F479896

General Info

Members Datasets Scaffolds Average Seq Length
767 237 1524 324

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10053197|Ga0207709_100531972
Length 375
Sequence MGGQPGRAASRAGFEVPDGHQSEDREDSGPEDPGVAAGAGGSGDRVMDRRAFLAGATTLLAAPLAAEAQPAAKIARIGWLAGNLAASPNLREAFRQGLSDLGYVEGRNVMIEYRDAEGKFERLPALAAELVALRVDVILAGGAPQALAAKQATRTLPIVFAAAAADPVTSGLVTSLARPGGNVTGLTGLAPELVGKCLDQLKQAVPGVSRVAVLWHPGASGEGTDKDMLKGAEVAARALGVRLQLVETRGPENFDRAFPDMIRARADALTVVPSAMFFGERRRLVDLAAKNRLPAVYPLREFVDAGGLMAYGADLADLFRRAAAYVDKILKGTKPADLPIEQATKFELVINLKTAKTLGLTIPRSLLLQADQVIE

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
237 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.26
Rhizoplane 1.3
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 12.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10053197 3300025935 Bacteria 2491
2 JGI25406J46586_10011462 3300003203 Bacteria 3888
3 Ga0065715_10021422 3300005293 Unclassified 1556
4 Ga0065707_10086735 3300005295 Bacteria 5322
5 Ga0065707_10094380 3300005295 Bacteria 3489
6 Ga0065707_10114112 3300005295 Bacteria 2306
7 Ga0070676_10015896 3300005328 Bacteria 4152
8 Ga0070676_10068960 3300005328 Bacteria 2118
9 Ga0070683_100017686 3300005329 Bacteria 6299
10 Ga0070683_100101965 3300005329 Bacteria 2703
11 Ga0070683_100416968 3300005329 Bacteria 1281
12 Ga0070690_100010635 3300005330 Bacteria 5360
13 Ga0070670_100000766 3300005331 Bacteria 24964
14 Ga0070670_100007771 3300005331 Bacteria 9125
15 Ga0070670_100013906 3300005331 Bacteria 6902
16 Ga0070670_100076780 3300005331 Unclassified 2870
17 Ga0070670_100086725 3300005331 Bacteria 2690
18 Ga0070670_100505346 3300005331 Bacteria 1075
19 Ga0070677_10107269 3300005333 Unclassified 1241
20 Ga0068869_100028295 3300005334 Bacteria 3915
21 Ga0068869_100045266 3300005334 Bacteria 3167
22 Ga0068869_100178004 3300005334 Bacteria 1666
23 Ga0070666_10025934 3300005335 Bacteria 3824
24 Ga0070666_10039431 3300005335 Bacteria 3149
25 Ga0068868_100028904 3300005338 Bacteria 4243
26 Ga0070660_100007564 3300005339 Bacteria 7570
27 Ga0070689_100010510 3300005340 Bacteria 6597
28 Ga0070691_10005546 3300005341 Bacteria 5742
29 Ga0070691_10150886 3300005341 Unclassified 1191
30 Ga0070661_100022031 3300005344 Bacteria 4558
31 Ga0070661_100231164 3300005344 Bacteria 1421
32 Ga0070692_10087400 3300005345 Bacteria 1689
33 Ga0070692_10108568 3300005345 Unclassified 1532
34 Ga0070692_10187814 3300005345 Bacteria 1202
35 Ga0070668_100029941 3300005347 Bacteria 4136
36 Ga0070668_100082328 3300005347 Bacteria 2524
37 Ga0070668_100099824 3300005347 Bacteria 2299
38 Ga0070668_100139654 3300005347 Bacteria 1951
39 Ga0070668_100153091 3300005347 Bacteria 1866
40 Ga0070668_100239614 3300005347 Bacteria 1502
41 Ga0070669_100085407 3300005353 Bacteria 2356
42 Ga0070669_100130037 3300005353 Unclassified 1930
43 Ga0070669_100148575 3300005353 Bacteria 1812
44 Ga0070669_100202427 3300005353 Bacteria 1563
45 Ga0070675_100115613 3300005354 Unclassified 2274
46 Ga0070675_100116888 3300005354 Bacteria 2262
47 Ga0070675_100157209 3300005354 Bacteria 1952
48 Ga0070671_100042211 3300005355 Bacteria 3791
49 Ga0070671_100145234 3300005355 Bacteria 2002
50 Ga0070674_100021404 3300005356 Bacteria 4151
51 Ga0070674_100031368 3300005356 Bacteria 3521
52 Ga0070674_100088585 3300005356 Bacteria 2228
53 Ga0070674_100164340 3300005356 Bacteria 1687
54 Ga0070673_100036336 3300005364 Bacteria 3743
55 Ga0070688_100065826 3300005365 Bacteria 2304
56 Ga0070659_100023413 3300005366 Bacteria 4725
57 Ga0070659_100075351 3300005366 Bacteria 2689
58 Ga0070667_100015974 3300005367 Bacteria 6211
59 Ga0070667_100210605 3300005367 Bacteria 1727
60 Ga0070714_100245012 3300005435 Bacteria 1655
61 Ga0070713_100244040 3300005436 Bacteria 1636
62 Ga0070705_100013483 3300005440 Bacteria 4183
63 Ga0070705_100017795 3300005440 Bacteria 3714
64 Ga0070705_100020712 3300005440 Bacteria 3486
65 Ga0070705_100031933 3300005440 Bacteria 2921
66 Ga0070705_100352350 3300005440 Bacteria 1074
67 Ga0070700_100086509 3300005441 Bacteria 2035
68 Ga0070700_100100856 3300005441 Bacteria 1902
69 Ga0070694_100086160 3300005444 Bacteria 2195
70 Ga0070694_100234943 3300005444 Bacteria 1381
71 Ga0070708_100038395 3300005445 Bacteria 4183
72 Ga0070708_100059953 3300005445 Bacteria 3394
73 Ga0070708_100064611 3300005445 Bacteria 3279
74 Ga0070708_100070408 3300005445 Bacteria 3146
75 Ga0070708_100073048 3300005445 Bacteria 3091
76 Ga0070708_100075450 3300005445 Bacteria 3043
77 Ga0070708_100082735 3300005445 Bacteria 2908
78 Ga0070708_100082742 3300005445 Bacteria 2908
79 Ga0070708_100125010 3300005445 Bacteria 2376
80 Ga0070708_100153238 3300005445 Bacteria 2144
81 Ga0070708_100156595 3300005445 Bacteria 2121
82 Ga0070708_100166195 3300005445 Bacteria 2058
83 Ga0070708_100177878 3300005445 Bacteria 1988
84 Ga0070708_100270292 3300005445 Bacteria 1599
85 Ga0070708_100340074 3300005445 Bacteria 1414
86 Ga0070708_100363757 3300005445 Bacteria 1363
87 Ga0070708_100480340 3300005445 Bacteria 1172
88 Ga0070663_100002574 3300005455 Bacteria 10236
89 Ga0070678_100009923 3300005456 Bacteria 5788
90 Ga0070678_100112184 3300005456 Bacteria 2135
91 Ga0070678_100134562 3300005456 Bacteria 1969
92 Ga0070662_100006539 3300005457 Bacteria 7520
93 Ga0070662_100008007 3300005457 Bacteria 6877
94 Ga0070662_100033014 3300005457 Unclassified 3642
95 Ga0070662_100093666 3300005457 Bacteria 2260
96 Ga0070681_10002977 3300005458 Bacteria 15719
97 Ga0070681_10547344 3300005458 Bacteria 1071
98 Ga0068867_100052189 3300005459 Bacteria 3017
99 Ga0068867_100098111 3300005459 Bacteria 2234
100 Ga0070706_100001712 3300005467 Bacteria 22795
101 Ga0070706_100014273 3300005467 Bacteria 7341
102 Ga0070706_100017060 3300005467 Bacteria 6707
103 Ga0070706_100028317 3300005467 Bacteria 5159
104 Ga0070706_100034870 3300005467 Bacteria 4646
105 Ga0070706_100052047 3300005467 Bacteria 3780
106 Ga0070706_100060091 3300005467 Bacteria 3508
107 Ga0070706_100061134 3300005467 Bacteria 3478
108 Ga0070706_100081818 3300005467 Bacteria 2991
109 Ga0070706_100093614 3300005467 Bacteria 2788
110 Ga0070706_100100760 3300005467 Bacteria 2684
111 Ga0070706_100119588 3300005467 Bacteria 2455
112 Ga0070706_100269106 3300005467 Bacteria 1590
113 Ga0070706_100326663 3300005467 Bacteria 1430
114 Ga0070706_100336537 3300005467 Bacteria 1407
115 Ga0070706_100344078 3300005467 Bacteria 1390
116 Ga0070706_100353551 3300005467 Bacteria 1369
117 Ga0070706_100405387 3300005467 Bacteria 1269
118 Ga0070706_100534974 3300005467 Bacteria 1090
119 Ga0070707_100003045 3300005468 Bacteria 15886
120 Ga0070707_100016633 3300005468 Bacteria 6905
121 Ga0070707_100031234 3300005468 Bacteria 5072
122 Ga0070707_100078492 3300005468 Bacteria 3185
123 Ga0070707_100099202 3300005468 Bacteria 2821
124 Ga0070707_100182253 3300005468 Bacteria 2047
125 Ga0070707_100191817 3300005468 Bacteria 1992
126 Ga0070707_100280527 3300005468 Bacteria 1619
127 Ga0070707_100411116 3300005468 Bacteria 1313
128 Ga0070707_100421937 3300005468 Bacteria 1294
129 Ga0070707_100455819 3300005468 Bacteria 1239
130 Ga0070707_100482282 3300005468 Bacteria 1201
131 Ga0070698_100007648 3300005471 Bacteria 11691
132 Ga0070698_100012203 3300005471 Bacteria 9104
133 Ga0070698_100025060 3300005471 Bacteria 6217
