 Ga0495629_0012147 3300046459 Bacteria 6241
429 Ga0495629_0016163 3300046459 Bacteria 5356
430 Ga0495629_0324979 3300046459 Bacteria 1051
431 Ga0495641_0000374 3300046461 Bacteria 37120
432 Ga0495641_0005898 3300046461 Bacteria 8087
433 Ga0495641_0039909 3300046461 Bacteria 2185
434 Ga0495641_0054876 3300046461 Bacteria 1810
435 Ga0495651_0025724 3300046462 Bacteria 4583
436 Ga0495651_0597754 3300046462 Bacteria 696
437 Ga0495653_0031666 3300046463 Bacteria 4202
438 Ga0495653_0255248 3300046463 Bacteria 1162
439 Ga0495580_0081573 3300046472 Bacteria 2254
440 Ga0495580_0274955 3300046472 Bacteria 1150
441 Ga0495582_0000124 3300046473 Bacteria 41197
442 Ga0495582_0013762 3300046473 Bacteria 4454
443 Ga0495639_0000786 3300046475 Bacteria 14467
444 Ga0495662_0011617 3300046476 Bacteria 4304
445 Ga0495664_0235129 3300046477 Bacteria 1108
446 Ga0495584_0070933 3300046491 Bacteria 1751
447 Ga0495584_0168617 3300046491 Bacteria 1113
448 Ga0495584_0245232 3300046491 Bacteria 911
449 Ga0495594_0000340 3300046499 Bacteria 23268
450 Ga0495594_0131420 3300046499 Bacteria 1418
451 Ga0495607_0062799 3300046501 Bacteria 2104
452 Ga0495608_0042588 3300046511 Bacteria 3036
453 Ga0495618_0034298 3300046514 Bacteria 3182
454 Ga0495618_0516246 3300046514 Bacteria 719
455 Ga0495628_0650699 3300046516 Bacteria 748
456 Ga0495630_0015163 3300046517 Bacteria 5623
457 Ga0495630_0039313 3300046517 Bacteria 3537
458 Ga0495630_0528420 3300046517 Bacteria 905
459 Ga0495637_0075180 3300046520 Bacteria 1356
460 Ga0495637_0182039 3300046520 Bacteria 779
461 Ga0495663_0063013 3300046525 Bacteria 1169
462 Ga0495666_0008147 3300046526 Bacteria 5255
463 Ga0495642_0072435 3300046528 Bacteria 1443
464 Ga0495652_0160456 3300046529 Bacteria 1746
465 Ga0495652_0176999 3300046529 Bacteria 1641
466 Ga0495665_0003068 3300046531 Bacteria 9034
467 Ga0495640_0443210 3300046533 Bacteria 794
468 Ga0495598_0045169 3300046537 Bacteria 1304
469 Ga0495598_0077579 3300046537 Bacteria 1059
470 Ga0495609_0111759 3300046538 Bacteria 1179
471 Ga0495597_0293837 3300046542 Bacteria 631
472 Ga0495645_0252776 3300046543 Bacteria 1171
473 Ga0495633_0433894 3300046558 Bacteria 594
474 Ga0495667_0035954 3300046559 Bacteria 3308
475 Ga0495656_0014479 3300046615 Bacteria 2958
476 Ga0495634_0160953 3300046642 Bacteria 1415
477 Ga0495635_0005548 3300046663 Bacteria 8781
478 Ga0495635_0111310 3300046663 Bacteria 1870
479 Ga0495635_0251207 3300046663 Bacteria 1192
480 Ga0495635_0508071 3300046663 Bacteria 793
481 Ga0495659_0118309 3300046664 Bacteria 1041
482 Ga0495659_0201582 3300046664 Bacteria 816
483 Ga0495661_0089784 3300046665 Bacteria 1751
484 Ga0495588_0003233 3300046674 Bacteria 7062
485 Ga0495647_0048009 3300046681 Bacteria 1649
486 Ga0495647_0367366 3300046681 Bacteria 657
487 Ga0495658_0000247 3300046683 Bacteria 30977
488 Ga0495613_0007600 3300046689 Bacteria 8058
489 Ga0495613_0164892 3300046689 Bacteria 1574
490 Ga0495613_0304822 3300046689 Bacteria 1102
491 Ga0495613_0560157 3300046689 Bacteria 764
492 Ga0495613_0674125 3300046689 Bacteria 682
493 Ga0495624_0012838 3300046690 Bacteria 5717
494 Ga0495670_0092785 3300046691 Bacteria 1547
495 Ga0495670_0145427 3300046691 Bacteria 1242
496 Ga0495671_0166031 3300046692 Bacteria 1074
497 Ga0495589_0057079 3300046794 Bacteria 1921
498 Ga0495581_0003701 3300047315 Bacteria 8805
499 Ga0495604_0047680 3300047317 Bacteria 3336
500 Ga0495604_0241374 3300047317 Bacteria 1235
501 Ga0495636_0141441 3300047318 Bacteria 1075
502 Ga0495674_0877600 3300047319 Bacteria 694
503 Ga0495676_0001077 3300047321 Bacteria 23118
504 Ga0495676_0001422 3300047321 Bacteria 20618
505 Ga0495676_0039372 3300047321 Bacteria 3915
506 Ga0495676_0079007 3300047321 Bacteria 2503
507 Ga0495676_0257125 3300047321 Bacteria 1189
508 Ga0495676_0940413 3300047321 Bacteria 553
509 Ga0495679_094099 3300047446 Bacteria 838
510 Ga0495684_0050248 3300047471 Bacteria 3184
511 Ga0495684_0393133 3300047471 Bacteria 975
512 Ga0495684_0610720 3300047471 Bacteria 734
513 Ga0495593_0006462 3300047673 Bacteria 6867
514 Ga0495602_0123551 3300048088 Bacteria 2078
515 Ga0495614_0038041 3300048089 Bacteria 2065
516 Ga0495615_0042566 3300048090 Bacteria 1140
517 Ga0495615_0067399 3300048090 Bacteria 958
518 Ga0496100_0006343 3300048903 Bacteria 6445
519 Ga0496100_0134527 3300048903 Bacteria 1745
520 Ga0496100_0239288 3300048903 Bacteria 1338
