F480298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 347 | 1552 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10304404|Ga0081455_103044042 |
| Length | 208 |
| Sequence | VPALLGLMHMLREKRVALGHIGGGLALLGSLMFMLFWGASLMEWQMVRGSADPVQMAALLDRIRVDYYGQETPLNQLSTINVPEARLLTIQPYDPSSIKSIERALQESDLGLTPSNDGKLIRLPIPQLTEERREELVKVVRHRAEEGRVAVRNVRRDCIHHLKELVRDGEVGDDEERRAEEQTQKLTDNHIAKIDEILKRKEAEILEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 83 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 192 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 193 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 200 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 201 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 204 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 205 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 343 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 344 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.1 |
| Metatranscriptomes | 0.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 13.14 |
| Rhizosphere | 85.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10304404 | 3300005937 | Bacteria | 1142 |
| 2 | JGI24743J22301_10063257 | 3300001991 | Bacteria | 764 |
| 3 | JGI25406J46586_10034387 | 3300003203 | Bacteria | 1861 |
| 4 | Ga0070658_10343741 | 3300005327 | Bacteria | 1276 |
| 5 | Ga0070683_100003014 | 3300005329 | Bacteria | 13523 |
| 6 | Ga0070683_100726188 | 3300005329 | Bacteria | 951 |
| 7 | Ga0070670_100526919 | 3300005331 | Bacteria | 1052 |
| 8 | Ga0070670_101335444 | 3300005331 | Bacteria | 657 |
| 9 | Ga0070682_100008758 | 3300005337 | Bacteria | 5710 |
| 10 | Ga0070682_100084214 | 3300005337 | Bacteria | 2066 |
| 11 | Ga0070682_100708966 | 3300005337 | Bacteria | 808 |
| 12 | Ga0068868_100505137 | 3300005338 | Bacteria | 1059 |
| 13 | Ga0070660_100013030 | 3300005339 | Bacteria | 5950 |
| 14 | Ga0070660_100159312 | 3300005339 | Bacteria | 1818 |
| 15 | Ga0070689_100237632 | 3300005340 | Bacteria | 1500 |
| 16 | Ga0070691_10210417 | 3300005341 | Bacteria | 1026 |
| 17 | Ga0070661_100636543 | 3300005344 | Bacteria | 865 |
| 18 | Ga0070692_10154936 | 3300005345 | Bacteria | 1308 |
| 19 | Ga0070668_100042964 | 3300005347 | Bacteria | 3465 |
| 20 | Ga0070671_100114415 | 3300005355 | Bacteria | 2268 |
| 21 | Ga0070671_100550539 | 3300005355 | Bacteria | 995 |
| 22 | Ga0070673_100566896 | 3300005364 | Bacteria | 1033 |
| 23 | Ga0070673_101441389 | 3300005364 | Bacteria | 649 |
| 24 | Ga0070659_100070513 | 3300005366 | Bacteria | 2776 |
| 25 | Ga0070703_10194467 | 3300005406 | Bacteria | 792 |
| 26 | Ga0070709_10274128 | 3300005434 | Bacteria | 1223 |
| 27 | Ga0070709_10491325 | 3300005434 | Bacteria | 931 |
| 28 | Ga0070714_100023226 | 3300005435 | Bacteria | 5091 |
| 29 | Ga0070714_100548407 | 3300005435 | Bacteria | 1107 |
| 30 | Ga0070713_100085262 | 3300005436 | Bacteria | 2705 |
| 31 | Ga0070713_100116999 | 3300005436 | Bacteria | 2332 |
| 32 | Ga0070713_100510578 | 3300005436 | Bacteria | 1135 |
| 33 | Ga0070713_100937162 | 3300005436 | Bacteria | 834 |
| 34 | Ga0070710_10177447 | 3300005437 | Bacteria | 1331 |
| 35 | Ga0070710_10580525 | 3300005437 | Bacteria | 778 |
| 36 | Ga0070711_100289630 | 3300005439 | Bacteria | 1298 |
| 37 | Ga0070711_100597271 | 3300005439 | Bacteria | 920 |
| 38 | Ga0070705_100044138 | 3300005440 | Bacteria | 2559 |
| 39 | Ga0070708_100010109 | 3300005445 | Bacteria | 7636 |
| 40 | Ga0070663_100049856 | 3300005455 | Bacteria | 2975 |
| 41 | Ga0070663_100257678 | 3300005455 | Bacteria | 1383 |
| 42 | Ga0070678_100089311 | 3300005456 | Bacteria | 2358 |
| 43 | Ga0070678_101246469 | 3300005456 | Bacteria | 691 |
| 44 | Ga0070662_100084293 | 3300005457 | Bacteria | 2374 |
| 45 | Ga0070662_100229295 | 3300005457 | Bacteria | 1485 |
| 46 | Ga0070662_100526942 | 3300005457 | Bacteria | 988 |
| 47 | Ga0070681_10010617 | 3300005458 | Bacteria | 9101 |
| 48 | Ga0070681_10020004 | 3300005458 | Bacteria | 6707 |
| 49 | Ga0070681_10028129 | 3300005458 | Bacteria | 5652 |
| 50 | Ga0070681_10206595 | 3300005458 | Bacteria | 1881 |
| 51 | Ga0070685_10650418 | 3300005466 | Bacteria | 764 |
| 52 | Ga0070706_100492332 | 3300005467 | Bacteria | 1141 |
| 53 | Ga0070706_100771109 | 3300005467 | Bacteria | 891 |
| 54 | Ga0070706_100855698 | 3300005467 | Bacteria | 841 |
| 55 | Ga0070698_100162922 | 3300005471 | Bacteria | 2174 |
| 56 | Ga0070698_100380701 | 3300005471 | Bacteria | 1344 |
| 57 | Ga0070699_100008553 | 3300005518 | Bacteria | 8868 |
| 58 | Ga0070699_100109701 | 3300005518 | Bacteria | 2422 |
| 59 | Ga0070679_100019792 | 3300005530 | Bacteria | 6553 |
| 60 | Ga0070679_100029031 | 3300005530 | Bacteria | 5455 |
| 61 | Ga0070679_100224293 | 3300005530 | Bacteria | 1840 |
| 62 | Ga0070679_100328963 | 3300005530 | Bacteria | 1477 |
| 63 | Ga0070679_100817945 | 3300005530 | Bacteria | 875 |
| 64 | Ga0070684_100004862 | 3300005535 | Bacteria | 10270 |
| 65 | Ga0070684_100066833 | 3300005535 | Bacteria | 3156 |
| 66 | Ga0070684_100172639 | 3300005535 | Bacteria | 1964 |
| 67 | Ga0070684_100632693 | 3300005535 | Bacteria | 995 |
| 68 | Ga0070684_100892624 | 3300005535 | Bacteria | 833 |
| 69 | Ga0068853_100306084 | 3300005539 | Bacteria | 1470 |
| 70 | Ga0070672_100126365 | 3300005543 | Bacteria | 2097 |
| 71 | Ga0070686_100441991 | 3300005544 | Bacteria | 998 |
| 72 | Ga0070693_100003389 | 3300005547 | Bacteria | 7419 |
| 73 | Ga0070693_100229444 | 3300005547 | Bacteria | 1221 |
| 74 | Ga0070665_100428569 | 3300005548 | Bacteria | 1331 |
| 75 | Ga0070665_100894141 | 3300005548 | Bacteria | 901 |
| 76 | Ga0070704_100071852 | 3300005549 | Bacteria | 2516 |
| 77 | Ga0070704_100959250 | 3300005549 | Bacteria | 772 |
| 78 | Ga0068855_100024333 | 3300005563 | Bacteria | 7248 |
| 79 | Ga0068855_100155801 | 3300005563 | Bacteria | 2595 |
| 80 | Ga0068855_100637558 | 3300005563 | Bacteria | 1146 |
| 81 | Ga0070664_100497105 | 3300005564 | Bacteria | 1124 |
| 82 | Ga0068857_100414187 | 3300005577 | Bacteria | 1255 |
| 83 | Ga0068857_101019805 | 3300005577 | Bacteria | 797 |
| 84 | Ga0068856_100162226 | 3300005614 | Bacteria | 2246 |
| 85 | Ga0068856_100343762 | 3300005614 | Bacteria | 1510 |
| 86 | Ga0068856_100574325 | 3300005614 | Bacteria | 1149 |
| 87 | Ga0068856_100697450 | 3300005614 | Bacteria | 1035 |
| 88 | Ga0068856_101627950 | 3300005614 | Bacteria | 658 |
| 89 | Ga0068852_100047629 | 3300005616 | Bacteria | 3657 |
| 90 | Ga0068859_100929429 | 3300005617 | Bacteria | 954 |
| 91 | Ga0068864_100208213 | 3300005618 | Bacteria | 1800 |
| 92 | Ga0068866_10481192 | 3300005718 | Bacteria | 818 |
| 93 | Ga0068861_100001363 | 3300005719 | Bacteria | 15367 |
| 94 | Ga0068870_10277864 | 3300005840 | Bacteria | 1049 |
| 95 | Ga0068863_100765658 | 3300005841 | Bacteria | 962 |
| 96 | Ga0068862_100982179 | 3300005844 | Bacteria | 834 |
| 97 | Ga0068862_101021210 | 3300005844 | Bacteria | 819 |
| 98 | Ga0081455_10099280 | 3300005937 | Bacteria | 2342 |
| 99 | Ga0081539_10001263 | 3300005985 | Bacteria | 44753 |
| 100 | Ga0070717_10101540 | 3300006028 | Bacteria | 2443 |
| 101 | Ga0070717_10104256 | 3300006028 | Bacteria | 2412 |
| 102 | Ga0075365_10266046 | 3300006038 | Bacteria | 1206 |
| 103 | Ga0075432_10021754 | 3300006058 | Bacteria | 2192 |
| 104 | Ga0070715_10047213 | 3300006163 | Bacteria | 1834 |
| 105 | Ga0070716_100012314 | 3300006173 | Bacteria | 4332 |
| 106 | Ga0070712_100409383 | 3300006175 | Bacteria | 1122 |
| 107 | Ga0070712_100828484 | 3300006175 | Bacteria | 795 |
| 108 | Ga0097621_100102787 | 3300006237 | Bacteria | 2406 |
| 109 | Ga0068871_100026340 | 3300006358 | Bacteria | 4536 |
| 110 | Ga0075428_100009035 | 3300006844 | Bacteria | 11060 |
| 111 | Ga0075428_100084482 | 3300006844 | Bacteria | 3463 |
| 112 | Ga0075428_100215700 | 3300006844 | Bacteria | 2073 |
| 113 | Ga0075430_100011120 | 3300006846 | Bacteria | 7629 |
| 114 | Ga0075430_100301449 | 3300006846 | Bacteria | 1325 |
| 115 | Ga0075431_100002708 | 3300006847 | Bacteria | 17182 |
| 116 | Ga0075431_100585624 | 3300006847 | Bacteria | 1101 |
| 117 | Ga0075431_101246092 | 3300006847 | Bacteria | 706 |
| 118 | Ga0075433_10005381 | 3300006852 | Bacteria | 10057 |
| 119 | Ga0075433_10155958 | 3300006852 | Bacteria | 2031 |
| 120 | Ga0075433_10289983 | 3300006852 | Bacteria | 1449 |
| 121 | Ga0075434_100000119 | 3300006871 | Bacteria | 45877 |
| 122 | Ga0075434_100043574 | 3300006871 | Bacteria | 4451 |
| 123 | Ga0075434_100148416 | 3300006871 | Bacteria | 2365 |
| 124 | Ga0075429_100013670 | 3300006880 | Bacteria | 7038 |
| 125 | Ga0075429_100027684 | 3300006880 | Bacteria | 4920 |
| 126 | Ga0075429_100127147 | 3300006880 | Bacteria | 2229 |
| 127 | Ga0075429_100137938 | 3300006880 | Bacteria | 2135 |
| 128 | Ga0097620_100929420 | 3300006931 | Bacteria | 954 |
| 129 | Ga0075435_100013923 | 3300007076 | Bacteria | 5998 |
| 130 | Ga0075435_100019498 | 3300007076 | Bacteria | 5183 |
| 131 | Ga0075435_100058953 | 3300007076 | Bacteria | 3111 |
| 132 | Ga0105240_10031263 | 3300009093 | Bacteria | 6906 |
| 133 | Ga0105240_10209059 | 3300009093 | Bacteria | 2282 |
| 134 | Ga0105240_10241083 | 3300009093 | Bacteria | 2096 |
