F480186

General Info

Members Datasets Scaffolds Average Seq Length
773 392 608 338

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0039612|Ga0495625_0039612_515_1717
Length 400
Sequence LSDENPVGACGAAIRLAREECTAVFQVLRVIVLRGQASLLQALAASAAFLSVLTFHNVEVFMATPFKRTALTLLAASVAAVSALLSSGAQAEGKISIAQQFGIGYLILDVVRDQQLIEKHGKEQGLDIKVDWNSISGATAMNEALLAGALDVVSAGVPPMLTIWDRTKGKQNVKAIASLGSMPNYLLTNNPNVKSLKDFTEKDRIAVPAAGVGFQSRTLQIETAKQFGAEHYKKFDDISISLAHPDATSALIAGGSEINSHFSSPPFQYQELQSPNVHKVLSSYDVLGGQATFNVLYTTEKFHDENPKTYKAFYAALAEAEKIIKADKPVAAQTYIRVEQSKLALPLVEKIVADPEINFTVVPQRTFIYAEKLQELGVLKNKAASWKDYFFEEAHGSEGS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231018 Pseudomonas sp. GM60 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231023 Pseudomonas sp. GM80 Isolate Nodule
13 2511231031 Pseudomonas sp. GM16 Isolate Nodule
14 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
15 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
16 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
17 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
18 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
19 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
20 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
21 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
22 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
23 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
24 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
25 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
26 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
27 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
28 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
29 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
30 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
31 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
32 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
33 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
34 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
35 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
36 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
37 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
38 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
39 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
40 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
41 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
42 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
43 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
44 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
45 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
46 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
47 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
48 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
49 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
50 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
51 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
52 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
53 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
54 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
55 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
56 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
57 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
58 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
59 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
60 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
61 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
62 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
63 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
64 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
65 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
66 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
67 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
68 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
69 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
70 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
71 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
72 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
73 2773857673 Pseudomonas sp. 443 Isolate Unclassified
74 2784132063 Pseudomonas sp. 424 Isolate Unclassified
75 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
76 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
77 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
78 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
79 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
80 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
81 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
82 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
83 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
84 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
85 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
86 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
87 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
88 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
89 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
90 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
91 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
92 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
93 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
94 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
95 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
96 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
97 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
98 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
99 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
100 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
101 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
102 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
103 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
104 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
105 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
106 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
107 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
108 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
109 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
110 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
111 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
112 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
113 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
114 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
115 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
116 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
117 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
118 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
119 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
120 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
121 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
122 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
123 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
124 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
125 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
126 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
127 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
128 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
129 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
130 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
131 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
132 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
133 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
134 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
135 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
136 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
137 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
138 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
139 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
140 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
141 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
142 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
143 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
144 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
145 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
146 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
147 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
148 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
149 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
150 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
151 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
152 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
153 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
154 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
155 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
156 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
157 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
158 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
159 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
160 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
161 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
162 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
163 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
164 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
165 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
166 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
167 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
168 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
171 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
172 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
173 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
174 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
175 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
181 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
182 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
183 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
184 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
185 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
186 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
189 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
190 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
191 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
210 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
211 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
212 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
213 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
214 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
215 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
216 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
253 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