521 Ga0496100_0467043 3300048903 Bacteria 969
522 Ga0496100_0483671 3300048903 Bacteria 952
523 Ga0496100_0535275 3300048903 Bacteria 905
524 Ga0496101_0010725 3300048904 Bacteria 6060
525 Ga0496101_0014565 3300048904 Bacteria 5287
526 Ga0496101_0138062 3300048904 Bacteria 1856
527 Ga0496101_0239761 3300048904 Bacteria 1411
528 Ga0496101_0438002 3300048904 Bacteria 1031
529 Ga0496102_0013540 3300048905 Bacteria 7068
530 Ga0496102_0052433 3300048905 Bacteria 3717
531 Ga0496102_0134736 3300048905 Bacteria 2314
532 Ga0496102_0170148 3300048905 Bacteria 2051
533 Ga0496103_0091108 3300048906 Bacteria 1924
534 Ga0496103_0209933 3300048906 Bacteria 1252
535 Ga0496104_0000606 3300048907 Bacteria 30748
536 Ga0496104_0014093 3300048907 Bacteria 7216
537 Ga0496104_0120944 3300048907 Bacteria 2514
538 Ga0496104_0138543 3300048907 Bacteria 2338
539 Ga0496104_0215181 3300048907 Bacteria 1833
540 Ga0496104_0304389 3300048907 Bacteria 1506
541 Ga0496105_0000182 3300048908 Bacteria 41923
542 Ga0496105_0037736 3300048908 Bacteria 3979
543 Ga0496105_0066251 3300048908 Bacteria 2981
544 Ga0496105_0110450 3300048908 Bacteria 2269
545 Ga0496105_0176321 3300048908 Bacteria 1751
546 Ga0496105_0341286 3300048908 Bacteria 1198
547 Ga0496105_0489642 3300048908 Bacteria 967
548 Ga0496106_0011036 3300048909 Bacteria 6678
549 Ga0496106_0016722 3300048909 Bacteria 5427
550 Ga0496106_0054642 3300048909 Bacteria 3017
551 Ga0496106_0101500 3300048909 Bacteria 2232
552 Ga0496106_0156092 3300048909 Bacteria 1802
553 Ga0496107_0009675 3300048910 Bacteria 6684
554 Ga0496107_0098049 3300048910 Bacteria 2147
555 Ga0496107_0168821 3300048910 Bacteria 1623
556 Ga0496107_0537534 3300048910 Bacteria 866
557 Ga0496108_0000777 3300048911 Bacteria 24915
558 Ga0496108_0031197 3300048911 Bacteria 4420
559 Ga0496108_0040239 3300048911 Bacteria 3895
560 Ga0496108_0064473 3300048911 Bacteria 3086
561 Ga0496108_0157581 3300048911 Bacteria 1961
562 Ga0496108_0612220 3300048911 Bacteria 949
563 Ga0496108_0638154 3300048911 Bacteria 926
564 Ga0496109_0000403 3300048912 Bacteria 39012
565 Ga0496109_0007741 3300048912 Bacteria 9095
566 Ga0496109_0009153 3300048912 Bacteria 8433
567 Ga0496109_0229702 3300048912 Bacteria 1745
568 Ga0496109_0310604 3300048912 Bacteria 1487
569 Ga0496109_0495375 3300048912 Bacteria 1153
570 Ga0496109_1154272 3300048912 Bacteria 711
571 Ga0496110_0000581 3300048913 Bacteria 25064
572 Ga0496110_0022850 3300048913 Bacteria 5314
573 Ga0496110_0023457 3300048913 Bacteria 5248
574 Ga0496110_0026058 3300048913 Bacteria 4999
575 Ga0496110_0067762 3300048913 Bacteria 3158
576 Ga0496110_0214988 3300048913 Bacteria 1748
577 Ga0496110_0404156 3300048913 Bacteria 1245
578 Ga0496110_0613329 3300048913 Bacteria 986
579 Ga0496110_0690897 3300048913 Bacteria 921
580 Ga0496110_1122586 3300048913 Unclassified 694
581 Ga0496110_1667969 3300048913 Bacteria 547
582 Ga0496111_0000076 3300048914 Bacteria 40931
583 Ga0496111_0006195 3300048914 Bacteria 7747
584 Ga0496111_0019420 3300048914 Bacteria 4720
585 Ga0496111_0029346 3300048914 Bacteria 3906
586 Ga0496112_0000832 3300048915 Bacteria 21960
587 Ga0496112_0031945 3300048915 Bacteria 5110
588 Ga0496112_0116989 3300048915 Bacteria 2636
589 Ga0496112_0152774 3300048915 Bacteria 2276
590 Ga0496112_0165505 3300048915 Bacteria 2177
591 Ga0496112_0218751 3300048915 Bacteria 1861
592 Ga0496112_0220299 3300048915 Bacteria 1854
593 Ga0496112_0263445 3300048915 Bacteria 1673
594 Ga0496112_0291082 3300048915 Bacteria 1579
595 Ga0496112_0644627 3300048915 Bacteria 989
596 Ga0496112_1163169 3300048915 Unclassified 689
597 Ga0496113_0000424 3300048916 Bacteria 20576
598 Ga0496113_0069096 3300048916 Bacteria 2682
599 Ga0496113_0096092 3300048916 Bacteria 2290
600 Ga0496113_0129082 3300048916 Bacteria 1982
601 Ga0496113_0132516 3300048916 Bacteria 1957
602 Ga0496113_0232994 3300048916 Bacteria 1468
603 Ga0496113_0487851 3300048916 Bacteria 990
604 Ga0496114_0042144 3300048917 Bacteria 3783
605 Ga0496114_0050148 3300048917 Bacteria 3474
606 Ga0496114_0068310 3300048917 Bacteria 2983
607 Ga0496114_0097464 3300048917 Bacteria 2505
608 Ga0496114_0114789 3300048917 Bacteria 2310
609 Ga0496114_0120943 3300048917 Bacteria 2252
610 Ga0496114_0233315 3300048917 Bacteria 1617
611 Ga0496114_0270878 3300048917 Bacteria 1496
612 Ga0496114_0384025 3300048917 Bacteria 1243