| 135 | Ga0111539_10315949 | 3300009094 | Bacteria | 1818 |
| 136 | Ga0111539_10357882 | 3300009094 | Bacteria | 1699 |
| 137 | Ga0105245_10991458 | 3300009098 | Bacteria | 884 |
| 138 | Ga0114129_10023134 | 3300009147 | Bacteria | 8814 |
| 139 | Ga0114129_10074244 | 3300009147 | Bacteria | 4737 |
| 140 | Ga0114129_10163685 | 3300009147 | Bacteria | 3037 |
| 141 | Ga0114129_11178583 | 3300009147 | Bacteria | 955 |
| 142 | Ga0114129_11936319 | 3300009147 | Bacteria | 714 |
| 143 | Ga0105243_10220725 | 3300009148 | Bacteria | 1675 |
| 144 | Ga0105243_10321517 | 3300009148 | Bacteria | 1410 |
| 145 | Ga0105243_11003184 | 3300009148 | Bacteria | 838 |
| 146 | Ga0105241_10086381 | 3300009174 | Bacteria | 2467 |
| 147 | Ga0105241_10229031 | 3300009174 | Bacteria | 1566 |
| 148 | Ga0105242_10115337 | 3300009176 | Bacteria | 2296 |
| 149 | Ga0105242_10168618 | 3300009176 | Bacteria | 1922 |
| 150 | Ga0105242_10388453 | 3300009176 | Bacteria | 1299 |
| 151 | Ga0105242_10467465 | 3300009176 | Bacteria | 1192 |
| 152 | Ga0105238_10240837 | 3300009551 | Bacteria | 1786 |
| 153 | Ga0105238_10661389 | 3300009551 | Bacteria | 1055 |
| 154 | Ga0105249_10051441 | 3300009553 | Bacteria | 3758 |
| 155 | Ga0105239_10063495 | 3300010375 | Bacteria | 4055 |
| 156 | Ga0105246_10654402 | 3300011119 | Bacteria | 915 |
| 157 | Ga0157343_1001271 | 3300012488 | Bacteria | 1203 |
| 158 | Ga0157341_1004565 | 3300012494 | Bacteria | 1006 |
| 159 | Ga0157373_10135400 | 3300013100 | Bacteria | 1732 |
| 160 | Ga0157370_10019560 | 3300013104 | Bacteria | 6786 |
| 161 | Ga0157370_10508474 | 3300013104 | Bacteria | 1106 |
| 162 | Ga0157369_10001856 | 3300013105 | Bacteria | 25507 |
| 163 | Ga0157369_10124289 | 3300013105 | Bacteria | 2736 |
| 164 | Ga0157369_11728073 | 3300013105 | Bacteria | 636 |
| 165 | Ga0163162_10039041 | 3300013306 | Bacteria | 4740 |
| 166 | Ga0157372_10059751 | 3300013307 | Bacteria | 4265 |
| 167 | Ga0157372_10597208 | 3300013307 | Bacteria | 1287 |
| 168 | Ga0157372_10767501 | 3300013307 | Bacteria | 1121 |
| 169 | Ga0157372_11582292 | 3300013307 | Bacteria | 755 |
| 170 | Ga0157375_10067646 | 3300013308 | Bacteria | 3570 |
| 171 | Ga0157375_10819227 | 3300013308 | Bacteria | 1079 |
| 172 | Ga0163163_10003631 | 3300014325 | Bacteria | 13119 |
| 173 | Ga0157380_10652129 | 3300014326 | Bacteria | 1050 |
| 174 | Ga0157377_10235083 | 3300014745 | Bacteria | 1180 |
| 175 | Ga0157376_10025932 | 3300014969 | Bacteria | 4624 |
| 176 | Ga0182005_1238906 | 3300015265 | Bacteria | 558 |
| 177 | Ga0163161_10163995 | 3300017792 | Bacteria | 1696 |
| 178 | Ga0197907_10856740 | 3300020069 | Bacteria | 676 |
| 179 | Ga0206354_11629680 | 3300020081 | Bacteria | 1208 |
| 180 | Ga0206353_10342286 | 3300020082 | Bacteria | 1282 |
| 181 | Ga0206353_11182390 | 3300020082 | Bacteria | 6192 |
| 182 | Ga0154015_1093925 | 3300020610 | Bacteria | 708 |
| 183 | Ga0207642_10317527 | 3300025899 | Bacteria | 909 |
| 184 | Ga0207688_10255804 | 3300025901 | Bacteria | 1062 |
| 185 | Ga0207680_10562360 | 3300025903 | Bacteria | 814 |
| 186 | Ga0207699_10080489 | 3300025906 | Bacteria | 2019 |
| 187 | Ga0207643_10306323 | 3300025908 | Bacteria | 989 |
| 188 | Ga0207643_10420807 | 3300025908 | Bacteria | 847 |
| 189 | Ga0207643_10799605 | 3300025908 | Bacteria | 611 |
| 190 | Ga0207705_10030135 | 3300025909 | Bacteria | 3870 |
| 191 | Ga0207705_10141569 | 3300025909 | Bacteria | 1797 |
| 192 | Ga0207684_10162562 | 3300025910 | Bacteria | 1923 |
| 193 | Ga0207684_10539474 | 3300025910 | Bacteria | 998 |
| 194 | Ga0207684_10634987 | 3300025910 | Bacteria | 910 |
| 195 | Ga0207707_10015097 | 3300025912 | Bacteria | 6724 |
| 196 | Ga0207707_10092988 | 3300025912 | Bacteria | 2634 |
| 197 | Ga0207707_10173536 | 3300025912 | Bacteria | 1884 |
| 198 | Ga0207707_10243733 | 3300025912 | Bacteria | 1562 |
| 199 | Ga0207695_10139731 | 3300025913 | Bacteria | 2372 |
| 200 | Ga0207695_10223399 | 3300025913 | Bacteria | 1790 |
| 201 | Ga0207693_10024259 | 3300025915 | Bacteria | 4815 |
| 202 | Ga0207693_10325760 | 3300025915 | Bacteria | 1202 |
| 203 | Ga0207693_10420738 | 3300025915 | Bacteria | 1044 |
| 204 | Ga0207663_10761479 | 3300025916 | Bacteria | 769 |
| 205 | Ga0207660_10017592 | 3300025917 | Bacteria | 4752 |
| 206 | Ga0207657_10008781 | 3300025919 | Bacteria | 10227 |
| 207 | Ga0207657_10149711 | 3300025919 | Bacteria | 1902 |
| 208 | Ga0207649_10347847 | 3300025920 | Bacteria | 1096 |
| 209 | Ga0207649_10560196 | 3300025920 | Bacteria | 875 |
| 210 | Ga0207649_10823926 | 3300025920 | Bacteria | 725 |
| 211 | Ga0207652_10010746 | 3300025921 | Bacteria | 7371 |
| 212 | Ga0207652_10136449 | 3300025921 | Bacteria | 2191 |
| 213 | Ga0207652_10261768 | 3300025921 | Bacteria | 1560 |
| 214 | Ga0207646_10110015 | 3300025922 | Bacteria | 2472 |
| 215 | Ga0207646_10224199 | 3300025922 | Bacteria | 1698 |
| 216 | Ga0207646_10478957 | 3300025922 | Bacteria | 1122 |
| 217 | Ga0207646_10580885 | 3300025922 | Bacteria | 1006 |
| 218 | Ga0207650_10024849 | 3300025925 | Bacteria | 4264 |
| 219 | Ga0207650_10381072 | 3300025925 | Bacteria | 1165 |
| 220 | Ga0207659_10046096 | 3300025926 | Bacteria | 3077 |
| 221 | Ga0207687_10010459 | 3300025927 | Bacteria | 6059 |
| 222 | Ga0207687_10134720 | 3300025927 | Bacteria | 1867 |
| 223 | Ga0207700_10080374 | 3300025928 | Bacteria | 2542 |
| 224 | Ga0207700_10572774 | 3300025928 | Bacteria | 1004 |
| 225 | Ga0207664_10442617 | 3300025929 | Bacteria | 1159 |
| 226 | Ga0207644_10090645 | 3300025931 | Bacteria | 2278 |
| 227 | Ga0207644_10945852 | 3300025931 | Bacteria | 723 |
| 228 | Ga0207690_10018243 | 3300025932 | Bacteria | 4302 |
| 229 | Ga0207706_10121292 | 3300025933 | Bacteria | 2299 |
| 230 | Ga0207706_10391212 | 3300025933 | Bacteria | 1206 |
| 231 | Ga0207686_10825510 | 3300025934 | Bacteria | 744 |
| 232 | Ga0207709_10651534 | 3300025935 | Bacteria | 838 |
| 233 | Ga0207709_10694553 | 3300025935 | Bacteria | 814 |
| 234 | Ga0207669_10106341 | 3300025937 | Bacteria | 1869 |
| 235 | Ga0207711_10471374 | 3300025941 | Bacteria | 1169 |
| 236 | Ga0207689_10091397 | 3300025942 | Bacteria | 2501 |
| 237 | Ga0207661_10257329 | 3300025944 | Bacteria | 1554 |
| 238 | Ga0207661_10285142 | 3300025944 | Bacteria | 1477 |
| 239 | Ga0207667_10017419 | 3300025949 | Bacteria | 8086 |
| 240 | Ga0207667_10132905 | 3300025949 | Bacteria | 2563 |
| 241 | Ga0207667_10305552 | 3300025949 | Bacteria | 1625 |
| 242 | Ga0207712_10168281 | 3300025961 | Bacteria | 1711 |
| 243 | Ga0207668_10033183 | 3300025972 | Bacteria | 3417 |
| 244 | Ga0207677_10184879 | 3300026023 | Bacteria | 1643 |
| 245 | Ga0207639_10445987 | 3300026041 | Bacteria | 1174 |
| 246 | Ga0207702_10002546 | 3300026078 | Bacteria | 17159 |
| 247 | Ga0207702_10319430 | 3300026078 | Bacteria | 1478 |
| 248 | Ga0207702_10343373 | 3300026078 | Bacteria | 1426 |
| 249 | Ga0207641_10502267 | 3300026088 | Bacteria | 1178 |
| 250 | Ga0207674_10027345 | 3300026116 | Bacteria | 6036 |
| 251 | Ga0207674_10263741 | 3300026116 | Bacteria | 1670 |
| 252 | Ga0207675_100000541 | 3300026118 | Bacteria | 36871 |
| 253 | Ga0207675_100633920 | 3300026118 | Bacteria | 1074 |
| 254 | Ga0207683_10004028 | 3300026121 | Bacteria | 12708 |
| 255 | Ga0207698_10248851 | 3300026142 | Bacteria | 1625 |
| 256 | Ga0209998_10025190 | 3300027717 | Bacteria | 1294 |
| 257 | Ga0207428_10064085 | 3300027907 | Bacteria | 2902 |
| 258 | Ga0207428_10356831 | 3300027907 | Bacteria | 1075 |
| 259 | Ga0268266_10412377 | 3300028379 | Bacteria | 1279 |
| 260 | Ga0268265_10362848 | 3300028380 | Bacteria | 1327 |
| 261 | Ga0268265_10502403 | 3300028380 | Bacteria | 1143 |
| 262 | Ga0268265_11346359 | 3300028380 | Bacteria | 715 |
| 263 | Ga0265326_10024345 | 3300028558 | Bacteria | 1728 |
| 264 | Ga0265326_10102266 | 3300028558 | Bacteria | 813 |
| 265 | Ga0265319_1002557 | 3300028563 | Bacteria | 9849 |
| 266 | Ga0265319_1016353 | 3300028563 | Bacteria | 2846 |
| 267 | Ga0265319_1060604 | 3300028563 | Bacteria | 1228 |
| 268 | Ga0265334_10013422 | 3300028573 | Bacteria | 3430 |
| 269 | Ga0265334_10165626 | 3300028573 | Bacteria | 775 |
| 270 | Ga0265318_10003094 | 3300028577 | Bacteria | 8544 |
| 271 | Ga0265318_10030320 | 3300028577 | Bacteria | 2105 |
| 272 | Ga0265318_10030334 | 3300028577 | Bacteria | 2104 |
| 273 | Ga0265322_10020839 | 3300028654 | Bacteria | 1878 |
| 274 | Ga0265336_10005714 | 3300028666 | Bacteria | 4559 |
| 275 | Ga0265338_10002058 | 3300028800 | Bacteria | 31087 |
| 276 | Ga0265338_10054250 | 3300028800 | Bacteria | 3576 |
| 277 | Ga0265338_10056315 | 3300028800 | Bacteria | 3488 |
| 278 | Ga0265338_10067959 | 3300028800 | Bacteria | 3073 |
| 279 | Ga0265338_10345560 | 3300028800 | Bacteria | 1071 |
| 280 | Ga0265324_10044403 | 3300029957 | Bacteria | 1532 |
| 281 | Ga0265330_10009834 | 3300031235 | Bacteria | 4526 |
| 282 | Ga0265332_10018123 | 3300031238 | Bacteria | 3104 |
| 283 | Ga0265328_10005742 | 3300031239 | Bacteria | 5299 |
| 284 | Ga0265320_10010065 | 3300031240 | Bacteria | 5654 |
| 285 | Ga0265320_10039231 | 3300031240 | Bacteria | 2370 |
| 286 | Ga0265320_10130692 | 3300031240 | Bacteria | 1141 |
| 287 | Ga0265320_10251962 | 3300031240 | Bacteria | 783 |