134 Ga0070698_100029481 3300005471 Bacteria 5697
135 Ga0070698_100040179 3300005471 Bacteria 4810
136 Ga0070698_100040610 3300005471 Bacteria 4780
137 Ga0070698_100066457 3300005471 Unclassified 3629
138 Ga0070698_100073123 3300005471 Bacteria 3435
139 Ga0070698_100086635 3300005471 Bacteria 3118
140 Ga0070698_100093787 3300005471 Bacteria 2981
141 Ga0070698_100121125 3300005471 Bacteria 2576
142 Ga0070698_100122634 3300005471 Bacteria 2557
143 Ga0070698_100128584 3300005471 Bacteria 2489
144 Ga0070698_100134820 3300005471 Bacteria 2423
145 Ga0070698_100134955 3300005471 Bacteria 2422
146 Ga0070699_100012388 3300005518 Bacteria 7358
147 Ga0070699_100043692 3300005518 Bacteria 3878
148 Ga0070699_100043701 3300005518 Bacteria 3878
149 Ga0070699_100045366 3300005518 Bacteria 3804
150 Ga0070699_100072337 3300005518 Bacteria 2999
151 Ga0070699_100159679 3300005518 Unclassified 1995
152 Ga0070699_100232575 3300005518 Bacteria 1644
153 Ga0070699_100267814 3300005518 Bacteria 1528
154 Ga0070699_100273415 3300005518 Bacteria 1513
155 Ga0070699_100388439 3300005518 Unclassified 1261
156 Ga0070679_100021689 3300005530 Bacteria 6272
157 Ga0070684_100115872 3300005535 Unclassified 2407
158 Ga0070697_100006249 3300005536 Bacteria 9221
159 Ga0070697_100017323 3300005536 Bacteria 5667
160 Ga0070697_100031005 3300005536 Bacteria 4298
161 Ga0070697_100036981 3300005536 Bacteria 3943
162 Ga0070697_100053739 3300005536 Bacteria 3274
163 Ga0070697_100057595 3300005536 Bacteria 3162
164 Ga0070697_100113712 3300005536 Bacteria 2258
165 Ga0070697_100131971 3300005536 Bacteria 2096
166 Ga0070697_100206591 3300005536 Unclassified 1671
167 Ga0070697_100307496 3300005536 Bacteria 1363
168 Ga0070697_100347572 3300005536 Bacteria 1280
169 Ga0070697_100404194 3300005536 Unclassified 1185
170 Ga0068853_100015761 3300005539 Bacteria 6207
171 Ga0068853_100382688 3300005539 Bacteria 1314
172 Ga0070672_100061032 3300005543 Bacteria 2971
173 Ga0070672_100069653 3300005543 Unclassified 2793
174 Ga0070672_100129423 3300005543 Bacteria 2073
175 Ga0070672_100209351 3300005543 Unclassified 1633
176 Ga0070672_100281953 3300005543 Bacteria 1405
177 Ga0070686_100122369 3300005544 Bacteria 1788
178 Ga0070695_100029396 3300005545 Bacteria 3414
179 Ga0070695_100033922 3300005545 Bacteria 3195
180 Ga0070695_100036639 3300005545 Bacteria 3087
181 Ga0070695_100048106 3300005545 Bacteria 2726
182 Ga0070695_100284200 3300005545 Bacteria 1217
183 Ga0070696_100041076 3300005546 Bacteria 3195
184 Ga0070696_100042175 3300005546 Bacteria 3154
185 Ga0070696_100149412 3300005546 Bacteria 1714
186 Ga0070693_100187893 3300005547 Bacteria 1334
187 Ga0070665_100065708 3300005548 Bacteria 3638
188 Ga0070665_100153146 3300005548 Bacteria 2308
189 Ga0070704_100118594 3300005549 Bacteria 2028
190 Ga0070704_100173662 3300005549 Bacteria 1717
191 Ga0068855_100082714 3300005563 Bacteria 3720
192 Ga0068855_100154315 3300005563 Bacteria 2610
193 Ga0068855_100322653 3300005563 Bacteria 1707
194 Ga0070664_100008150 3300005564 Bacteria 8473
195 Ga0070664_100036601 3300005564 Bacteria 4123
196 Ga0070664_100142450 3300005564 Unclassified 2111
197 Ga0068857_100033781 3300005577 Bacteria 4523
198 Ga0068857_100280424 3300005577 Bacteria 1533
199 Ga0068854_100055287 3300005578 Bacteria 2857
200 Ga0068854_100330212 3300005578 Bacteria 1242
201 Ga0068856_100017977 3300005614 Bacteria 6855
202 Ga0068856_100075678 3300005614 Bacteria 3334
203 Ga0068852_100047165 3300005616 Bacteria 3674
204 Ga0068859_100214308 3300005617 Bacteria 2013
205 Ga0068859_100406943 3300005617 Bacteria 1457
206 Ga0068859_100611525 3300005617 Bacteria 1183
207 Ga0068864_100018305 3300005618 Bacteria 5849
208 Ga0068864_100034918 3300005618 Bacteria 4279
209 Ga0068864_100036543 3300005618 Bacteria 4187
210 Ga0068864_100227638 3300005618 Bacteria 1723
211 Ga0068864_100358227 3300005618 Bacteria 1378
212 Ga0068851_10199532 3300005834 Bacteria 1116
213 Ga0068863_100012311 3300005841 Bacteria 8257
214 Ga0068863_100013707 3300005841 Bacteria 7817
215 Ga0068863_100057808 3300005841 Unclassified 3670
216 Ga0068863_100281296 3300005841 Unclassified 1612
217 Ga0068860_100040913 3300005843 Bacteria 4428
218 Ga0068860_100080095 3300005843 Bacteria 3106
219 Ga0068860_100154786 3300005843 Unclassified 2209
220 Ga0068860_100221893 3300005843 Bacteria 1835
221 Ga0068860_100424432 3300005843 Bacteria 1318
222 Ga0068862_100013867 3300005844 Bacteria 6680
223 Ga0068862_100041918 3300005844 Bacteria 3896
224 Ga0068862_100055276 3300005844 Bacteria 3400
225 Ga0068862_100205970 3300005844 Bacteria 1775
226 Ga0081455_10024121 3300005937 Bacteria 5642
227 Ga0081455_10057656 3300005937 Bacteria 3291
228 Ga0081455_10067753 3300005937 Bacteria 2973
229 Ga0081455_10082419 3300005937 Bacteria 2631
230 Ga0081538_10052640 3300005981 Unclassified 2430
231 Ga0081540_1017383 3300005983 Bacteria 4454
232 Ga0081540_1054633 3300005983 Unclassified 1950
233 Ga0070716_100038149 3300006173 Bacteria 2659
234 Ga0070716_100149284 3300006173 Bacteria 1501
235 Ga0070712_100038209 3300006175 Bacteria 3279
236 Ga0070712_100247288 3300006175 Bacteria 1423
237 Ga0097621_100024200 3300006237 Bacteria 4738
238 Ga0097621_100027159 3300006237 Unclassified 4499
239 Ga0097621_100038419 3300006237 Bacteria 3841
240 Ga0097621_100047375 3300006237 Bacteria 3483
241 Ga0097621_100314565 3300006237 Bacteria 1386
242 Ga0068871_100008600 3300006358 Bacteria 7340
243 Ga0068871_100276001 3300006358 Unclassified 1469
244 Ga0075428_100014005 3300006844 Bacteria 8927
245 Ga0075428_100022854 3300006844 Bacteria 6919
246 Ga0075428_100048120 3300006844 Unclassified 4681
247 Ga0075428_100048863 3300006844 Unclassified 4642
248 Ga0075428_100080617 3300006844 Plasmid 3552
249 Ga0075428_100108292 3300006844 Bacteria 3029
250 Ga0075428_100289365 3300006844 Unclassified 1762
251 Ga0075428_100301020 3300006844 Bacteria 1724
252 Ga0075428_100307600 3300006844 Unclassified 1704
253 Ga0075428_100701161 3300006844 Bacteria 1078
254 Ga0075430_100113486 3300006846 Bacteria 2258
255 Ga0075431_100174226 3300006847 Unclassified 2210
256 Ga0075431_100220011 3300006847 Bacteria 1937
257 Ga0075431_100410523 3300006847 Unclassified 1354
258 Ga0075431_100421128 3300006847 Unclassified 1335
259 Ga0075431_100498188 3300006847 Unclassified 1210
260 Ga0075433_10002894 3300006852 Bacteria 13156
261 Ga0075433_10009496 3300006852 Bacteria 7774
262 Ga0075433_10023573 3300006852 Bacteria 5182
263 Ga0075433_10036244 3300006852 Bacteria 4248
264 Ga0075433_10037449 3300006852 Bacteria 4185
265 Ga0075433_10047431 3300006852 Bacteria 3736
266 Ga0075433_10047942 3300006852 Bacteria 3715
267 Ga0075433_10054766 3300006852 Bacteria 3480
268 Ga0075433_10111499 3300006852 Bacteria 2427
269 Ga0075433_10113447 3300006852 Bacteria 2404
270 Ga0075433_10122027 3300006852 Bacteria 2314
271 Ga0075433_10176169 3300006852 Bacteria 1903
272 Ga0075433_10201363 3300006852 Bacteria 1770
273 Ga0075433_10202954 3300006852 Bacteria 1762
274 Ga0075433_10270314 3300006852 Unclassified 1506
275 Ga0075433_10296988 3300006852 Bacteria 1430
276 Ga0075433_10314942 3300006852 Bacteria 1385
277 Ga0075434_100004508 3300006871 Bacteria 12568
278 Ga0075434_100007682 3300006871 Bacteria 9980
279 Ga0075434_100018298 3300006871 Bacteria 6766
280 Ga0075434_100022189 3300006871 Bacteria 6183