260 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
277 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
278 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
279 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
280 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
281 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
282 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
283 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
284 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
285 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
286 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
287 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
365 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
384 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
385 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
386 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
387 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
388 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
389 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
390 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
391 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
392 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 0
Isolates 21.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 7.24
Nodule 1.81
Rhizoplane 7.12
Rhizosphere 70.5
Stem 0
Stem Tuber 0.65
Unclassified 12.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000002 3300003751 Bacteria 999437
2 Ga0055538_1000053 3300003751 Bacteria 127408
3 Ga0055539_1000002 3300003752 Bacteria 999437
4 Ga0055539_1000078 3300003752 Bacteria 127408
5 Ga0055533_1000004 3300003756 Bacteria 999437
6 Ga0055533_1000084 3300003756 Bacteria 127408
7 Ga0055525_1000002 3300003759 Bacteria 999437
8 Ga0055525_1000112 3300003759 Bacteria 127408
9 Ga0055536_1000115 3300003781 Bacteria 69846
10 Ga0055536_1000214 3300003781 Bacteria 47510
11 Ga0055530_10000010 3300003791 Bacteria 173678
12 Ga0055540_1000032 3300003792 Bacteria 173678
13 Ga0055540_1000204 3300003792 Bacteria 57435
14 Ga0055531_10000186 3300003794 Bacteria 69495
15 Ga0055541_1000002 3300003841 Bacteria 896405
16 Ga0055541_1000055 3300003841 Bacteria 127408
17 Ga0065714_10015565 3300005288 Bacteria 1718
18 Ga0065714_10066888 3300005288 Bacteria 6140
19 Ga0065714_10068063 3300005288 Bacteria 4996
20 Ga0065714_10109085 3300005288 Bacteria 1505
21 Ga0065704_10027136 3300005289 Bacteria 1377
22 Ga0065704_10127903 3300005289 Bacteria 1669
23 Ga0070670_100002176 3300005331 Bacteria 16107
24 Ga0070661_100000140 3300005344 Bacteria 60039
25 Ga0070668_100171707 3300005347 Bacteria 1766
26 Ga0070669_100004711 3300005353 Bacteria 9839
27 Ga0070669_100127993 3300005353 Bacteria 1945
28 Ga0070700_100029931 3300005441 Bacteria 3250
29 Ga0070662_100004873 3300005457 Bacteria 8517
30 Ga0068867_100109717 3300005459 Bacteria 2119
31 Ga0070695_100015810 3300005545 Bacteria 4559
32 Ga0070665_100517004 3300005548 Bacteria 1205
33 Ga0068855_100003463 3300005563 Bacteria 19313
34 Ga0070664_100000201 3300005564 Bacteria 42562
35 Ga0068854_100115111 3300005578 Bacteria 2034
36 Ga0068856_100645353 3300005614 Bacteria 1079
37 Ga0068851_10001221 3300005834 Bacteria 11166
38 Ga0081540_1001935 3300005983 Bacteria 17336
39 Ga0075368_10000567 3300006042 Bacteria 11075
40 Ga0075363_100016545 3300006048 Bacteria 3644
41 Ga0075364_10126793 3300006051 Bacteria 1712
42 Ga0075367_10075188 3300006178 Bacteria 2037
43 Ga0075428_100013546 3300006844 Bacteria 9079
44 Ga0075428_100054265 3300006844 Bacteria 4392
45 Ga0075430_100021098 3300006846 Bacteria 5539
46 Ga0075431_100016112 3300006847 Bacteria 7583
47 Ga0075433_10004725 3300006852 Bacteria 10621
48 Ga0075434_100005019 3300006871 Bacteria 12011
49 Ga0075434_100015419 3300006871 Bacteria 7326
50 Ga0075436_100159600 3300006914 Unclassified 1589
51 Ga0075435_100029315 3300007076 Plasmid 4319
52 Ga0075435_100205767 3300007076 Bacteria 1668
53 Ga0105251_10000375 3300009011 Bacteria 43786
54 Ga0105251_10001649 3300009011 Bacteria 18872
55 Ga0105251_10003318 3300009011 Bacteria 11763
56 Ga0105251_10004367 3300009011 Bacteria 9652
57 Ga0105251_10009327 3300009011 Bacteria 5805
58 Ga0105251_10010770 3300009011 Bacteria 5273
59 Ga0105251_10038446 3300009011 Bacteria 2344
60 Ga0105251_10122295 3300009011 Bacteria 1182
61 Ga0105244_10000762 3300009036 Bacteria 27497
62 Ga0105244_10008860 3300009036 Bacteria 6241
63 Ga0105244_10009956 3300009036 Bacteria 5796
64 Ga0105244_10013017 3300009036 Bacteria 4885
65 Ga0105244_10018753 3300009036 Bacteria 3875
66 Ga0105244_10021150 3300009036 Bacteria 3603
67 Ga0105244_10022751 3300009036 Bacteria 3446
68 Ga0105244_10061149 3300009036 Bacteria 1896
69 Ga0105250_10000016 3300009092 Bacteria 256310
70 Ga0105250_10000176 3300009092 Bacteria 55832
71 Ga0105250_10000199 3300009092 Bacteria 51075
72 Ga0105250_10000506 3300009092 Bacteria 27341
73 Ga0105250_10001803 3300009092 Bacteria 11215
74 Ga0105250_10002992 3300009092 Bacteria 8200
75 Ga0105240_10240563 3300009093 Unclassified 2098
76 Ga0111539_10396924 3300009094 Bacteria 1606
77 Ga0111539_10437642 3300009094 Unclassified 1522
78 Ga0111539_10449305 3300009094 Unclassified 1501
79 Ga0114129_10047411 3300009147 Bacteria 6037
80 Ga0105243_10001643 3300009148 Bacteria 19417
81 Ga0105242_10012926 3300009176 Bacteria 6435
82 Ga0105242_10017049 3300009176 Bacteria 5655
83 Ga0105248_10139370 3300009177 Bacteria 2736
84 Ga0105237_10000413 3300009545 Bacteria 60829
85 Ga0105237_10010237 3300009545 Bacteria 9992
86 Ga0105238_10000125 3300009551 Bacteria 84436
87 Ga0105239_10003165 3300010375 Bacteria 20393
88 Ga0105246_10082078 3300011119 Bacteria 2300
89 Ga0157345_1000004 3300012498 Bacteria 80365
90 Ga0157373_10000039 3300013100 Bacteria 117160
91 Ga0157373_10002201 3300013100 Bacteria 14757
92 Ga0157373_10003615 3300013100 Bacteria 11680
93 Ga0157373_10009624 3300013100 Bacteria 7133
94 Ga0157373_10014064 3300013100 Bacteria 5867
95 Ga0157373_10024748 3300013100 Bacteria 4346
96 Ga0157373_10055489 3300013100 Bacteria 2814
97 Ga0157373_10241405 3300013100 Bacteria 1277
98 Ga0157371_10000360 3300013102 Bacteria 57883
99 Ga0157371_10168426 3300013102 Bacteria 1565
100 Ga0157370_10013915 3300013104 Bacteria 8262
101 Ga0157370_10055838 3300013104 Bacteria 3760
102 Ga0157370_10086632 3300013104 Bacteria 2942
103 Ga0157370_10435503 3300013104 Bacteria 1206
104 Ga0157369_10000286 3300013105 Bacteria 67677
105 Ga0157369_10004993 3300013105 Bacteria 15534
106 Ga0157369_10022167 3300013105 Bacteria 7095
107 Ga0157369_10022596 3300013105 Bacteria 7015
108 Ga0157369_10031991 3300013105 Bacteria 5788
109 Ga0157369_10035157 3300013105 Bacteria 5496
110 Ga0157369_10123274 3300013105 Bacteria 2749
111 Ga0157378_10320194 3300013297 Bacteria 1506
112 Ga0163162_10000067 3300013306 Bacteria 99435
113 Ga0157372_10003028 3300013307 Bacteria 18103
114 Ga0157375_10000819 3300013308 Bacteria 27196
115 Ga0157375_10005669 3300013308 Bacteria 10865
116 Ga0157375_10043075 3300013308 Bacteria 4374
117 Ga0157375_10098142 3300013308 Bacteria 3005
118 Ga0182008_10000878 3300014497 Bacteria 20898
119 Ga0182008_10003948 3300014497 Bacteria 8775
120 Ga0182006_1000529 3300015261 Bacteria 28957
121 Ga0182006_1003319 3300015261 Bacteria 8300
122 Ga0182006_1017245 3300015261 Bacteria 3070
123 Ga0182006_1034812 3300015261 Bacteria 2012
124 Ga0182006_1051941 3300015261 Bacteria 1576
125 Ga0182007_10003890 3300015262 Bacteria 6924
126 Ga0182007_10008579 3300015262 Bacteria 4187
127 Ga0182005_1009931 3300015265 Bacteria 2750
128 Ga0182005_1018257 3300015265 Bacteria 1939
129 Ga0163161_10000204 3300017792 Bacteria 54224
130 Ga0163161_10015769 3300017792 Bacteria 5269
131 Ga0163161_10050889 3300017792 Bacteria 2999
132 Ga0163161_10059022 3300017792 Bacteria 2789
133 Ga0163161_10071041 3300017792 Bacteria 2546
134 Ga0163161_10145347 3300017792 Bacteria 1798
135 Ga0213872_10005011 3300021361 Bacteria 6876
136 Ga0213872_10027138 3300021361 Bacteria 2629
137 Ga0213876_10000368 3300021384 Bacteria 38187
138 Ga0209784_100002 3300025224 Bacteria 1753105
139 Ga0209784_100035 3300025224 Bacteria 299760
140 Ga0209566_100003 3300025225 Bacteria 1753105
141 Ga0209566_100040 3300025225 Bacteria 299760
142 Ga0209674_100004 3300025226 Bacteria 1753105
143 Ga0209674_100057 3300025226 Bacteria 299760
144 Ga0209563_100006 3300025230 Bacteria 1753105
145 Ga0209563_100059 3300025230 Bacteria 299760
146 Ga0209563_100751 3300025230 Bacteria 9942
147 Ga0209677_100003 3300025253 Bacteria 1753105
148 Ga0209677_100036 3300025253 Bacteria 299760
149 Ga0209675_1001494 3300025291 Bacteria 13411
150 Ga0209675_1004373 3300025291 Bacteria 6301
151 Ga0209676_1000020 3300025292 Bacteria 617256
152 Ga0209676_1000102 3300025292 Bacteria 227372
153 Ga0209676_1002965 3300025292 Bacteria 11045
154 Ga0209050_1000043 3300025298 Bacteria 398654
155 Ga0209050_1000105 3300025298 Bacteria 227285
156 Ga0209051_1000030 3300025303 Bacteria 398654
157 Ga0209051_1000066 3300025303 Bacteria 227369
158 Ga0209257_1000124 3300025304 Bacteria 218195
159 Ga0209257_1008354 3300025304 Bacteria 5914
160 Ga0207656_10001105 3300025321 Bacteria 8856
161 Ga0207696_1000030 3300025711 Bacteria 395961
162 Ga0207696_1000051 3300025711 Bacteria 276833
163 Ga0207696_1000090 3300025711 Bacteria 188474
164 Ga0207696_1000109 3300025711 Bacteria 156361
165 Ga0207696_1000176 3300025711 Bacteria 100134
166 Ga0207696_1000177 3300025711 Bacteria 100134
167 Ga0207696_1001491 3300025711 Bacteria 12591
168 Ga0207696_1001893 3300025711 Bacteria 10684
169 Ga0207655_1000140 3300025728 Bacteria 139110
170 Ga0207655_1001057 3300025728 Bacteria 27466
171 Ga0207655_1002205 3300025728 Bacteria 16174
172 Ga0207655_1002480 3300025728 Bacteria 14944
173 Ga0207655_1004046 3300025728 Bacteria 10560
174 Ga0207655_1030580 3300025728 Bacteria 2501
175 Ga0207713_1000009 3300025735 Bacteria 551314
176 Ga0207713_1000128 3300025735 Bacteria 118144
177 Ga0207713_1000199 3300025735 Bacteria 83023
178 Ga0207713_1001600 3300025735 Bacteria 17697
179 Ga0207713_1001615 3300025735 Bacteria 17565
180 Ga0207713_1005257 3300025735 Bacteria 8159
181 Ga0207713_1009097 3300025735 Bacteria 5639
182 Ga0207713_1011282 3300025735 Bacteria 4872
183 Ga0207713_1055101 3300025735 Bacteria 1554
184 Ga0207695_10003770 3300025913 Bacteria 21033
185 Ga0207695_10197317 3300025913 Unclassified 1928
186 Ga0207671_10002331 3300025914 Bacteria 20489
187 Ga0207671_10003125 3300025914 Bacteria 16823
188 Ga0207649_10000156 3300025920 Bacteria 55743
189 Ga0207681_10003357 3300025923 Bacteria 10025
190 Ga0207694_10001397 3300025924 Bacteria 20729
191 Ga0207650_10000963 3300025925 Bacteria 21659
192 Ga0207706_10010315 3300025933 Bacteria 8541
193 Ga0207686_10003046 3300025934 Bacteria 9021
194 Ga0207679_10000016 3300025945 Bacteria 253494
195 Ga0207667_10008338 3300025949 Bacteria 12323
196 Ga0207708_10046943 3300026075 Bacteria 3289
197 Ga0207641_10214234 3300026088 Bacteria 1783
198 Ga0207674_10101251 3300026116 Bacteria 2862
199 Ga0207675_100061903 3300026118 Bacteria 3494