| 288 | Ga0265325_10021903 | 3300031241 | Bacteria | 3504 |
| 289 | Ga0265329_10003580 | 3300031242 | Bacteria | 6722 |
| 290 | Ga0265340_10101866 | 3300031247 | Bacteria | 1334 |
| 291 | Ga0265340_10122480 | 3300031247 | Bacteria | 1196 |
| 292 | Ga0265339_10034627 | 3300031249 | Bacteria | 2836 |
| 293 | Ga0265331_10019512 | 3300031250 | Bacteria | 3501 |
| 294 | Ga0265327_10010760 | 3300031251 | Bacteria | 6383 |
| 295 | Ga0265327_10017655 | 3300031251 | Bacteria | 4463 |
| 296 | Ga0265327_10024357 | 3300031251 | Bacteria | 3560 |
| 297 | Ga0265316_10059236 | 3300031344 | Bacteria | 2979 |
| 298 | Ga0265313_10021700 | 3300031595 | Bacteria | 3504 |
| 299 | Ga0265314_10037625 | 3300031711 | Bacteria | 3504 |
| 300 | Ga0265342_10025656 | 3300031712 | Bacteria | 3702 |
| 301 | Ga0307405_10140506 | 3300031731 | Bacteria | 1683 |
| 302 | Ga0307413_10019063 | 3300031824 | Bacteria | 3615 |
| 303 | Ga0307410_10369941 | 3300031852 | Bacteria | 1150 |
| 304 | Ga0307410_10778351 | 3300031852 | Bacteria | 812 |
| 305 | Ga0307406_10625008 | 3300031901 | Bacteria | 891 |
| 306 | Ga0307406_10871192 | 3300031901 | Bacteria | 765 |
| 307 | Ga0307412_10793246 | 3300031911 | Bacteria | 821 |
| 308 | Ga0307409_100128572 | 3300031995 | Bacteria | 2160 |
| 309 | Ga0307409_100325540 | 3300031995 | Bacteria | 1440 |
| 310 | Ga0307409_100561537 | 3300031995 | Bacteria | 1122 |
| 311 | Ga0307416_100308556 | 3300032002 | Bacteria | 1577 |
| 312 | Ga0307416_100459785 | 3300032002 | Bacteria | 1327 |
| 313 | Ga0307415_100072666 | 3300032126 | Bacteria | 2423 |
| 314 | Ga0307415_100083510 | 3300032126 | Bacteria | 2289 |
| 315 | Ga0373944_0004799 | 3300035089 | Bacteria | 3540 |
| 316 | Ga0373944_0038715 | 3300035089 | Bacteria | 1465 |
| 317 | Ga0373945_0004700 | 3300035116 | Bacteria | 4349 |
| 318 | Ga0373945_0005298 | 3300035116 | Bacteria | 4128 |
| 319 | Ga0373943_0000101 | 3300035170 | Bacteria | 31609 |
| 320 | Ga0373943_0030594 | 3300035170 | Bacteria | 2549 |
| 321 | Ga0373943_0090283 | 3300035170 | Bacteria | 1586 |
| 322 | Ga0373943_0375113 | 3300035170 | Bacteria | 818 |
| 323 | Ga0373946_0018922 | 3300035171 | Bacteria | 2648 |
| 324 | Ga0373946_0094565 | 3300035171 | Bacteria | 1330 |
| 325 | Ga0373961_0011018 | 3300035241 | Bacteria | 2238 |
| 326 | Ga0373924_0096467 | 3300035410 | Bacteria | 1269 |
| 327 | Ga0373935_0017891 | 3300035692 | Bacteria | 4305 |
| 328 | Ga0373927_0011038 | 3300035695 | Bacteria | 6018 |
| 329 | Ga0373947_0000788 | 3300035725 | Bacteria | 19051 |
| 330 | Ga0373947_0014095 | 3300035725 | Bacteria | 4583 |
| 331 | Ga0373947_0015882 | 3300035725 | Bacteria | 4324 |
| 332 | Ga0373925_0005074 | 3300037068 | Bacteria | 9852 |
| 333 | Ga0373925_0658328 | 3300037068 | Bacteria | 863 |
| 334 | Ga0395899_0002082 | 3300037312 | Bacteria | 16425 |
| 335 | Ga0395899_0030622 | 3300037312 | Bacteria | 4046 |
| 336 | Ga0395899_0053530 | 3300037312 | Bacteria | 2988 |
| 337 | Ga0395899_0063312 | 3300037312 | Bacteria | 2721 |
| 338 | Ga0395899_0082236 | 3300037312 | Bacteria | 2342 |
| 339 | Ga0395899_0317234 | 3300037312 | Bacteria | 1051 |
| 340 | Ga0395900_0003566 | 3300037418 | Bacteria | 16741 |
| 341 | Ga0395900_0003571 | 3300037418 | Bacteria | 16714 |
| 342 | Ga0395900_0006173 | 3300037418 | Bacteria | 12513 |
| 343 | Ga0395900_0145082 | 3300037418 | Bacteria | 2427 |
| 344 | Ga0395900_0147174 | 3300037418 | Bacteria | 2408 |
| 345 | Ga0395900_0300670 | 3300037418 | Bacteria | 1591 |
| 346 | Ga0395900_0559999 | 3300037418 | Bacteria | 1087 |
| 347 | Ga0395900_1577275 | 3300037418 | Bacteria | 568 |
| 348 | Ga0395898_0001966 | 3300037466 | Bacteria | 25888 |
| 349 | Ga0395898_0003782 | 3300037466 | Bacteria | 16749 |
| 350 | Ga0395898_0004411 | 3300037466 | Bacteria | 15397 |
| 351 | Ga0395898_0010754 | 3300037466 | Bacteria | 9558 |
| 352 | Ga0395898_0050623 | 3300037466 | Bacteria | 4065 |
| 353 | Ga0395898_0071610 | 3300037466 | Bacteria | 3349 |
| 354 | Ga0395898_0095443 | 3300037466 | Bacteria | 2857 |
| 355 | Ga0395898_0108582 | 3300037466 | Bacteria | 2661 |
| 356 | Ga0395898_0131682 | 3300037466 | Bacteria | 2395 |
| 357 | Ga0395898_0151970 | 3300037466 | Bacteria | 2215 |
| 358 | Ga0395898_0155429 | 3300037466 | Bacteria | 2188 |
| 359 | Ga0395898_0205858 | 3300037466 | Bacteria | 1877 |
| 360 | Ga0395898_0582452 | 3300037466 | Bacteria | 1061 |
| 361 | Ga0395898_0811592 | 3300037466 | Bacteria | 876 |
| 362 | Ga0395905_0004551 | 3300037471 | Bacteria | 14359 |
| 363 | Ga0395905_0007392 | 3300037471 | Bacteria | 10922 |
| 364 | Ga0395905_0008109 | 3300037471 | Bacteria | 10376 |
| 365 | Ga0395905_0061244 | 3300037471 | Bacteria | 3520 |
| 366 | Ga0395905_0090076 | 3300037471 | Bacteria | 2875 |
| 367 | Ga0395905_0181075 | 3300037471 | Bacteria | 1978 |
| 368 | Ga0395901_0005629 | 3300038443 | Bacteria | 12676 |
| 369 | Ga0395901_0005947 | 3300038443 | Bacteria | 12356 |
| 370 | Ga0395901_0009334 | 3300038443 | Bacteria | 9945 |
| 371 | Ga0395901_0025215 | 3300038443 | Bacteria | 6105 |
| 372 | Ga0395901_0025603 | 3300038443 | Bacteria | 6056 |
| 373 | Ga0395901_0032655 | 3300038443 | Bacteria | 5369 |
| 374 | Ga0395901_0137866 | 3300038443 | Bacteria | 2564 |
| 375 | Ga0395901_0156670 | 3300038443 | Bacteria | 2392 |
| 376 | Ga0395901_0163335 | 3300038443 | Bacteria | 2338 |
| 377 | Ga0395901_0185962 | 3300038443 | Bacteria | 2179 |
| 378 | Ga0395901_0403124 | 3300038443 | Bacteria | 1405 |
| 379 | Ga0395901_0474037 | 3300038443 | Bacteria | 1277 |
| 380 | Ga0395901_1090955 | 3300038443 | Unclassified | 769 |
| 381 | Ga0436365_1882850 | 3300039437 | Bacteria | 808 |
| 382 | Ga0439436_0050841 | 3300041404 | Bacteria | 1172 |
| 383 | Ga0439439_0001293 | 3300041406 | Bacteria | 4900 |
| 384 | Ga0439447_051928 | 3300041407 | Bacteria | 977 |
| 385 | Ga0439461_0037391 | 3300041410 | Bacteria | 1037 |
| 386 | Ga0451793_1094665 | 3300041452 | Bacteria | 1819 |
| 387 | Ga0451804_1171148 | 3300041463 | Bacteria | 1040 |
| 388 | Ga0451853_0262434 | 3300041512 | Bacteria | 730 |
| 389 | Ga0451853_1687415 | 3300041512 | Bacteria | 758 |
| 390 | Ga0451853_2895983 | 3300041512 | Bacteria | 766 |
| 391 | Ga0439433_0000148 | 3300041999 | Bacteria | 10791 |
| 392 | Ga0439449_0076219 | 3300042007 | Bacteria | 1236 |
| 393 | Ga0439454_001224 | 3300042011 | Bacteria | 2398 |
| 394 | Ga0439457_077834 | 3300042014 | Bacteria | 760 |
| 395 | Ga0439462_0008078 | 3300042015 | Bacteria | 2647 |
| 396 | Ga0450920_014012 | 3300042122 | Bacteria | 1513 |
| 397 | Ga0439446_0011502 | 3300042156 | Bacteria | 2403 |
| 398 | Ga0439434_0009214 | 3300042435 | Bacteria | 2902 |
| 399 | Ga0439435_0204863 | 3300042436 | Bacteria | 652 |
| 400 | Ga0439459_0070956 | 3300042438 | Bacteria | 806 |
| 401 | Ga0466966_0455286 | 3300044684 | Bacteria | 769 |
| 402 | Ga0466963_0002476 | 3300044694 | Bacteria | 10328 |
| 403 | Ga0466963_0004822 | 3300044694 | Bacteria | 7865 |
| 404 | Ga0466963_0014591 | 3300044694 | Bacteria | 4848 |
| 405 | Ga0466968_0095583 | 3300044735 | Bacteria | 1322 |
| 406 | Ga0466968_0137802 | 3300044735 | Bacteria | 1114 |
| 407 | Ga0466957_0664464 | 3300044842 | Bacteria | 733 |
| 408 | Ga0466960_0116163 | 3300044901 | Bacteria | 1396 |
| 409 | Ga0466959_0061683 | 3300045049 | Bacteria | 2726 |
| 410 | Ga0451576_0977521 | 3300045051 | Bacteria | 887 |
| 411 | Ga0466958_0013947 | 3300045836 | Bacteria | 4582 |
| 412 | Ga0466958_0027857 | 3300045836 | Bacteria | 3345 |
| 413 | Ga0466958_0049073 | 3300045836 | Bacteria | 2553 |
| 414 | Ga0466967_0000305 | 3300045976 | Bacteria | 22092 |
| 415 | Ga0466967_0014043 | 3300045976 | Bacteria | 6220 |
| 416 | Ga0466967_0023465 | 3300045976 | Bacteria | 5055 |
| 417 | Ga0466967_0097796 | 3300045976 | Bacteria | 2679 |
| 418 | Ga0466967_0125450 | 3300045976 | Bacteria | 2377 |
| 419 | Ga0466967_0638170 | 3300045976 | Bacteria | 1052 |
| 420 | Ga0495592_0019083 | 3300046454 | Bacteria | 5220 |
| 421 | Ga0495592_0409108 | 3300046454 | Bacteria | 858 |
| 422 | Ga0495592_0532650 | 3300046454 | Bacteria | 725 |
| 423 | Ga0495603_0013923 | 3300046455 | Bacteria | 4864 |
| 424 | Ga0495603_0099071 | 3300046455 | Bacteria | 1702 |
| 425 | Ga0495603_0131789 | 3300046455 | Bacteria | 1455 |
| 426 | Ga0495603_0506114 | 3300046455 | Bacteria | 692 |
| 427 | Ga0495590_0132826 | 3300046457 | Bacteria | 896 |
| 428 | Ga0495629_0012147 | 3300046459 | Bacteria | 6241 |
| 429 | Ga0495629_0016163 | 3300046459 | Bacteria | 5356 |
| 430 | Ga0495629_0324979 | 3300046459 | Bacteria | 1051 |
| 431 | Ga0495641_0000374 | 3300046461 | Bacteria | 37120 |
| 432 | Ga0495641_0005898 | 3300046461 | Bacteria | 8087 |
| 433 | Ga0495641_0039909 | 3300046461 | Bacteria | 2185 |
| 434 | Ga0495641_0054876 | 3300046461 | Bacteria | 1810 |
| 435 | Ga0495651_0025724 | 3300046462 | Bacteria | 4583 |
| 436 | Ga0495651_0597754 | 3300046462 | Bacteria | 696 |
| 437 | Ga0495653_0031666 | 3300046463 | Bacteria | 4202 |
| 438 | Ga0495653_0255248 | 3300046463 | Bacteria | 1162 |
| 439 | Ga0495580_0081573 | 3300046472 | Bacteria | 2254 |
| 440 | Ga0495580_0274955 | 3300046472 | Bacteria | 1150 |
| 441 | Ga0495582_0000124 | 3300046473 | Bacteria | 41197 |
| 442 | Ga0495582_0013762 | 3300046473 | Bacteria | 4454 |