613 Ga0496115_0001178 3300048918 Bacteria 18760
614 Ga0496115_0036527 3300048918 Bacteria 3891
615 Ga0496115_0047479 3300048918 Bacteria 3434
616 Ga0496115_0142275 3300048918 Bacteria 1979
617 Ga0496115_0280435 3300048918 Bacteria 1368
618 Ga0501291_025358 3300049514 Bacteria 970
619 Ga0501031_0012215 3300049568 Bacteria 5598
620 Ga0501031_0051205 3300049568 Bacteria 2689
621 Ga0501032_0002668 3300049569 Bacteria 13926
622 Ga0501032_0617495 3300049569 Bacteria 689
623 Ga0501033_0005054 3300049570 Bacteria 10507
624 Ga0501033_0139052 3300049570 Bacteria 1756
625 Ga0501033_0640532 3300049570 Bacteria 727
626 Ga0501034_0751400 3300049571 Bacteria 871
627 Ga0501036_0000693 3300049572 Bacteria 24868
628 Ga0501036_0040031 3300049572 Bacteria 3964
629 Ga0501036_0068181 3300049572 Bacteria 3010
630 Ga0501037_0040290 3300049573 Bacteria 3437
631 Ga0501038_0000548 3300049574 Bacteria 33027
632 Ga0501038_0022399 3300049574 Bacteria 5663
633 Ga0501039_0000176 3300049575 Bacteria 45277
634 Ga0501039_0025073 3300049575 Bacteria 4581
635 Ga0501039_0105102 3300049575 Bacteria 2205
636 Ga0501039_0390350 3300049575 Bacteria 1093
637 Ga0501040_0013388 3300049576 Bacteria 5390
638 Ga0501040_0048306 3300049576 Bacteria 2908
639 Ga0501040_0176566 3300049576 Bacteria 1513
640 Ga0501041_0000022 3300049577 Bacteria 52719
641 Ga0501041_0076183 3300049577 Bacteria 2063
642 Ga0501041_0182726 3300049577 Bacteria 1313
643 Ga0501042_0000092 3300049578 Bacteria 35165
644 Ga0501042_0008327 3300049578 Bacteria 6837
645 Ga0501042_0314941 3300049578 Bacteria 1130
646 Ga0501043_0000891 3300049579 Bacteria 26496
647 Ga0501046_0002474 3300049580 Bacteria 17319
648 Ga0501046_0041525 3300049580 Bacteria 3670
649 Ga0501046_0704815 3300049580 Bacteria 711
650 Ga0501047_0010177 3300049581 Bacteria 8894
651 Ga0501047_0744764 3300049581 Bacteria 796
652 Ga0501048_0001223 3300049582 Bacteria 19432
653 Ga0501048_0023508 3300049582 Bacteria 4502
654 Ga0501048_0370590 3300049582 Bacteria 1022
655 Ga0501048_0601281 3300049582 Bacteria 789
656 Ga0501067_0002569 3300049583 Bacteria 10026
657 Ga0501067_0033702 3300049583 Bacteria 2841
658 Ga0501067_0283926 3300049583 Bacteria 922
659 Ga0501068_0000554 3300049584 Bacteria 18987
660 Ga0501068_0016638 3300049584 Bacteria 4241
661 Ga0501068_0143665 3300049584 Bacteria 1497
662 Ga0501068_0343150 3300049584 Bacteria 959
663 Ga0501069_0005499 3300049585 Bacteria 6594
664 Ga0501069_0008128 3300049585 Bacteria 5512
665 Ga0501069_0025761 3300049585 Bacteria 3216
666 Ga0501069_0045322 3300049585 Bacteria 2436
667 Ga0501070_0008506 3300049586 Bacteria 8673
668 Ga0501070_0037529 3300049586 Bacteria 4044
669 Ga0501070_0129553 3300049586 Bacteria 2084
670 Ga0501071_0026502 3300049587 Bacteria 4069
671 Ga0501071_0091995 3300049587 Bacteria 2228
672 Ga0501071_0156085 3300049587 Bacteria 1704
673 Ga0501072_0003510 3300049588 Bacteria 11812
674 Ga0501072_0035421 3300049588 Bacteria 3909
675 Ga0501072_0063745 3300049588 Bacteria 2907
676 Ga0501073_0012723 3300049589 Bacteria 6138
677 Ga0501074_0002118 3300049590 Bacteria 13705
678 Ga0501074_0023101 3300049590 Bacteria 4522
679 Ga0501074_0430848 3300049590 Bacteria 935
680 Ga0501074_0904165 3300049590 Bacteria 621
681 Ga0501075_0000040 3300049591 Bacteria 52221
682 Ga0501075_0022523 3300049591 Bacteria 4602
683 Ga0501075_0083110 3300049591 Bacteria 2426
684 Ga0501075_0208247 3300049591 Bacteria 1491
685 Ga0501075_0276316 3300049591 Bacteria 1280
686 Ga0501075_0428959 3300049591 Bacteria 1008
687 Ga0501076_0000462 3300049592 Bacteria 25816
688 Ga0501076_0018932 3300049592 Bacteria 5253
689 Ga0501076_0145768 3300049592 Bacteria 1925
690 Ga0501076_0309453 3300049592 Bacteria 1295
691 Ga0501076_0337586 3300049592 Bacteria 1236
692 Ga0501076_0466832 3300049592 Bacteria 1039
693 Ga0501076_0820192 3300049592 Bacteria 767
694 Ga0501076_0872168 3300049592 Bacteria 742
695 Ga0501077_0001230 3300049593 Bacteria 15458
696 Ga0501077_0022967 3300049593 Bacteria 3954
697 Ga0501077_0040233 3300049593 Bacteria 2978
698 Ga0501077_0107389 3300049593 Bacteria 1769
699 Ga0501077_0298681 3300049593 Bacteria 1026
700 Ga0501217_107907 3300049661 Bacteria 798
701 Ga0501079_0037028 3300049741 Bacteria 3758
702 Ga0501079_0056934 3300049741 Bacteria 3016
703 Ga0501079_0057448 3300049741 Bacteria 3002
704 Ga0501079_0349600 3300049741 Bacteria 1158
705 Ga0501080_0020429 3300049742 Bacteria 6129