281 Ga0075434_100032802 3300006871 Bacteria 5122
282 Ga0075434_100039410 3300006871 Bacteria 4681
283 Ga0075434_100057902 3300006871 Bacteria 3851
284 Ga0075434_100061503 3300006871 Bacteria 3736
285 Ga0075434_100064265 3300006871 Bacteria 3654
286 Ga0075434_100074648 3300006871 Bacteria 3384
287 Ga0075434_100090287 3300006871 Bacteria 3065
288 Ga0075434_100158604 3300006871 Bacteria 2282
289 Ga0075434_100175950 3300006871 Bacteria 2160
290 Ga0075434_100301671 3300006871 Unclassified 1622
291 Ga0075429_100008463 3300006880 Bacteria 8956
292 Ga0075429_100017070 3300006880 Bacteria 6276
293 Ga0075429_100242496 3300006880 Bacteria 1579
294 Ga0068865_100198808 3300006881 Bacteria 1555
295 Ga0068865_100294983 3300006881 Bacteria 1295
296 Ga0075436_100008944 3300006914 Bacteria 6855
297 Ga0075436_100030194 3300006914 Bacteria 3730
298 Ga0075436_100160814 3300006914 Unclassified 1583
299 Ga0075436_100199756 3300006914 Unclassified 1416
300 Ga0097620_100214303 3300006931 Bacteria 2013
301 Ga0097620_100406909 3300006931 Bacteria 1457
302 Ga0097620_100611519 3300006931 Bacteria 1183
303 Ga0075435_100002831 3300007076 Bacteria 11605
304 Ga0075435_100010753 3300007076 Bacteria 6703
305 Ga0075435_100011428 3300007076 Bacteria 6531
306 Ga0075435_100063531 3300007076 Bacteria 2998
307 Ga0075435_100069380 3300007076 Unclassified 2874
308 Ga0075435_100221832 3300007076 Bacteria 1605
309 Ga0075435_100308296 3300007076 Unclassified 1354
310 Ga0099794_10008106 3300007265 Bacteria 4351
311 Ga0099794_10021118 3300007265 Bacteria 2956
312 Ga0099794_10087664 3300007265 Bacteria 1542
313 Ga0105240_10186743 3300009093 Unclassified 2441
314 Ga0111539_10000704 3300009094 Bacteria 43339
315 Ga0111539_10000978 3300009094 Bacteria 37530
316 Ga0111539_10101343 3300009094 Bacteria 3381
317 Ga0111539_10190486 3300009094 Bacteria 2393
318 Ga0111539_10197152 3300009094 Bacteria 2348
319 Ga0111539_10375451 3300009094 Bacteria 1655
320 Ga0111539_10443858 3300009094 Bacteria 1511
321 Ga0105245_10082792 3300009098 Bacteria 2936
322 Ga0114129_10006922 3300009147 Bacteria 16127
323 Ga0114129_10013738 3300009147 Bacteria 11543
324 Ga0114129_10020968 3300009147 Bacteria 9281
325 Ga0114129_10050646 3300009147 Bacteria 5833
326 Ga0114129_10098363 3300009147 Bacteria 4050
327 Ga0114129_10197691 3300009147 Bacteria 2726
328 Ga0114129_10209281 3300009147 Bacteria 2637
329 Ga0114129_10215469 3300009147 Unclassified 2593
330 Ga0114129_10434665 3300009147 Bacteria 1724
331 Ga0114129_10480183 3300009147 Unclassified 1626
332 Ga0114129_10547108 3300009147 Bacteria 1506
333 Ga0114129_10548684 3300009147 Bacteria 1503
334 Ga0114129_10693496 3300009147 Bacteria 1309
335 Ga0114129_10723032 3300009147 Bacteria 1277
336 Ga0114129_10743780 3300009147 Unclassified 1256
337 Ga0114129_10746166 3300009147 Unclassified 1254
338 Ga0114129_11005654 3300009147 Bacteria 1050
339 Ga0105243_10008736 3300009148 Bacteria 7766
340 Ga0105243_10142556 3300009148 Bacteria 2046
341 Ga0105243_10174383 3300009148 Bacteria 1865
342 Ga0105243_10262772 3300009148 Bacteria 1546
343 Ga0105243_10444708 3300009148 Unclassified 1214
344 Ga0105241_10035496 3300009174 Bacteria 3750
345 Ga0105241_10043715 3300009174 Bacteria 3394
346 Ga0105241_10064764 3300009174 Bacteria 2823
347 Ga0105242_10046035 3300009176 Unclassified 3538
348 Ga0105248_10003485 3300009177 Bacteria 17469
349 Ga0105248_10161331 3300009177 Unclassified 2529
350 Ga0105248_10593496 3300009177 Bacteria 1250
351 Ga0105237_10073532 3300009545 Bacteria 3410
352 Ga0105238_10093792 3300009551 Bacteria 2990
353 Ga0105238_10269922 3300009551 Unclassified 1682
354 Ga0105249_10052178 3300009553 Unclassified 3734
355 Ga0105249_10058664 3300009553 Bacteria 3528
356 Ga0105249_10416320 3300009553 Bacteria 1377
357 Ga0099796_10059453 3300010159 Bacteria 1350
358 Ga0105239_10094232 3300010375 Bacteria 3307
359 Ga0105239_10105161 3300010375 Bacteria 3126
360 Ga0105246_10333582 3300011119 Bacteria 1237
361 Ga0157373_10119045 3300013100 Bacteria 1856
362 Ga0157371_10016020 3300013102 Bacteria 5605
363 Ga0157371_10040368 3300013102 Bacteria 3333
364 Ga0157369_10015060 3300013105 Bacteria 8728
365 Ga0157374_10012109 3300013296 Bacteria 7491
366 Ga0157374_10073702 3300013296 Bacteria 3222
367 Ga0157374_10259458 3300013296 Bacteria 1711
368 Ga0157378_10296855 3300013297 Bacteria 1562
369 Ga0157378_10298954 3300013297 Bacteria 1557
370 Ga0157378_10356659 3300013297 Bacteria 1430
371 Ga0157378_10368083 3300013297 Bacteria 1408
372 Ga0163162_10064610 3300013306 Bacteria 3704
373 Ga0163162_10080587 3300013306 Bacteria 3324
374 Ga0163162_10094728 3300013306 Bacteria 3072
375 Ga0163162_10136218 3300013306 Bacteria 2566
376 Ga0163162_10307662 3300013306 Bacteria 1717
377 Ga0157372_10033183 3300013307 Bacteria 5668
378 Ga0157372_10474528 3300013307 Bacteria 1458
379 Ga0157375_10289520 3300013308 Bacteria 1801
380 Ga0157375_10334712 3300013308 Bacteria 1679
381 Ga0157375_10679187 3300013308 Unclassified 1184
382 Ga0163163_10032634 3300014325 Bacteria 5031
383 Ga0163163_10040034 3300014325 Bacteria 4575
384 Ga0163163_10067444 3300014325 Bacteria 3558
385 Ga0163163_10292866 3300014325 Bacteria 1680
386 Ga0157380_10474511 3300014326 Unclassified 1208
387 Ga0157379_10376136 3300014968 Bacteria 1303
388 Ga0157376_10055102 3300014969 Bacteria 3317
389 Ga0157376_10055569 3300014969 Bacteria 3304
390 Ga0157376_10086591 3300014969 Bacteria 2702
391 Ga0157376_10123842 3300014969 Bacteria 2295
392 Ga0157376_10123893 3300014969 Unclassified 2295
393 Ga0157376_10459450 3300014969 Bacteria 1244
394 Ga0163161_10133275 3300017792 Archaea 1876
395 Ga0163161_10245195 3300017792 Unclassified 1395
396 Ga0213876_10034704 3300021384 Bacteria 2661
397 Ga0207697_10050089 3300025315 Bacteria 1724
398 Ga0207656_10127812 3300025321 Bacteria 1188
399 Ga0207653_10038249 3300025885 Bacteria 1567
400 Ga0207682_10072695 3300025893 Bacteria 1460
401 Ga0207692_10195541 3300025898 Bacteria 1186
402 Ga0207688_10016834 3300025901 Bacteria 3969
403 Ga0207645_10014826 3300025907 Bacteria 5202
404 Ga0207645_10015073 3300025907 Bacteria 5149
405 Ga0207643_10093584 3300025908 Bacteria 1755
406 Ga0207684_10005282 3300025910 Bacteria 11974
407 Ga0207684_10008176 3300025910 Bacteria 9318
408 Ga0207684_10012341 3300025910 Bacteria 7435
409 Ga0207684_10016795 3300025910 Bacteria 6284
410 Ga0207684_10020346 3300025910 Bacteria 5670
411 Ga0207684_10027517 3300025910 Bacteria 4843
412 Ga0207684_10060513 3300025910 Bacteria 3216
413 Ga0207684_10077837 3300025910 Bacteria 2820
414 Ga0207684_10078174 3300025910 Unclassified 2814
415 Ga0207684_10091035 3300025910 Bacteria 2599
416 Ga0207684_10106578 3300025910 Bacteria 2397
417 Ga0207684_10123452 3300025910 Bacteria 2221
418 Ga0207684_10142991 3300025910 Unclassified 2057
419 Ga0207684_10204291 3300025910 Bacteria 1704
420 Ga0207684_10255989 3300025910 Bacteria 1510
421 Ga0207684_10287347 3300025910 Bacteria 1418
422 Ga0207684_10287684 3300025910 Bacteria 1417
423 Ga0207684_10327876 3300025910 Bacteria 1319
424 Ga0207684_10344506 3300025910 Bacteria 1283
425 Ga0207684_10388779 3300025910 Bacteria 1199
426 Ga0207654_10061761 3300025911 Bacteria 2193
427 Ga0207707_10004013 3300025912 Bacteria 13065
428 Ga0207707_10158961 3300025912 Bacteria 1976