| 443 | Ga0495639_0000786 | 3300046475 | Bacteria | 14467 |
| 444 | Ga0495662_0011617 | 3300046476 | Bacteria | 4304 |
| 445 | Ga0495664_0235129 | 3300046477 | Bacteria | 1108 |
| 446 | Ga0495584_0070933 | 3300046491 | Bacteria | 1751 |
| 447 | Ga0495584_0168617 | 3300046491 | Bacteria | 1113 |
| 448 | Ga0495584_0245232 | 3300046491 | Bacteria | 911 |
| 449 | Ga0495594_0000340 | 3300046499 | Bacteria | 23268 |
| 450 | Ga0495594_0131420 | 3300046499 | Bacteria | 1418 |
| 451 | Ga0495607_0062799 | 3300046501 | Bacteria | 2104 |
| 452 | Ga0495608_0042588 | 3300046511 | Bacteria | 3036 |
| 453 | Ga0495618_0034298 | 3300046514 | Bacteria | 3182 |
| 454 | Ga0495618_0516246 | 3300046514 | Bacteria | 719 |
| 455 | Ga0495628_0650699 | 3300046516 | Bacteria | 748 |
| 456 | Ga0495630_0015163 | 3300046517 | Bacteria | 5623 |
| 457 | Ga0495630_0039313 | 3300046517 | Bacteria | 3537 |
| 458 | Ga0495630_0528420 | 3300046517 | Bacteria | 905 |
| 459 | Ga0495637_0075180 | 3300046520 | Bacteria | 1356 |
| 460 | Ga0495637_0182039 | 3300046520 | Bacteria | 779 |
| 461 | Ga0495663_0063013 | 3300046525 | Bacteria | 1169 |
| 462 | Ga0495666_0008147 | 3300046526 | Bacteria | 5255 |
| 463 | Ga0495642_0072435 | 3300046528 | Bacteria | 1443 |
| 464 | Ga0495652_0160456 | 3300046529 | Bacteria | 1746 |
| 465 | Ga0495652_0176999 | 3300046529 | Bacteria | 1641 |
| 466 | Ga0495665_0003068 | 3300046531 | Bacteria | 9034 |
| 467 | Ga0495640_0443210 | 3300046533 | Bacteria | 794 |
| 468 | Ga0495598_0045169 | 3300046537 | Bacteria | 1304 |
| 469 | Ga0495598_0077579 | 3300046537 | Bacteria | 1059 |
| 470 | Ga0495609_0111759 | 3300046538 | Bacteria | 1179 |
| 471 | Ga0495597_0293837 | 3300046542 | Bacteria | 631 |
| 472 | Ga0495645_0252776 | 3300046543 | Bacteria | 1171 |
| 473 | Ga0495633_0433894 | 3300046558 | Bacteria | 594 |
| 474 | Ga0495667_0035954 | 3300046559 | Bacteria | 3308 |
| 475 | Ga0495656_0014479 | 3300046615 | Bacteria | 2958 |
| 476 | Ga0495634_0160953 | 3300046642 | Bacteria | 1415 |
| 477 | Ga0495635_0005548 | 3300046663 | Bacteria | 8781 |
| 478 | Ga0495635_0111310 | 3300046663 | Bacteria | 1870 |
| 479 | Ga0495635_0251207 | 3300046663 | Bacteria | 1192 |
| 480 | Ga0495635_0508071 | 3300046663 | Bacteria | 793 |
| 481 | Ga0495659_0118309 | 3300046664 | Bacteria | 1041 |
| 482 | Ga0495659_0201582 | 3300046664 | Bacteria | 816 |
| 483 | Ga0495661_0089784 | 3300046665 | Bacteria | 1751 |
| 484 | Ga0495588_0003233 | 3300046674 | Bacteria | 7062 |
| 485 | Ga0495647_0048009 | 3300046681 | Bacteria | 1649 |
| 486 | Ga0495647_0367366 | 3300046681 | Bacteria | 657 |
| 487 | Ga0495658_0000247 | 3300046683 | Bacteria | 30977 |
| 488 | Ga0495613_0007600 | 3300046689 | Bacteria | 8058 |
| 489 | Ga0495613_0164892 | 3300046689 | Bacteria | 1574 |
| 490 | Ga0495613_0304822 | 3300046689 | Bacteria | 1102 |
| 491 | Ga0495613_0560157 | 3300046689 | Bacteria | 764 |
| 492 | Ga0495613_0674125 | 3300046689 | Bacteria | 682 |
| 493 | Ga0495624_0012838 | 3300046690 | Bacteria | 5717 |
| 494 | Ga0495670_0092785 | 3300046691 | Bacteria | 1547 |
| 495 | Ga0495670_0145427 | 3300046691 | Bacteria | 1242 |
| 496 | Ga0495671_0166031 | 3300046692 | Bacteria | 1074 |
| 497 | Ga0495589_0057079 | 3300046794 | Bacteria | 1921 |
| 498 | Ga0495581_0003701 | 3300047315 | Bacteria | 8805 |
| 499 | Ga0495604_0047680 | 3300047317 | Bacteria | 3336 |
| 500 | Ga0495604_0241374 | 3300047317 | Bacteria | 1235 |
| 501 | Ga0495636_0141441 | 3300047318 | Bacteria | 1075 |
| 502 | Ga0495674_0877600 | 3300047319 | Bacteria | 694 |
| 503 | Ga0495676_0001077 | 3300047321 | Bacteria | 23118 |
| 504 | Ga0495676_0001422 | 3300047321 | Bacteria | 20618 |
| 505 | Ga0495676_0039372 | 3300047321 | Bacteria | 3915 |
| 506 | Ga0495676_0079007 | 3300047321 | Bacteria | 2503 |
| 507 | Ga0495676_0257125 | 3300047321 | Bacteria | 1189 |
| 508 | Ga0495676_0940413 | 3300047321 | Bacteria | 553 |
| 509 | Ga0495679_094099 | 3300047446 | Bacteria | 838 |
| 510 | Ga0495684_0050248 | 3300047471 | Bacteria | 3184 |
| 511 | Ga0495684_0393133 | 3300047471 | Bacteria | 975 |
| 512 | Ga0495684_0610720 | 3300047471 | Bacteria | 734 |
| 513 | Ga0495593_0006462 | 3300047673 | Bacteria | 6867 |
| 514 | Ga0495602_0123551 | 3300048088 | Bacteria | 2078 |
| 515 | Ga0495614_0038041 | 3300048089 | Bacteria | 2065 |
| 516 | Ga0495615_0042566 | 3300048090 | Bacteria | 1140 |
| 517 | Ga0495615_0067399 | 3300048090 | Bacteria | 958 |
| 518 | Ga0496100_0006343 | 3300048903 | Bacteria | 6445 |
| 519 | Ga0496100_0134527 | 3300048903 | Bacteria | 1745 |
| 520 | Ga0496100_0239288 | 3300048903 | Bacteria | 1338 |
| 521 | Ga0496100_0467043 | 3300048903 | Bacteria | 969 |
| 522 | Ga0496100_0483671 | 3300048903 | Bacteria | 952 |
| 523 | Ga0496100_0535275 | 3300048903 | Bacteria | 905 |
| 524 | Ga0496101_0010725 | 3300048904 | Bacteria | 6060 |
| 525 | Ga0496101_0014565 | 3300048904 | Bacteria | 5287 |
| 526 | Ga0496101_0138062 | 3300048904 | Bacteria | 1856 |
| 527 | Ga0496101_0239761 | 3300048904 | Bacteria | 1411 |
| 528 | Ga0496101_0438002 | 3300048904 | Bacteria | 1031 |
| 529 | Ga0496102_0013540 | 3300048905 | Bacteria | 7068 |
| 530 | Ga0496102_0052433 | 3300048905 | Bacteria | 3717 |
| 531 | Ga0496102_0134736 | 3300048905 | Bacteria | 2314 |
| 532 | Ga0496102_0170148 | 3300048905 | Bacteria | 2051 |
| 533 | Ga0496103_0091108 | 3300048906 | Bacteria | 1924 |
| 534 | Ga0496103_0209933 | 3300048906 | Bacteria | 1252 |
| 535 | Ga0496104_0000606 | 3300048907 | Bacteria | 30748 |
| 536 | Ga0496104_0014093 | 3300048907 | Bacteria | 7216 |
| 537 | Ga0496104_0120944 | 3300048907 | Bacteria | 2514 |
| 538 | Ga0496104_0138543 | 3300048907 | Bacteria | 2338 |
| 539 | Ga0496104_0215181 | 3300048907 | Bacteria | 1833 |
| 540 | Ga0496104_0304389 | 3300048907 | Bacteria | 1506 |
| 541 | Ga0496105_0000182 | 3300048908 | Bacteria | 41923 |
| 542 | Ga0496105_0037736 | 3300048908 | Bacteria | 3979 |
| 543 | Ga0496105_0066251 | 3300048908 | Bacteria | 2981 |
| 544 | Ga0496105_0110450 | 3300048908 | Bacteria | 2269 |
| 545 | Ga0496105_0176321 | 3300048908 | Bacteria | 1751 |
| 546 | Ga0496105_0341286 | 3300048908 | Bacteria | 1198 |
| 547 | Ga0496105_0489642 | 3300048908 | Bacteria | 967 |
| 548 | Ga0496106_0011036 | 3300048909 | Bacteria | 6678 |
| 549 | Ga0496106_0016722 | 3300048909 | Bacteria | 5427 |
| 550 | Ga0496106_0054642 | 3300048909 | Bacteria | 3017 |
| 551 | Ga0496106_0101500 | 3300048909 | Bacteria | 2232 |
| 552 | Ga0496106_0156092 | 3300048909 | Bacteria | 1802 |
| 553 | Ga0496107_0009675 | 3300048910 | Bacteria | 6684 |
| 554 | Ga0496107_0098049 | 3300048910 | Bacteria | 2147 |
| 555 | Ga0496107_0168821 | 3300048910 | Bacteria | 1623 |
| 556 | Ga0496107_0537534 | 3300048910 | Bacteria | 866 |
| 557 | Ga0496108_0000777 | 3300048911 | Bacteria | 24915 |
| 558 | Ga0496108_0031197 | 3300048911 | Bacteria | 4420 |
| 559 | Ga0496108_0040239 | 3300048911 | Bacteria | 3895 |
| 560 | Ga0496108_0064473 | 3300048911 | Bacteria | 3086 |
| 561 | Ga0496108_0157581 | 3300048911 | Bacteria | 1961 |
| 562 | Ga0496108_0612220 | 3300048911 | Bacteria | 949 |
| 563 | Ga0496108_0638154 | 3300048911 | Bacteria | 926 |
| 564 | Ga0496109_0000403 | 3300048912 | Bacteria | 39012 |
| 565 | Ga0496109_0007741 | 3300048912 | Bacteria | 9095 |
| 566 | Ga0496109_0009153 | 3300048912 | Bacteria | 8433 |
| 567 | Ga0496109_0229702 | 3300048912 | Bacteria | 1745 |
| 568 | Ga0496109_0310604 | 3300048912 | Bacteria | 1487 |
| 569 | Ga0496109_0495375 | 3300048912 | Bacteria | 1153 |
| 570 | Ga0496109_1154272 | 3300048912 | Bacteria | 711 |
| 571 | Ga0496110_0000581 | 3300048913 | Bacteria | 25064 |
| 572 | Ga0496110_0022850 | 3300048913 | Bacteria | 5314 |
| 573 | Ga0496110_0023457 | 3300048913 | Bacteria | 5248 |
| 574 | Ga0496110_0026058 | 3300048913 | Bacteria | 4999 |
| 575 | Ga0496110_0067762 | 3300048913 | Bacteria | 3158 |
| 576 | Ga0496110_0214988 | 3300048913 | Bacteria | 1748 |
| 577 | Ga0496110_0404156 | 3300048913 | Bacteria | 1245 |
| 578 | Ga0496110_0613329 | 3300048913 | Bacteria | 986 |
| 579 | Ga0496110_0690897 | 3300048913 | Bacteria | 921 |
| 580 | Ga0496110_1122586 | 3300048913 | Unclassified | 694 |
| 581 | Ga0496110_1667969 | 3300048913 | Bacteria | 547 |
| 582 | Ga0496111_0000076 | 3300048914 | Bacteria | 40931 |
| 583 | Ga0496111_0006195 | 3300048914 | Bacteria | 7747 |
| 584 | Ga0496111_0019420 | 3300048914 | Bacteria | 4720 |
| 585 | Ga0496111_0029346 | 3300048914 | Bacteria | 3906 |
| 586 | Ga0496112_0000832 | 3300048915 | Bacteria | 21960 |
| 587 | Ga0496112_0031945 | 3300048915 | Bacteria | 5110 |
| 588 | Ga0496112_0116989 | 3300048915 | Bacteria | 2636 |
| 589 | Ga0496112_0152774 | 3300048915 | Bacteria | 2276 |
| 590 | Ga0496112_0165505 | 3300048915 | Bacteria | 2177 |
| 591 | Ga0496112_0218751 | 3300048915 | Bacteria | 1861 |
| 592 | Ga0496112_0220299 | 3300048915 | Bacteria | 1854 |
| 593 | Ga0496112_0263445 | 3300048915 | Bacteria | 1673 |
| 594 | Ga0496112_0291082 | 3300048915 | Bacteria | 1579 |
| 595 | Ga0496112_0644627 | 3300048915 | Bacteria | 989 |
| 596 | Ga0496112_1163169 | 3300048915 | Unclassified | 689 |
| 597 | Ga0496113_0000424 | 3300048916 | Bacteria | 20576 |
| 598 | Ga0496113_0069096 | 3300048916 | Bacteria | 2682 |