706 Ga0501080_0076027 3300049742 Bacteria 3123
707 Ga0501080_0142318 3300049742 Bacteria 2217
708 Ga0501080_0265002 3300049742 Bacteria 1564
709 Ga0501081_0000040 3300049743 Bacteria 48110
710 Ga0501081_0013087 3300049743 Bacteria 5457
711 Ga0501081_0192855 3300049743 Bacteria 1476
712 Ga0501083_0000928 3300049744 Bacteria 19450
713 Ga0501083_0227300 3300049744 Bacteria 1215
714 Ga0501083_0359214 3300049744 Bacteria 947
715 Ga0501035_0006640 3300049822 Bacteria 10827
716 Ga0501035_0045759 3300049822 Bacteria 3936
717 Ga0501044_0152827 3300049823 Bacteria 2290
718 Ga0501045_0000098 3300049824 Bacteria 42917
719 Ga0501045_0013753 3300049824 Bacteria 5721
720 Ga0501045_0074738 3300049824 Bacteria 2495
721 Ga0501045_0139616 3300049824 Bacteria 1802
722 Ga0501045_0210039 3300049824 Bacteria 1450
723 Ga0501045_0220141 3300049824 Bacteria 1413
724 Ga0501045_0306116 3300049824 Bacteria 1183
725 nmdc:mga00v17_207208_c1 3300050491 Bacteria 1268
726 nmdc:mga0yw44_282340_c1 3300050492 Bacteria 1110
727 nmdc:mga05p37_3875_c1 3300050507 Bacteria 17497
728 nmdc:mga05p37_62072_c1 3300050507 Bacteria 4600
729 nmdc:mga05p37_648715_c1 3300050507 Bacteria 1182
730 nmdc:mga09592_185253_c1 3300050508 Bacteria 1801
731 nmdc:mga09592_39124_c1 3300050508 Bacteria 3983
732 nmdc:mga09592_5576_c1 3300050508 Bacteria 10250
733 nmdc:mga0qj67_21076_c1 3300050509 Bacteria 4997
734 nmdc:mga0qj67_25076_c1 3300050509 Bacteria 4603
735 nmdc:mga06r32_28316_c1 3300050510 Bacteria 5241
736 nmdc:mga06r32_499515_c1 3300050510 Bacteria 1193
737 nmdc:mga06r32_74469_c1 3300050510 Bacteria 3292
738 nmdc:mga06r32_828013_c1 3300050510 Bacteria 885
739 nmdc:mga08y16_523772_c1 3300050511 Bacteria 1202
740 nmdc:mga08y16_816734_c1 3300050511 Bacteria 924
741 nmdc:mga0n895_13798_c1 3300050512 Bacteria 7307
742 nmdc:mga0n895_6128_c1 3300050512 Bacteria 10157
743 nmdc:mga0rr50_26606_c1 3300050513 Bacteria 4039
744 nmdc:mga0rr50_297455_c1 3300050513 Bacteria 1350
745 nmdc:mga0rr50_3510_c1 3300050513 Bacteria 9042
746 nmdc:mga0rr50_985000_c1 3300050513 Bacteria 718
747 nmdc:mga08x19_472975_c1 3300050514 Bacteria 883
748 nmdc:mga0a205_109331_c1 3300050515 Bacteria 2663
749 nmdc:mga0a205_5955_c1 3300050515 Bacteria 10989
750 Ga0495601_0315156 3300053077 Bacteria 1019
751 Ga0495601_0441002 3300053077 Bacteria 842
752 Ga0495612_0343383 3300053078 Bacteria 673
753 Ga0495655_0050425 3300053083 Bacteria 1100
754 Ga0495595_0033117 3300053084 Bacteria 2330
755 Ga0495619_0064237 3300053085 Bacteria 2447
756 Ga0495619_0460687 3300053085 Bacteria 876
757 Ga0500628_065359 3300053129 Bacteria 899
758 Ga0501084_0000228 3300054114 Bacteria 42475
759 Ga0501084_0022100 3300054114 Bacteria 5306
760 Ga0501084_0051910 3300054114 Bacteria 3431
761 Ga0501084_0176697 3300054114 Bacteria 1802
762 Ga0501084_0197374 3300054114 Bacteria 1698
763 Ga0590075_025861 3300059424 Bacteria 1476
764 Ga0590077_050826 3300059426 Bacteria 930
765 Ga0587079_043538 3300059647 Bacteria 916
766 Ga0587107_049593 3300059652 Bacteria 707
767 Ga0501082_0000313 3300060353 Bacteria 43217
768 Ga0501082_0012188 3300060353 Bacteria 7386
769 Ga0501082_0225537 3300060353 Bacteria 1630
770 Ga0501082_0357092 3300060353 Bacteria 1274
771 Ga0530510_0000233 3300061734 Bacteria 34858
772 Ga0530510_0019256 3300061734 Bacteria 4844
773 Ga0530510_0043860 3300061734 Bacteria 3231
774 Ga0530510_0058431 3300061734 Bacteria 2789
775 Ga0530510_0273079 3300061734 Bacteria 1262
776 Ga0530510_1055520 3300061734 Bacteria 622
777 Ga0081455_10304404
778 JGI24743J22301_10063257
779 JGI25406J46586_10034387
780 Ga0070658_10343741
781 Ga0070683_100003014
782 Ga0070683_100726188
783 Ga0070670_100526919
784 Ga0070670_101335444
785 Ga0070682_100008758
786 Ga0070682_100084214
787 Ga0070682_100708966
788 Ga0068868_100505137
789 Ga0070660_100013030
790 Ga0070660_100159312
791 Ga0070689_100237632
792 Ga0070691_10210417
793 Ga0070661_100636543
794 Ga0070692_10154936
795 Ga0070668_100042964
796 Ga0070671_100114415
797 Ga0070671_100550539
798 Ga0070673_100566896
799 Ga0070673_101441389
800 Ga0070659_100070513
801 Ga0070703_10194467
802 Ga0070709_10274128
803 Ga0070709_10491325
804 Ga0070714_100023226
805 Ga0070714_100548407
806 Ga0070713_100085262
807 Ga0070713_100116999
808 Ga0070713_100510578
809 Ga0070713_100937162
810 Ga0070710_10177447
811 Ga0070710_10580525
812 Ga0070711_100289630