429 Ga0207693_10035385 3300025915 Bacteria 3938
430 Ga0207693_10109060 3300025915 Bacteria 2171
431 Ga0207693_10294608 3300025915 Bacteria 1271
432 Ga0207660_10191792 3300025917 Viruses 1592
433 Ga0207662_10007490 3300025918 Bacteria 5942
434 Ga0207657_10065137 3300025919 Bacteria 3108
435 Ga0207657_10221067 3300025919 Unclassified 1517
436 Ga0207649_10058791 3300025920 Bacteria 2409
437 Ga0207649_10194442 3300025920 Bacteria 1429
438 Ga0207646_10005146 3300025922 Bacteria 13857
439 Ga0207646_10023660 3300025922 Bacteria 5639
440 Ga0207646_10026986 3300025922 Bacteria 5236
441 Ga0207646_10034966 3300025922 Bacteria 4541
442 Ga0207646_10041309 3300025922 Bacteria 4147
443 Ga0207646_10053162 3300025922 Bacteria 3623
444 Ga0207646_10062799 3300025922 Bacteria 3316
445 Ga0207646_10083998 3300025922 Bacteria 2848
446 Ga0207646_10103437 3300025922 Bacteria 2554
447 Ga0207646_10104147 3300025922 Bacteria 2545
448 Ga0207646_10110779 3300025922 Bacteria 2463
449 Ga0207646_10126265 3300025922 Bacteria 2300
450 Ga0207646_10141974 3300025922 Bacteria 2163
451 Ga0207646_10145546 3300025922 Bacteria 2135
452 Ga0207646_10152911 3300025922 Bacteria 2081
453 Ga0207646_10157884 3300025922 Bacteria 2046
454 Ga0207646_10188293 3300025922 Unclassified 1864
455 Ga0207646_10215994 3300025922 Bacteria 1732
456 Ga0207646_10230085 3300025922 Bacteria 1675
457 Ga0207646_10339498 3300025922 Bacteria 1357
458 Ga0207646_10360531 3300025922 Bacteria 1313
459 Ga0207646_10413730 3300025922 Unclassified 1217
460 Ga0207646_10432084 3300025922 Bacteria 1188
461 Ga0207646_10435137 3300025922 Unclassified 1184
462 Ga0207681_10055227 3300025923 Bacteria 2704
463 Ga0207681_10127118 3300025923 Bacteria 1879
464 Ga0207681_10185369 3300025923 Bacteria 1588
465 Ga0207681_10304018 3300025923 Bacteria 1263
466 Ga0207694_10014929 3300025924 Bacteria 5857
467 Ga0207694_10075709 3300025924 Bacteria 2635
468 Ga0207694_10273447 3300025924 Unclassified 1386
469 Ga0207650_10003347 3300025925 Bacteria 11029
470 Ga0207650_10059994 3300025925 Unclassified 2838
471 Ga0207650_10079313 3300025925 Bacteria 2486
472 Ga0207650_10079452 3300025925 Unclassified 2484
473 Ga0207650_10099917 3300025925 Bacteria 2231
474 Ga0207650_10383642 3300025925 Bacteria 1161
475 Ga0207650_10391148 3300025925 Bacteria 1149
476 Ga0207659_10068039 3300025926 Bacteria 2589
477 Ga0207659_10149113 3300025926 Bacteria 1825
478 Ga0207659_10223959 3300025926 Bacteria 1514
479 Ga0207687_10048093 3300025927 Bacteria 2959
480 Ga0207700_10105180 3300025928 Bacteria 2260
481 Ga0207644_10001510 3300025931 Bacteria 15001
482 Ga0207644_10017458 3300025931 Unclassified 4846
483 Ga0207690_10083378 3300025932 Bacteria 2238
484 Ga0207690_10151645 3300025932 Bacteria 1719
485 Ga0207706_10005833 3300025933 Bacteria 11454
486 Ga0207706_10015569 3300025933 Bacteria 6871
487 Ga0207706_10025007 3300025933 Bacteria 5354
488 Ga0207706_10044684 3300025933 Unclassified 3926
489 Ga0207706_10212185 3300025933 Bacteria 1697
490 Ga0207686_10022115 3300025934 Bacteria 3659
491 Ga0207686_10045713 3300025934 Unclassified 2695
492 Ga0207709_10096892 3300025935 Bacteria 1941
493 Ga0207709_10130930 3300025935 Unclassified 1710
494 Ga0207709_10182107 3300025935 Bacteria 1484
495 Ga0207670_10017583 3300025936 Bacteria 4324
496 Ga0207704_10043413 3300025938 Bacteria 2655
497 Ga0207704_10061134 3300025938 Bacteria 2335
498 Ga0207704_10123716 3300025938 Bacteria 1776
499 Ga0207704_10180387 3300025938 Unclassified 1525
500 Ga0207665_10010391 3300025939 Bacteria 6114
501 Ga0207665_10165890 3300025939 Bacteria 1592
502 Ga0207665_10273055 3300025939 Bacteria 1256
503 Ga0207691_10007193 3300025940 Bacteria 10739
504 Ga0207691_10031411 3300025940 Bacteria 4957
505 Ga0207711_10001820 3300025941 Bacteria 19466
506 Ga0207711_10207722 3300025941 Bacteria 1788
507 Ga0207711_10284127 3300025941 Unclassified 1524
508 Ga0207689_10108003 3300025942 Bacteria 2287
509 Ga0207689_10150808 3300025942 Bacteria 1916
510 Ga0207661_10487894 3300025944 Bacteria 1125
511 Ga0207679_10002132 3300025945 Bacteria 12252
512 Ga0207679_10209871 3300025945 Unclassified 1632
513 Ga0207667_10028250 3300025949 Bacteria 6095
514 Ga0207667_10097926 3300025949 Bacteria 3027
515 Ga0207667_10324149 3300025949 Unclassified 1573
516 Ga0207712_10012257 3300025961 Bacteria 5478
517 Ga0207712_10031973 3300025961 Unclassified 3548
518 Ga0207640_10227888 3300025981 Bacteria 1431
519 Ga0207658_10195218 3300025986 Bacteria 1686
520 Ga0207677_10246499 3300026023 Bacteria 1448
521 Ga0207703_10295002 3300026035 Bacteria 1477
522 Ga0207639_10143842 3300026041 Bacteria 1990
523 Ga0207678_10007649 3300026067 Bacteria 9542
524 Ga0207708_10029815 3300026075 Bacteria 4136
525 Ga0207702_10161655 3300026078 Bacteria 2045
526 Ga0207702_10182258 3300026078 Bacteria 1935
527 Ga0207641_10059759 3300026088 Unclassified 3247
528 Ga0207641_10080049 3300026088 Bacteria 2833
529 Ga0207641_10183818 3300026088 Bacteria 1916
530 Ga0207641_10199656 3300026088 Unclassified 1843
531 Ga0207641_10330964 3300026088 Unclassified 1447
532 Ga0207648_10160577 3300026089 Bacteria 1985
533 Ga0207648_10329166 3300026089 Bacteria 1374
534 Ga0207676_10027014 3300026095 Bacteria 4271
535 Ga0207676_10066909 3300026095 Bacteria 2868
536 Ga0207676_10102555 3300026095 Bacteria 2375
537 Ga0207676_10149604 3300026095 Bacteria 2009
538 Ga0207676_10544836 3300026095 Bacteria 1108
539 Ga0207674_10029764 3300026116 Bacteria 5745
540 Ga0207674_10121482 3300026116 Unclassified 2580
541 Ga0207674_10143448 3300026116 Bacteria 2347
542 Ga0207674_10236996 3300026116 Bacteria 1772
543 Ga0207675_100057012 3300026118 Bacteria 3644
544 Ga0207675_100071649 3300026118 Bacteria 3240
545 Ga0207675_100266887 3300026118 Bacteria 1660
546 Ga0207683_10001789 3300026121 Bacteria 19023
547 Ga0207683_10050266 3300026121 Bacteria 3651
548 Ga0207683_10056372 3300026121 Bacteria 3447
549 Ga0207698_10054084 3300026142 Bacteria 3087
550 Ga0209588_1010175 3300027671 Bacteria 2824
551 Ga0209588_1026932 3300027671 Bacteria 1827
552 Ga0207428_10000463 3300027907 Bacteria 48950
553 Ga0207428_10000727 3300027907 Bacteria 38034
554 Ga0207428_10041717 3300027907 Bacteria 3714
555 Ga0268265_10016647 3300028380 Bacteria 5057
556 Ga0268265_10030483 3300028380 Bacteria 3885
557 Ga0268265_10186774 3300028380 Bacteria 1786
558 Ga0268265_10214325 3300028380 Bacteria 1680
559 Ga0268265_10379270 3300028380 Bacteria 1300
560 Ga0268264_10103360 3300028381 Unclassified 2481
561 Ga0268264_10126552 3300028381 Bacteria 2259
562 Ga0268264_10177251 3300028381 Bacteria 1933
563 Ga0268264_10394078 3300028381 Bacteria 1329
564 Ga0268264_10433692 3300028381 Bacteria 1269
565 Ga0307515_10034389 3300028794 Bacteria 8300
566 Ga0265313_10100077 3300031595 Bacteria 1288
567 Ga0307516_10003435 3300031730 Bacteria 20328
568 Ga0307416_100078140 3300032002 Bacteria 2783
569 Ga0373940_0001659 3300035088 Bacteria 4105
570 Ga0373952_0012927 3300035092 Bacteria 1650
571 Ga0373939_0006777 3300035114 Unclassified 2766
572 Ga0373931_0017011 3300035691 Bacteria 3588
573 Ga0373931_0035617 3300035691 Bacteria 2589
574 Ga0373925_0016213 3300037068 Bacteria 5394
575 Ga0395899_0088652 3300037312 Bacteria 2244
576 Ga0395900_0157432 3300037418 Bacteria 2320
577 Ga0395898_0025507 3300037466 Bacteria 5956