| 599 | Ga0496113_0096092 | 3300048916 | Bacteria | 2290 |
| 600 | Ga0496113_0129082 | 3300048916 | Bacteria | 1982 |
| 601 | Ga0496113_0132516 | 3300048916 | Bacteria | 1957 |
| 602 | Ga0496113_0232994 | 3300048916 | Bacteria | 1468 |
| 603 | Ga0496113_0487851 | 3300048916 | Bacteria | 990 |
| 604 | Ga0496114_0042144 | 3300048917 | Bacteria | 3783 |
| 605 | Ga0496114_0050148 | 3300048917 | Bacteria | 3474 |
| 606 | Ga0496114_0068310 | 3300048917 | Bacteria | 2983 |
| 607 | Ga0496114_0097464 | 3300048917 | Bacteria | 2505 |
| 608 | Ga0496114_0114789 | 3300048917 | Bacteria | 2310 |
| 609 | Ga0496114_0120943 | 3300048917 | Bacteria | 2252 |
| 610 | Ga0496114_0233315 | 3300048917 | Bacteria | 1617 |
| 611 | Ga0496114_0270878 | 3300048917 | Bacteria | 1496 |
| 612 | Ga0496114_0384025 | 3300048917 | Bacteria | 1243 |
| 613 | Ga0496115_0001178 | 3300048918 | Bacteria | 18760 |
| 614 | Ga0496115_0036527 | 3300048918 | Bacteria | 3891 |
| 615 | Ga0496115_0047479 | 3300048918 | Bacteria | 3434 |
| 616 | Ga0496115_0142275 | 3300048918 | Bacteria | 1979 |
| 617 | Ga0496115_0280435 | 3300048918 | Bacteria | 1368 |
| 618 | Ga0501291_025358 | 3300049514 | Bacteria | 970 |
| 619 | Ga0501031_0012215 | 3300049568 | Bacteria | 5598 |
| 620 | Ga0501031_0051205 | 3300049568 | Bacteria | 2689 |
| 621 | Ga0501032_0002668 | 3300049569 | Bacteria | 13926 |
| 622 | Ga0501032_0617495 | 3300049569 | Bacteria | 689 |
| 623 | Ga0501033_0005054 | 3300049570 | Bacteria | 10507 |
| 624 | Ga0501033_0139052 | 3300049570 | Bacteria | 1756 |
| 625 | Ga0501033_0640532 | 3300049570 | Bacteria | 727 |
| 626 | Ga0501034_0751400 | 3300049571 | Bacteria | 871 |
| 627 | Ga0501036_0000693 | 3300049572 | Bacteria | 24868 |
| 628 | Ga0501036_0040031 | 3300049572 | Bacteria | 3964 |
| 629 | Ga0501036_0068181 | 3300049572 | Bacteria | 3010 |
| 630 | Ga0501037_0040290 | 3300049573 | Bacteria | 3437 |
| 631 | Ga0501038_0000548 | 3300049574 | Bacteria | 33027 |
| 632 | Ga0501038_0022399 | 3300049574 | Bacteria | 5663 |
| 633 | Ga0501039_0000176 | 3300049575 | Bacteria | 45277 |
| 634 | Ga0501039_0025073 | 3300049575 | Bacteria | 4581 |
| 635 | Ga0501039_0105102 | 3300049575 | Bacteria | 2205 |
| 636 | Ga0501039_0390350 | 3300049575 | Bacteria | 1093 |
| 637 | Ga0501040_0013388 | 3300049576 | Bacteria | 5390 |
| 638 | Ga0501040_0048306 | 3300049576 | Bacteria | 2908 |
| 639 | Ga0501040_0176566 | 3300049576 | Bacteria | 1513 |
| 640 | Ga0501041_0000022 | 3300049577 | Bacteria | 52719 |
| 641 | Ga0501041_0076183 | 3300049577 | Bacteria | 2063 |
| 642 | Ga0501041_0182726 | 3300049577 | Bacteria | 1313 |
| 643 | Ga0501042_0000092 | 3300049578 | Bacteria | 35165 |
| 644 | Ga0501042_0008327 | 3300049578 | Bacteria | 6837 |
| 645 | Ga0501042_0314941 | 3300049578 | Bacteria | 1130 |
| 646 | Ga0501043_0000891 | 3300049579 | Bacteria | 26496 |
| 647 | Ga0501046_0002474 | 3300049580 | Bacteria | 17319 |
| 648 | Ga0501046_0041525 | 3300049580 | Bacteria | 3670 |
| 649 | Ga0501046_0704815 | 3300049580 | Bacteria | 711 |
| 650 | Ga0501047_0010177 | 3300049581 | Bacteria | 8894 |
| 651 | Ga0501047_0744764 | 3300049581 | Bacteria | 796 |
| 652 | Ga0501048_0001223 | 3300049582 | Bacteria | 19432 |
| 653 | Ga0501048_0023508 | 3300049582 | Bacteria | 4502 |
| 654 | Ga0501048_0370590 | 3300049582 | Bacteria | 1022 |
| 655 | Ga0501048_0601281 | 3300049582 | Bacteria | 789 |
| 656 | Ga0501067_0002569 | 3300049583 | Bacteria | 10026 |
| 657 | Ga0501067_0033702 | 3300049583 | Bacteria | 2841 |
| 658 | Ga0501067_0283926 | 3300049583 | Bacteria | 922 |
| 659 | Ga0501068_0000554 | 3300049584 | Bacteria | 18987 |
| 660 | Ga0501068_0016638 | 3300049584 | Bacteria | 4241 |
| 661 | Ga0501068_0143665 | 3300049584 | Bacteria | 1497 |
| 662 | Ga0501068_0343150 | 3300049584 | Bacteria | 959 |
| 663 | Ga0501069_0005499 | 3300049585 | Bacteria | 6594 |
| 664 | Ga0501069_0008128 | 3300049585 | Bacteria | 5512 |
| 665 | Ga0501069_0025761 | 3300049585 | Bacteria | 3216 |
| 666 | Ga0501069_0045322 | 3300049585 | Bacteria | 2436 |
| 667 | Ga0501070_0008506 | 3300049586 | Bacteria | 8673 |
| 668 | Ga0501070_0037529 | 3300049586 | Bacteria | 4044 |
| 669 | Ga0501070_0129553 | 3300049586 | Bacteria | 2084 |
| 670 | Ga0501071_0026502 | 3300049587 | Bacteria | 4069 |
| 671 | Ga0501071_0091995 | 3300049587 | Bacteria | 2228 |
| 672 | Ga0501071_0156085 | 3300049587 | Bacteria | 1704 |
| 673 | Ga0501072_0003510 | 3300049588 | Bacteria | 11812 |
| 674 | Ga0501072_0035421 | 3300049588 | Bacteria | 3909 |
| 675 | Ga0501072_0063745 | 3300049588 | Bacteria | 2907 |
| 676 | Ga0501073_0012723 | 3300049589 | Bacteria | 6138 |
| 677 | Ga0501074_0002118 | 3300049590 | Bacteria | 13705 |
| 678 | Ga0501074_0023101 | 3300049590 | Bacteria | 4522 |
| 679 | Ga0501074_0430848 | 3300049590 | Bacteria | 935 |
| 680 | Ga0501074_0904165 | 3300049590 | Bacteria | 621 |
| 681 | Ga0501075_0000040 | 3300049591 | Bacteria | 52221 |
| 682 | Ga0501075_0022523 | 3300049591 | Bacteria | 4602 |
| 683 | Ga0501075_0083110 | 3300049591 | Bacteria | 2426 |
| 684 | Ga0501075_0208247 | 3300049591 | Bacteria | 1491 |
| 685 | Ga0501075_0276316 | 3300049591 | Bacteria | 1280 |
| 686 | Ga0501075_0428959 | 3300049591 | Bacteria | 1008 |
| 687 | Ga0501076_0000462 | 3300049592 | Bacteria | 25816 |
| 688 | Ga0501076_0018932 | 3300049592 | Bacteria | 5253 |
| 689 | Ga0501076_0145768 | 3300049592 | Bacteria | 1925 |
| 690 | Ga0501076_0309453 | 3300049592 | Bacteria | 1295 |
| 691 | Ga0501076_0337586 | 3300049592 | Bacteria | 1236 |
| 692 | Ga0501076_0466832 | 3300049592 | Bacteria | 1039 |
| 693 | Ga0501076_0820192 | 3300049592 | Bacteria | 767 |
| 694 | Ga0501076_0872168 | 3300049592 | Bacteria | 742 |
| 695 | Ga0501077_0001230 | 3300049593 | Bacteria | 15458 |
| 696 | Ga0501077_0022967 | 3300049593 | Bacteria | 3954 |
| 697 | Ga0501077_0040233 | 3300049593 | Bacteria | 2978 |
| 698 | Ga0501077_0107389 | 3300049593 | Bacteria | 1769 |
| 699 | Ga0501077_0298681 | 3300049593 | Bacteria | 1026 |
| 700 | Ga0501217_107907 | 3300049661 | Bacteria | 798 |
| 701 | Ga0501079_0037028 | 3300049741 | Bacteria | 3758 |
| 702 | Ga0501079_0056934 | 3300049741 | Bacteria | 3016 |
| 703 | Ga0501079_0057448 | 3300049741 | Bacteria | 3002 |
| 704 | Ga0501079_0349600 | 3300049741 | Bacteria | 1158 |
| 705 | Ga0501080_0020429 | 3300049742 | Bacteria | 6129 |
| 706 | Ga0501080_0076027 | 3300049742 | Bacteria | 3123 |
| 707 | Ga0501080_0142318 | 3300049742 | Bacteria | 2217 |
| 708 | Ga0501080_0265002 | 3300049742 | Bacteria | 1564 |
| 709 | Ga0501081_0000040 | 3300049743 | Bacteria | 48110 |
| 710 | Ga0501081_0013087 | 3300049743 | Bacteria | 5457 |
| 711 | Ga0501081_0192855 | 3300049743 | Bacteria | 1476 |
| 712 | Ga0501083_0000928 | 3300049744 | Bacteria | 19450 |
| 713 | Ga0501083_0227300 | 3300049744 | Bacteria | 1215 |
| 714 | Ga0501083_0359214 | 3300049744 | Bacteria | 947 |
| 715 | Ga0501035_0006640 | 3300049822 | Bacteria | 10827 |
| 716 | Ga0501035_0045759 | 3300049822 | Bacteria | 3936 |
| 717 | Ga0501044_0152827 | 3300049823 | Bacteria | 2290 |
| 718 | Ga0501045_0000098 | 3300049824 | Bacteria | 42917 |
| 719 | Ga0501045_0013753 | 3300049824 | Bacteria | 5721 |
| 720 | Ga0501045_0074738 | 3300049824 | Bacteria | 2495 |
| 721 | Ga0501045_0139616 | 3300049824 | Bacteria | 1802 |
| 722 | Ga0501045_0210039 | 3300049824 | Bacteria | 1450 |
| 723 | Ga0501045_0220141 | 3300049824 | Bacteria | 1413 |
| 724 | Ga0501045_0306116 | 3300049824 | Bacteria | 1183 |
| 725 | nmdc:mga00v17_207208_c1 | 3300050491 | Bacteria | 1268 |
| 726 | nmdc:mga0yw44_282340_c1 | 3300050492 | Bacteria | 1110 |
| 727 | nmdc:mga05p37_3875_c1 | 3300050507 | Bacteria | 17497 |
| 728 | nmdc:mga05p37_62072_c1 | 3300050507 | Bacteria | 4600 |
| 729 | nmdc:mga05p37_648715_c1 | 3300050507 | Bacteria | 1182 |
| 730 | nmdc:mga09592_185253_c1 | 3300050508 | Bacteria | 1801 |
| 731 | nmdc:mga09592_39124_c1 | 3300050508 | Bacteria | 3983 |
| 732 | nmdc:mga09592_5576_c1 | 3300050508 | Bacteria | 10250 |
| 733 | nmdc:mga0qj67_21076_c1 | 3300050509 | Bacteria | 4997 |
| 734 | nmdc:mga0qj67_25076_c1 | 3300050509 | Bacteria | 4603 |
| 735 | nmdc:mga06r32_28316_c1 | 3300050510 | Bacteria | 5241 |
| 736 | nmdc:mga06r32_499515_c1 | 3300050510 | Bacteria | 1193 |
| 737 | nmdc:mga06r32_74469_c1 | 3300050510 | Bacteria | 3292 |
| 738 | nmdc:mga06r32_828013_c1 | 3300050510 | Bacteria | 885 |
| 739 | nmdc:mga08y16_523772_c1 | 3300050511 | Bacteria | 1202 |
| 740 | nmdc:mga08y16_816734_c1 | 3300050511 | Bacteria | 924 |
| 741 | nmdc:mga0n895_13798_c1 | 3300050512 | Bacteria | 7307 |
| 742 | nmdc:mga0n895_6128_c1 | 3300050512 | Bacteria | 10157 |
| 743 | nmdc:mga0rr50_26606_c1 | 3300050513 | Bacteria | 4039 |
| 744 | nmdc:mga0rr50_297455_c1 | 3300050513 | Bacteria | 1350 |
| 745 | nmdc:mga0rr50_3510_c1 | 3300050513 | Bacteria | 9042 |
| 746 | nmdc:mga0rr50_985000_c1 | 3300050513 | Bacteria | 718 |
| 747 | nmdc:mga08x19_472975_c1 | 3300050514 | Bacteria | 883 |
| 748 | nmdc:mga0a205_109331_c1 | 3300050515 | Bacteria | 2663 |
| 749 | nmdc:mga0a205_5955_c1 | 3300050515 | Bacteria | 10989 |
| 750 | Ga0495601_0315156 | 3300053077 | Bacteria | 1019 |
| 751 | Ga0495601_0441002 | 3300053077 | Bacteria | 842 |