813 Ga0070711_100597271
814 Ga0070705_100044138
815 Ga0070708_100010109
816 Ga0070663_100049856
817 Ga0070663_100257678
818 Ga0070678_100089311
819 Ga0070678_101246469
820 Ga0070662_100084293
821 Ga0070662_100229295
822 Ga0070662_100526942
823 Ga0070681_10010617
824 Ga0070681_10020004
825 Ga0070681_10028129
826 Ga0070681_10206595
827 Ga0070685_10650418
828 Ga0070706_100492332
829 Ga0070706_100771109
830 Ga0070706_100855698
831 Ga0070698_100162922
832 Ga0070698_100380701
833 Ga0070699_100008553
834 Ga0070699_100109701
835 Ga0070679_100019792
836 Ga0070679_100029031
837 Ga0070679_100224293
838 Ga0070679_100328963
839 Ga0070679_100817945
840 Ga0070684_100004862
841 Ga0070684_100066833
842 Ga0070684_100172639
843 Ga0070684_100632693
844 Ga0070684_100892624
845 Ga0068853_100306084
846 Ga0070672_100126365
847 Ga0070686_100441991
848 Ga0070693_100003389
849 Ga0070693_100229444
850 Ga0070665_100428569
851 Ga0070665_100894141
852 Ga0070704_100071852
853 Ga0070704_100959250
854 Ga0068855_100024333
855 Ga0068855_100155801
856 Ga0068855_100637558
857 Ga0070664_100497105
858 Ga0068857_100414187
859 Ga0068857_101019805
860 Ga0068856_100162226
861 Ga0068856_100343762
862 Ga0068856_100574325
863 Ga0068856_100697450
864 Ga0068856_101627950
865 Ga0068852_100047629
866 Ga0068859_100929429
867 Ga0068864_100208213
868 Ga0068866_10481192
869 Ga0068861_100001363
870 Ga0068870_10277864
871 Ga0068863_100765658
872 Ga0068862_100982179
873 Ga0068862_101021210
874 Ga0081455_10099280
875 Ga0081539_10001263
876 Ga0070717_10101540
877 Ga0070717_10104256
878 Ga0075365_10266046
879 Ga0075432_10021754
880 Ga0070715_10047213
881 Ga0070716_100012314
882 Ga0070712_100409383
883 Ga0070712_100828484
884 Ga0097621_100102787
885 Ga0068871_100026340
886 Ga0075428_100009035
887 Ga0075428_100084482
888 Ga0075428_100215700
889 Ga0075430_100011120
890 Ga0075430_100301449
891 Ga0075431_100002708
892 Ga0075431_100585624
893 Ga0075431_101246092
894 Ga0075433_10005381
895 Ga0075433_10155958
896 Ga0075433_10289983
897 Ga0075434_100000119
898 Ga0075434_100043574
899 Ga0075434_100148416
900 Ga0075429_100013670
901 Ga0075429_100027684
902 Ga0075429_100127147
903 Ga0075429_100137938
904 Ga0097620_100929420
905 Ga0075435_100013923
906 Ga0075435_100019498
907 Ga0075435_100058953
908 Ga0105240_10031263
909 Ga0105240_10209059
910 Ga0105240_10241083
911 Ga0111539_10315949
912 Ga0111539_10357882
913 Ga0105245_10991458
914 Ga0114129_10023134
915 Ga0114129_10074244
916 Ga0114129_10163685
917 Ga0114129_11178583
918 Ga0114129_11936319
919 Ga0105243_10220725
920 Ga0105243_10321517
921 Ga0105243_11003184
922 Ga0105241_10086381
923 Ga0105241_10229031
924 Ga0105242_10115337
925 Ga0105242_10168618
926 Ga0105242_10388453
927 Ga0105242_10467465
928 Ga0105238_10240837
929 Ga0105238_10661389
930 Ga0105249_10051441
931 Ga0105239_10063495
932 Ga0105246_10654402
933 Ga0157343_1001271
934 Ga0157341_1004565
935 Ga0157373_10135400
936 Ga0157370_10019560
937 Ga0157370_10508474
938 Ga0157369_10001856
939 Ga0157369_10124289
940 Ga0157369_11728073
941 Ga0163162_10039041
942 Ga0157372_10059751
943 Ga0157372_10597208
944 Ga0157372_10767501
945 Ga0157372_11582292
946 Ga0157375_10067646
947 Ga0157375_10819227
948 Ga0163163_10003631
949 Ga0157380_10652129
950 Ga0157377_10235083
951 Ga0157376_10025932
952 Ga0182005_1238906
953 Ga0163161_10163995
954 Ga0197907_10856740
955 Ga0206354_11629680
956 Ga0206353_10342286
957 Ga0206353_11182390
958 Ga0154015_1093925
959 Ga0207642_10317527
960 Ga0207688_10255804
961 Ga0207680_10562360
962 Ga0207699_10080489
963 Ga0207643_10306323
964 Ga0207643_10420807
965 Ga0207643_10799605
966 Ga0207705_10030135
967 Ga0207705_10141569
968 Ga0207684_10162562
969 Ga0207684_10539474
970 Ga0207684_10634987
971 Ga0207707_10015097
972 Ga0207707_10092988
973 Ga0207707_10173536
974 Ga0207707_10243733
975 Ga0207695_10139731
976 Ga0207695_10223399
977 Ga0207693_10024259
978 Ga0207693_10325760
979 Ga0207693_10420738
980 Ga0207663_10761479
981 Ga0207660_10017592
982 Ga0207657_10008781
983 Ga0207657_10149711
984 Ga0207649_10347847
985 Ga0207649_10560196
986 Ga0207649_10823926
987 Ga0207652_10010746
988 Ga0207652_10136449
989 Ga0207652_10261768
990 Ga0207646_10110015
991 Ga0207646_10224199
992 Ga0207646_10478957
993 Ga0207646_10580885
994 Ga0207650_10024849
995 Ga0207650_10381072
996 Ga0207659_10046096
997 Ga0207687_10010459
998 Ga0207687_10134720