200 Ga0209281_1002352 3300027111 Bacteria 7794
201 Ga0209371_1000310 3300027312 Bacteria 54149
202 Ga0209371_1000525 3300027312 Bacteria 36586
203 Ga0207428_10009892 3300027907 Bacteria 8541
204 Ga0207428_10018770 3300027907 Bacteria 5900
205 Ga0268266_10199164 3300028379 Bacteria 1832
206 Ga0268265_10023237 3300028380 Bacteria 4369
207 Ga0265318_10004229 3300028577 Bacteria 7005
208 Ga0265338_10192502 3300028800 Bacteria 1545
209 Ga0268256_1000076 3300030500 Bacteria 178295
210 Ga0268256_1000267 3300030500 Bacteria 54149
211 Ga0268256_1004820 3300030500 Bacteria 5467
212 Ga0316179_1009738 3300030734 Bacteria 1124
213 Ga0316178_1002530 3300030735 Bacteria 5413
214 Ga0265320_10015256 3300031240 Bacteria 4346
215 Ga0265329_10009312 3300031242 Bacteria 3670
216 Ga0265340_10012169 3300031247 Bacteria 4548
217 Ga0265316_10171806 3300031344 Bacteria 1616
218 Ga0307408_100000085 3300031548 Bacteria 104335
219 Ga0307408_100004965 3300031548 Bacteria 8945
220 Ga0307408_100032029 3300031548 Bacteria 3664
221 Ga0307408_100037295 3300031548 Bacteria 3423
222 Ga0307514_10011530 3300031649 Bacteria 7350
223 Ga0265342_10014569 3300031712 Bacteria 5215
224 Ga0307405_10000197 3300031731 Bacteria 22213
225 Ga0307405_10051150 3300031731 Bacteria 2562
226 Ga0307406_10092065 3300031901 Bacteria 2043
227 Ga0307412_10001387 3300031911 Bacteria 13458
228 Ga0307412_10077873 3300031911 Bacteria 2281
229 Ga0307414_10104491 3300032004 Bacteria 2139
230 Ga0307414_10113389 3300032004 Bacteria 2069
231 Ga0307414_10360197 3300032004 Bacteria 1251
232 Ga0307411_10009261 3300032005 Bacteria 5163
233 Ga0307411_10106084 3300032005 Bacteria 1999
234 Ga0307510_10010763 3300033180 Bacteria 10879
235 Ga0373939_0003741 3300035114 Bacteria 3585
236 Ga0373941_0008739 3300035115 Bacteria 2528
237 Ga0373931_0000154 3300035691 Bacteria 29993
238 Ga0395899_0148781 3300037312 Unclassified 1661
239 Ga0395900_0093915 3300037418 Bacteria 3081
240 Ga0395905_0032452 3300037471 Bacteria 4911
241 Ga0395901_0117851 3300038443 Bacteria 2790
242 Ga0436365_0117120 3300039437 Bacteria 67592
243 Ga0436365_1009064 3300039437 Bacteria 17108
244 Ga0436361_0442878 3300039447 Bacteria 7602
245 Ga0439438_000077 3300041405 Bacteria 45928
246 Ga0439438_000205 3300041405 Bacteria 26994
247 Ga0439438_006478 3300041405 Bacteria 4120
248 Ga0439447_000018 3300041407 Bacteria 59762
249 Ga0439466_0019324 3300041411 Bacteria 2438
250 Ga0439466_0021820 3300041411 Bacteria 2265
251 Ga0439432_022189 3300042006 Bacteria 2097
252 Ga0439451_013286 3300042009 Bacteria 1664
253 Ga0439452_000081 3300042010 Bacteria 82231
254 Ga0439456_001343 3300042013 Bacteria 4908
255 Ga0439456_010001 3300042013 Bacteria 1958
256 Ga0439463_000051 3300042016 Bacteria 25071
257 Ga0439463_019606 3300042016 Bacteria 1684
258 Ga0439463_040241 3300042016 Bacteria 1187
259 Ga0450911_000488 3300042115 Bacteria 12619
260 Ga0450900_001423 3300042136 Bacteria 2329
261 Ga0450903_007678 3300042138 Bacteria 1770
262 Ga0450906_000446 3300042145 Bacteria 8593
263 Ga0450906_008392 3300042145 Bacteria 2000
264 Ga0439464_0042722 3300042439 Bacteria 1295
265 Ga0439460_0013383 3300042461 Bacteria 2145
266 Ga0466957_0026094 3300044842 Bacteria 3465
267 Ga0466958_0091102 3300045836 Bacteria 1887
268 Ga0495617_015581 3300046452 Bacteria 2574
269 Ga0495617_040034 3300046452 Bacteria 1567
270 Ga0495627_000076 3300046453 Bacteria 120147
271 Ga0495627_000101 3300046453 Bacteria 105414
272 Ga0495627_015018 3300046453 Bacteria 2682
273 Ga0495627_019705 3300046453 Bacteria 2257
274 Ga0495590_0010123 3300046457 Bacteria 3557
275 Ga0495591_000027 3300046458 Bacteria 186086
276 Ga0495591_000032 3300046458 Bacteria 176337
277 Ga0495591_000082 3300046458 Bacteria 107579
278 Ga0495591_000120 3300046458 Bacteria 86214
279 Ga0495591_000360 3300046458 Bacteria 39602
280 Ga0495591_000877 3300046458 Bacteria 21122
281 Ga0495591_003545 3300046458 Bacteria 7995
282 Ga0495591_005553 3300046458 Bacteria 5803
283 Ga0495591_005656 3300046458 Bacteria 5725
284 Ga0495591_021175 3300046458 Bacteria 2128
285 Ga0495638_0012989 3300046460 Bacteria 5686
286 Ga0495638_0028047 3300046460 Bacteria 3638
287 Ga0495638_0101947 3300046460 Bacteria 1715
288 Ga0495650_0001176 3300046471 Bacteria 27830
289 Ga0495650_0009217 3300046471 Bacteria 5645
290 Ga0495650_0015429 3300046471 Bacteria 3919
291 Ga0495650_0016179 3300046471 Bacteria 3789
292 Ga0495650_0021683 3300046471 Bacteria 3095
293 Ga0495605_0000019 3300046474 Bacteria 270010
294 Ga0495605_0000122 3300046474 Bacteria 101994
295 Ga0495605_0000147 3300046474 Bacteria 90988
296 Ga0495605_0000211 3300046474 Bacteria 71871
297 Ga0495605_0000549 3300046474 Bacteria 30709
298 Ga0495605_0000996 3300046474 Bacteria 19166
299 Ga0495605_0007223 3300046474 Bacteria 6314
300 Ga0495605_0019300 3300046474 Bacteria 3645
301 Ga0495605_0069423 3300046474 Bacteria 1668
302 Ga0495584_0001271 3300046491 Bacteria 15361
303 Ga0495584_0003889 3300046491 Bacteria 8083
304 Ga0495584_0004786 3300046491 Bacteria 7237
305 Ga0495584_0014310 3300046491 Bacteria 4042
306 Ga0495584_0030686 3300046491 Bacteria 2722
307 Ga0495584_0039347 3300046491 Bacteria 2388
308 Ga0495585_0000778 3300046492 Bacteria 28216
309 Ga0495585_0003440 3300046492 Bacteria 10693
310 Ga0495585_0003811 3300046492 Bacteria 10041
311 Ga0495585_0019362 3300046492 Bacteria 3924
312 Ga0495585_0026514 3300046492 Bacteria 3310
313 Ga0495594_0000394 3300046499 Bacteria 21938
314 Ga0495596_0008681 3300046500 Bacteria 4505
315 Ga0495596_0013039 3300046500 Bacteria 3540
316 Ga0495607_0000358 3300046501 Bacteria 47061
317 Ga0495607_0000603 3300046501 Bacteria 35007
318 Ga0495607_0000610 3300046501 Bacteria 34751
319 Ga0495607_0001402 3300046501 Bacteria 21443
320 Ga0495607_0001675 3300046501 Bacteria 19157
321 Ga0495607_0003555 3300046501 Bacteria 11870
322 Ga0495607_0003971 3300046501 Bacteria 11123
323 Ga0495607_0004765 3300046501 Bacteria 9915
324 Ga0495607_0031794 3300046501 Bacteria 3228
325 Ga0495607_0039592 3300046501 Bacteria 2814
326 Ga0495607_0054677 3300046501 Bacteria 2299
327 Ga0495607_0065067 3300046501 Bacteria 2057
328 Ga0495583_0000097 3300046506 Bacteria 149533
329 Ga0495583_0000670 3300046506 Bacteria 44793
330 Ga0495583_0002573 3300046506 Bacteria 15254
331 Ga0495583_0004622 3300046506 Bacteria 9727
332 Ga0495583_0006116 3300046506 Bacteria 7941
333 Ga0495583_0038740 3300046506 Bacteria 2250
334 Ga0495606_0000634 3300046507 Bacteria 55249
335 Ga0495606_0001829 3300046507 Bacteria 26961
336 Ga0495606_0002123 3300046507 Bacteria 24018
337 Ga0495606_0007373 3300046507 Bacteria 9870
338 Ga0495606_0013482 3300046507 Bacteria 6450
339 Ga0495606_0038492 3300046507 Bacteria 3234
340 Ga0495606_0099056 3300046507 Bacteria 1777
341 Ga0495610_0000133 3300046512 Bacteria 82356
342 Ga0495610_0002092 3300046512 Bacteria 17052
343 Ga0495610_0002864 3300046512 Bacteria 14007
344 Ga0495610_0014481 3300046512 Bacteria 4629
345 Ga0495616_0001757 3300046513 Bacteria 14739
346 Ga0495616_0004535 3300046513 Bacteria 8744
347 Ga0495616_0005698 3300046513 Bacteria 7631
348 Ga0495616_0009481 3300046513 Bacteria 5686
349 Ga0495616_0031066 3300046513 Bacteria 2801
350 Ga0495620_0000127 3300046515 Bacteria 62010
351 Ga0495620_0000163 3300046515 Bacteria 53016
352 Ga0495620_0000305 3300046515 Bacteria 34966
353 Ga0495620_0000504 3300046515 Bacteria 25344
354 Ga0495620_0008149 3300046515 Bacteria 5639
355 Ga0495620_0011877 3300046515 Bacteria 4526
356 Ga0495620_0019554 3300046515 Bacteria 3327
357 Ga0495631_0000003 3300046518 Bacteria 164714
358 Ga0495631_0000013 3300046518 Bacteria 109794
359 Ga0495631_0010448 3300046518 Bacteria 4591
360 Ga0495631_0027497 3300046518 Bacteria 2602
361 Ga0495631_0062159 3300046518 Bacteria 1618
362 Ga0495632_0000515 3300046519 Bacteria 36406
363 Ga0495632_0002535 3300046519 Bacteria 13843
364 Ga0495632_0004215 3300046519 Bacteria 9828
365 Ga0495632_0008410 3300046519 Bacteria 6334
366 Ga0495632_0009952 3300046519 Bacteria 5677
367 Ga0495632_0011811 3300046519 Bacteria 5081
368 Ga0495632_0030161 3300046519 Bacteria 2817
369 Ga0495632_0080333 3300046519 Bacteria 1555
370 Ga0495637_0000238 3300046520 Bacteria 42855
371 Ga0495637_0000242 3300046520 Bacteria 42656
372 Ga0495637_0000855 3300046520 Bacteria 19898
373 Ga0495637_0001018 3300046520 Bacteria 17624
374 Ga0495637_0015434 3300046520 Bacteria 3581
375 Ga0495637_0020190 3300046520 Bacteria 3068
376 Ga0495637_0021520 3300046520 Bacteria 2955
377 Ga0495637_0036806 3300046520 Bacteria 2128
378 Ga0495643_0000396 3300046522 Bacteria 57359
379 Ga0495643_0005933 3300046522 Bacteria 8150
380 Ga0495644_0001633 3300046523 Bacteria 9122
381 Ga0495644_0005850 3300046523 Bacteria 4804
382 Ga0495648_0000672 3300046524 Bacteria 36559
383 Ga0495648_0002586 3300046524 Bacteria 16576
384 Ga0495648_0003849 3300046524 Bacteria 13022
385 Ga0495648_0007343 3300046524 Bacteria 8826
386 Ga0495648_0009901 3300046524 Bacteria 7319
387 Ga0495648_0038174 3300046524 Bacteria 3075
388 Ga0495642_0115863 3300046528 Bacteria 1148
389 Ga0495652_0086104 3300046529 Bacteria 2581
390 Ga0495654_0000104 3300046530 Bacteria 95266
391 Ga0495654_0000407 3300046530 Bacteria 36796
392 Ga0495654_0000409 3300046530 Bacteria 36562
393 Ga0495654_0005004 3300046530 Bacteria 7779
394 Ga0495654_0005203 3300046530 Bacteria 7589
395 Ga0495654_0009031 3300046530 Bacteria 5471
396 Ga0495654_0009881 3300046530 Bacteria 5214
397 Ga0495654_0010073 3300046530 Bacteria 5157
398 Ga0495654_0010157 3300046530 Bacteria 5132
399 Ga0495654_0011525 3300046530 Bacteria 4780
400 Ga0495654_0018195 3300046530 Bacteria 3685
401 Ga0495609_0000023 3300046538 Bacteria 269702
402 Ga0495609_0000057 3300046538 Bacteria 143793
403 Ga0495609_0000232 3300046538 Bacteria 53159
404 Ga0495609_0000526 3300046538 Bacteria 30607
405 Ga0495609_0000879 3300046538 Bacteria 21988
406 Ga0495609_0001274 3300046538 Bacteria 17195
407 Ga0495609_0007402 3300046538 Bacteria 5485
408 Ga0495609_0019094 3300046538 Bacteria 3173
409 Ga0495597_0000052 3300046542 Bacteria 96489
410 Ga0495597_0000965 3300046542 Bacteria 22210
411 Ga0495597_0003427 3300046542 Bacteria 9262
412 Ga0495597_0015902 3300046542 Bacteria 3557
413 Ga0495597_0033078 3300046542 Bacteria 2343
414 Ga0495597_0064335 3300046542 Bacteria 1593
415 Ga0495597_0099112 3300046542 Bacteria 1230
416 Ga0495622_0000047 3300046557 Bacteria 109638
417 Ga0495622_0040111 3300046557 Bacteria 2179
418 Ga0495633_0000038 3300046558 Bacteria 182144
419 Ga0495633_0000304 3300046558 Bacteria 55996
420 Ga0495633_0006735 3300046558 Bacteria 6761
421 Ga0495656_0114421 3300046615 Bacteria 1266
422 Ga0495668_0002358 3300046616 Bacteria 15711
423 Ga0495668_0011989 3300046616 Bacteria 5160
424 Ga0495668_0019393 3300046616 Bacteria 3921
425 Ga0495611_0000024 3300046648 Bacteria 118898
426 Ga0495611_0000601 3300046648 Bacteria 20761
427 Ga0495611_0006442 3300046648 Bacteria 5005
428 Ga0495625_0000103 3300046660 Bacteria 136109
429 Ga0495625_0000203 3300046660 Bacteria 94546
430 Ga0495625_0002403 3300046660 Bacteria 20297
431 Ga0495625_0010547 3300046660 Bacteria 7632
432 Ga0495625_0039612 3300046660 Bacteria 3440
433 Ga0495625_0215167 3300046660 Bacteria 1261
434 Ga0495659_0066649 3300046664 Bacteria 1341
435 Ga0495661_0000079 3300046665 Bacteria 117662
436 Ga0495661_0000200 3300046665 Bacteria 69488
437 Ga0495661_0000307 3300046665 Bacteria 55845
438 Ga0495661_0001309 3300046665 Bacteria 21197
439 Ga0495661_0002279 3300046665 Bacteria 14840
440 Ga0495661_0011970 3300046665 Bacteria 5870
441 Ga0495661_0018399 3300046665 Bacteria 4597
442 Ga0495661_0029479 3300046665 Bacteria 3501
443 Ga0495661_0031599 3300046665 Bacteria 3357
444 Ga0495588_0110758 3300046674 Bacteria 1446
445 Ga0495670_0000020 3300046691 Bacteria 110171
446 Ga0495670_0000131 3300046691 Bacteria 32446
447 Ga0495670_0000856 3300046691 Bacteria 14727
448 Ga0495670_0149491 3300046691 Bacteria 1224
449 Ga0495671_0000402 3300046692 Bacteria 35090
450 Ga0495671_0000541 3300046692 Bacteria 28528
451 Ga0495671_0007459 3300046692 Bacteria 6229
452 Ga0495671_0014123 3300046692 Bacteria 4305
453 Ga0495671_0061192 3300046692 Bacteria 1857
454 Ga0495649_0002309 3300046694 Bacteria 13533
455 Ga0495649_0004085 3300046694 Bacteria 9603
456 Ga0495649_0007150 3300046694 Bacteria 6854
457 Ga0495649_0024018 3300046694 Bacteria 3402
458 Ga0495649_0035572 3300046694 Bacteria 2739
459 Ga0495649_0125649 3300046694 Bacteria 1355
460 Ga0495589_0000234 3300046794 Bacteria 46522
461 Ga0495589_0001765 3300046794 Bacteria 12315
462 Ga0495589_0002333 3300046794 Bacteria 10666
463 Ga0495589_0021740 3300046794 Bacteria 3277
464 Ga0495660_0001437 3300046810 Bacteria 16299
465 Ga0495660_0002576 3300046810 Bacteria 11514
466 Ga0495660_0004619 3300046810 Bacteria 8305
467 Ga0495660_0007458 3300046810 Bacteria 6419
468 Ga0495660_0018034 3300046810 Bacteria 4059
469 Ga0495660_0026588 3300046810 Bacteria 3279
470 Ga0495660_0038289 3300046810 Bacteria 2666
471 Ga0495660_0090916 3300046810 Bacteria 1586
472 Ga0495672_0003653 3300047320 Bacteria 13028
473 Ga0495672_0004567 3300047320 Bacteria 11257
474 Ga0495672_0015739 3300047320 Bacteria 5124
475 Ga0495672_0041011 3300047320 Bacteria 2803
476 Ga0495676_0000033 3300047321 Bacteria 126929
477 Ga0495676_0000058 3300047321 Bacteria 86045
478 Ga0495683_0000032 3300047323 Bacteria 149612
479 Ga0495683_0000062 3300047323 Bacteria 113926
480 Ga0495683_0011221 3300047323 Bacteria 4720
481 Ga0495683_0018289 3300047323 Bacteria 3625
482 Ga0495683_0026806 3300047323 Bacteria 2949
483 Ga0495687_056484 3300047443 Bacteria 1637
484 Ga0495679_000061 3300047446 Bacteria 108279
485 Ga0495679_000612 3300047446 Bacteria 24130
486 Ga0495679_001075 3300047446 Bacteria 16546
487 Ga0495679_001335 3300047446 Bacteria 14250
488 Ga0495679_004062 3300047446 Bacteria 6860
489 Ga0495679_004870 3300047446 Bacteria 6061
490 Ga0495679_007852 3300047446 Bacteria 4398
491 Ga0495673_0000506 3300047469 Bacteria 41323
492 Ga0495673_0001081 3300047469 Bacteria 23812
493 Ga0495673_0001967 3300047469 Bacteria 15211
494 Ga0495673_0002039 3300047469 Bacteria 14802
495 Ga0495673_0002097 3300047469 Bacteria 14527
496 Ga0495673_0007025 3300047469 Bacteria 6537
497 Ga0495673_0008887 3300047469 Bacteria 5601
498 Ga0495673_0016420 3300047469 Bacteria 3785
499 Ga0495673_0029225 3300047469 Bacteria 2603
500 Ga0495673_0034324 3300047469 Bacteria 2345
501 Ga0495673_0046479 3300047469 Bacteria 1923
502 Ga0495673_0057293 3300047469 Bacteria 1682
503 Ga0495673_0065663 3300047469 Bacteria 1540
504 Ga0495673_0078843 3300047469 Bacteria 1368
505 Ga0495681_0000083 3300047470 Bacteria 82240
506 Ga0495681_0000231 3300047470 Bacteria 46423
507 Ga0495681_0002852 3300047470 Bacteria 12212
508 Ga0495681_0003977 3300047470 Bacteria 10172
509 Ga0495681_0009135 3300047470 Bacteria 6137
510 Ga0495681_0013480 3300047470 Bacteria 4737
511 Ga0495681_0016791 3300047470 Bacteria 4087
512 Ga0495686_0000266 3300047472 Bacteria 93781
513 Ga0495686_0001781 3300047472 Bacteria 21922
514 Ga0495626_0000074 3300048091 Bacteria 132552
515 Ga0495626_0000084 3300048091 Bacteria 126896
516 Ga0495626_0000104 3300048091 Bacteria 110079
517 Ga0495626_0007211 3300048091 Bacteria 6212
518 Ga0495626_0010037 3300048091 Bacteria 5079
519 Ga0495626_0036137 3300048091 Bacteria 2354
520 Ga0496104_0001908 3300048907 Bacteria 18063
521 Ga0496108_0008581 3300048911 Bacteria 8287
522 Ga0496109_0012613 3300048912 Bacteria 7298
523 Ga0496110_0002277 3300048913 Bacteria 14343
524 Ga0496110_0015034 3300048913 Bacteria 6437
525 Ga0496111_0009830 3300048914 Bacteria 6392
526 Ga0496111_0174147 3300048914 Bacteria 1599
527 Ga0496112_0029266 3300048915 Bacteria 5326
528 Ga0496112_0109393 3300048915 Bacteria 2734
529 Ga0496113_0008061 3300048916 Bacteria 6836
530 Ga0496116_0000255 3300048919 Bacteria 94048
531 Ga0496116_0001015 3300048919 Bacteria 34238
532 Ga0496116_0007951 3300048919 Bacteria 9292
533 Ga0496116_0030101 3300048919 Bacteria 3905
534 Ga0496117_0000246 3300048920 Bacteria 102783
535 Ga0496117_0000475 3300048920 Bacteria 66690
536 Ga0496117_0028925 3300048920 Bacteria 4281
537 Ga0496117_0074598 3300048920 Bacteria 2257
538 Ga0496117_0148511 3300048920 Bacteria 1391
539 Ga0496117_0154020 3300048920 Bacteria 1356
540 Ga0496118_0000482 3300048921 Bacteria 66218
541 Ga0496118_0004092 3300048921 Bacteria 17677
542 Ga0496118_0014730 3300048921 Bacteria 7302
543 Ga0496118_0045460 3300048921 Bacteria 3427
544 Ga0496119_0071602 3300048922 Bacteria 2028
545 Ga0496119_0072833 3300048922 Bacteria 2005
546 Ga0496120_0001430 3300048923 Bacteria 28786
547 Ga0496120_0050579 3300048923 Bacteria 2378
548 Ga0496121_0001730 3300048924 Bacteria 35634
549 Ga0496121_0005253 3300048924 Bacteria 16739
550 Ga0496121_0007471 3300048924 Bacteria 13196
551 Ga0496121_0045502 3300048924 Bacteria 3770
552 Ga0496122_0000304 3300048925 Bacteria 108409
553 Ga0496122_0000866 3300048925 Bacteria 57016
554 Ga0496122_0012165 3300048925 Bacteria 8605
555 Ga0496122_0027987 3300048925 Bacteria 4800
556 Ga0496122_0056402 3300048925 Bacteria 2928
557 Ga0496122_0090181 3300048925 Bacteria 2093
558 Ga0496123_0000254 3300048926 Bacteria 108095
559 Ga0496123_0000413 3300048926 Bacteria 78006
560 Ga0496123_0002199 3300048926 Bacteria 24807
561 Ga0496123_0003395 3300048926 Bacteria 17945
562 Ga0496123_0009098 3300048926 Bacteria 8992
563 Ga0496124_0000007 3300048927 Bacteria 883534
564 Ga0496124_0000887 3300048927 Bacteria 48606
565 Ga0496124_0001319 3300048927 Bacteria 37386
566 Ga0496124_0004236 3300048927 Bacteria 16873
567 Ga0496124_0016215 3300048927 Bacteria 7098
568 Ga0496124_0063035 3300048927 Bacteria 3099
569 Ga0496124_0201597 3300048927 Bacteria 1512
570 Ga0496125_0001337 3300048928 Bacteria 36347
571 Ga0496125_0011521 3300048928 Bacteria 8835
572 Ga0496126_0199780 3300048929 Bacteria 1689
573 Ga0495678_000046 3300049459 Bacteria 171703
574 Ga0495678_000125 3300049459 Bacteria 90012
575 Ga0495678_000222 3300049459 Bacteria 65798
576 Ga0495678_001994 3300049459 Bacteria 14674
577 Ga0495678_003914 3300049459 Bacteria 8928
578 Ga0495678_008133 3300049459 Bacteria 5339
579 Ga0495678_014258 3300049459 Bacteria 3701
580 Ga0495678_067082 3300049459 Bacteria 1326
581 Ga0495682_0000060 3300049460 Bacteria 102283
582 Ga0495682_0000186 3300049460 Bacteria 50692
583 Ga0495682_0000425 3300049460 Bacteria 29587
584 Ga0495682_0017639 3300049460 Bacteria 2691
585 Ga0501067_0143915 3300049583 Bacteria 1328
586 Ga0501072_0017862 3300049588 Bacteria 5455
587 Ga0501241_000247 3300049758 Bacteria 12110
588 nmdc:mga0k408_31054_c1 3300050493 Bacteria 3048
589 nmdc:mga06z11_3723_c1 3300050494 Bacteria 5923
590 nmdc:mga05p37_283694_c1 3300050507 Bacteria 1974
591 nmdc:mga08y16_445471_c1 3300050511 Unclassified 1321
592 nmdc:mga08y16_478365_c1 3300050511 Unclassified 1268
593 nmdc:mga0n895_13514_c1 3300050512 Bacteria 7370
594 nmdc:mga0n895_2124_c1 3300050512 Bacteria 15308
595 nmdc:mga0rr50_12866_c1 3300050513 Bacteria 5424
596 nmdc:mga0a205_61789_c1 3300050515 Bacteria 3619
597 Ga0500644_0083630 3300053088 Unclassified 1179
598 Ga0500646_0002782 3300053090 Bacteria 4499
599 Ga0500651_0045925 3300053093 Bacteria 2747
600 Ga0500650_0214272 3300053098 Unclassified 874
601 Ga0500572_002475 3300053111 Bacteria 4427
602 Ga0500593_000651 3300053117 Bacteria 13292
603 Ga0500618_000228 3300053125 Bacteria 44193
604 Ga0500618_003817 3300053125 Bacteria 5029
605 Ga0500642_0019434 3300053130 Bacteria 2649
606 Ga0500655_002244 3300053133 Bacteria 3548
607 Ga0500658_0064259 3300053134 Bacteria 1535
608 Ga0500604_0001412 3300053151 Bacteria 6696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053098 Ga0500650_0214272 Ga0500650_0214272_10_858 280
2 3300032004 Ga0307414_10360197 Ga0307414_103601971 310
3 3300028800 Ga0265338_10192502 Ga0265338_101925021 317
4 3300003751 Ga0055538_1000053 Ga0055538_100005365 318
5 3300003752 Ga0055539_1000078 Ga0055539_100007865 318
6 3300003756 Ga0055533_1000084 Ga0055533_100008465 318
7 3300003759 Ga0055525_1000112 Ga0055525_100011257 318
8 3300003841 Ga0055541_1000055 Ga0055541_100005557 318
9 3300021361 Ga0213872_10005011 Ga0213872_100050114 318
10 3300025224 Ga0209784_100035 Ga0209784_10003557 318
11 3300025225 Ga0209566_100040 Ga0209566_10004057 318
12 3300025226 Ga0209674_100057 Ga0209674_10005757 318
13 3300025230 Ga0209563_100059 Ga0209563_10005957 318
14 3300025253 Ga0209677_100036 Ga0209677_10003657 318
15 3300026116 Ga0207674_10101251 Ga0207674_101012513 318
16 3300031649 Ga0307514_10011530 Ga0307514_100115306 318
17 3300039447 Ga0436361_0442878 Ga0436361_0442878_1016_2032 318
18 3300053117 Ga0500593_000651 Ga0500593_000651_11642_12658 318
19 iso_pu_bacteria 2904439833 2904444239 319
20 iso_pu_bacteria 2904584206 2904589320 319
21 iso_pu_bacteria 2904589729 2904595022 319
22 iso_pu_bacteria 2904601388 2904606497 319
23 iso_pu_bacteria 2919079590 2919084553 319
24 3300005563 Ga0068855_100003463 Ga0068855_1000034632 321
25 3300009545 Ga0105237_10010237 Ga0105237_100102373 321
26 3300025914 Ga0207671_10002331 Ga0207671_1000233114 321
27 3300025949 Ga0207667_10008338 Ga0207667_100083382 321
28 3300050494 nmdc:mga06z11_3723_c1 nmdc:mga06z11_3723_c1_3934_4923 321
29 3300009551 Ga0105238_10000125 Ga0105238_1000012571 322
30 3300010375 Ga0105239_10003165 Ga0105239_100031653 322
31 3300015261 Ga0182006_1017245 Ga0182006_10172452 322
32 3300025913 Ga0207695_10003770 Ga0207695_1000377014 322
33 3300025924 Ga0207694_10001397 Ga0207694_1000139715 322
34 3300047469 Ga0495673_0007025 Ga0495673_0007025_2602_3594 322
35 3300046674 Ga0495588_0110758 Ga0495588_0110758_464_1435 323
36 3300046474 Ga0495605_0019300 Ga0495605_0019300_853_1830 325
37 iso_pu_bacteria 2884811622 2884815319 325
38 iso_pu_bacteria 2884836552 2884840837 325
39 iso_pu_bacteria 2884852848 2884857567 325
40 iso_pu_bacteria 2896154374 2896158507 325
41 3300009093 Ga0105240_10240563 Ga0105240_102405633 326
42 3300026088 Ga0207641_10214234 Ga0207641_102142342 326
43 3300037312 Ga0395899_0148781 Ga0395899_0148781_322_1320 326
44 3300037418 Ga0395900_0093915 Ga0395900_0093915_912_1910 326
45 3300037471 Ga0395905_0032452 Ga0395905_0032452_1060_2058 326
46 3300038443 Ga0395901_0117851 Ga0395901_0117851_1301_2299 326
47 3300048907 Ga0496104_0001908 Ga0496104_0001908_961_1965 326
48 3300048911 Ga0496108_0008581 Ga0496108_0008581_4188_5192 326
49 3300048912 Ga0496109_0012613 Ga0496109_0012613_2115_3119 326
50 3300048913 Ga0496110_0002277 Ga0496110_0002277_486_1490 326
51 3300048914 Ga0496111_0009830 Ga0496111_0009830_4673_5677 326
52 3300048915 Ga0496112_0029266 Ga0496112_0029266_3387_4391 326
53 3300048916 Ga0496113_0008061 Ga0496113_0008061_3019_4023 326
54 iso_pu_bacteria 2511231003 2511252220 327
55 iso_pu_bacteria 2609459761 2609913282 327
56 3300005614 Ga0068856_100645353 Ga0068856_1006453531 328
57 3300025913 Ga0207695_10197317 Ga0207695_101973173 328
58 3300032004 Ga0307414_10113389 Ga0307414_101133892 328
59 3300044842 Ga0466957_0026094 Ga0466957_0026094_2111_3118 328
60 3300045836 Ga0466958_0091102 Ga0466958_0091102_584_1591 328
61 3300046542 Ga0495597_0099112 Ga0495597_0099112_234_1220 328
62 iso_pu_bacteria 2823421272 2823423474 328
63 iso_pu_bacteria 2928115317 2928119522 328
64 3300005347 Ga0070668_100171707 Ga0070668_1001717072 329
65 3300005441 Ga0070700_100029931 Ga0070700_1000299312 329
66 3300005459 Ga0068867_100109717 Ga0068867_1001097172 329
67 3300005545 Ga0070695_100015810 Ga0070695_1000158102 329
68 3300005983 Ga0081540_1001935 Ga0081540_100193514 329
69 3300006042 Ga0075368_10000567 Ga0075368_1000056711 329
70 3300006048 Ga0075363_100016545 Ga0075363_1000165452 329
71 3300006178 Ga0075367_10075188 Ga0075367_100751882 329
72 3300006844 Ga0075428_100013546 Ga0075428_10001354611 329
73 3300006844 Ga0075428_100054265 Ga0075428_1000542651 329
74 3300006846 Ga0075430_100021098 Ga0075430_1000210987 329
75 3300006847 Ga0075431_100016112 Ga0075431_10001611210 329
76 3300006852 Ga0075433_10004725 Ga0075433_1000472513 329
77 3300006871 Ga0075434_100005019 Ga0075434_1000050197 329
78 3300006871 Ga0075434_100015419 Ga0075434_10001541910 329
79 3300006914 Ga0075436_100159600 Ga0075436_1001596002 329
80 3300007076 Ga0075435_100029315 Ga0075435_1000293152 329
81 3300007076 Ga0075435_100205767 Ga0075435_1002057672 329
82 3300009094 Ga0111539_10396924 Ga0111539_103969242 329
83 3300009094 Ga0111539_10437642 Ga0111539_104376422 329
84 3300009094 Ga0111539_10449305 Ga0111539_104493052 329
85 3300009147 Ga0114129_10047411 Ga0114129_100474117 329
86 3300013297 Ga0157378_10320194 Ga0157378_103201942 329
87 3300017792 Ga0163161_10071041 Ga0163161_100710413 329
88 3300026075 Ga0207708_10046943 Ga0207708_100469432 329
89 3300026118 Ga0207675_100061903 Ga0207675_1000619031 329
90 3300027907 Ga0207428_10018770 Ga0207428_100187704 329
91 3300028380 Ga0268265_10023237 Ga0268265_100232372 329
92 3300028577 Ga0265318_10004229 Ga0265318_100042297 329
93 3300031247 Ga0265340_10012169 Ga0265340_100121692 329
94 3300031712 Ga0265342_10014569 Ga0265342_100145696 329
95 3300035114 Ga0373939_0003741 Ga0373939_0003741_2417_3427 329
96 3300035115 Ga0373941_0008739 Ga0373941_0008739_1051_2061 329
97 3300035691 Ga0373931_0000154 Ga0373931_0000154_10754_11764 329
98 3300039437 Ga0436365_1009064 Ga0436365_1009064_4640_5650 329
99 3300046460 Ga0495638_0028047 Ga0495638_0028047_982_1992 329
100 3300048913 Ga0496110_0015034 Ga0496110_0015034_3416_4426 329
101 3300048914 Ga0496111_0174147 Ga0496111_0174147_100_1110 329
102 3300049588 Ga0501072_0017862 Ga0501072_0017862_4416_5426 329
103 3300050507 nmdc:mga05p37_283694_c1 nmdc:mga05p37_283694_c1_752_1762 329
104 3300050511 nmdc:mga08y16_445471_c1 nmdc:mga08y16_445471_c1_159_1172 329
105 3300050511 nmdc:mga08y16_478365_c1 nmdc:mga08y16_478365_c1_150_1160 329
106 3300050512 nmdc:mga0n895_13514_c1 nmdc:mga0n895_13514_c1_872_1876 329
107 3300050512 nmdc:mga0n895_2124_c1 nmdc:mga0n895_2124_c1_6685_7695 329
108 3300050513 nmdc:mga0rr50_12866_c1 nmdc:mga0rr50_12866_c1_706_1716 329
109 3300050515 nmdc:mga0a205_61789_c1 nmdc:mga0a205_61789_c1_2540_3550 329
110 3300053134 Ga0500658_0064259 Ga0500658_0064259_142_1152 329
111 iso_pu_bacteria 2599185167 2599397590 329
112 iso_pu_bacteria 2599185179 2599452035 329
113 iso_pu_bacteria 2599185190 2599513581 329
114 iso_pu_bacteria 2599185191 2599517917 329
115 iso_pu_bacteria 2599185290 2599892258 329
116 iso_pu_bacteria 2675903420 2677899417 329
117 iso_pu_bacteria 2808606386 2808984134 329
118 iso_pu_bacteria 2808606415 2809131938 329
119 iso_pu_bacteria 2808606419 2809151561 329
120 iso_pu_bacteria 2818991445 2819594414 329
121 iso_pu_bacteria 2834028612 2834032610 329
122 iso_pu_bacteria 2839094727 2839095189 329
123 iso_pu_bacteria 2842854478 2842858084 329
124 iso_pu_bacteria 2852618963 2852622422 329
125 iso_pu_bacteria 2852618963 2852622980 329
126 iso_pu_bacteria 2871272651 2871275452 329
127 iso_pu_bacteria 2931390751 2931393455 329
128 iso_pu_bacteria 2945961074 2945964357 329
129 iso_pu_bacteria 8054285046 8054286621 329
130 iso_pu_bacteria 8056143049 8056146270 329
131 3300025291 Ga0209675_1004373 Ga0209675_10043732 330
132 3300031240 Ga0265320_10015256 Ga0265320_100152563 330
133 3300031242 Ga0265329_10009312 Ga0265329_100093122 330
134 3300031344 Ga0265316_10171806 Ga0265316_101718062 330
135 3300050493 nmdc:mga0k408_31054_c1 nmdc:mga0k408_31054_c1_530_1528 330
136 iso_pu_bacteria 2600255256 2601535404 330
137 iso_pu_bacteria 2600255257 2601539961 330
138 iso_pu_bacteria 2600255310 2601758584 330
139 iso_pu_bacteria 2600255311 2601764698 330
140 iso_pu_bacteria 2602042046 2603636745 330
141 iso_pu_bacteria 2811995292 2813727759 330
142 iso_pu_bacteria 2814123068 2814695306 330
143 iso_pu_bacteria 2891633521 2891636289 330
144 iso_pu_bacteria 2945874760 2945879127 330
145 3300021384 Ga0213876_10000368 Ga0213876_1000036829 331
146 3300025291 Ga0209675_1001494 Ga0209675_10014942 331
147 3300046501 Ga0495607_0000358 Ga0495607_0000358_34886_35881 331
148 3300046615 Ga0495656_0114421 Ga0495656_0114421_105_1106 331
149 iso_pu_bacteria 2510065053 2510285006 331
150 iso_pu_bacteria 2510065055 2510294158 331
151 iso_pu_bacteria 2510065058 2510313189 331
152 iso_pu_bacteria 2599185212 2599612025 331
153 iso_pu_bacteria 2599185248 2599769091 331
154 iso_pu_bacteria 2599185289 2599888335 331
155 iso_pu_bacteria 2599185291 2599895937 331
156 iso_pu_bacteria 2599185305 2599957821 331
157 iso_pu_bacteria 2599185306 2599968916 331
158 iso_pu_bacteria 2599185308 2599980436 331
159 iso_pu_bacteria 2599185311 2599992434 331
160 iso_pu_bacteria 2599185313 2600004091 331
161 iso_pu_bacteria 2599185314 2600014247 331
162 iso_pu_bacteria 2599185315 2600015545 331
163 iso_pu_bacteria 2599185316 2600023276 331
164 iso_pu_bacteria 2599185317 2600030864 331
165 iso_pu_bacteria 2599185318 2600038324 331
166 iso_pu_bacteria 2599185319 2600044425 331
167 iso_pu_bacteria 2599185321 2600050753 331
168 iso_pu_bacteria 2599185322 2600058877 331
169 iso_pu_bacteria 2599185323 2600067975 331
170 iso_pu_bacteria 2599185324 2600072726 331
171 iso_pu_bacteria 2599185325 2600077024 331
172 iso_pu_bacteria 2600254930 2600360668 331
173 iso_pu_bacteria 2667528170 2671088629 331
174 iso_pu_bacteria 2667528176 2671125142 331
175 iso_pu_bacteria 2773857672 2774128114 331
176 iso_pu_bacteria 2818991449 2819614432 331
177 iso_pu_bacteria 2904601388 2904603734 331
178 iso_pu_bacteria 2923586266 2923586311 331
179 iso_pu_bacteria 2929144301 2929147166 331
180 iso_pu_bacteria 2931369376 2931369497 331
181 iso_pu_bacteria 2974298342 2974299734 331
182 iso_pu_bacteria 2984499530 2984502106 331
183 3300046810 Ga0495660_0038289 Ga0495660_0038289_1419_2435 332
184 iso_pu_bacteria 2551306416 2553005790 332
185 iso_pu_bacteria 2600255389 2602011455 332
186 iso_pu_bacteria 2818991449 2819618526 332
187 iso_pu_bacteria 2857542790 2857544125 332
188 iso_pu_bacteria 2904530477 2904533844 332
189 iso_pu_bacteria 2919501602 2919503508 332
190 iso_pu_bacteria 2923510766 2923514644 332
191 iso_pu_bacteria 2926063275 2926065920 332
192 iso_pu_bacteria 3007252601 3007252814 332
193 iso_pu_bacteria 3007315729 3007318531 332
194 iso_pu_bacteria 8034962539 8034965027 332
195 3300005288 Ga0065714_10068063 Ga0065714_100680633 333
196 3300005331 Ga0070670_100002176 Ga0070670_10000217614 333
197 3300005353 Ga0070669_100004711 Ga0070669_1000047116 333
198 3300005457 Ga0070662_100004873 Ga0070662_1000048732 333
199 3300005578 Ga0068854_100115111 Ga0068854_1001151113 333
200 3300005834 Ga0068851_10001221 Ga0068851_1000122111 333
201 3300009011 Ga0105251_10001649 Ga0105251_100016497 333
202 3300009011 Ga0105251_10004367 Ga0105251_100043677 333
203 3300009177 Ga0105248_10139370 Ga0105248_101393703 333
204 3300013100 Ga0157373_10002201 Ga0157373_100022013 333
205 3300013100 Ga0157373_10014064 Ga0157373_100140645 333
206 3300013105 Ga0157369_10004993 Ga0157369_100049939 333
207 3300015262 Ga0182007_10008579 Ga0182007_100085792 333
208 3300025321 Ga0207656_10001105 Ga0207656_100011059 333
209 3300025711 Ga0207696_1000109 Ga0207696_100010974 333
210 3300025735 Ga0207713_1000009 Ga0207713_1000009263 333
211 3300025735 Ga0207713_1001615 Ga0207713_100161513 333
212 3300025735 Ga0207713_1005257 Ga0207713_10052574 333
213 3300025923 Ga0207681_10003357 Ga0207681_100033576 333
214 3300025925 Ga0207650_10000963 Ga0207650_100009636 333
215 3300025933 Ga0207706_10010315 Ga0207706_100103152 333
216 3300031548 Ga0307408_100000085 Ga0307408_10000008548 333
217 3300031548 Ga0307408_100037295 Ga0307408_1000372953 333
218 3300031731 Ga0307405_10051150 Ga0307405_100511502 333
219 3300031901 Ga0307406_10092065 Ga0307406_100920651 333
220 3300031911 Ga0307412_10001387 Ga0307412_100013872 333
221 3300032005 Ga0307411_10106084 Ga0307411_101060842 333
222 3300041405 Ga0439438_000077 Ga0439438_000077_22793_23794 333
223 3300041405 Ga0439438_000205 Ga0439438_000205_20650_21651 333
224 3300041411 Ga0439466_0021820 Ga0439466_0021820_902_1903 333
225 3300042006 Ga0439432_022189 Ga0439432_022189_730_1731 333
226 3300046501 Ga0495607_0003971 Ga0495607_0003971_7948_8949 333
227 3300046529 Ga0495652_0086104 Ga0495652_0086104_65_1066 333
228 3300047446 Ga0495679_001075 Ga0495679_001075_10768_11769 333
229 3300048920 Ga0496117_0000246 Ga0496117_0000246_97145_98146 333
230 3300048923 Ga0496120_0001430 Ga0496120_0001430_7064_8065 333
231 3300048927 Ga0496124_0001319 Ga0496124_0001319_29075_30076 333
232 3300048928 Ga0496125_0001337 Ga0496125_0001337_7082_8083 333
233 3300049460 Ga0495682_0000060 Ga0495682_0000060_19362_20363 333
234 3300053130 Ga0500642_0019434 Ga0500642_0019434_1385_2407 333
235 iso_pu_bacteria 2511231010 2511291264 333
236 iso_pu_bacteria 2599185288 2599880705 333
237 iso_pu_bacteria 2599185303 2599949750 333
238 iso_pu_bacteria 2600255318 2601796139 333
239 iso_pu_bacteria 2603880185 2606075008 333
240 iso_pu_bacteria 2603880199 2606127871 333
241 iso_pu_bacteria 2623620443 2624480184 333
242 iso_pu_bacteria 2713897149 2715758419 333
243 iso_pu_bacteria 2738541294 2738806174 333
244 iso_pu_bacteria 2738541309 2738893534 333
245 iso_pu_bacteria 2878029506 2878032097 333
246 iso_pu_bacteria 2908446538 2908449008 333
247 iso_pu_bacteria 2919063839 2919068568 333
248 iso_pu_bacteria 2919125081 2919129711 333
249 iso_pu_bacteria 2945928738 2945932975 333
250 iso_pu_bacteria 2946006987 2946010608 333
251 iso_pu_bacteria 2984504281 2984504395 333
252 iso_pu_bacteria 8016728285 8016728371 333
253 iso_pu_bacteria 8055817908 8055821598 333
254 3300009011 Ga0105251_10038446 Ga0105251_100384462 334
255 3300027312 Ga0209371_1000525 Ga0209371_10005254 334
256 3300030500 Ga0268256_1000076 Ga0268256_100007633 334
257 3300030500 Ga0268256_1004820 Ga0268256_10048206 334
258 3300039437 Ga0436365_0117120 Ga0436365_0117120_40928_41932 334
259 3300048919 Ga0496116_0001015 Ga0496116_0001015_3618_4622 334
260 3300048920 Ga0496117_0000475 Ga0496117_0000475_51023_52027 334
261 3300048921 Ga0496118_0000482 Ga0496118_0000482_51087_52091 334
262 3300048925 Ga0496122_0000866 Ga0496122_0000866_1505_2509 334
263 3300048925 Ga0496122_0056402 Ga0496122_0056402_793_1797 334
264 3300048926 Ga0496123_0000413 Ga0496123_0000413_22480_23484 334
265 3300048926 Ga0496123_0003395 Ga0496123_0003395_13971_14975 334
266 iso_pu_bacteria 2511231011 2511296528 334
267 iso_pu_bacteria 2511231023 2511367936 334
268 iso_pu_bacteria 2511231031 2511414456 334
269 iso_pu_bacteria 2713897148 2715753508 334
270 iso_pu_bacteria 2718217725 2718634534 334
271 iso_pu_bacteria 2738543025 2739313174 334
272 iso_pu_bacteria 2773857673 2774137996 334
273 iso_pu_bacteria 2784132063 2784264930 334
274 iso_pu_bacteria 2818991456 2819656852 334
275 iso_pu_bacteria 2842832357 2842835313 334
276 iso_pu_bacteria 2842843487 2842844133 334
277 iso_pu_bacteria 2852657418 2852662145 334
278 iso_pu_bacteria 2880230671 2880233029 334
279 iso_pu_bacteria 2904518522 2904523415 334
280 iso_pu_bacteria 2919385768 2919386922 334
281 iso_pu_bacteria 2919481497 2919485493 334
282 iso_pu_bacteria 2919487758 2919492925 334
283 iso_pu_bacteria 2969304461 2969307023 334
284 iso_pu_bacteria 2974289157 2974291564 334
285 iso_pu_bacteria 2998139840 2998142216 334
286 iso_pu_bacteria 3007614139 3007619278 334
287 iso_pu_bacteria 3007855910 3007856427 334
288 iso_pu_bacteria 3007861166 3007862522 334
289 iso_pu_bacteria 8029995093 8029998488 334
290 iso_pu_bacteria 8056166840 8056168853 334
291 3300003791 Ga0055530_10000010 Ga0055530_10000010140 335
292 3300003792 Ga0055540_1000032 Ga0055540_1000032140 335
293 3300013100 Ga0157373_10241405 Ga0157373_102414052 335
294 3300014497 Ga0182008_10003948 Ga0182008_100039482 335
295 3300015262 Ga0182007_10003890 Ga0182007_100038906 335
296 3300025292 Ga0209676_1002965 Ga0209676_10029655 335
297 3300025298 Ga0209050_1000043 Ga0209050_100004311 335
298 3300025303 Ga0209051_1000030 Ga0209051_1000030338 335
299 3300025304 Ga0209257_1008354 Ga0209257_10083545 335
300 3300042009 Ga0439451_013286 Ga0439451_013286_518_1525 335
301 3300042013 Ga0439456_010001 Ga0439456_010001_561_1568 335
302 3300042016 Ga0439463_019606 Ga0439463_019606_173_1180 335
303 3300042016 Ga0439463_040241 Ga0439463_040241_84_1091 335
304 3300042145 Ga0450906_008392 Ga0450906_008392_476_1483 335
305 3300042461 Ga0439460_0013383 Ga0439460_0013383_732_1739 335
306 3300046453 Ga0495627_000076 Ga0495627_000076_112844_113851 335
307 3300046458 Ga0495591_000027 Ga0495591_000027_142122_143129 335
308 3300046501 Ga0495607_0001402 Ga0495607_0001402_4456_5463 335
309 3300046542 Ga0495597_0000052 Ga0495597_0000052_35476_36483 335
310 3300046660 Ga0495625_0215167 Ga0495625_0215167_135_1142 335
311 3300047320 Ga0495672_0004567 Ga0495672_0004567_7576_8583 335
312 3300047320 Ga0495672_0041011 Ga0495672_0041011_126_1133 335
313 3300053093 Ga0500651_0045925 Ga0500651_0045925_1357_2370 335
314 iso_pu_bacteria 2511231004 2511256980 335
315 iso_pu_bacteria 2511231008 2511278922 335
316 iso_pu_bacteria 2511231016 2511327210 335
317 iso_pu_bacteria 2511231018 2511337930 335
318 iso_pu_bacteria 2511231019 2511345236 335
319 iso_pu_bacteria 2537561728 2538425983 335
320 iso_pu_bacteria 2599185155 2599327513 335
321 iso_pu_bacteria 2599185307 2599974623 335
322 iso_pu_bacteria 2600255283 2601628286 335
323 iso_pu_bacteria 2643221565 2643845917 335
324 iso_pu_bacteria 2808606382 2808958045 335
325 iso_pu_bacteria 2826581358 2826582563 335
326 iso_pu_bacteria 2842815866 2842817584 335
327 iso_pu_bacteria 2842849001 2842851547 335
328 iso_pu_bacteria 2855195626 2855196105 335
329 iso_pu_bacteria 2860339153 2860339180 335
330 iso_pu_bacteria 2871282230 2871285491 335
331 iso_pu_bacteria 2919046199 2919051157 335
332 iso_pu_bacteria 2919456309 2919456598 335
333 iso_pu_bacteria 3007511990 3007514863 335
334 iso_pu_bacteria 8056155041 8056157545 335
335 iso_pu_bacteria 8056177738 8056182773 335
336 3300006051 Ga0075364_10126793 Ga0075364_101267932 336
337 3300009036 Ga0105244_10009956 Ga0105244_100099564 336
338 3300013105 Ga0157369_10123274 Ga0157369_101232743 336
339 3300017792 Ga0163161_10145347 Ga0163161_101453472 336
340 3300027312 Ga0209371_1000310 Ga0209371_100031041 336
341 3300030500 Ga0268256_1000267 Ga0268256_100026741 336
342 3300042439 Ga0439464_0042722 Ga0439464_0042722_46_1062 336
343 3300046457 Ga0495590_0010123 Ga0495590_0010123_280_1290 336
344 3300046458 Ga0495591_000877 Ga0495591_000877_8700_9710 336
345 3300046507 Ga0495606_0038492 Ga0495606_0038492_398_1408 336
346 3300046512 Ga0495610_0002864 Ga0495610_0002864_11337_12347 336
347 3300046520 Ga0495637_0015434 Ga0495637_0015434_286_1296 336
348 3300046530 Ga0495654_0018195 Ga0495654_0018195_411_1421 336
349 3300046542 Ga0495597_0015902 Ga0495597_0015902_280_1290 336
350 3300046665 Ga0495661_0001309 Ga0495661_0001309_11460_12470 336
351 3300046694 Ga0495649_0024018 Ga0495649_0024018_178_1188 336
352 3300048925 Ga0496122_0090181 Ga0496122_0090181_985_2007 336
353 3300048927 Ga0496124_0000007 Ga0496124_0000007_429974_430996 336
354 3300003781 Ga0055536_1000115 Ga0055536_100011521 337
355 3300003792 Ga0055540_1000204 Ga0055540_10002047 337
356 3300003794 Ga0055531_10000186 Ga0055531_1000018611 337
357 3300005288 Ga0065714_10066888 Ga0065714_100668884 337
358 3300005288 Ga0065714_10109085 Ga0065714_101090851 337
359 3300005289 Ga0065704_10027136 Ga0065704_100271361 337
360 3300005344 Ga0070661_100000140 Ga0070661_10000014073 337
361 3300005353 Ga0070669_100127993 Ga0070669_1001279932 337
362 3300005548 Ga0070665_100517004 Ga0070665_1005170041 337
363 3300005564 Ga0070664_100000201 Ga0070664_1000002012 337
364 3300009011 Ga0105251_10003318 Ga0105251_100033187 337
365 3300009011 Ga0105251_10010770 Ga0105251_100107702 337
366 3300009011 Ga0105251_10122295 Ga0105251_101222951 337
367 3300009036 Ga0105244_10013017 Ga0105244_100130171 337
368 3300009036 Ga0105244_10022751 Ga0105244_100227513 337
369 3300009092 Ga0105250_10000199 Ga0105250_1000019920 337
370 3300009092 Ga0105250_10002992 Ga0105250_100029927 337
371 3300009176 Ga0105242_10012926 Ga0105242_100129262 337
372 3300009545 Ga0105237_10000413 Ga0105237_1000041320 337
373 3300011119 Ga0105246_10082078 Ga0105246_100820783 337
374 3300013100 Ga0157373_10009624 Ga0157373_100096243 337
375 3300013100 Ga0157373_10024748 Ga0157373_100247484 337
376 3300013104 Ga0157370_10086632 Ga0157370_100866323 337
377 3300013105 Ga0157369_10022596 Ga0157369_100225963 337
378 3300013105 Ga0157369_10031991 Ga0157369_100319915 337
379 3300013308 Ga0157375_10000819 Ga0157375_1000081921 337
380 3300013308 Ga0157375_10005669 Ga0157375_100056697 337
381 3300013308 Ga0157375_10043075 Ga0157375_100430752 337
382 3300017792 Ga0163161_10050889 Ga0163161_100508893 337
383 3300025292 Ga0209676_1000102 Ga0209676_100010221 337
384 3300025298 Ga0209050_1000105 Ga0209050_100010521 337
385 3300025303 Ga0209051_1000066 Ga0209051_100006621 337
386 3300025304 Ga0209257_1000124 Ga0209257_1000124169 337
387 3300025711 Ga0207696_1000090 Ga0207696_1000090132 337
388 3300025711 Ga0207696_1000176 Ga0207696_100017620 337
389 3300025711 Ga0207696_1000177 Ga0207696_100017789 337
390 3300025711 Ga0207696_1001491 Ga0207696_10014915 337
391 3300025728 Ga0207655_1000140 Ga0207655_100014036 337
392 3300025728 Ga0207655_1002205 Ga0207655_10022057 337
393 3300025728 Ga0207655_1030580 Ga0207655_10305802 337
394 3300025735 Ga0207713_1000199 Ga0207713_100019921 337
395 3300025735 Ga0207713_1001600 Ga0207713_10016007 337
396 3300025735 Ga0207713_1011282 Ga0207713_10112824 337
397 3300025735 Ga0207713_1055101 Ga0207713_10551011 337
398 3300025914 Ga0207671_10003125 Ga0207671_100031254 337
399 3300025920 Ga0207649_10000156 Ga0207649_1000015612 337
400 3300025934 Ga0207686_10003046 Ga0207686_100030461 337
401 3300025945 Ga0207679_10000016 Ga0207679_1000001687 337
402 3300028379 Ga0268266_10199164 Ga0268266_101991643 337
403 3300031731 Ga0307405_10000197 Ga0307405_1000019713 337
404 3300046506 Ga0495583_0004622 Ga0495583_0004622_7644_8657 337
405 3300046530 Ga0495654_0000407 Ga0495654_0000407_26676_27689 337
406 3300046665 Ga0495661_0002279 Ga0495661_0002279_11715_12728 337
407 3300046810 Ga0495660_0007458 Ga0495660_0007458_5233_6246 337
408 3300047446 Ga0495679_004062 Ga0495679_004062_943_1956 337
409 3300048920 Ga0496117_0074598 Ga0496117_0074598_70_1083 337
410 3300048925 Ga0496122_0027987 Ga0496122_0027987_1498_2511 337
411 3300048927 Ga0496124_0016215 Ga0496124_0016215_737_1750 337
412 3300048928 Ga0496125_0011521 Ga0496125_0011521_6648_7661 337
413 iso_pu_bacteria 2738541271 2738690072 337
414 iso_pu_bacteria 2738543016 2739265846 337
415 3300003781 Ga0055536_1000214 Ga0055536_100021412 338
416 3300009036 Ga0105244_10008860 Ga0105244_100088603 338
417 3300009036 Ga0105244_10018753 Ga0105244_100187534 338
418 3300009036 Ga0105244_10061149 Ga0105244_100611492 338
419 3300009092 Ga0105250_10000016 Ga0105250_10000016195 338
420 3300009092 Ga0105250_10000176 Ga0105250_1000017628 338
421 3300009092 Ga0105250_10000506 Ga0105250_100005068 338
422 3300009092 Ga0105250_10001803 Ga0105250_1000180311 338
423 3300009176 Ga0105242_10017049 Ga0105242_100170494 338
424 3300012498 Ga0157345_1000004 Ga0157345_10000045 338
425 3300013100 Ga0157373_10000039 Ga0157373_1000003971 338
426 3300013100 Ga0157373_10055489 Ga0157373_100554891 338
427 3300013102 Ga0157371_10168426 Ga0157371_101684261 338
428 3300013104 Ga0157370_10435503 Ga0157370_104355031 338
429 3300013105 Ga0157369_10000286 Ga0157369_1000028610 338
430 3300013105 Ga0157369_10022167 Ga0157369_100221675 338
431 3300013105 Ga0157369_10035157 Ga0157369_100351572 338
432 3300013306 Ga0163162_10000067 Ga0163162_1000006728 338
433 3300013307 Ga0157372_10003028 Ga0157372_100030287 338
434 3300013308 Ga0157375_10098142 Ga0157375_100981421 338
435 3300014497 Ga0182008_10000878 Ga0182008_100008787 338
436 3300015261 Ga0182006_1003319 Ga0182006_10033194 338
437 3300015261 Ga0182006_1034812 Ga0182006_10348123 338
438 3300017792 Ga0163161_10000204 Ga0163161_100002045 338
439 3300017792 Ga0163161_10059022 Ga0163161_100590223 338
440 3300025230 Ga0209563_100751 Ga0209563_1007515 338
441 3300025292 Ga0209676_1000020 Ga0209676_1000020457 338
442 3300025711 Ga0207696_1000030 Ga0207696_1000030270 338
443 3300025711 Ga0207696_1000051 Ga0207696_100005114 338
444 3300025711 Ga0207696_1001893 Ga0207696_10018931 338
445 3300025728 Ga0207655_1002480 Ga0207655_10024808 338
446 3300025728 Ga0207655_1004046 Ga0207655_10040466 338
447 3300027111 Ga0209281_1002352 Ga0209281_10023523 338
448 3300030734 Ga0316179_1009738 Ga0316179_10097381 338
449 3300030735 Ga0316178_1002530 Ga0316178_10025302 338
450 3300031548 Ga0307408_100004965 Ga0307408_1000049656 338
451 3300031548 Ga0307408_100032029 Ga0307408_1000320292 338
452 3300031911 Ga0307412_10077873 Ga0307412_100778732 338
453 3300032004 Ga0307414_10104491 Ga0307414_101044912 338
454 3300032005 Ga0307411_10009261 Ga0307411_100092617 338
455 3300033180 Ga0307510_10010763 Ga0307510_100107636 338
456 3300041405 Ga0439438_006478 Ga0439438_006478_1920_2936 338
457 3300041411 Ga0439466_0019324 Ga0439466_0019324_673_1689 338
458 3300042010 Ga0439452_000081 Ga0439452_000081_74509_75525 338
459 3300042013 Ga0439456_001343 Ga0439456_001343_1182_2198 338
460 3300042115 Ga0450911_000488 Ga0450911_000488_6137_7153 338
461 3300042136 Ga0450900_001423 Ga0450900_001423_877_1893 338
462 3300042138 Ga0450903_007678 Ga0450903_007678_619_1635 338
463 3300042145 Ga0450906_000446 Ga0450906_000446_6447_7463 338
464 3300046453 Ga0495627_000101 Ga0495627_000101_95711_96727 338
465 3300046453 Ga0495627_015018 Ga0495627_015018_214_1230 338
466 3300046458 Ga0495591_000032 Ga0495591_000032_7351_8367 338
467 3300046458 Ga0495591_000082 Ga0495591_000082_99003_100019 338
468 3300046458 Ga0495591_000120 Ga0495591_000120_10792_11808 338
469 3300046458 Ga0495591_005656 Ga0495591_005656_3429_4445 338
470 3300046460 Ga0495638_0101947 Ga0495638_0101947_525_1541 338
471 3300046471 Ga0495650_0009217 Ga0495650_0009217_1381_2397 338
472 3300046471 Ga0495650_0021683 Ga0495650_0021683_1905_2963 338
473 3300046474 Ga0495605_0000147 Ga0495605_0000147_81194_82210 338
474 3300046491 Ga0495584_0004786 Ga0495584_0004786_923_1939 338
475 3300046492 Ga0495585_0003440 Ga0495585_0003440_5647_6663 338
476 3300046492 Ga0495585_0003811 Ga0495585_0003811_7095_8111 338
477 3300046492 Ga0495585_0019362 Ga0495585_0019362_1708_2724 338
478 3300046500 Ga0495596_0008681 Ga0495596_0008681_80_1096 338
479 3300046501 Ga0495607_0000603 Ga0495607_0000603_31478_32494 338
480 3300046501 Ga0495607_0003555 Ga0495607_0003555_7142_8158 338
481 3300046501 Ga0495607_0039592 Ga0495607_0039592_1115_2131 338
482 3300046501 Ga0495607_0065067 Ga0495607_0065067_465_1481 338
483 3300046507 Ga0495606_0000634 Ga0495606_0000634_463_1479 338
484 3300046507 Ga0495606_0007373 Ga0495606_0007373_1174_2190 338
485 3300046507 Ga0495606_0099056 Ga0495606_0099056_464_1480 338
486 3300046512 Ga0495610_0000133 Ga0495610_0000133_14402_15418 338
487 3300046513 Ga0495616_0001757 Ga0495616_0001757_8872_9888 338
488 3300046513 Ga0495616_0004535 Ga0495616_0004535_1644_2660 338
489 3300046513 Ga0495616_0009481 Ga0495616_0009481_1268_2284 338
490 3300046515 Ga0495620_0000127 Ga0495620_0000127_7747_8763 338
491 3300046515 Ga0495620_0011877 Ga0495620_0011877_3196_4212 338
492 3300046518 Ga0495631_0000013 Ga0495631_0000013_6357_7373 338
493 3300046519 Ga0495632_0002535 Ga0495632_0002535_10319_11335 338
494 3300046519 Ga0495632_0011811 Ga0495632_0011811_2910_3926 338
495 3300046519 Ga0495632_0080333 Ga0495632_0080333_429_1445 338
496 3300046520 Ga0495637_0000855 Ga0495637_0000855_5199_6215 338
497 3300046522 Ga0495643_0000396 Ga0495643_0000396_48633_49649 338
498 3300046523 Ga0495644_0005850 Ga0495644_0005850_1731_2747 338
499 3300046524 Ga0495648_0002586 Ga0495648_0002586_9039_10055 338
500 3300046524 Ga0495648_0009901 Ga0495648_0009901_5085_6101 338
501 3300046530 Ga0495654_0000104 Ga0495654_0000104_9720_10736 338
502 3300046530 Ga0495654_0009881 Ga0495654_0009881_1280_2296 338
503 3300046538 Ga0495609_0000526 Ga0495609_0000526_5137_6153 338
504 3300046538 Ga0495609_0000879 Ga0495609_0000879_8032_9048 338
505 3300046538 Ga0495609_0007402 Ga0495609_0007402_3111_4127 338
506 3300046538 Ga0495609_0019094 Ga0495609_0019094_1128_2144 338
507 3300046542 Ga0495597_0000965 Ga0495597_0000965_17038_18054 338
508 3300046557 Ga0495622_0000047 Ga0495622_0000047_6360_7376 338
509 3300046558 Ga0495633_0000304 Ga0495633_0000304_46960_47976 338
510 3300046616 Ga0495668_0002358 Ga0495668_0002358_3012_4028 338
511 3300046616 Ga0495668_0019393 Ga0495668_0019393_1228_2244 338
512 3300046648 Ga0495611_0000024 Ga0495611_0000024_107438_108454 338
513 3300046660 Ga0495625_0000103 Ga0495625_0000103_126454_127470 338
514 3300046660 Ga0495625_0002403 Ga0495625_0002403_11318_12334 338
515 3300046665 Ga0495661_0029479 Ga0495661_0029479_1420_2436 338
516 3300046691 Ga0495670_0000020 Ga0495670_0000020_8059_9075 338
517 3300046692 Ga0495671_0000541 Ga0495671_0000541_26106_27122 338
518 3300046694 Ga0495649_0002309 Ga0495649_0002309_8995_10011 338
519 3300046694 Ga0495649_0007150 Ga0495649_0007150_163_1179 338
520 3300046794 Ga0495589_0002333 Ga0495589_0002333_5664_6680 338
521 3300046794 Ga0495589_0021740 Ga0495589_0021740_1852_2868 338
522 3300046810 Ga0495660_0002576 Ga0495660_0002576_7323_8339 338
523 3300046810 Ga0495660_0018034 Ga0495660_0018034_241_1257 338
524 3300046810 Ga0495660_0026588 Ga0495660_0026588_1125_2141 338
525 3300047320 Ga0495672_0003653 Ga0495672_0003653_8370_9386 338
526 3300047320 Ga0495672_0015739 Ga0495672_0015739_2857_3873 338
527 3300047321 Ga0495676_0000058 Ga0495676_0000058_79263_80279 338
528 3300047323 Ga0495683_0011221 Ga0495683_0011221_3501_4517 338
529 3300047323 Ga0495683_0018289 Ga0495683_0018289_1411_2427 338
530 3300047446 Ga0495679_000612 Ga0495679_000612_14466_15482 338
531 3300047446 Ga0495679_004870 Ga0495679_004870_3559_4575 338
532 3300047446 Ga0495679_007852 Ga0495679_007852_1489_2505 338
533 3300047469 Ga0495673_0002039 Ga0495673_0002039_8820_9836 338
534 3300047469 Ga0495673_0008887 Ga0495673_0008887_3361_4377 338
535 3300047469 Ga0495673_0057293 Ga0495673_0057293_35_1051 338
536 3300047470 Ga0495681_0000231 Ga0495681_0000231_6679_7695 338
537 3300047470 Ga0495681_0003977 Ga0495681_0003977_3218_4234 338
538 3300047472 Ga0495686_0000266 Ga0495686_0000266_84071_85087 338
539 3300048091 Ga0495626_0000074 Ga0495626_0000074_5085_6101 338
540 3300048091 Ga0495626_0007211 Ga0495626_0007211_108_1124 338
541 3300048091 Ga0495626_0010037 Ga0495626_0010037_1256_2272 338
542 3300048919 Ga0496116_0000255 Ga0496116_0000255_63015_64031 338
543 3300048919 Ga0496116_0007951 Ga0496116_0007951_1293_2309 338
544 3300048920 Ga0496117_0028925 Ga0496117_0028925_1430_2446 338
545 3300048920 Ga0496117_0154020 Ga0496117_0154020_55_1086 338
546 3300048921 Ga0496118_0004092 Ga0496118_0004092_15924_16940 338
547 3300048922 Ga0496119_0071602 Ga0496119_0071602_153_1169 338
548 3300048922 Ga0496119_0072833 Ga0496119_0072833_838_1854 338
549 3300048923 Ga0496120_0050579 Ga0496120_0050579_1250_2266 338
550 3300048924 Ga0496121_0007471 Ga0496121_0007471_10785_11801 338
551 3300048927 Ga0496124_0201597 Ga0496124_0201597_340_1356 338
552 3300048929 Ga0496126_0199780 Ga0496126_0199780_220_1251 338
553 3300049459 Ga0495678_000222 Ga0495678_000222_52638_53654 338
554 3300049459 Ga0495678_001994 Ga0495678_001994_4840_5856 338
555 3300049459 Ga0495678_014258 Ga0495678_014258_1295_2311 338
556 3300049460 Ga0495682_0000425 Ga0495682_0000425_7713_8729 338
557 3300049758 Ga0501241_000247 Ga0501241_000247_3507_4523 338
558 3300053111 Ga0500572_002475 Ga0500572_002475_1121_2137 338
559 iso_pu_bacteria 2852103415 2852104072 338
560 iso_pu_bacteria 2900051742 2900055546 338
561 iso_pu_bacteria 2974320154 2974320761 338
562 3300005288 Ga0065714_10015565 Ga0065714_100155652 339
563 3300005289 Ga0065704_10127903 Ga0065704_101279031 339
564 3300009011 Ga0105251_10000375 Ga0105251_1000037513 339
565 3300009011 Ga0105251_10009327 Ga0105251_100093273 339
566 3300009036 Ga0105244_10000762 Ga0105244_1000076219 339
567 3300009148 Ga0105243_10001643 Ga0105243_100016436 339
568 3300013100 Ga0157373_10003615 Ga0157373_100036156 339
569 3300013102 Ga0157371_10000360 Ga0157371_1000036035 339
570 3300013104 Ga0157370_10013915 Ga0157370_100139153 339
571 3300013104 Ga0157370_10055838 Ga0157370_100558384 339
572 3300015261 Ga0182006_1051941 Ga0182006_10519413 339
573 3300015265 Ga0182005_1009931 Ga0182005_10099312 339
574 3300015265 Ga0182005_1018257 Ga0182005_10182572 339
575 3300017792 Ga0163161_10015769 Ga0163161_100157697 339
576 3300025728 Ga0207655_1001057 Ga0207655_100105719 339
577 3300025735 Ga0207713_1000128 Ga0207713_100012831 339
578 3300025735 Ga0207713_1009097 Ga0207713_10090973 339
579 3300041407 Ga0439447_000018 Ga0439447_000018_28729_29748 339
580 3300042016 Ga0439463_000051 Ga0439463_000051_23531_24550 339
581 3300046452 Ga0495617_015581 Ga0495617_015581_1530_2549 339
582 3300046452 Ga0495617_040034 Ga0495617_040034_120_1139 339
583 3300046453 Ga0495627_019705 Ga0495627_019705_339_1358 339
584 3300046458 Ga0495591_000360 Ga0495591_000360_11239_12258 339
585 3300046458 Ga0495591_003545 Ga0495591_003545_6866_7885 339
586 3300046458 Ga0495591_005553 Ga0495591_005553_4680_5699 339
587 3300046458 Ga0495591_021175 Ga0495591_021175_429_1448 339
588 3300046460 Ga0495638_0012989 Ga0495638_0012989_1819_2838 339
589 3300046471 Ga0495650_0015429 Ga0495650_0015429_2531_3550 339
590 3300046471 Ga0495650_0016179 Ga0495650_0016179_227_1246 339
591 3300046474 Ga0495605_0000019 Ga0495605_0000019_58709_59728 339
592 3300046474 Ga0495605_0000122 Ga0495605_0000122_75346_76365 339
593 3300046474 Ga0495605_0000211 Ga0495605_0000211_47610_48629 339
594 3300046474 Ga0495605_0000549 Ga0495605_0000549_29381_30400 339
595 3300046474 Ga0495605_0000996 Ga0495605_0000996_4526_5545 339
596 3300046474 Ga0495605_0069423 Ga0495605_0069423_19_1038 339
597 3300046491 Ga0495584_0001271 Ga0495584_0001271_2121_3140 339
598 3300046491 Ga0495584_0003889 Ga0495584_0003889_6006_7025 339
599 3300046491 Ga0495584_0030686 Ga0495584_0030686_1688_2707 339
600 3300046491 Ga0495584_0039347 Ga0495584_0039347_90_1109 339
601 3300046492 Ga0495585_0000778 Ga0495585_0000778_3518_4537 339
602 3300046492 Ga0495585_0026514 Ga0495585_0026514_2205_3224 339
603 3300046499 Ga0495594_0000394 Ga0495594_0000394_6432_7451 339
604 3300046501 Ga0495607_0000610 Ga0495607_0000610_31762_32781 339
605 3300046501 Ga0495607_0001675 Ga0495607_0001675_10298_11317 339
606 3300046501 Ga0495607_0004765 Ga0495607_0004765_3094_4113 339
607 3300046501 Ga0495607_0031794 Ga0495607_0031794_1534_2553 339
608 3300046506 Ga0495583_0000097 Ga0495583_0000097_90116_91135 339
609 3300046506 Ga0495583_0002573 Ga0495583_0002573_10232_11251 339
610 3300046506 Ga0495583_0006116 Ga0495583_0006116_2551_3570 339
611 3300046506 Ga0495583_0038740 Ga0495583_0038740_95_1114 339
612 3300046507 Ga0495606_0001829 Ga0495606_0001829_18549_19568 339
613 3300046507 Ga0495606_0013482 Ga0495606_0013482_3790_4809 339
614 3300046512 Ga0495610_0014481 Ga0495610_0014481_1265_2284 339
615 3300046513 Ga0495616_0005698 Ga0495616_0005698_3146_4165 339
616 3300046513 Ga0495616_0031066 Ga0495616_0031066_1102_2121 339
617 3300046515 Ga0495620_0000163 Ga0495620_0000163_46469_47488 339
618 3300046515 Ga0495620_0000305 Ga0495620_0000305_11166_12185 339
619 3300046515 Ga0495620_0000504 Ga0495620_0000504_773_1792 339
620 3300046515 Ga0495620_0008149 Ga0495620_0008149_1967_2986 339
621 3300046518 Ga0495631_0000003 Ga0495631_0000003_32361_33380 339
622 3300046518 Ga0495631_0010448 Ga0495631_0010448_3031_4050 339
623 3300046518 Ga0495631_0027497 Ga0495631_0027497_274_1293 339
624 3300046519 Ga0495632_0000515 Ga0495632_0000515_26308_27327 339
625 3300046519 Ga0495632_0008410 Ga0495632_0008410_3382_4401 339
626 3300046519 Ga0495632_0009952 Ga0495632_0009952_2539_3558 339
627 3300046520 Ga0495637_0001018 Ga0495637_0001018_7187_8206 339
628 3300046520 Ga0495637_0020190 Ga0495637_0020190_1076_2095 339
629 3300046520 Ga0495637_0036806 Ga0495637_0036806_512_1531 339
630 3300046522 Ga0495643_0005933 Ga0495643_0005933_5720_6739 339
631 3300046524 Ga0495648_0003849 Ga0495648_0003849_6646_7665 339
632 3300046524 Ga0495648_0007343 Ga0495648_0007343_5252_6271 339
633 3300046524 Ga0495648_0038174 Ga0495648_0038174_137_1156 339
634 3300046528 Ga0495642_0115863 Ga0495642_0115863_94_1113 339
635 3300046530 Ga0495654_0000409 Ga0495654_0000409_32852_33871 339
636 3300046530 Ga0495654_0005004 Ga0495654_0005004_1250_2269 339
637 3300046530 Ga0495654_0005203 Ga0495654_0005203_1920_2939 339
638 3300046530 Ga0495654_0009031 Ga0495654_0009031_304_1323 339
639 3300046530 Ga0495654_0010157 Ga0495654_0010157_1181_2200 339
640 3300046538 Ga0495609_0000023 Ga0495609_0000023_72459_73478 339
641 3300046538 Ga0495609_0000057 Ga0495609_0000057_90187_91206 339
642 3300046538 Ga0495609_0001274 Ga0495609_0001274_7551_8570 339
643 3300046542 Ga0495597_0003427 Ga0495597_0003427_1835_2854 339
644 3300046542 Ga0495597_0033078 Ga0495597_0033078_120_1139 339
645 3300046542 Ga0495597_0064335 Ga0495597_0064335_357_1376 339
646 3300046557 Ga0495622_0040111 Ga0495622_0040111_926_1945 339
647 3300046558 Ga0495633_0000038 Ga0495633_0000038_91279_92298 339
648 3300046558 Ga0495633_0006735 Ga0495633_0006735_2783_3802 339
649 3300046616 Ga0495668_0011989 Ga0495668_0011989_3587_4606 339
650 3300046648 Ga0495611_0006442 Ga0495611_0006442_1284_2303 339
651 3300046660 Ga0495625_0010547 Ga0495625_0010547_3606_4625 339
652 3300046665 Ga0495661_0000079 Ga0495661_0000079_64284_65303 339
653 3300046665 Ga0495661_0000200 Ga0495661_0000200_59828_60847 339
654 3300046665 Ga0495661_0011970 Ga0495661_0011970_1079_2098 339
655 3300046665 Ga0495661_0018399 Ga0495661_0018399_101_1120 339
656 3300046665 Ga0495661_0031599 Ga0495661_0031599_305_1324 339
657 3300046691 Ga0495670_0000131 Ga0495670_0000131_25634_26653 339
658 3300046691 Ga0495670_0000856 Ga0495670_0000856_10651_11670 339
659 3300046691 Ga0495670_0149491 Ga0495670_0149491_111_1130 339
660 3300046692 Ga0495671_0000402 Ga0495671_0000402_10408_11427 339
661 3300046692 Ga0495671_0007459 Ga0495671_0007459_2886_3905 339
662 3300046692 Ga0495671_0014123 Ga0495671_0014123_1000_2019 339
663 3300046692 Ga0495671_0061192 Ga0495671_0061192_821_1840 339
664 3300046694 Ga0495649_0035572 Ga0495649_0035572_103_1122 339
665 3300046694 Ga0495649_0125649 Ga0495649_0125649_323_1342 339
666 3300046794 Ga0495589_0000234 Ga0495589_0000234_40361_41380 339
667 3300046794 Ga0495589_0001765 Ga0495589_0001765_6703_7722 339
668 3300046810 Ga0495660_0004619 Ga0495660_0004619_7047_8066 339
669 3300046810 Ga0495660_0090916 Ga0495660_0090916_550_1569 339
670 3300047321 Ga0495676_0000033 Ga0495676_0000033_91357_92376 339
671 3300047323 Ga0495683_0000032 Ga0495683_0000032_58411_59430 339
672 3300047323 Ga0495683_0000062 Ga0495683_0000062_80805_81824 339
673 3300047323 Ga0495683_0026806 Ga0495683_0026806_118_1137 339
674 3300047443 Ga0495687_056484 Ga0495687_056484_499_1518 339
675 3300047446 Ga0495679_001335 Ga0495679_001335_10766_11785 339
676 3300047469 Ga0495673_0001081 Ga0495673_0001081_7822_8841 339
677 3300047469 Ga0495673_0001967 Ga0495673_0001967_11349_12368 339
678 3300047469 Ga0495673_0002097 Ga0495673_0002097_9345_10364 339
679 3300047469 Ga0495673_0016420 Ga0495673_0016420_1795_2814 339
680 3300047469 Ga0495673_0046479 Ga0495673_0046479_521_1540 339
681 3300047469 Ga0495673_0078843 Ga0495673_0078843_321_1340 339
682 3300047470 Ga0495681_0000083 Ga0495681_0000083_57619_58638 339
683 3300047470 Ga0495681_0013480 Ga0495681_0013480_2277_3296 339
684 3300047470 Ga0495681_0016791 Ga0495681_0016791_2099_3118 339
685 3300047472 Ga0495686_0001781 Ga0495686_0001781_1315_2334 339
686 3300048091 Ga0495626_0000104 Ga0495626_0000104_64344_65363 339
687 3300048091 Ga0495626_0036137 Ga0495626_0036137_695_1714 339
688 3300048915 Ga0496112_0109393 Ga0496112_0109393_1128_2147 339
689 3300048920 Ga0496117_0148511 Ga0496117_0148511_65_1084 339
690 3300048921 Ga0496118_0045460 Ga0496118_0045460_88_1107 339
691 3300048924 Ga0496121_0001730 Ga0496121_0001730_752_1771 339
692 3300048924 Ga0496121_0005253 Ga0496121_0005253_4706_5725 339
693 3300048924 Ga0496121_0045502 Ga0496121_0045502_2626_3645 339
694 3300048925 Ga0496122_0000304 Ga0496122_0000304_22061_23080 339
695 3300048925 Ga0496122_0012165 Ga0496122_0012165_6282_7301 339
696 3300048926 Ga0496123_0000254 Ga0496123_0000254_22039_23058 339
697 3300048926 Ga0496123_0009098 Ga0496123_0009098_6941_7960 339
698 3300048927 Ga0496124_0000887 Ga0496124_0000887_10878_11912 339
699 3300048927 Ga0496124_0004236 Ga0496124_0004236_11881_12900 339
700 3300049459 Ga0495678_000046 Ga0495678_000046_78045_79064 339
701 3300049459 Ga0495678_008133 Ga0495678_008133_2523_3542 339
702 3300049459 Ga0495678_067082 Ga0495678_067082_258_1277 339
703 3300049460 Ga0495682_0000186 Ga0495682_0000186_21684_22703 339
704 3300049460 Ga0495682_0017639 Ga0495682_0017639_671_1690 339
705 3300053125 Ga0500618_003817 Ga0500618_003817_2971_4002 339
706 iso_pu_bacteria 2854601825 2854602214 339
707 3300015261 Ga0182006_1000529 Ga0182006_100052915 340
708 3300049583 Ga0501067_0143915 Ga0501067_0143915_17_1072 340
709 3300053125 Ga0500618_000228 Ga0500618_000228_23068_24093 341
710 iso_pu_bacteria 2808606386 2808982049 341
711 iso_pu_bacteria 2808606415 2809131672 341
712 iso_pu_bacteria 2808606419 2809151294 341
713 3300048921 Ga0496118_0014730 Ga0496118_0014730_3459_4556 343
714 iso_pu_bacteria 2765235838 2765569486 343
715 iso_pu_bacteria 2839094727 2839095646 343
716 3300046664 Ga0495659_0066649 Ga0495659_0066649_50_1252 344
717 3300047469 Ga0495673_0000506 Ga0495673_0000506_39094_40164 344
718 3300053088 Ga0500644_0083630 Ga0500644_0083630_39_1127 344
719 3300053090 Ga0500646_0002782 Ga0500646_0002782_1402_2490 344
720 3300053133 Ga0500655_002244 Ga0500655_002244_226_1314 344
721 3300053151 Ga0500604_0001412 Ga0500604_0001412_2760_3848 344
722 3300009036 Ga0105244_10021150 Ga0105244_100211502 345
723 3300027907 Ga0207428_10009892 Ga0207428_100098922 345
724 3300046471 Ga0495650_0001176 Ga0495650_0001176_7074_8135 345
725 3300046474 Ga0495605_0007223 Ga0495605_0007223_31_1092 345
726 3300046491 Ga0495584_0014310 Ga0495584_0014310_111_1268 345
727 3300046500 Ga0495596_0013039 Ga0495596_0013039_317_1378 345
728 3300046501 Ga0495607_0054677 Ga0495607_0054677_545_1717 345
729 3300046506 Ga0495583_0000670 Ga0495583_0000670_11074_12114 345
730 3300046507 Ga0495606_0002123 Ga0495606_0002123_11371_12432 345
731 3300046512 Ga0495610_0002092 Ga0495610_0002092_15544_16692 345
732 3300046515 Ga0495620_0019554 Ga0495620_0019554_1780_2841 345
733 3300046518 Ga0495631_0062159 Ga0495631_0062159_419_1591 345
734 3300046519 Ga0495632_0004215 Ga0495632_0004215_5681_6742 345
735 3300046519 Ga0495632_0030161 Ga0495632_0030161_884_1945 345
736 3300046520 Ga0495637_0000238 Ga0495637_0000238_11051_12121 345
737 3300046520 Ga0495637_0000242 Ga0495637_0000242_34037_35209 345
738 3300046520 Ga0495637_0021520 Ga0495637_0021520_412_1569 345
739 3300046523 Ga0495644_0001633 Ga0495644_0001633_5562_6734 345
740 3300046524 Ga0495648_0000672 Ga0495648_0000672_24695_25756 345
741 3300046530 Ga0495654_0010073 Ga0495654_0010073_1668_2819 345
742 3300046530 Ga0495654_0011525 Ga0495654_0011525_2482_3543 345
743 3300046538 Ga0495609_0000232 Ga0495609_0000232_31153_32214 345
744 3300046648 Ga0495611_0000601 Ga0495611_0000601_18525_19586 345
745 3300046660 Ga0495625_0000203 Ga0495625_0000203_71967_73028 345
746 3300046660 Ga0495625_0039612 Ga0495625_0039612_515_1717 345
747 3300046665 Ga0495661_0000307 Ga0495661_0000307_23961_25022 345
748 3300046694 Ga0495649_0004085 Ga0495649_0004085_302_1363 345
749 3300046810 Ga0495660_0001437 Ga0495660_0001437_7314_8375 345
750 3300047446 Ga0495679_000061 Ga0495679_000061_83832_84893 345
751 3300047469 Ga0495673_0029225 Ga0495673_0029225_303_1373 345
752 3300047469 Ga0495673_0034324 Ga0495673_0034324_356_1528 345
753 3300047469 Ga0495673_0065663 Ga0495673_0065663_226_1287 345
754 3300047470 Ga0495681_0002852 Ga0495681_0002852_1780_2841 345
755 3300047470 Ga0495681_0009135 Ga0495681_0009135_4427_5584 345
756 3300048091 Ga0495626_0000084 Ga0495626_0000084_33868_34929 345
757 3300048919 Ga0496116_0030101 Ga0496116_0030101_862_1905 345
758 3300048927 Ga0496124_0063035 Ga0496124_0063035_43_1104 345
759 3300049459 Ga0495678_000125 Ga0495678_000125_26872_27942 345
760 3300049459 Ga0495678_003914 Ga0495678_003914_341_1402 345
761 3300003751 Ga0055538_1000002 Ga0055538_1000002229 346
762 3300003752 Ga0055539_1000002 Ga0055539_1000002229 346
763 3300003756 Ga0055533_1000004 Ga0055533_1000004229 346
764 3300003759 Ga0055525_1000002 Ga0055525_1000002229 346
765 3300003841 Ga0055541_1000002 Ga0055541_1000002613 346
766 3300021361 Ga0213872_10027138 Ga0213872_100271382 346
767 3300025224 Ga0209784_100002 Ga0209784_100002462 346
768 3300025225 Ga0209566_100003 Ga0209566_100003462 346
769 3300025226 Ga0209674_100004 Ga0209674_100004462 346
770 3300025230 Ga0209563_100006 Ga0209563_100006462 346
771 3300025253 Ga0209677_100003 Ga0209677_100003462 346
772 3300048926 Ga0496123_0002199 Ga0496123_0002199_7587_8693 346
773 iso_pu_bacteria 2643221603 2644029465 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

99

338

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.798 39 340
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.7951 40 340
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.7879 40 340
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7797 40 338
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7758 39 340
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7861 126 229 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7464 126 229 3.40.190.10
3hn0B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7327 38 306 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7318 39 346 3.40.190.10
4h6dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7314 41 340 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A381H4S2-F1-model_v4 deleted 0.9903 128 235
AF-A0A536ZMF9-F1-model_v4 ABC transporter substrate-binding protein 0.9873 88 241
AF-A0A537D327-F1-model_v4 ABC transporter substrate-binding protein 0.9868 57 320
AF-A0A2X2V617-F1-model_v4 ABC-type taurine transport system, periplasmic component 0.986 98 272
AF-A0A4Q6GC39-F1-model_v4 deleted 0.9836 128 346

Feature Viewer

pLDDT pTM Quality
90.4 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map