| 752 | Ga0495612_0343383 | 3300053078 | Bacteria | 673 |
| 753 | Ga0495655_0050425 | 3300053083 | Bacteria | 1100 |
| 754 | Ga0495595_0033117 | 3300053084 | Bacteria | 2330 |
| 755 | Ga0495619_0064237 | 3300053085 | Bacteria | 2447 |
| 756 | Ga0495619_0460687 | 3300053085 | Bacteria | 876 |
| 757 | Ga0500628_065359 | 3300053129 | Bacteria | 899 |
| 758 | Ga0501084_0000228 | 3300054114 | Bacteria | 42475 |
| 759 | Ga0501084_0022100 | 3300054114 | Bacteria | 5306 |
| 760 | Ga0501084_0051910 | 3300054114 | Bacteria | 3431 |
| 761 | Ga0501084_0176697 | 3300054114 | Bacteria | 1802 |
| 762 | Ga0501084_0197374 | 3300054114 | Bacteria | 1698 |
| 763 | Ga0590075_025861 | 3300059424 | Bacteria | 1476 |
| 764 | Ga0590077_050826 | 3300059426 | Bacteria | 930 |
| 765 | Ga0587079_043538 | 3300059647 | Bacteria | 916 |
| 766 | Ga0587107_049593 | 3300059652 | Bacteria | 707 |
| 767 | Ga0501082_0000313 | 3300060353 | Bacteria | 43217 |
| 768 | Ga0501082_0012188 | 3300060353 | Bacteria | 7386 |
| 769 | Ga0501082_0225537 | 3300060353 | Bacteria | 1630 |
| 770 | Ga0501082_0357092 | 3300060353 | Bacteria | 1274 |
| 771 | Ga0530510_0000233 | 3300061734 | Bacteria | 34858 |
| 772 | Ga0530510_0019256 | 3300061734 | Bacteria | 4844 |
| 773 | Ga0530510_0043860 | 3300061734 | Bacteria | 3231 |
| 774 | Ga0530510_0058431 | 3300061734 | Bacteria | 2789 |
| 775 | Ga0530510_0273079 | 3300061734 | Bacteria | 1262 |
| 776 | Ga0530510_1055520 | 3300061734 | Bacteria | 622 |
| 777 | Ga0081455_10304404 | |||
| 778 | JGI24743J22301_10063257 | |||
| 779 | JGI25406J46586_10034387 | |||
| 780 | Ga0070658_10343741 | |||
| 781 | Ga0070683_100003014 | |||
| 782 | Ga0070683_100726188 | |||
| 783 | Ga0070670_100526919 | |||
| 784 | Ga0070670_101335444 | |||
| 785 | Ga0070682_100008758 | |||
| 786 | Ga0070682_100084214 | |||
| 787 | Ga0070682_100708966 | |||
| 788 | Ga0068868_100505137 | |||
| 789 | Ga0070660_100013030 | |||
| 790 | Ga0070660_100159312 | |||
| 791 | Ga0070689_100237632 | |||
| 792 | Ga0070691_10210417 | |||
| 793 | Ga0070661_100636543 | |||
| 794 | Ga0070692_10154936 | |||
| 795 | Ga0070668_100042964 | |||
| 796 | Ga0070671_100114415 | |||
| 797 | Ga0070671_100550539 | |||
| 798 | Ga0070673_100566896 | |||
| 799 | Ga0070673_101441389 | |||
| 800 | Ga0070659_100070513 | |||
| 801 | Ga0070703_10194467 | |||
| 802 | Ga0070709_10274128 | |||
| 803 | Ga0070709_10491325 | |||
| 804 | Ga0070714_100023226 | |||
| 805 | Ga0070714_100548407 | |||
| 806 | Ga0070713_100085262 | |||
| 807 | Ga0070713_100116999 | |||
| 808 | Ga0070713_100510578 | |||
| 809 | Ga0070713_100937162 | |||
| 810 | Ga0070710_10177447 | |||
| 811 | Ga0070710_10580525 | |||
| 812 | Ga0070711_100289630 | |||
| 813 | Ga0070711_100597271 | |||
| 814 | Ga0070705_100044138 | |||
| 815 | Ga0070708_100010109 | |||
| 816 | Ga0070663_100049856 | |||
| 817 | Ga0070663_100257678 | |||
| 818 | Ga0070678_100089311 | |||
| 819 | Ga0070678_101246469 | |||
| 820 | Ga0070662_100084293 | |||
| 821 | Ga0070662_100229295 | |||
| 822 | Ga0070662_100526942 | |||
| 823 | Ga0070681_10010617 | |||
| 824 | Ga0070681_10020004 | |||
| 825 | Ga0070681_10028129 | |||
| 826 | Ga0070681_10206595 | |||
| 827 | Ga0070685_10650418 | |||
| 828 | Ga0070706_100492332 | |||
| 829 | Ga0070706_100771109 | |||
| 830 | Ga0070706_100855698 | |||
| 831 | Ga0070698_100162922 | |||
| 832 | Ga0070698_100380701 | |||
| 833 | Ga0070699_100008553 | |||
| 834 | Ga0070699_100109701 | |||
| 835 | Ga0070679_100019792 | |||
| 836 | Ga0070679_100029031 | |||
| 837 | Ga0070679_100224293 | |||
| 838 | Ga0070679_100328963 | |||
| 839 | Ga0070679_100817945 | |||
| 840 | Ga0070684_100004862 | |||
| 841 | Ga0070684_100066833 | |||
| 842 | Ga0070684_100172639 | |||
| 843 | Ga0070684_100632693 | |||
| 844 | Ga0070684_100892624 | |||
| 845 | Ga0068853_100306084 | |||
| 846 | Ga0070672_100126365 | |||
| 847 | Ga0070686_100441991 | |||
| 848 | Ga0070693_100003389 | |||
| 849 | Ga0070693_100229444 | |||
| 850 | Ga0070665_100428569 | |||
| 851 | Ga0070665_100894141 | |||
| 852 | Ga0070704_100071852 | |||
| 853 | Ga0070704_100959250 | |||
| 854 | Ga0068855_100024333 | |||
| 855 | Ga0068855_100155801 | |||
| 856 | Ga0068855_100637558 | |||
| 857 | Ga0070664_100497105 | |||
| 858 | Ga0068857_100414187 | |||
| 859 | Ga0068857_101019805 | |||
| 860 | Ga0068856_100162226 | |||
| 861 | Ga0068856_100343762 | |||
| 862 | Ga0068856_100574325 | |||
| 863 | Ga0068856_100697450 | |||
| 864 | Ga0068856_101627950 | |||
| 865 | Ga0068852_100047629 | |||
| 866 | Ga0068859_100929429 | |||
| 867 | Ga0068864_100208213 | |||
| 868 | Ga0068866_10481192 | |||
| 869 | Ga0068861_100001363 | |||
| 870 | Ga0068870_10277864 | |||
| 871 | Ga0068863_100765658 | |||
| 872 | Ga0068862_100982179 | |||
| 873 | Ga0068862_101021210 | |||
| 874 | Ga0081455_10099280 | |||
| 875 | Ga0081539_10001263 | |||
| 876 | Ga0070717_10101540 | |||
| 877 | Ga0070717_10104256 | |||
| 878 | Ga0075365_10266046 | |||
| 879 | Ga0075432_10021754 | |||
| 880 | Ga0070715_10047213 | |||
| 881 | Ga0070716_100012314 | |||
| 882 | Ga0070712_100409383 | |||
| 883 | Ga0070712_100828484 | |||
| 884 | Ga0097621_100102787 | |||
| 885 | Ga0068871_100026340 | |||
| 886 | Ga0075428_100009035 | |||
| 887 | Ga0075428_100084482 | |||
| 888 | Ga0075428_100215700 | |||
| 889 | Ga0075430_100011120 | |||
| 890 | Ga0075430_100301449 | |||
| 891 | Ga0075431_100002708 | |||
| 892 | Ga0075431_100585624 | |||
| 893 | Ga0075431_101246092 | |||
| 894 | Ga0075433_10005381 | |||
| 895 | Ga0075433_10155958 | |||
| 896 | Ga0075433_10289983 | |||
| 897 | Ga0075434_100000119 | |||
| 898 | Ga0075434_100043574 | |||
| 899 | Ga0075434_100148416 | |||
| 900 | Ga0075429_100013670 | |||
| 901 | Ga0075429_100027684 | |||
| 902 | Ga0075429_100127147 | |||
| 903 | Ga0075429_100137938 | |||
| 904 | Ga0097620_100929420 | |||
| 905 | Ga0075435_100013923 | |||
| 906 | Ga0075435_100019498 | |||
| 907 | Ga0075435_100058953 | |||
| 908 | Ga0105240_10031263 | |||
| 909 | Ga0105240_10209059 | |||
| 910 | Ga0105240_10241083 | |||
| 911 | Ga0111539_10315949 | |||
| 912 | Ga0111539_10357882 | |||
| 913 | Ga0105245_10991458 | |||
| 914 | Ga0114129_10023134 | |||
| 915 | Ga0114129_10074244 | |||
| 916 | Ga0114129_10163685 | |||
| 917 | Ga0114129_11178583 | |||
| 918 | Ga0114129_11936319 | |||
| 919 | Ga0105243_10220725 | |||
| 920 | Ga0105243_10321517 | |||
| 921 | Ga0105243_11003184 | |||
| 922 | Ga0105241_10086381 | |||
| 923 | Ga0105241_10229031 | |||
| 924 | Ga0105242_10115337 | |||
| 925 | Ga0105242_10168618 | |||
| 926 | Ga0105242_10388453 | |||
| 927 | Ga0105242_10467465 | |||
| 928 | Ga0105238_10240837 | |||
| 929 | Ga0105238_10661389 | |||
| 930 | Ga0105249_10051441 | |||
| 931 | Ga0105239_10063495 | |||
| 932 | Ga0105246_10654402 | |||
| 933 | Ga0157343_1001271 | |||
| 934 | Ga0157341_1004565 | |||
| 935 | Ga0157373_10135400 | |||
| 936 | Ga0157370_10019560 | |||
| 937 | Ga0157370_10508474 | |||
| 938 | Ga0157369_10001856 | |||
| 939 | Ga0157369_10124289 | |||
| 940 | Ga0157369_11728073 | |||
| 941 | Ga0163162_10039041 | |||
| 942 | Ga0157372_10059751 | |||
| 943 | Ga0157372_10597208 | |||
| 944 | Ga0157372_10767501 | |||
| 945 | Ga0157372_11582292 | |||
| 946 | Ga0157375_10067646 | |||
| 947 | Ga0157375_10819227 | |||
| 948 | Ga0163163_10003631 | |||
| 949 | Ga0157380_10652129 | |||
| 950 | Ga0157377_10235083 | |||
| 951 | Ga0157376_10025932 | |||
| 952 | Ga0182005_1238906 | |||
| 953 | Ga0163161_10163995 | |||
| 954 | Ga0197907_10856740 | |||
| 955 | Ga0206354_11629680 | |||
| 956 | Ga0206353_10342286 | |||
| 957 | Ga0206353_11182390 | |||
| 958 | Ga0154015_1093925 | |||
| 959 | Ga0207642_10317527 | |||
| 960 | Ga0207688_10255804 | |||
| 961 | Ga0207680_10562360 | |||
| 962 | Ga0207699_10080489 | |||
| 963 | Ga0207643_10306323 | |||
| 964 | Ga0207643_10420807 | |||
| 965 | Ga0207643_10799605 | |||
| 966 | Ga0207705_10030135 | |||
| 967 | Ga0207705_10141569 | |||
| 968 | Ga0207684_10162562 | |||
| 969 | Ga0207684_10539474 | |||
| 970 | Ga0207684_10634987 | |||
| 971 | Ga0207707_10015097 | |||
| 972 | Ga0207707_10092988 | |||
| 973 | Ga0207707_10173536 | |||
| 974 | Ga0207707_10243733 | |||
| 975 | Ga0207695_10139731 | |||
| 976 | Ga0207695_10223399 | |||
| 977 | Ga0207693_10024259 | |||
| 978 | Ga0207693_10325760 | |||
| 979 | Ga0207693_10420738 | |||
| 980 | Ga0207663_10761479 | |||
| 981 | Ga0207660_10017592 | |||
| 982 | Ga0207657_10008781 | |||
| 983 | Ga0207657_10149711 | |||
| 984 | Ga0207649_10347847 | |||
| 985 | Ga0207649_10560196 | |||
| 986 | Ga0207649_10823926 | |||
| 987 | Ga0207652_10010746 | |||
| 988 | Ga0207652_10136449 | |||
| 989 | Ga0207652_10261768 | |||
| 990 | Ga0207646_10110015 | |||
| 991 | Ga0207646_10224199 | |||
| 992 | Ga0207646_10478957 | |||
| 993 | Ga0207646_10580885 | |||
| 994 | Ga0207650_10024849 | |||
| 995 | Ga0207650_10381072 | |||
| 996 | Ga0207659_10046096 | |||
| 997 | Ga0207687_10010459 | |||
| 998 | Ga0207687_10134720 | |||
| 999 | Ga0207700_10080374 | |||
| 1000 | Ga0207700_10572774 | |||
| 1001 | Ga0207664_10442617 | |||
| 1002 | Ga0207644_10090645 | |||
| 1003 | Ga0207644_10945852 | |||
| 1004 | Ga0207690_10018243 | |||
| 1005 | Ga0207706_10121292 | |||