999 Ga0207700_10080374
1000 Ga0207700_10572774
1001 Ga0207664_10442617
1002 Ga0207644_10090645
1003 Ga0207644_10945852
1004 Ga0207690_10018243
1005 Ga0207706_10121292
1006 Ga0207706_10391212
1007 Ga0207686_10825510
1008 Ga0207709_10651534
1009 Ga0207709_10694553
1010 Ga0207669_10106341
1011 Ga0207711_10471374
1012 Ga0207689_10091397
1013 Ga0207661_10257329
1014 Ga0207661_10285142
1015 Ga0207667_10017419
1016 Ga0207667_10132905
1017 Ga0207667_10305552
1018 Ga0207712_10168281
1019 Ga0207668_10033183
1020 Ga0207677_10184879
1021 Ga0207639_10445987
1022 Ga0207702_10002546
1023 Ga0207702_10319430
1024 Ga0207702_10343373
1025 Ga0207641_10502267
1026 Ga0207674_10027345
1027 Ga0207674_10263741
1028 Ga0207675_100000541
1029 Ga0207675_100633920
1030 Ga0207683_10004028
1031 Ga0207698_10248851
1032 Ga0209998_10025190
1033 Ga0207428_10064085
1034 Ga0207428_10356831
1035 Ga0268266_10412377
1036 Ga0268265_10362848
1037 Ga0268265_10502403
1038 Ga0268265_11346359
1039 Ga0265326_10024345
1040 Ga0265326_10102266
1041 Ga0265319_1002557
1042 Ga0265319_1016353
1043 Ga0265319_1060604
1044 Ga0265334_10013422
1045 Ga0265334_10165626
1046 Ga0265318_10003094
1047 Ga0265318_10030320
1048 Ga0265318_10030334
1049 Ga0265322_10020839
1050 Ga0265336_10005714
1051 Ga0265338_10002058
1052 Ga0265338_10054250
1053 Ga0265338_10056315
1054 Ga0265338_10067959
1055 Ga0265338_10345560
1056 Ga0265324_10044403
1057 Ga0265330_10009834
1058 Ga0265332_10018123
1059 Ga0265328_10005742
1060 Ga0265320_10010065
1061 Ga0265320_10039231
1062 Ga0265320_10130692
1063 Ga0265320_10251962
1064 Ga0265325_10021903
1065 Ga0265329_10003580
1066 Ga0265340_10101866
1067 Ga0265340_10122480
1068 Ga0265339_10034627
1069 Ga0265331_10019512
1070 Ga0265327_10010760
1071 Ga0265327_10017655
1072 Ga0265327_10024357
1073 Ga0265316_10059236
1074 Ga0265313_10021700
1075 Ga0265314_10037625
1076 Ga0265342_10025656
1077 Ga0307405_10140506
1078 Ga0307413_10019063
1079 Ga0307410_10369941
1080 Ga0307410_10778351
1081 Ga0307406_10625008
1082 Ga0307406_10871192
1083 Ga0307412_10793246
1084 Ga0307409_100128572
1085 Ga0307409_100325540
1086 Ga0307409_100561537
1087 Ga0307416_100308556
1088 Ga0307416_100459785
1089 Ga0307415_100072666
1090 Ga0307415_100083510
1091 Ga0373944_0004799
1092 Ga0373944_0038715
1093 Ga0373945_0004700
1094 Ga0373945_0005298
1095 Ga0373943_0000101
1096 Ga0373943_0030594
1097 Ga0373943_0090283
1098 Ga0373943_0375113
1099 Ga0373946_0018922
1100 Ga0373946_0094565
1101 Ga0373961_0011018
1102 Ga0373924_0096467
1103 Ga0373935_0017891
1104 Ga0373927_0011038
1105 Ga0373947_0000788
1106 Ga0373947_0014095
1107 Ga0373947_0015882
1108 Ga0373925_0005074
1109 Ga0373925_0658328
1110 Ga0395899_0002082
1111 Ga0395899_0030622
1112 Ga0395899_0053530
1113 Ga0395899_0063312
1114 Ga0395899_0082236
1115 Ga0395899_0317234
1116 Ga0395900_0003566
1117 Ga0395900_0003571
1118 Ga0395900_0006173
1119 Ga0395900_0145082
1120 Ga0395900_0147174
1121 Ga0395900_0300670
1122 Ga0395900_0559999
1123 Ga0395900_1577275
1124 Ga0395898_0001966
1125 Ga0395898_0003782
1126 Ga0395898_0004411
1127 Ga0395898_0010754
1128 Ga0395898_0050623
1129 Ga0395898_0071610
1130 Ga0395898_0095443
1131 Ga0395898_0108582
1132 Ga0395898_0131682
1133 Ga0395898_0151970
1134 Ga0395898_0155429
1135 Ga0395898_0205858
1136 Ga0395898_0582452
1137 Ga0395898_0811592
1138 Ga0395905_0004551
1139 Ga0395905_0007392
1140 Ga0395905_0008109
1141 Ga0395905_0061244
1142 Ga0395905_0090076
1143 Ga0395905_0181075
1144 Ga0395901_0005629
1145 Ga0395901_0005947
1146 Ga0395901_0009334
1147 Ga0395901_0025215
1148 Ga0395901_0025603
1149 Ga0395901_0032655
1150 Ga0395901_0137866
1151 Ga0395901_0156670
1152 Ga0395901_0163335
1153 Ga0395901_0185962
1154 Ga0395901_0403124
1155 Ga0395901_0474037
1156 Ga0395901_1090955
1157 Ga0436365_1882850
1158 Ga0439436_0050841
1159 Ga0439439_0001293
1160 Ga0439447_051928
1161 Ga0439461_0037391
1162 Ga0451793_1094665
1163 Ga0451804_1171148
1164 Ga0451853_0262434
1165 Ga0451853_1687415
1166 Ga0451853_2895983
1167 Ga0439433_0000148
1168 Ga0439449_0076219
1169 Ga0439454_001224
1170 Ga0439457_077834
1171 Ga0439462_0008078
1172 Ga0450920_014012
1173 Ga0439446_0011502
1174 Ga0439434_0009214
1175 Ga0439435_0204863
1176 Ga0439459_0070956
1177 Ga0466966_0455286
1178 Ga0466963_0002476
1179 Ga0466963_0004822
1180 Ga0466963_0014591
1181 Ga0466968_0095583
1182 Ga0466968_0137802
1183 Ga0466957_0664464