578 Ga0395901_0061181 3300038443 Bacteria 3918
579 Ga0436365_1534158 3300039437 Bacteria 1930
580 Ga0439450_000996 3300042008 Bacteria 3971
581 Ga0439455_0009191 3300042012 Unclassified 2138
582 Ga0439460_0007077 3300042461 Bacteria 2800
583 Ga0451577_0033363 3300042876 Bacteria 4641
584 Ga0451577_0093721 3300042876 Unclassified 2682
585 Ga0451577_0100141 3300042876 Bacteria 2588
586 Ga0451577_0117224 3300042876 Bacteria 2385
587 Ga0451577_0191328 3300042876 Bacteria 1846
588 Ga0451577_0443233 3300042876 Unclassified 1179
589 Ga0453683_0011611 3300044673 Bacteria 5802
590 Ga0453683_0023730 3300044673 Bacteria 3907
591 Ga0453683_0049355 3300044673 Bacteria 2638
592 Ga0453683_0108175 3300044673 Bacteria 1748
593 Ga0453683_0199631 3300044673 Bacteria 1270
594 Ga0453684_0112070 3300044712 Bacteria 3312
595 Ga0453684_0477856 3300044712 Bacteria 1383
596 Ga0453684_0514415 3300044712 Unclassified 1323
597 Ga0451576_0044727 3300045051 Bacteria 4665
598 Ga0451576_0085841 3300045051 Bacteria 3274
599 Ga0451576_0103437 3300045051 Bacteria 2962
600 Ga0451576_0116407 3300045051 Bacteria 2783
601 Ga0451576_0178141 3300045051 Bacteria 2219
602 Ga0451576_0306162 3300045051 Unclassified 1662
603 Ga0451576_0328293 3300045051 Bacteria 1601
604 Ga0451576_0363831 3300045051 Bacteria 1515
605 Ga0495603_0025232 3300046455 Bacteria 3595
606 Ga0495580_0000762 3300046472 Bacteria 27673
607 Ga0495580_0021377 3300046472 Bacteria 4774
608 Ga0495580_0085439 3300046472 Bacteria 2197
609 Ga0495594_0120110 3300046499 Bacteria 1485
610 Ga0495598_0013680 3300046537 Bacteria 2017
611 Ga0495645_0091468 3300046543 Bacteria 2173
612 Ga0495659_0027374 3300046664 Bacteria 1966
613 Ga0495659_0078159 3300046664 Bacteria 1251
614 Ga0495669_0030895 3300046684 Bacteria 2351
615 Ga0495671_0048498 3300046692 Bacteria 2119
616 Ga0496104_0069080 3300048907 Bacteria 3358
617 Ga0496106_0082308 3300048909 Bacteria 2474
618 Ga0496106_0116677 3300048909 Bacteria 2083
619 Ga0496107_0092261 3300048910 Bacteria 2214
620 Ga0496108_0043384 3300048911 Bacteria 3757
621 Ga0496108_0254760 3300048911 Bacteria 1527
622 Ga0496110_0588448 3300048913 Bacteria 1010
623 Ga0496112_0015794 3300048915 Bacteria 7054
624 Ga0496112_0315746 3300048915 Bacteria 1507
625 Ga0496115_0137109 3300048918 Bacteria 2018
626 Ga0501040_0003458 3300049576 Bacteria 10185
627 Ga0501040_0046768 3300049576 Bacteria 2954
628 Ga0501040_0162409 3300049576 Bacteria 1579
629 Ga0501040_0284811 3300049576 Bacteria 1180
630 Ga0501041_0007836 3300049577 Bacteria 6275
631 Ga0501041_0018654 3300049577 Bacteria 4132
632 Ga0501042_0008302 3300049578 Bacteria 6847
633 Ga0501043_0065869 3300049579 Bacteria 2845
634 Ga0501046_0004871 3300049580 Bacteria 12094
635 Ga0501046_0084335 3300049580 Bacteria 2451
636 Ga0501048_0020059 3300049582 Bacteria 4903
637 Ga0501048_0302549 3300049582 Unclassified 1138
638 Ga0501071_0112298 3300049587 Bacteria 2015
639 Ga0501072_0011265 3300049588 Bacteria 6828
640 Ga0501072_0246682 3300049588 Bacteria 1422
641 Ga0501073_0105137 3300049589 Bacteria 1959
642 Ga0501074_0085010 3300049590 Bacteria 2267
643 Ga0501074_0143878 3300049590 Bacteria 1705
644 Ga0501075_0012872 3300049591 Bacteria 5957
645 Ga0501075_0191425 3300049591 Unclassified 1560
646 Ga0501076_0005192 3300049592 Bacteria 9323
647 Ga0501076_0201920 3300049592 Bacteria 1623
648 Ga0501076_0410744 3300049592 Unclassified 1113
649 Ga0501077_0014498 3300049593 Bacteria 4954
650 Ga0501077_0071286 3300049593 Bacteria 2202
651 Ga0501077_0071696 3300049593 Bacteria 2196
652 Ga0501077_0118952 3300049593 Bacteria 1674
653 Ga0501079_0009225 3300049741 Bacteria 7473
654 Ga0501079_0010392 3300049741 Bacteria 7074
655 Ga0501079_0040059 3300049741 Bacteria 3614
656 Ga0501079_0356557 3300049741 Bacteria 1146
657 Ga0501080_0015625 3300049742 Bacteria 7000
658 Ga0501080_0418072 3300049742 Unclassified 1205
659 Ga0501081_0004213 3300049743 Bacteria 9222
660 Ga0501081_0043666 3300049743 Bacteria 3075
661 Ga0501081_0227851 3300049743 Bacteria 1356
662 Ga0501083_0010370 3300049744 Bacteria 6560
663 Ga0501045_0002044 3300049824 Bacteria 13623
664 nmdc:mga05p37_12630_c1 3300050507 Bacteria 5871
665 nmdc:mga05p37_12701_c1 3300050507 Bacteria 10066
666 nmdc:mga05p37_133865_c1 3300050507 Bacteria 3041
667 nmdc:mga05p37_15078_c1 3300050507 Bacteria 9280
668 nmdc:mga05p37_187053_c1 3300050507 Bacteria 2517
669 nmdc:mga05p37_227912_c1 3300050507 Bacteria 2246
670 nmdc:mga05p37_230605_c1 3300050507 Bacteria 2231
671 nmdc:mga05p37_23628_c2 3300050507 Unclassified 4824
672 nmdc:mga05p37_260872_c1 3300050507 Bacteria 2074
673 nmdc:mga05p37_285441_c1 3300050507 Bacteria 1967
674 nmdc:mga05p37_32940_c1 3300050507 Bacteria 6344
675 nmdc:mga05p37_348885_c1 3300050507 Bacteria 1743
676 nmdc:mga05p37_37894_c1 3300050507 Bacteria 5913
677 nmdc:mga05p37_388074_c1 3300050507 Bacteria 1634
678 nmdc:mga05p37_456466_c1 3300050507 Unclassified 1478
679 nmdc:mga05p37_50611_c1 3300050507 Bacteria 5110
680 nmdc:mga05p37_528444_c1 3300050507 Bacteria 1348
681 nmdc:mga05p37_67417_c1 3300050507 Bacteria 4403
682 nmdc:mga05p37_76543_c1 3300050507 Bacteria 4119
683 nmdc:mga09592_139984_c1 3300050508 Bacteria 2085
684 nmdc:mga09592_276838_c1 3300050508 Bacteria 1455
685 nmdc:mga09592_37763_c1 3300050508 Bacteria 4052
686 nmdc:mga09592_48456_c1 3300050508 Unclassified 3582
687 nmdc:mga09592_49133_c1 3300050508 Bacteria 3557
688 nmdc:mga0qj67_100836_c1 3300050509 Bacteria 2327
689 nmdc:mga0qj67_102749_c1 3300050509 Bacteria 2305
690 nmdc:mga0qj67_321076_c1 3300050509 Unclassified 1253
691 nmdc:mga06r32_27582_c1 3300050510 Bacteria 5308
692 nmdc:mga06r32_285473_c1 3300050510 Unclassified 1637
693 nmdc:mga06r32_309895_c1 3300050510 Bacteria 1564
694 nmdc:mga06r32_45403_c1 3300050510 Bacteria 4188
695 nmdc:mga08y16_154170_c1 3300050511 Unclassified 2388
696 nmdc:mga08y16_173352_c1 3300050511 Bacteria 2240
697 nmdc:mga08y16_1852_c1 3300050511 Bacteria 21486
698 nmdc:mga08y16_26267_c1 3300050511 Bacteria 6140
699 nmdc:mga0n895_113918_c1 3300050512 Bacteria 2722
700 nmdc:mga0n895_14716_c1 3300050512 Bacteria 7116
701 nmdc:mga0n895_16740_c1 3300050512 Bacteria 6737
702 nmdc:mga0n895_26410_c1 3300050512 Bacteria 5499
703 nmdc:mga0n895_279571_c1 3300050512 Bacteria 1693
704 nmdc:mga0n895_33850_c1 3300050512 Bacteria 4913
705 nmdc:mga0n895_4263_c1 3300050512 Bacteria 11701
706 nmdc:mga0n895_48243_c1 3300050512 Bacteria 4168
707 nmdc:mga0n895_535496_c1 3300050512 Bacteria 1178
708 nmdc:mga0n895_63394_c1 3300050512 Bacteria 3655
709 nmdc:mga0n895_82600_c1 3300050512 Bacteria 3203
710 nmdc:mga0n895_84860_c1 3300050512 Bacteria 3161
711 nmdc:mga0n895_9289_c1 3300050512 Bacteria 8591
712 nmdc:mga0rr50_101925_c1 3300050513 Bacteria 2257
713 nmdc:mga0rr50_149352_c1 3300050513 Unclassified 1887
714 nmdc:mga0rr50_152668_c1 3300050513 Bacteria 1868
715 nmdc:mga0rr50_173335_c1 3300050513 Bacteria 1759
716 nmdc:mga0rr50_1784_c1 3300050513 Bacteria 11881
717 nmdc:mga0rr50_17969_c1 3300050513 Unclassified 3318
718 nmdc:mga0rr50_190632_c1 3300050513 Bacteria 1680
719 nmdc:mga0rr50_22377_c1 3300050513 Bacteria 4338
720 nmdc:mga0rr50_225570_c1 3300050513 Bacteria 1549
721 nmdc:mga0rr50_245684_c1 3300050513 Unclassified 1485
722 nmdc:mga0rr50_286458_c1 3300050513 Bacteria 1376
723 nmdc:mga0rr50_52121_c1 3300050513 Bacteria 3039