| 1006 | Ga0207706_10391212 | |||
| 1007 | Ga0207686_10825510 | |||
| 1008 | Ga0207709_10651534 | |||
| 1009 | Ga0207709_10694553 | |||
| 1010 | Ga0207669_10106341 | |||
| 1011 | Ga0207711_10471374 | |||
| 1012 | Ga0207689_10091397 | |||
| 1013 | Ga0207661_10257329 | |||
| 1014 | Ga0207661_10285142 | |||
| 1015 | Ga0207667_10017419 | |||
| 1016 | Ga0207667_10132905 | |||
| 1017 | Ga0207667_10305552 | |||
| 1018 | Ga0207712_10168281 | |||
| 1019 | Ga0207668_10033183 | |||
| 1020 | Ga0207677_10184879 | |||
| 1021 | Ga0207639_10445987 | |||
| 1022 | Ga0207702_10002546 | |||
| 1023 | Ga0207702_10319430 | |||
| 1024 | Ga0207702_10343373 | |||
| 1025 | Ga0207641_10502267 | |||
| 1026 | Ga0207674_10027345 | |||
| 1027 | Ga0207674_10263741 | |||
| 1028 | Ga0207675_100000541 | |||
| 1029 | Ga0207675_100633920 | |||
| 1030 | Ga0207683_10004028 | |||
| 1031 | Ga0207698_10248851 | |||
| 1032 | Ga0209998_10025190 | |||
| 1033 | Ga0207428_10064085 | |||
| 1034 | Ga0207428_10356831 | |||
| 1035 | Ga0268266_10412377 | |||
| 1036 | Ga0268265_10362848 | |||
| 1037 | Ga0268265_10502403 | |||
| 1038 | Ga0268265_11346359 | |||
| 1039 | Ga0265326_10024345 | |||
| 1040 | Ga0265326_10102266 | |||
| 1041 | Ga0265319_1002557 | |||
| 1042 | Ga0265319_1016353 | |||
| 1043 | Ga0265319_1060604 | |||
| 1044 | Ga0265334_10013422 | |||
| 1045 | Ga0265334_10165626 | |||
| 1046 | Ga0265318_10003094 | |||
| 1047 | Ga0265318_10030320 | |||
| 1048 | Ga0265318_10030334 | |||
| 1049 | Ga0265322_10020839 | |||
| 1050 | Ga0265336_10005714 | |||
| 1051 | Ga0265338_10002058 | |||
| 1052 | Ga0265338_10054250 | |||
| 1053 | Ga0265338_10056315 | |||
| 1054 | Ga0265338_10067959 | |||
| 1055 | Ga0265338_10345560 | |||
| 1056 | Ga0265324_10044403 | |||
| 1057 | Ga0265330_10009834 | |||
| 1058 | Ga0265332_10018123 | |||
| 1059 | Ga0265328_10005742 | |||
| 1060 | Ga0265320_10010065 | |||
| 1061 | Ga0265320_10039231 | |||
| 1062 | Ga0265320_10130692 | |||
| 1063 | Ga0265320_10251962 | |||
| 1064 | Ga0265325_10021903 | |||
| 1065 | Ga0265329_10003580 | |||
| 1066 | Ga0265340_10101866 | |||
| 1067 | Ga0265340_10122480 | |||
| 1068 | Ga0265339_10034627 | |||
| 1069 | Ga0265331_10019512 | |||
| 1070 | Ga0265327_10010760 | |||
| 1071 | Ga0265327_10017655 | |||
| 1072 | Ga0265327_10024357 | |||
| 1073 | Ga0265316_10059236 | |||
| 1074 | Ga0265313_10021700 | |||
| 1075 | Ga0265314_10037625 | |||
| 1076 | Ga0265342_10025656 | |||
| 1077 | Ga0307405_10140506 | |||
| 1078 | Ga0307413_10019063 | |||
| 1079 | Ga0307410_10369941 | |||
| 1080 | Ga0307410_10778351 | |||
| 1081 | Ga0307406_10625008 | |||
| 1082 | Ga0307406_10871192 | |||
| 1083 | Ga0307412_10793246 | |||
| 1084 | Ga0307409_100128572 | |||
| 1085 | Ga0307409_100325540 | |||
| 1086 | Ga0307409_100561537 | |||
| 1087 | Ga0307416_100308556 | |||
| 1088 | Ga0307416_100459785 | |||
| 1089 | Ga0307415_100072666 | |||
| 1090 | Ga0307415_100083510 | |||
| 1091 | Ga0373944_0004799 | |||
| 1092 | Ga0373944_0038715 | |||
| 1093 | Ga0373945_0004700 | |||
| 1094 | Ga0373945_0005298 | |||
| 1095 | Ga0373943_0000101 | |||
| 1096 | Ga0373943_0030594 | |||
| 1097 | Ga0373943_0090283 | |||
| 1098 | Ga0373943_0375113 | |||
| 1099 | Ga0373946_0018922 | |||
| 1100 | Ga0373946_0094565 | |||
| 1101 | Ga0373961_0011018 | |||
| 1102 | Ga0373924_0096467 | |||
| 1103 | Ga0373935_0017891 | |||
| 1104 | Ga0373927_0011038 | |||
| 1105 | Ga0373947_0000788 | |||
| 1106 | Ga0373947_0014095 | |||
| 1107 | Ga0373947_0015882 | |||
| 1108 | Ga0373925_0005074 | |||
| 1109 | Ga0373925_0658328 | |||
| 1110 | Ga0395899_0002082 | |||
| 1111 | Ga0395899_0030622 | |||
| 1112 | Ga0395899_0053530 | |||
| 1113 | Ga0395899_0063312 | |||
| 1114 | Ga0395899_0082236 | |||
| 1115 | Ga0395899_0317234 | |||
| 1116 | Ga0395900_0003566 | |||
| 1117 | Ga0395900_0003571 | |||
| 1118 | Ga0395900_0006173 | |||
| 1119 | Ga0395900_0145082 | |||
| 1120 | Ga0395900_0147174 | |||
| 1121 | Ga0395900_0300670 | |||
| 1122 | Ga0395900_0559999 | |||
| 1123 | Ga0395900_1577275 | |||
| 1124 | Ga0395898_0001966 | |||
| 1125 | Ga0395898_0003782 | |||
| 1126 | Ga0395898_0004411 | |||
| 1127 | Ga0395898_0010754 | |||
| 1128 | Ga0395898_0050623 | |||
| 1129 | Ga0395898_0071610 | |||
| 1130 | Ga0395898_0095443 | |||
| 1131 | Ga0395898_0108582 | |||
| 1132 | Ga0395898_0131682 | |||
| 1133 | Ga0395898_0151970 | |||
| 1134 | Ga0395898_0155429 | |||
| 1135 | Ga0395898_0205858 | |||
| 1136 | Ga0395898_0582452 | |||
| 1137 | Ga0395898_0811592 | |||
| 1138 | Ga0395905_0004551 | |||
| 1139 | Ga0395905_0007392 | |||
| 1140 | Ga0395905_0008109 | |||
| 1141 | Ga0395905_0061244 | |||
| 1142 | Ga0395905_0090076 | |||
| 1143 | Ga0395905_0181075 | |||
| 1144 | Ga0395901_0005629 | |||
| 1145 | Ga0395901_0005947 | |||
| 1146 | Ga0395901_0009334 | |||
| 1147 | Ga0395901_0025215 | |||
| 1148 | Ga0395901_0025603 | |||
| 1149 | Ga0395901_0032655 | |||
| 1150 | Ga0395901_0137866 | |||
| 1151 | Ga0395901_0156670 | |||
| 1152 | Ga0395901_0163335 | |||
| 1153 | Ga0395901_0185962 | |||
| 1154 | Ga0395901_0403124 | |||
| 1155 | Ga0395901_0474037 | |||
| 1156 | Ga0395901_1090955 | |||
| 1157 | Ga0436365_1882850 | |||
| 1158 | Ga0439436_0050841 | |||
| 1159 | Ga0439439_0001293 | |||
| 1160 | Ga0439447_051928 | |||
| 1161 | Ga0439461_0037391 | |||
| 1162 | Ga0451793_1094665 | |||
| 1163 | Ga0451804_1171148 | |||
| 1164 | Ga0451853_0262434 | |||
| 1165 | Ga0451853_1687415 | |||
| 1166 | Ga0451853_2895983 | |||
| 1167 | Ga0439433_0000148 | |||
| 1168 | Ga0439449_0076219 | |||
| 1169 | Ga0439454_001224 | |||
| 1170 | Ga0439457_077834 | |||
| 1171 | Ga0439462_0008078 | |||
| 1172 | Ga0450920_014012 | |||
| 1173 | Ga0439446_0011502 | |||
| 1174 | Ga0439434_0009214 | |||
| 1175 | Ga0439435_0204863 | |||
| 1176 | Ga0439459_0070956 | |||
| 1177 | Ga0466966_0455286 | |||
| 1178 | Ga0466963_0002476 | |||
| 1179 | Ga0466963_0004822 | |||
| 1180 | Ga0466963_0014591 | |||
| 1181 | Ga0466968_0095583 | |||
| 1182 | Ga0466968_0137802 | |||
| 1183 | Ga0466957_0664464 | |||
| 1184 | Ga0466960_0116163 | |||
| 1185 | Ga0466959_0061683 | |||
| 1186 | Ga0451576_0977521 | |||
| 1187 | Ga0466958_0013947 | |||
| 1188 | Ga0466958_0027857 | |||
| 1189 | Ga0466958_0049073 | |||
| 1190 | Ga0466967_0000305 | |||
| 1191 | Ga0466967_0014043 | |||
| 1192 | Ga0466967_0023465 | |||
| 1193 | Ga0466967_0097796 | |||
| 1194 | Ga0466967_0125450 | |||
| 1195 | Ga0466967_0638170 | |||
| 1196 | Ga0495592_0019083 | |||
| 1197 | Ga0495592_0409108 | |||
| 1198 | Ga0495592_0532650 | |||
| 1199 | Ga0495603_0013923 | |||
| 1200 | Ga0495603_0099071 | |||
| 1201 | Ga0495603_0131789 | |||
| 1202 | Ga0495603_0506114 | |||
| 1203 | Ga0495590_0132826 | |||
| 1204 | Ga0495629_0012147 | |||
| 1205 | Ga0495629_0016163 | |||
| 1206 | Ga0495629_0324979 | |||
| 1207 | Ga0495641_0000374 | |||
| 1208 | Ga0495641_0005898 | |||
| 1209 | Ga0495641_0039909 | |||
| 1210 | Ga0495641_0054876 | |||
| 1211 | Ga0495651_0025724 | |||
| 1212 | Ga0495651_0597754 | |||
| 1213 | Ga0495653_0031666 | |||
| 1214 | Ga0495653_0255248 | |||
| 1215 | Ga0495580_0081573 | |||
| 1216 | Ga0495580_0274955 | |||
| 1217 | Ga0495582_0000124 | |||
| 1218 | Ga0495582_0013762 | |||
| 1219 | Ga0495639_0000786 | |||
| 1220 | Ga0495662_0011617 | |||
| 1221 | Ga0495664_0235129 | |||
| 1222 | Ga0495584_0070933 | |||
| 1223 | Ga0495584_0168617 | |||
| 1224 | Ga0495584_0245232 | |||
| 1225 | Ga0495594_0000340 | |||
| 1226 | Ga0495594_0131420 | |||
| 1227 | Ga0495607_0062799 | |||
| 1228 | Ga0495608_0042588 | |||
| 1229 | Ga0495618_0034298 | |||
| 1230 | Ga0495618_0516246 | |||
| 1231 | Ga0495628_0650699 | |||
| 1232 | Ga0495630_0015163 | |||
| 1233 | Ga0495630_0039313 | |||
| 1234 | Ga0495630_0528420 | |||
| 1235 | Ga0495637_0075180 | |||
| 1236 | Ga0495637_0182039 | |||
| 1237 | Ga0495663_0063013 | |||
| 1238 | Ga0495666_0008147 | |||
| 1239 | Ga0495642_0072435 | |||
| 1240 | Ga0495652_0160456 | |||
| 1241 | Ga0495652_0176999 | |||
| 1242 | Ga0495665_0003068 | |||
| 1243 | Ga0495640_0443210 | |||
| 1244 | Ga0495598_0045169 | |||
| 1245 | Ga0495598_0077579 | |||
| 1246 | Ga0495609_0111759 | |||
| 1247 | Ga0495597_0293837 | |||
| 1248 | Ga0495645_0252776 | |||
| 1249 | Ga0495633_0433894 | |||
| 1250 | Ga0495667_0035954 | |||
| 1251 | Ga0495656_0014479 | |||
| 1252 | Ga0495634_0160953 | |||
| 1253 | Ga0495635_0005548 | |||
| 1254 | Ga0495635_0111310 | |||
| 1255 | Ga0495635_0251207 | |||
| 1256 | Ga0495635_0508071 | |||
| 1257 | Ga0495659_0118309 | |||
| 1258 | Ga0495659_0201582 | |||
| 1259 | Ga0495661_0089784 | |||
| 1260 | Ga0495588_0003233 | |||
| 1261 | Ga0495647_0048009 | |||
| 1262 | Ga0495647_0367366 | |||
| 1263 | Ga0495658_0000247 | |||
| 1264 | Ga0495613_0007600 | |||
| 1265 | Ga0495613_0164892 | |||
| 1266 | Ga0495613_0304822 | |||
| 1267 | Ga0495613_0560157 | |||
| 1268 | Ga0495613_0674125 | |||
| 1269 | Ga0495624_0012838 | |||
| 1270 | Ga0495670_0092785 | |||
| 1271 | Ga0495670_0145427 | |||
| 1272 | Ga0495671_0166031 | |||
| 1273 | Ga0495589_0057079 | |||
| 1274 | Ga0495581_0003701 | |||
| 1275 | Ga0495604_0047680 | |||
| 1276 | Ga0495604_0241374 | |||
| 1277 | Ga0495636_0141441 | |||
| 1278 | Ga0495674_0877600 | |||
| 1279 | Ga0495676_0001077 | |||
| 1280 | Ga0495676_0001422 | |||