1184 Ga0466960_0116163
1185 Ga0466959_0061683
1186 Ga0451576_0977521
1187 Ga0466958_0013947
1188 Ga0466958_0027857
1189 Ga0466958_0049073
1190 Ga0466967_0000305
1191 Ga0466967_0014043
1192 Ga0466967_0023465
1193 Ga0466967_0097796
1194 Ga0466967_0125450
1195 Ga0466967_0638170
1196 Ga0495592_0019083
1197 Ga0495592_0409108
1198 Ga0495592_0532650
1199 Ga0495603_0013923
1200 Ga0495603_0099071
1201 Ga0495603_0131789
1202 Ga0495603_0506114
1203 Ga0495590_0132826
1204 Ga0495629_0012147
1205 Ga0495629_0016163
1206 Ga0495629_0324979
1207 Ga0495641_0000374
1208 Ga0495641_0005898
1209 Ga0495641_0039909
1210 Ga0495641_0054876
1211 Ga0495651_0025724
1212 Ga0495651_0597754
1213 Ga0495653_0031666
1214 Ga0495653_0255248
1215 Ga0495580_0081573
1216 Ga0495580_0274955
1217 Ga0495582_0000124
1218 Ga0495582_0013762
1219 Ga0495639_0000786
1220 Ga0495662_0011617
1221 Ga0495664_0235129
1222 Ga0495584_0070933
1223 Ga0495584_0168617
1224 Ga0495584_0245232
1225 Ga0495594_0000340
1226 Ga0495594_0131420
1227 Ga0495607_0062799
1228 Ga0495608_0042588
1229 Ga0495618_0034298
1230 Ga0495618_0516246
1231 Ga0495628_0650699
1232 Ga0495630_0015163
1233 Ga0495630_0039313
1234 Ga0495630_0528420
1235 Ga0495637_0075180
1236 Ga0495637_0182039
1237 Ga0495663_0063013
1238 Ga0495666_0008147
1239 Ga0495642_0072435
1240 Ga0495652_0160456
1241 Ga0495652_0176999
1242 Ga0495665_0003068
1243 Ga0495640_0443210
1244 Ga0495598_0045169
1245 Ga0495598_0077579
1246 Ga0495609_0111759
1247 Ga0495597_0293837
1248 Ga0495645_0252776
1249 Ga0495633_0433894
1250 Ga0495667_0035954
1251 Ga0495656_0014479
1252 Ga0495634_0160953
1253 Ga0495635_0005548
1254 Ga0495635_0111310
1255 Ga0495635_0251207
1256 Ga0495635_0508071
1257 Ga0495659_0118309
1258 Ga0495659_0201582
1259 Ga0495661_0089784
1260 Ga0495588_0003233
1261 Ga0495647_0048009
1262 Ga0495647_0367366
1263 Ga0495658_0000247
1264 Ga0495613_0007600
1265 Ga0495613_0164892
1266 Ga0495613_0304822
1267 Ga0495613_0560157
1268 Ga0495613_0674125
1269 Ga0495624_0012838
1270 Ga0495670_0092785
1271 Ga0495670_0145427
1272 Ga0495671_0166031
1273 Ga0495589_0057079
1274 Ga0495581_0003701
1275 Ga0495604_0047680
1276 Ga0495604_0241374
1277 Ga0495636_0141441
1278 Ga0495674_0877600
1279 Ga0495676_0001077
1280 Ga0495676_0001422
1281 Ga0495676_0039372
1282 Ga0495676_0079007
1283 Ga0495676_0257125
1284 Ga0495676_0940413
1285 Ga0495679_094099
1286 Ga0495684_0050248
1287 Ga0495684_0393133
1288 Ga0495684_0610720
1289 Ga0495593_0006462
1290 Ga0495602_0123551
1291 Ga0495614_0038041
1292 Ga0495615_0042566
1293 Ga0495615_0067399
1294 Ga0496100_0006343
1295 Ga0496100_0134527
1296 Ga0496100_0239288
1297 Ga0496100_0467043
1298 Ga0496100_0483671
1299 Ga0496100_0535275
1300 Ga0496101_0010725
1301 Ga0496101_0014565
1302 Ga0496101_0138062
1303 Ga0496101_0239761
1304 Ga0496101_0438002
1305 Ga0496102_0013540
1306 Ga0496102_0052433
1307 Ga0496102_0134736
1308 Ga0496102_0170148
1309 Ga0496103_0091108
1310 Ga0496103_0209933
1311 Ga0496104_0000606
1312 Ga0496104_0014093
1313 Ga0496104_0120944
1314 Ga0496104_0138543
1315 Ga0496104_0215181
1316 Ga0496104_0304389
1317 Ga0496105_0000182
1318 Ga0496105_0037736
1319 Ga0496105_0066251
1320 Ga0496105_0110450
1321 Ga0496105_0176321
1322 Ga0496105_0341286
1323 Ga0496105_0489642
1324 Ga0496106_0011036
1325 Ga0496106_0016722
1326 Ga0496106_0054642
1327 Ga0496106_0101500
1328 Ga0496106_0156092
1329 Ga0496107_0009675
1330 Ga0496107_0098049
1331 Ga0496107_0168821
1332 Ga0496107_0537534
1333 Ga0496108_0000777
1334 Ga0496108_0031197
1335 Ga0496108_0040239
1336 Ga0496108_0064473
1337 Ga0496108_0157581
1338 Ga0496108_0612220
1339 Ga0496108_0638154
1340 Ga0496109_0000403
1341 Ga0496109_0007741
1342 Ga0496109_0009153
1343 Ga0496109_0229702
1344 Ga0496109_0310604
1345 Ga0496109_0495375
1346 Ga0496109_1154272
1347 Ga0496110_0000581
1348 Ga0496110_0022850
1349 Ga0496110_0023457
1350 Ga0496110_0026058
1351 Ga0496110_0067762
1352 Ga0496110_0214988
1353 Ga0496110_0404156
1354 Ga0496110_0613329
1355 Ga0496110_0690897
1356 Ga0496110_1122586
1357 Ga0496110_1667969
1358 Ga0496111_0000076
1359 Ga0496111_0006195
1360 Ga0496111_0019420
1361 Ga0496111_0029346
1362 Ga0496112_0000832
1363 Ga0496112_0031945
1364 Ga0496112_0116989
1365 Ga0496112_0152774
1366 Ga0496112_0165505
1367 Ga0496112_0218751
1368 Ga0496112_0220299
1369 Ga0496112_0263445
1370 Ga0496112_0291082
1371 Ga0496112_0644627
1372 Ga0496112_1163169
1373 Ga0496113_0000424
1374 Ga0496113_0069096
1375 Ga0496113_0096092
1376 Ga0496113_0129082
1377 Ga0496113_0132516
1378 Ga0496113_0232994
1379 Ga0496113_0487851
1380 Ga0496114_0042144
1381 Ga0496114_0050148
1382 Ga0496114_0068310
1383 Ga0496114_0097464
1384 Ga0496114_0114789
1385 Ga0496114_0120943
1386 Ga0496114_0233315
1387 Ga0496114_0270878
1388 Ga0496114_0384025
1389 Ga0496115_0001178
1390 Ga0496115_0036527
1391 Ga0496115_0047479
1392 Ga0496115_0142275
1393 Ga0496115_0280435
1394 Ga0501291_025358
1395 Ga0501031_0012215
1396 Ga0501031_0051205
1397 Ga0501032_0002668
1398 Ga0501032_0617495
1399 Ga0501033_0005054
1400 Ga0501033_0139052
1401 Ga0501033_0640532
1402 Ga0501034_0751400
1403 Ga0501036_0000693
1404 Ga0501036_0040031
1405 Ga0501036_0068181
1406 Ga0501037_0040290
1407 Ga0501038_0000548
1408 Ga0501038_0022399
1409 Ga0501039_0000176
1410 Ga0501039_0025073
1411 Ga0501039_0105102
1412 Ga0501039_0390350
1413 Ga0501040_0013388
1414 Ga0501040_0048306
1415 Ga0501040_0176566
1416 Ga0501041_0000022
1417 Ga0501041_0076183
1418 Ga0501041_0182726
1419 Ga0501042_0000092
1420 Ga0501042_0008327
1421 Ga0501042_0314941
1422 Ga0501043_0000891
1423 Ga0501046_0002474
1424 Ga0501046_0041525
1425 Ga0501046_0704815
1426 Ga0501047_0010177
1427 Ga0501047_0744764
1428 Ga0501048_0001223
1429 Ga0501048_0023508
1430 Ga0501048_0370590
1431 Ga0501048_0601281
1432 Ga0501067_0002569
1433 Ga0501067_0033702
1434 Ga0501067_0283926
1435 Ga0501068_0000554
1436 Ga0501068_0016638
1437 Ga0501068_0143665
1438 Ga0501068_0343150
1439 Ga0501069_0005499
1440 Ga0501069_0008128
1441 Ga0501069_0025761
1442 Ga0501069_0045322
1443 Ga0501070_0008506
1444 Ga0501070_0037529
1445 Ga0501070_0129553
1446 Ga0501071_0026502
1447 Ga0501071_0091995
1448 Ga0501071_0156085
1449 Ga0501072_0003510
1450 Ga0501072_0035421
1451 Ga0501072_0063745
1452 Ga0501073_0012723
1453 Ga0501074_0002118
1454 Ga0501074_0023101
1455 Ga0501074_0430848
1456 Ga0501074_0904165
1457 Ga0501075_0000040
1458 Ga0501075_0022523
1459 Ga0501075_0083110
1460 Ga0501075_0208247
1461 Ga0501075_0276316
1462 Ga0501075_0428959
1463 Ga0501076_0000462
1464 Ga0501076_0018932
1465 Ga0501076_0145768
1466 Ga0501076_0309453
1467 Ga0501076_0337586
1468 Ga0501076_0466832
1469 Ga0501076_0820192
1470 Ga0501076_0872168
1471 Ga0501077_0001230
1472 Ga0501077_0022967
1473 Ga0501077_0040233
1474 Ga0501077_0107389
1475 Ga0501077_0298681
1476 Ga0501217_107907
1477 Ga0501079_0037028
1478 Ga0501079_0056934
1479 Ga0501079_0057448
1480 Ga0501079_0349600
1481 Ga0501080_0020429
1482 Ga0501080_0076027
1483 Ga0501080_0142318
1484 Ga0501080_0265002
1485 Ga0501081_0000040
1486 Ga0501081_0013087
1487 Ga0501081_0192855
1488 Ga0501083_0000928
1489 Ga0501083_0227300
1490 Ga0501083_0359214
1491 Ga0501035_0006640
1492 Ga0501035_0045759
1493 Ga0501044_0152827
1494 Ga0501045_0000098
1495 Ga0501045_0013753
1496 Ga0501045_0074738
1497 Ga0501045_0139616
1498 Ga0501045_0210039
1499 Ga0501045_0220141
1500 Ga0501045_0306116
1501 nmdc:mga00v17_207208_c1
1502 nmdc:mga0yw44_282340_c1
1503 nmdc:mga05p37_3875_c1
1504 nmdc:mga05p37_62072_c1
1505 nmdc:mga05p37_648715_c1
1506 nmdc:mga09592_185253_c1
1507 nmdc:mga09592_39124_c1
1508 nmdc:mga09592_5576_c1
1509 nmdc:mga0qj67_21076_c1
1510 nmdc:mga0qj67_25076_c1
1511 nmdc:mga06r32_28316_c1
1512 nmdc:mga06r32_499515_c1
1513 nmdc:mga06r32_74469_c1
1514 nmdc:mga06r32_828013_c1
1515 nmdc:mga08y16_523772_c1
1516 nmdc:mga08y16_816734_c1
1517 nmdc:mga0n895_13798_c1
1518 nmdc:mga0n895_6128_c1
1519 nmdc:mga0rr50_26606_c1
1520 nmdc:mga0rr50_297455_c1
1521 nmdc:mga0rr50_3510_c1
1522 nmdc:mga0rr50_985000_c1
1523 nmdc:mga08x19_472975_c1
1524 nmdc:mga0a205_109331_c1
1525 nmdc:mga0a205_5955_c1
1526 Ga0495601_0315156
1527 Ga0495601_0441002
1528 Ga0495612_0343383
1529 Ga0495655_0050425
1530 Ga0495595_0033117
1531 Ga0495619_0064237
1532 Ga0495619_0460687
1533 Ga0500628_065359
1534 Ga0501084_0000228
1535 Ga0501084_0022100
1536 Ga0501084_0051910
1537 Ga0501084_0176697
1538 Ga0501084_0197374
1539 Ga0590075_025861
1540 Ga0590077_050826
1541 Ga0587079_043538
1542 Ga0587107_049593
1543 Ga0501082_0000313
1544 Ga0501082_0012188
1545 Ga0501082_0225537
1546 Ga0501082_0357092
1547 Ga0530510_0000233
1548 Ga0530510_0019256
1549 Ga0530510_0043860
1550 Ga0530510_0058431
1551 Ga0530510_0273079
1552 Ga0530510_1055520

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

49

206

0.99

Map