724 nmdc:mga0rr50_8272_c1 3300050513 Bacteria 6467
725 nmdc:mga08x19_116013_c1 3300050514 Unclassified 1790
726 nmdc:mga08x19_13639_c1 3300050514 Bacteria 4916
727 nmdc:mga08x19_14219_c1 3300050514 Bacteria 4824
728 nmdc:mga0a205_100981_c1 3300050515 Bacteria 2784
729 nmdc:mga0a205_115979_c1 3300050515 Bacteria 2577
730 nmdc:mga0a205_118081_c1 3300050515 Bacteria 2551
731 nmdc:mga0a205_13194_c1 3300050515 Bacteria 7679
732 nmdc:mga0a205_135402_c1 3300050515 Bacteria 2364
733 nmdc:mga0a205_1366_c1 3300050515 Bacteria 20598
734 nmdc:mga0a205_205805_c1 3300050515 Bacteria 1857
735 nmdc:mga0a205_218355_c1 3300050515 Bacteria 1793
736 nmdc:mga0a205_247472_c1 3300050515 Bacteria 1663
737 nmdc:mga0a205_316576_c1 3300050515 Bacteria 1432
738 nmdc:mga0a205_320327_c1 3300050515 Unclassified 1422
739 nmdc:mga0a205_444669_c1 3300050515 Unclassified 1157
740 nmdc:mga0a205_50141_c1 3300050515 Bacteria 4030
741 nmdc:mga0a205_566517_c1 3300050515 Bacteria 990
742 nmdc:mga0a205_59947_c1 3300050515 Bacteria 3676
743 nmdc:mga0a205_60921_c1 3300050515 Bacteria 3645
744 nmdc:mga0a205_73363_c1 3300050515 Bacteria 3307
745 nmdc:mga0a205_9119_c1 3300050515 Bacteria 9054
746 nmdc:mga0a205_95956_c1 3300050515 Bacteria 2864
747 nmdc:mga0a205_984_c1 3300050515 Bacteria 23565
748 Ga0501084_0012940 3300054114 Bacteria 6908
749 Ga0501084_0045514 3300054114 Bacteria 3674
750 Ga0501084_0358607 3300054114 Unclassified 1232
751 Ga0590071_001936 3300059421 Bacteria 5298
752 Ga0590075_021306 3300059424 Bacteria 1616
753 Ga0590075_033774 3300059424 Unclassified 1299
754 Ga0590077_008492 3300059426 Bacteria 2103
755 Ga0501082_0004058 3300060353 Bacteria 12768
756 Ga0501082_0004630 3300060353 Bacteria 12005
757 Ga0501082_0344263 3300060353 Bacteria 1299
758 Ga0530510_0074523 3300061734 Bacteria 2464
759 Ga0530510_0099230 3300061734 Bacteria 2129
760 Ga0530510_0255788 3300061734 Bacteria 1305
761 2513891422 2513237141 Bacteria 8496279
762 2894234131 2894232714 Bacteria 8834183
763 Ga0207709_10053197
764 JGI25406J46586_10011462
765 Ga0065715_10021422
766 Ga0065707_10086735
767 Ga0065707_10094380
768 Ga0065707_10114112
769 Ga0070676_10015896
770 Ga0070676_10068960
771 Ga0070683_100017686
772 Ga0070683_100101965
773 Ga0070683_100416968
774 Ga0070690_100010635
775 Ga0070670_100000766
776 Ga0070670_100007771
777 Ga0070670_100013906
778 Ga0070670_100076780
779 Ga0070670_100086725
780 Ga0070670_100505346
781 Ga0070677_10107269
782 Ga0068869_100028295
783 Ga0068869_100045266
784 Ga0068869_100178004
785 Ga0070666_10025934
786 Ga0070666_10039431
787 Ga0068868_100028904
788 Ga0070660_100007564
789 Ga0070689_100010510
790 Ga0070691_10005546
791 Ga0070691_10150886
792 Ga0070661_100022031
793 Ga0070661_100231164
794 Ga0070692_10087400
795 Ga0070692_10108568
796 Ga0070692_10187814
797 Ga0070668_100029941
798 Ga0070668_100082328
799 Ga0070668_100099824
800 Ga0070668_100139654
801 Ga0070668_100153091
802 Ga0070668_100239614
803 Ga0070669_100085407
804 Ga0070669_100130037
805 Ga0070669_100148575
806 Ga0070669_100202427
807 Ga0070675_100115613
808 Ga0070675_100116888
809 Ga0070675_100157209
810 Ga0070671_100042211
811 Ga0070671_100145234
812 Ga0070674_100021404
813 Ga0070674_100031368
814 Ga0070674_100088585
815 Ga0070674_100164340
816 Ga0070673_100036336
817 Ga0070688_100065826
818 Ga0070659_100023413
819 Ga0070659_100075351
820 Ga0070667_100015974
821 Ga0070667_100210605
822 Ga0070714_100245012
823 Ga0070713_100244040
824 Ga0070705_100013483
825 Ga0070705_100017795
826 Ga0070705_100020712
827 Ga0070705_100031933
828 Ga0070705_100352350
829 Ga0070700_100086509
830 Ga0070700_100100856
831 Ga0070694_100086160
832 Ga0070694_100234943
833 Ga0070708_100038395
834 Ga0070708_100059953
835 Ga0070708_100064611
836 Ga0070708_100070408
837 Ga0070708_100073048
838 Ga0070708_100075450
839 Ga0070708_100082735
840 Ga0070708_100082742
841 Ga0070708_100125010
842 Ga0070708_100153238
843 Ga0070708_100156595
844 Ga0070708_100166195
845 Ga0070708_100177878
846 Ga0070708_100270292
847 Ga0070708_100340074
848 Ga0070708_100363757
849 Ga0070708_100480340
850 Ga0070663_100002574
851 Ga0070678_100009923
852 Ga0070678_100112184
853 Ga0070678_100134562
854 Ga0070662_100006539
855 Ga0070662_100008007
856 Ga0070662_100033014
857 Ga0070662_100093666
858 Ga0070681_10002977
859 Ga0070681_10547344
860 Ga0068867_100052189
861 Ga0068867_100098111
862 Ga0070706_100001712
863 Ga0070706_100014273
864 Ga0070706_100017060
865 Ga0070706_100028317
866 Ga0070706_100034870
867 Ga0070706_100052047
868 Ga0070706_100060091
869 Ga0070706_100061134
870 Ga0070706_100081818
871 Ga0070706_100093614
872 Ga0070706_100100760
873 Ga0070706_100119588
874 Ga0070706_100269106
875 Ga0070706_100326663
876 Ga0070706_100336537
877 Ga0070706_100344078
878 Ga0070706_100353551
879 Ga0070706_100405387
880 Ga0070706_100534974
881 Ga0070707_100003045
882 Ga0070707_100016633
883 Ga0070707_100031234
884 Ga0070707_100078492
885 Ga0070707_100099202
886 Ga0070707_100182253
887 Ga0070707_100191817
888 Ga0070707_100280527
889 Ga0070707_100411116
890 Ga0070707_100421937
891 Ga0070707_100455819
892 Ga0070707_100482282
893 Ga0070698_100007648
894 Ga0070698_100012203
895 Ga0070698_100025060
896 Ga0070698_100029481
897 Ga0070698_100040179
898 Ga0070698_100040610
899 Ga0070698_100066457
900 Ga0070698_100073123
901 Ga0070698_100086635
902 Ga0070698_100093787
903 Ga0070698_100121125
904 Ga0070698_100122634
905 Ga0070698_100128584
906 Ga0070698_100134820
907 Ga0070698_100134955
908 Ga0070699_100012388
909 Ga0070699_100043692
910 Ga0070699_100043701
911 Ga0070699_100045366
912 Ga0070699_100072337
913 Ga0070699_100159679
914 Ga0070699_100232575
915 Ga0070699_100267814
916 Ga0070699_100273415
917 Ga0070699_100388439
918 Ga0070679_100021689
919 Ga0070684_100115872
920 Ga0070697_100006249
921 Ga0070697_100017323
922 Ga0070697_100031005
923 Ga0070697_100036981
924 Ga0070697_100053739
925 Ga0070697_100057595
926 Ga0070697_100113712
927 Ga0070697_100131971
928 Ga0070697_100206591
929 Ga0070697_100307496
930 Ga0070697_100347572
931 Ga0070697_100404194
932 Ga0068853_100015761
933 Ga0068853_100382688
934 Ga0070672_100061032
935 Ga0070672_100069653
936 Ga0070672_100129423
937 Ga0070672_100209351
938 Ga0070672_100281953
939 Ga0070686_100122369
940 Ga0070695_100029396
941 Ga0070695_100033922
942 Ga0070695_100036639
943 Ga0070695_100048106
944 Ga0070695_100284200
945 Ga0070696_100041076
946 Ga0070696_100042175
947 Ga0070696_100149412
948 Ga0070693_100187893
949 Ga0070665_100065708
950 Ga0070665_100153146
951 Ga0070704_100118594
952 Ga0070704_100173662
953 Ga0068855_100082714
954 Ga0068855_100154315
955 Ga0068855_100322653
956 Ga0070664_100008150
957 Ga0070664_100036601
958 Ga0070664_100142450
959 Ga0068857_100033781
960 Ga0068857_100280424
961 Ga0068854_100055287
962 Ga0068854_100330212
963 Ga0068856_100017977
964 Ga0068856_100075678
965 Ga0068852_100047165
966 Ga0068859_100214308
967 Ga0068859_100406943
968 Ga0068859_100611525
969 Ga0068864_100018305
970 Ga0068864_100034918
971 Ga0068864_100036543
972 Ga0068864_100227638
973 Ga0068864_100358227
974 Ga0068851_10199532
975 Ga0068863_100012311
976 Ga0068863_100013707
977 Ga0068863_100057808
978 Ga0068863_100281296
979 Ga0068860_100040913
980 Ga0068860_100080095
981 Ga0068860_100154786
982 Ga0068860_100221893
983 Ga0068860_100424432
984 Ga0068862_100013867
985 Ga0068862_100041918
986 Ga0068862_100055276
987 Ga0068862_100205970
988 Ga0081455_10024121
989 Ga0081455_10057656
990 Ga0081455_10067753
991 Ga0081455_10082419
992 Ga0081538_10052640
993 Ga0081540_1017383
994 Ga0081540_1054633
995 Ga0070716_100038149
996 Ga0070716_100149284
997 Ga0070712_100038209
998 Ga0070712_100247288
999 Ga0097621_100024200
1000 Ga0097621_100027159
1001 Ga0097621_100038419
1002 Ga0097621_100047375
1003 Ga0097621_100314565
1004 Ga0068871_100008600
1005 Ga0068871_100276001
1006 Ga0075428_100014005
1007 Ga0075428_100022854
1008 Ga0075428_100048120
1009 Ga0075428_100048863
1010 Ga0075428_100080617
1011 Ga0075428_100108292
1012 Ga0075428_100289365
1013 Ga0075428_100301020
1014 Ga0075428_100307600
1015 Ga0075428_100701161
1016 Ga0075430_100113486
1017 Ga0075431_100174226
1018 Ga0075431_100220011
1019 Ga0075431_100410523
1020 Ga0075431_100421128
1021 Ga0075431_100498188
1022 Ga0075433_10002894
1023 Ga0075433_10009496
1024 Ga0075433_10023573
1025 Ga0075433_10036244
1026 Ga0075433_10037449
1027 Ga0075433_10047431
1028 Ga0075433_10047942
1029 Ga0075433_10054766
1030 Ga0075433_10111499
1031 Ga0075433_10113447
1032 Ga0075433_10122027
1033 Ga0075433_10176169
1034 Ga0075433_10201363
1035 Ga0075433_10202954
1036 Ga0075433_10270314
1037 Ga0075433_10296988
1038 Ga0075433_10314942
1039 Ga0075434_100004508
1040 Ga0075434_100007682
1041 Ga0075434_100018298
1042 Ga0075434_100022189
1043 Ga0075434_100032802
1044 Ga0075434_100039410
1045 Ga0075434_100057902
1046 Ga0075434_100061503
1047 Ga0075434_100064265
1048 Ga0075434_100074648
1049 Ga0075434_100090287
1050 Ga0075434_100158604
1051 Ga0075434_100175950
1052 Ga0075434_100301671
1053 Ga0075429_100008463
1054 Ga0075429_100017070
1055 Ga0075429_100242496
1056 Ga0068865_100198808
1057 Ga0068865_100294983
1058 Ga0075436_100008944
1059 Ga0075436_100030194
1060 Ga0075436_100160814
1061 Ga0075436_100199756
1062 Ga0097620_100214303
1063 Ga0097620_100406909
1064 Ga0097620_100611519
1065 Ga0075435_100002831
1066 Ga0075435_100010753
1067 Ga0075435_100011428
1068 Ga0075435_100063531
1069 Ga0075435_100069380
1070 Ga0075435_100221832
1071 Ga0075435_100308296
1072 Ga0099794_10008106
1073 Ga0099794_10021118
1074 Ga0099794_10087664
1075 Ga0105240_10186743
1076 Ga0111539_10000704
1077 Ga0111539_10000978
1078 Ga0111539_10101343
1079 Ga0111539_10190486
1080 Ga0111539_10197152
1081 Ga0111539_10375451
1082 Ga0111539_10443858
1083 Ga0105245_10082792
1084 Ga0114129_10006922
1085 Ga0114129_10013738
1086 Ga0114129_10020968
1087 Ga0114129_10050646
1088 Ga0114129_10098363
1089 Ga0114129_10197691
1090 Ga0114129_10209281
1091 Ga0114129_10215469
1092 Ga0114129_10434665
1093 Ga0114129_10480183
1094 Ga0114129_10547108
1095 Ga0114129_10548684
1096 Ga0114129_10693496
1097 Ga0114129_10723032
1098 Ga0114129_10743780
1099 Ga0114129_10746166
1100 Ga0114129_11005654
1101 Ga0105243_10008736
1102 Ga0105243_10142556
1103 Ga0105243_10174383
1104 Ga0105243_10262772
1105 Ga0105243_10444708
1106 Ga0105241_10035496
1107 Ga0105241_10043715
1108 Ga0105241_10064764
1109 Ga0105242_10046035
1110 Ga0105248_10003485
1111 Ga0105248_10161331
1112 Ga0105248_10593496
1113 Ga0105237_10073532
1114 Ga0105238_10093792
1115 Ga0105238_10269922
1116 Ga0105249_10052178
1117 Ga0105249_10058664
1118 Ga0105249_10416320
1119 Ga0099796_10059453
1120 Ga0105239_10094232
1121 Ga0105239_10105161
1122 Ga0105246_10333582
1123 Ga0157373_10119045
1124 Ga0157371_10016020
1125 Ga0157371_10040368
1126 Ga0157369_10015060
1127 Ga0157374_10012109
1128 Ga0157374_10073702
1129 Ga0157374_10259458
1130 Ga0157378_10296855
1131 Ga0157378_10298954
1132 Ga0157378_10356659
1133 Ga0157378_10368083
1134 Ga0163162_10064610
1135 Ga0163162_10080587
1136 Ga0163162_10094728
1137 Ga0163162_10136218
1138 Ga0163162_10307662
1139 Ga0157372_10033183
1140 Ga0157372_10474528
1141 Ga0157375_10289520
1142 Ga0157375_10334712
1143 Ga0157375_10679187
1144 Ga0163163_10032634
1145 Ga0163163_10040034
1146 Ga0163163_10067444
1147 Ga0163163_10292866
1148 Ga0157380_10474511
1149 Ga0157379_10376136
1150 Ga0157376_10055102
1151 Ga0157376_10055569
1152 Ga0157376_10086591
1153 Ga0157376_10123842
1154 Ga0157376_10123893
1155 Ga0157376_10459450
1156 Ga0163161_10133275
1157 Ga0163161_10245195
1158 Ga0213876_10034704
1159 Ga0207697_10050089
1160 Ga0207656_10127812
1161 Ga0207653_10038249
1162 Ga0207682_10072695
1163 Ga0207692_10195541
1164 Ga0207688_10016834
1165 Ga0207645_10014826
1166 Ga0207645_10015073
1167 Ga0207643_10093584
1168 Ga0207684_10005282
1169 Ga0207684_10008176
1170 Ga0207684_10012341
1171 Ga0207684_10016795
1172 Ga0207684_10020346
1173 Ga0207684_10027517
1174 Ga0207684_10060513
1175 Ga0207684_10077837
1176 Ga0207684_10078174
1177 Ga0207684_10091035
1178 Ga0207684_10106578
1179 Ga0207684_10123452
1180 Ga0207684_10142991
1181 Ga0207684_10204291
1182 Ga0207684_10255989
1183 Ga0207684_10287347
1184 Ga0207684_10287684
1185 Ga0207684_10327876
1186 Ga0207684_10344506
1187 Ga0207684_10388779
1188 Ga0207654_10061761
1189 Ga0207707_10004013
1190 Ga0207707_10158961
1191 Ga0207693_10035385
1192 Ga0207693_10109060
1193 Ga0207693_10294608
1194 Ga0207660_10191792
1195 Ga0207662_10007490
1196 Ga0207657_10065137
1197 Ga0207657_10221067
1198 Ga0207649_10058791
1199 Ga0207649_10194442
1200 Ga0207646_10005146
1201 Ga0207646_10023660
1202 Ga0207646_10026986
1203 Ga0207646_10034966
1204 Ga0207646_10041309
1205 Ga0207646_10053162
1206 Ga0207646_10062799
1207 Ga0207646_10083998
1208 Ga0207646_10103437
1209 Ga0207646_10104147
1210 Ga0207646_10110779
1211 Ga0207646_10126265
1212 Ga0207646_10141974
1213 Ga0207646_10145546
1214 Ga0207646_10152911
1215 Ga0207646_10157884
1216 Ga0207646_10188293
1217 Ga0207646_10215994
1218 Ga0207646_10230085
1219 Ga0207646_10339498
1220 Ga0207646_10360531
1221 Ga0207646_10413730
1222 Ga0207646_10432084
1223 Ga0207646_10435137
1224 Ga0207681_10055227
1225 Ga0207681_10127118
1226 Ga0207681_10185369
1227 Ga0207681_10304018
1228 Ga0207694_10014929
1229 Ga0207694_10075709
1230 Ga0207694_10273447
1231 Ga0207650_10003347
1232 Ga0207650_10059994
1233 Ga0207650_10079313
1234 Ga0207650_10079452
1235 Ga0207650_10099917
1236 Ga0207650_10383642
1237 Ga0207650_10391148
1238 Ga0207659_10068039
1239 Ga0207659_10149113
1240 Ga0207659_10223959
1241 Ga0207687_10048093
1242 Ga0207700_10105180
1243 Ga0207644_10001510
1244 Ga0207644_10017458
1245 Ga0207690_10083378
1246 Ga0207690_10151645
1247 Ga0207706_10005833
1248 Ga0207706_10015569
1249 Ga0207706_10025007
1250 Ga0207706_10044684
1251 Ga0207706_10212185
1252 Ga0207686_10022115
1253 Ga0207686_10045713
1254 Ga0207709_10096892
1255 Ga0207709_10130930
1256 Ga0207709_10182107
1257 Ga0207670_10017583
1258 Ga0207704_10043413
1259 Ga0207704_10061134
1260 Ga0207704_10123716
1261 Ga0207704_10180387
1262 Ga0207665_10010391
1263 Ga0207665_10165890
1264 Ga0207665_10273055
1265 Ga0207691_10007193
1266 Ga0207691_10031411
1267 Ga0207711_10001820
1268 Ga0207711_10207722
1269 Ga0207711_10284127
1270 Ga0207689_10108003
1271 Ga0207689_10150808
1272 Ga0207661_10487894
1273 Ga0207679_10002132
1274 Ga0207679_10209871
1275 Ga0207667_10028250
1276 Ga0207667_10097926
1277 Ga0207667_10324149
1278 Ga0207712_10012257
1279 Ga0207712_10031973
1280 Ga0207640_10227888
1281 Ga0207658_10195218
1282 Ga0207677_10246499
1283 Ga0207703_10295002
1284 Ga0207639_10143842
1285 Ga0207678_10007649
1286 Ga0207708_10029815
1287 Ga0207702_10161655
1288 Ga0207702_10182258
1289 Ga0207641_10059759
1290 Ga0207641_10080049
1291 Ga0207641_10183818
1292 Ga0207641_10199656
1293 Ga0207641_10330964
1294 Ga0207648_10160577
1295 Ga0207648_10329166
1296 Ga0207676_10027014
1297 Ga0207676_10066909
1298 Ga0207676_10102555
1299 Ga0207676_10149604
1300 Ga0207676_10544836
1301 Ga0207674_10029764
1302 Ga0207674_10121482
1303 Ga0207674_10143448
1304 Ga0207674_10236996
1305 Ga0207675_100057012
1306 Ga0207675_100071649
1307 Ga0207675_100266887
1308 Ga0207683_10001789
1309 Ga0207683_10050266
1310 Ga0207683_10056372
1311 Ga0207698_10054084
1312 Ga0209588_1010175
1313 Ga0209588_1026932
1314 Ga0207428_10000463
1315 Ga0207428_10000727
1316 Ga0207428_10041717
1317 Ga0268265_10016647
1318 Ga0268265_10030483
1319 Ga0268265_10186774
1320 Ga0268265_10214325
1321 Ga0268265_10379270
1322 Ga0268264_10103360
1323 Ga0268264_10126552
1324 Ga0268264_10177251
1325 Ga0268264_10394078
1326 Ga0268264_10433692
1327 Ga0307515_10034389
1328 Ga0265313_10100077
1329 Ga0307516_10003435
1330 Ga0307416_100078140
1331 Ga0373940_0001659
1332 Ga0373952_0012927
1333 Ga0373939_0006777
1334 Ga0373931_0017011
1335 Ga0373931_0035617
1336 Ga0373925_0016213
1337 Ga0395899_0088652
1338 Ga0395900_0157432
1339 Ga0395898_0025507
1340 Ga0395901_0061181
1341 Ga0436365_1534158
1342 Ga0439450_000996
1343 Ga0439455_0009191
1344 Ga0439460_0007077
1345 Ga0451577_0033363
1346 Ga0451577_0093721
1347 Ga0451577_0100141
1348 Ga0451577_0117224
1349 Ga0451577_0191328
1350 Ga0451577_0443233
1351 Ga0453683_0011611
1352 Ga0453683_0023730
1353 Ga0453683_0049355
1354 Ga0453683_0108175
1355 Ga0453683_0199631
1356 Ga0453684_0112070
1357 Ga0453684_0477856
1358 Ga0453684_0514415
1359 Ga0451576_0044727
1360 Ga0451576_0085841
1361 Ga0451576_0103437
1362 Ga0451576_0116407
1363 Ga0451576_0178141
1364 Ga0451576_0306162
1365 Ga0451576_0328293
1366 Ga0451576_0363831
1367 Ga0495603_0025232
1368 Ga0495580_0000762
1369 Ga0495580_0021377
1370 Ga0495580_0085439
1371 Ga0495594_0120110
1372 Ga0495598_0013680
1373 Ga0495645_0091468
1374 Ga0495659_0027374
1375 Ga0495659_0078159
1376 Ga0495669_0030895
1377 Ga0495671_0048498
1378 Ga0496104_0069080
1379 Ga0496106_0082308
1380 Ga0496106_0116677
1381 Ga0496107_0092261
1382 Ga0496108_0043384
1383 Ga0496108_0254760
1384 Ga0496110_0588448
1385 Ga0496112_0015794
1386 Ga0496112_0315746
1387 Ga0496115_0137109
1388 Ga0501040_0003458
1389 Ga0501040_0046768
1390 Ga0501040_0162409
1391 Ga0501040_0284811
1392 Ga0501041_0007836
1393 Ga0501041_0018654
1394 Ga0501042_0008302
1395 Ga0501043_0065869
1396 Ga0501046_0004871
1397 Ga0501046_0084335
1398 Ga0501048_0020059
1399 Ga0501048_0302549
1400 Ga0501071_0112298
1401 Ga0501072_0011265
1402 Ga0501072_0246682
1403 Ga0501073_0105137
1404 Ga0501074_0085010
1405 Ga0501074_0143878
1406 Ga0501075_0012872
1407 Ga0501075_0191425
1408 Ga0501076_0005192
1409 Ga0501076_0201920
1410 Ga0501076_0410744
1411 Ga0501077_0014498
1412 Ga0501077_0071286
1413 Ga0501077_0071696
1414 Ga0501077_0118952
1415 Ga0501079_0009225
1416 Ga0501079_0010392
1417 Ga0501079_0040059
1418 Ga0501079_0356557
1419 Ga0501080_0015625
1420 Ga0501080_0418072
1421 Ga0501081_0004213
1422 Ga0501081_0043666
1423 Ga0501081_0227851
1424 Ga0501083_0010370
1425 Ga0501045_0002044
1426 nmdc:mga05p37_12630_c1
1427 nmdc:mga05p37_12701_c1
1428 nmdc:mga05p37_133865_c1
1429 nmdc:mga05p37_15078_c1
1430 nmdc:mga05p37_187053_c1
1431 nmdc:mga05p37_227912_c1
1432 nmdc:mga05p37_230605_c1
1433 nmdc:mga05p37_23628_c2
1434 nmdc:mga05p37_260872_c1
1435 nmdc:mga05p37_285441_c1
1436 nmdc:mga05p37_32940_c1
1437 nmdc:mga05p37_348885_c1
1438 nmdc:mga05p37_37894_c1
1439 nmdc:mga05p37_388074_c1
1440 nmdc:mga05p37_456466_c1
1441 nmdc:mga05p37_50611_c1
1442 nmdc:mga05p37_528444_c1
1443 nmdc:mga05p37_67417_c1
1444 nmdc:mga05p37_76543_c1
1445 nmdc:mga09592_139984_c1
1446 nmdc:mga09592_276838_c1
1447 nmdc:mga09592_37763_c1
1448 nmdc:mga09592_48456_c1
1449 nmdc:mga09592_49133_c1
1450 nmdc:mga0qj67_100836_c1
1451 nmdc:mga0qj67_102749_c1
1452 nmdc:mga0qj67_321076_c1
1453 nmdc:mga06r32_27582_c1
1454 nmdc:mga06r32_285473_c1
1455 nmdc:mga06r32_309895_c1
1456 nmdc:mga06r32_45403_c1
1457 nmdc:mga08y16_154170_c1
1458 nmdc:mga08y16_173352_c1
1459 nmdc:mga08y16_1852_c1
1460 nmdc:mga08y16_26267_c1
1461 nmdc:mga0n895_113918_c1
1462 nmdc:mga0n895_14716_c1
1463 nmdc:mga0n895_16740_c1
1464 nmdc:mga0n895_26410_c1
1465 nmdc:mga0n895_279571_c1
1466 nmdc:mga0n895_33850_c1
1467 nmdc:mga0n895_4263_c1
1468 nmdc:mga0n895_48243_c1
1469 nmdc:mga0n895_535496_c1
1470 nmdc:mga0n895_63394_c1
1471 nmdc:mga0n895_82600_c1
1472 nmdc:mga0n895_84860_c1
1473 nmdc:mga0n895_9289_c1
1474 nmdc:mga0rr50_101925_c1
1475 nmdc:mga0rr50_149352_c1
1476 nmdc:mga0rr50_152668_c1
1477 nmdc:mga0rr50_173335_c1
1478 nmdc:mga0rr50_1784_c1
1479 nmdc:mga0rr50_17969_c1
1480 nmdc:mga0rr50_190632_c1
1481 nmdc:mga0rr50_22377_c1
1482 nmdc:mga0rr50_225570_c1
1483 nmdc:mga0rr50_245684_c1
1484 nmdc:mga0rr50_286458_c1
1485 nmdc:mga0rr50_52121_c1
1486 nmdc:mga0rr50_8272_c1
1487 nmdc:mga08x19_116013_c1
1488 nmdc:mga08x19_13639_c1
1489 nmdc:mga08x19_14219_c1
1490 nmdc:mga0a205_100981_c1
1491 nmdc:mga0a205_115979_c1
1492 nmdc:mga0a205_118081_c1
1493 nmdc:mga0a205_13194_c1
1494 nmdc:mga0a205_135402_c1
1495 nmdc:mga0a205_1366_c1
1496 nmdc:mga0a205_205805_c1
1497 nmdc:mga0a205_218355_c1
1498 nmdc:mga0a205_247472_c1
1499 nmdc:mga0a205_316576_c1
1500 nmdc:mga0a205_320327_c1
1501 nmdc:mga0a205_444669_c1
1502 nmdc:mga0a205_50141_c1
1503 nmdc:mga0a205_566517_c1
1504 nmdc:mga0a205_59947_c1
1505 nmdc:mga0a205_60921_c1
1506 nmdc:mga0a205_73363_c1
1507 nmdc:mga0a205_9119_c1
1508 nmdc:mga0a205_95956_c1
1509 nmdc:mga0a205_984_c1
1510 Ga0501084_0012940
1511 Ga0501084_0045514
1512 Ga0501084_0358607
1513 Ga0590071_001936
1514 Ga0590075_021306
1515 Ga0590075_033774
1516 Ga0590077_008492
1517 Ga0501082_0004058
1518 Ga0501082_0004630
1519 Ga0501082_0344263
1520 Ga0530510_0074523
1521 Ga0530510_0099230
1522 Ga0530510_0255788
1523 2513891422
1524 2894234131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

85

374

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8867 29 321
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8803 30 322
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8756 29 321
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.872 30 322
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8651 32 322
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8879 147 321 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8784 147 322 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.865 147 321 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8615 147 322 3.40.50.2300
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8216 163 249 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536Z1U0-F1-model_v4 ABC transporter substrate-binding protein 0.9668 148 323
AF-A0A534UAK1-F1-model_v4 ABC transporter substrate-binding protein 0.9593 24 114
AF-A0A536ZNV2-F1-model_v4 ABC transporter substrate-binding protein 0.955 20 323
AF-A0A537SB65-F1-model_v4 ABC transporter substrate-binding protein 0.9517 128 323
AF-A0A537RE95-F1-model_v4 ABC transporter substrate-binding protein 0.9491 130 323

Map