| 1281 | Ga0495676_0039372 | |||
| 1282 | Ga0495676_0079007 | |||
| 1283 | Ga0495676_0257125 | |||
| 1284 | Ga0495676_0940413 | |||
| 1285 | Ga0495679_094099 | |||
| 1286 | Ga0495684_0050248 | |||
| 1287 | Ga0495684_0393133 | |||
| 1288 | Ga0495684_0610720 | |||
| 1289 | Ga0495593_0006462 | |||
| 1290 | Ga0495602_0123551 | |||
| 1291 | Ga0495614_0038041 | |||
| 1292 | Ga0495615_0042566 | |||
| 1293 | Ga0495615_0067399 | |||
| 1294 | Ga0496100_0006343 | |||
| 1295 | Ga0496100_0134527 | |||
| 1296 | Ga0496100_0239288 | |||
| 1297 | Ga0496100_0467043 | |||
| 1298 | Ga0496100_0483671 | |||
| 1299 | Ga0496100_0535275 | |||
| 1300 | Ga0496101_0010725 | |||
| 1301 | Ga0496101_0014565 | |||
| 1302 | Ga0496101_0138062 | |||
| 1303 | Ga0496101_0239761 | |||
| 1304 | Ga0496101_0438002 | |||
| 1305 | Ga0496102_0013540 | |||
| 1306 | Ga0496102_0052433 | |||
| 1307 | Ga0496102_0134736 | |||
| 1308 | Ga0496102_0170148 | |||
| 1309 | Ga0496103_0091108 | |||
| 1310 | Ga0496103_0209933 | |||
| 1311 | Ga0496104_0000606 | |||
| 1312 | Ga0496104_0014093 | |||
| 1313 | Ga0496104_0120944 | |||
| 1314 | Ga0496104_0138543 | |||
| 1315 | Ga0496104_0215181 | |||
| 1316 | Ga0496104_0304389 | |||
| 1317 | Ga0496105_0000182 | |||
| 1318 | Ga0496105_0037736 | |||
| 1319 | Ga0496105_0066251 | |||
| 1320 | Ga0496105_0110450 | |||
| 1321 | Ga0496105_0176321 | |||
| 1322 | Ga0496105_0341286 | |||
| 1323 | Ga0496105_0489642 | |||
| 1324 | Ga0496106_0011036 | |||
| 1325 | Ga0496106_0016722 | |||
| 1326 | Ga0496106_0054642 | |||
| 1327 | Ga0496106_0101500 | |||
| 1328 | Ga0496106_0156092 | |||
| 1329 | Ga0496107_0009675 | |||
| 1330 | Ga0496107_0098049 | |||
| 1331 | Ga0496107_0168821 | |||
| 1332 | Ga0496107_0537534 | |||
| 1333 | Ga0496108_0000777 | |||
| 1334 | Ga0496108_0031197 | |||
| 1335 | Ga0496108_0040239 | |||
| 1336 | Ga0496108_0064473 | |||
| 1337 | Ga0496108_0157581 | |||
| 1338 | Ga0496108_0612220 | |||
| 1339 | Ga0496108_0638154 | |||
| 1340 | Ga0496109_0000403 | |||
| 1341 | Ga0496109_0007741 | |||
| 1342 | Ga0496109_0009153 | |||
| 1343 | Ga0496109_0229702 | |||
| 1344 | Ga0496109_0310604 | |||
| 1345 | Ga0496109_0495375 | |||
| 1346 | Ga0496109_1154272 | |||
| 1347 | Ga0496110_0000581 | |||
| 1348 | Ga0496110_0022850 | |||
| 1349 | Ga0496110_0023457 | |||
| 1350 | Ga0496110_0026058 | |||
| 1351 | Ga0496110_0067762 | |||
| 1352 | Ga0496110_0214988 | |||
| 1353 | Ga0496110_0404156 | |||
| 1354 | Ga0496110_0613329 | |||
| 1355 | Ga0496110_0690897 | |||
| 1356 | Ga0496110_1122586 | |||
| 1357 | Ga0496110_1667969 | |||
| 1358 | Ga0496111_0000076 | |||
| 1359 | Ga0496111_0006195 | |||
| 1360 | Ga0496111_0019420 | |||
| 1361 | Ga0496111_0029346 | |||
| 1362 | Ga0496112_0000832 | |||
| 1363 | Ga0496112_0031945 | |||
| 1364 | Ga0496112_0116989 | |||
| 1365 | Ga0496112_0152774 | |||
| 1366 | Ga0496112_0165505 | |||
| 1367 | Ga0496112_0218751 | |||
| 1368 | Ga0496112_0220299 | |||
| 1369 | Ga0496112_0263445 | |||
| 1370 | Ga0496112_0291082 | |||
| 1371 | Ga0496112_0644627 | |||
| 1372 | Ga0496112_1163169 | |||
| 1373 | Ga0496113_0000424 | |||
| 1374 | Ga0496113_0069096 | |||
| 1375 | Ga0496113_0096092 | |||
| 1376 | Ga0496113_0129082 | |||
| 1377 | Ga0496113_0132516 | |||
| 1378 | Ga0496113_0232994 | |||
| 1379 | Ga0496113_0487851 | |||
| 1380 | Ga0496114_0042144 | |||
| 1381 | Ga0496114_0050148 | |||
| 1382 | Ga0496114_0068310 | |||
| 1383 | Ga0496114_0097464 | |||
| 1384 | Ga0496114_0114789 | |||
| 1385 | Ga0496114_0120943 | |||
| 1386 | Ga0496114_0233315 | |||
| 1387 | Ga0496114_0270878 | |||
| 1388 | Ga0496114_0384025 | |||
| 1389 | Ga0496115_0001178 | |||
| 1390 | Ga0496115_0036527 | |||
| 1391 | Ga0496115_0047479 | |||
| 1392 | Ga0496115_0142275 | |||
| 1393 | Ga0496115_0280435 | |||
| 1394 | Ga0501291_025358 | |||
| 1395 | Ga0501031_0012215 | |||
| 1396 | Ga0501031_0051205 | |||
| 1397 | Ga0501032_0002668 | |||
| 1398 | Ga0501032_0617495 | |||
| 1399 | Ga0501033_0005054 | |||
| 1400 | Ga0501033_0139052 | |||
| 1401 | Ga0501033_0640532 | |||
| 1402 | Ga0501034_0751400 | |||
| 1403 | Ga0501036_0000693 | |||
| 1404 | Ga0501036_0040031 | |||
| 1405 | Ga0501036_0068181 | |||
| 1406 | Ga0501037_0040290 | |||
| 1407 | Ga0501038_0000548 | |||
| 1408 | Ga0501038_0022399 | |||
| 1409 | Ga0501039_0000176 | |||
| 1410 | Ga0501039_0025073 | |||
| 1411 | Ga0501039_0105102 | |||
| 1412 | Ga0501039_0390350 | |||
| 1413 | Ga0501040_0013388 | |||
| 1414 | Ga0501040_0048306 | |||
| 1415 | Ga0501040_0176566 | |||
| 1416 | Ga0501041_0000022 | |||
| 1417 | Ga0501041_0076183 | |||
| 1418 | Ga0501041_0182726 | |||
| 1419 | Ga0501042_0000092 | |||
| 1420 | Ga0501042_0008327 | |||
| 1421 | Ga0501042_0314941 | |||
| 1422 | Ga0501043_0000891 | |||
| 1423 | Ga0501046_0002474 | |||
| 1424 | Ga0501046_0041525 | |||
| 1425 | Ga0501046_0704815 | |||
| 1426 | Ga0501047_0010177 | |||
| 1427 | Ga0501047_0744764 | |||
| 1428 | Ga0501048_0001223 | |||
| 1429 | Ga0501048_0023508 | |||
| 1430 | Ga0501048_0370590 | |||
| 1431 | Ga0501048_0601281 | |||
| 1432 | Ga0501067_0002569 | |||
| 1433 | Ga0501067_0033702 | |||
| 1434 | Ga0501067_0283926 | |||
| 1435 | Ga0501068_0000554 | |||
| 1436 | Ga0501068_0016638 | |||
| 1437 | Ga0501068_0143665 | |||
| 1438 | Ga0501068_0343150 | |||
| 1439 | Ga0501069_0005499 | |||
| 1440 | Ga0501069_0008128 | |||
| 1441 | Ga0501069_0025761 | |||
| 1442 | Ga0501069_0045322 | |||
| 1443 | Ga0501070_0008506 | |||
| 1444 | Ga0501070_0037529 | |||
| 1445 | Ga0501070_0129553 | |||
| 1446 | Ga0501071_0026502 | |||
| 1447 | Ga0501071_0091995 | |||
| 1448 | Ga0501071_0156085 | |||
| 1449 | Ga0501072_0003510 | |||
| 1450 | Ga0501072_0035421 | |||
| 1451 | Ga0501072_0063745 | |||
| 1452 | Ga0501073_0012723 | |||
| 1453 | Ga0501074_0002118 | |||
| 1454 | Ga0501074_0023101 | |||
| 1455 | Ga0501074_0430848 | |||
| 1456 | Ga0501074_0904165 | |||
| 1457 | Ga0501075_0000040 | |||
| 1458 | Ga0501075_0022523 | |||
| 1459 | Ga0501075_0083110 | |||
| 1460 | Ga0501075_0208247 | |||
| 1461 | Ga0501075_0276316 | |||
| 1462 | Ga0501075_0428959 | |||
| 1463 | Ga0501076_0000462 | |||
| 1464 | Ga0501076_0018932 | |||
| 1465 | Ga0501076_0145768 | |||
| 1466 | Ga0501076_0309453 | |||
| 1467 | Ga0501076_0337586 | |||
| 1468 | Ga0501076_0466832 | |||
| 1469 | Ga0501076_0820192 | |||
| 1470 | Ga0501076_0872168 | |||
| 1471 | Ga0501077_0001230 | |||
| 1472 | Ga0501077_0022967 | |||
| 1473 | Ga0501077_0040233 | |||
| 1474 | Ga0501077_0107389 | |||
| 1475 | Ga0501077_0298681 | |||
| 1476 | Ga0501217_107907 | |||
| 1477 | Ga0501079_0037028 | |||
| 1478 | Ga0501079_0056934 | |||
| 1479 | Ga0501079_0057448 | |||
| 1480 | Ga0501079_0349600 | |||
| 1481 | Ga0501080_0020429 | |||
| 1482 | Ga0501080_0076027 | |||
| 1483 | Ga0501080_0142318 | |||
| 1484 | Ga0501080_0265002 | |||
| 1485 | Ga0501081_0000040 | |||
| 1486 | Ga0501081_0013087 | |||
| 1487 | Ga0501081_0192855 | |||
| 1488 | Ga0501083_0000928 | |||
| 1489 | Ga0501083_0227300 | |||
| 1490 | Ga0501083_0359214 | |||
| 1491 | Ga0501035_0006640 | |||
| 1492 | Ga0501035_0045759 | |||
| 1493 | Ga0501044_0152827 | |||
| 1494 | Ga0501045_0000098 | |||
| 1495 | Ga0501045_0013753 | |||
| 1496 | Ga0501045_0074738 | |||
| 1497 | Ga0501045_0139616 | |||
| 1498 | Ga0501045_0210039 | |||
| 1499 | Ga0501045_0220141 | |||
| 1500 | Ga0501045_0306116 | |||
| 1501 | nmdc:mga00v17_207208_c1 | |||
| 1502 | nmdc:mga0yw44_282340_c1 | |||
| 1503 | nmdc:mga05p37_3875_c1 | |||
| 1504 | nmdc:mga05p37_62072_c1 | |||
| 1505 | nmdc:mga05p37_648715_c1 | |||
| 1506 | nmdc:mga09592_185253_c1 | |||
| 1507 | nmdc:mga09592_39124_c1 | |||
| 1508 | nmdc:mga09592_5576_c1 | |||
| 1509 | nmdc:mga0qj67_21076_c1 | |||
| 1510 | nmdc:mga0qj67_25076_c1 | |||
| 1511 | nmdc:mga06r32_28316_c1 | |||
| 1512 | nmdc:mga06r32_499515_c1 | |||
| 1513 | nmdc:mga06r32_74469_c1 | |||
| 1514 | nmdc:mga06r32_828013_c1 | |||
| 1515 | nmdc:mga08y16_523772_c1 | |||
| 1516 | nmdc:mga08y16_816734_c1 | |||
| 1517 | nmdc:mga0n895_13798_c1 | |||
| 1518 | nmdc:mga0n895_6128_c1 | |||
| 1519 | nmdc:mga0rr50_26606_c1 | |||
| 1520 | nmdc:mga0rr50_297455_c1 | |||
| 1521 | nmdc:mga0rr50_3510_c1 | |||
| 1522 | nmdc:mga0rr50_985000_c1 | |||
| 1523 | nmdc:mga08x19_472975_c1 | |||
| 1524 | nmdc:mga0a205_109331_c1 | |||
| 1525 | nmdc:mga0a205_5955_c1 | |||
| 1526 | Ga0495601_0315156 | |||
| 1527 | Ga0495601_0441002 | |||
| 1528 | Ga0495612_0343383 | |||
| 1529 | Ga0495655_0050425 | |||
| 1530 | Ga0495595_0033117 | |||
| 1531 | Ga0495619_0064237 | |||
| 1532 | Ga0495619_0460687 | |||
| 1533 | Ga0500628_065359 | |||
| 1534 | Ga0501084_0000228 | |||
| 1535 | Ga0501084_0022100 | |||
| 1536 | Ga0501084_0051910 | |||
| 1537 | Ga0501084_0176697 | |||
| 1538 | Ga0501084_0197374 | |||
| 1539 | Ga0590075_025861 | |||
| 1540 | Ga0590077_050826 | |||
| 1541 | Ga0587079_043538 | |||
| 1542 | Ga0587107_049593 | |||
| 1543 | Ga0501082_0000313 | |||
| 1544 | Ga0501082_0012188 | |||
| 1545 | Ga0501082_0225537 | |||
| 1546 | Ga0501082_0357092 | |||
| 1547 | Ga0530510_0000233 | |||
| 1548 | Ga0530510_0019256 | |||
| 1549 | Ga0530510_0043860 | |||
| 1550 | Ga0530510_0058431 | |||
| 1551 | Ga0530510_0273079 | |||
| 1552 | Ga0530510_1055520 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy