F479796

General Info

Members Datasets Scaffolds Average Seq Length
765 337 1530 194

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_0733621|Ga0451843_0733621_756_1460
Length 234
Sequence MEFADVVRRRRMVRRFDPDRAVAPSALEAVLYAAQRAPSAGFSQGWDFVVLAEAADRSRFWAATRDPAPNADADAGSDASPVAAPDGWLAGVSAAPVLVLCLSDPDTYLDRYAEPDKGWADRDPARWPVPYWDVDTGMAAMLMLLAAVDQGLGALFFGIPPARHASVRLAHGIPENRRLVGVVALGHELRRTEGSSRTRPRRAPADVVHWGHFRDGLGSGADEGSSGESGAAPV

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
176 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
217 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
218 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
219 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
226 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
326 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
327 2643221679 Angustibacter sp. Root456 Isolate Unclassified
328 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
329 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
330 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
331 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
332 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
333 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
334 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
335 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
336 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
337 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 0.78
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 7.71
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_0733621 3300041509 Bacteria 2011
2 JGI24735J21928_10079593 3300002067 Bacteria 938
3 JGI24751J29686_10002230 3300002459 Bacteria 3926
4 JGI25407J50210_10005672 3300003373 Bacteria 3078
5 JGI25407J50210_10010793 3300003373 Bacteria 2328
6 Ga0006562J51391_1185136 3300003578 Bacteria 2180
7 Ga0065715_10128788 3300005293 Bacteria 2058
8 Ga0070658_10084104 3300005327 Bacteria 2616
9 Ga0070658_10532757 3300005327 Bacteria 1016
10 Ga0070676_10270198 3300005328 Bacteria 1142
11 Ga0070683_100143746 3300005329 Bacteria 2260
12 Ga0070683_100155006 3300005329 Bacteria 2172
13 Ga0070683_100485972 3300005329 Bacteria 1179
14 Ga0070670_100013557 3300005331 Bacteria 6986
15 Ga0068869_100004413 3300005334 Bacteria 8744
16 Ga0068869_100135660 3300005334 Bacteria 1896
17 Ga0068869_100351781 3300005334 Bacteria 1201
18 Ga0070666_10226631 3300005335 Bacteria 1319
19 Ga0070680_100090405 3300005336 Bacteria 2534
20 Ga0070682_100057896 3300005337 Bacteria 2442
21 Ga0070682_100160744 3300005337 Bacteria 1551
22 Ga0070660_100006740 3300005339 Bacteria 7967
23 Ga0070687_100211066 3300005343 Bacteria 1183
24 Ga0070661_100030676 3300005344 Bacteria 3884
25 Ga0070668_100025037 3300005347 Bacteria 4523
26 Ga0070668_100030060 3300005347 Bacteria 4129
27 Ga0070674_100229323 3300005356 Bacteria 1448
28 Ga0070673_100144493 3300005364 Bacteria 2010
29 Ga0070688_100061278 3300005365 Bacteria 2378
30 Ga0070659_100038461 3300005366 Bacteria 3731
31 Ga0070659_100089791 3300005366 Bacteria 2462
32 Ga0070709_10031728 3300005434 Bacteria 3180
33 Ga0070714_100205627 3300005435 Bacteria 1803
34 Ga0070714_100669368 3300005435 Bacteria 1000
35 Ga0070713_100001253 3300005436 Bacteria 16220
36 Ga0070713_100056089 3300005436 Bacteria 3277
37 Ga0070710_10014422 3300005437 Bacteria 3980
38 Ga0070701_10114935 3300005438 Bacteria 1509
39 Ga0070705_100150830 3300005440 Bacteria 1542
40 Ga0070705_100347578 3300005440 Bacteria 1080
41 Ga0070700_100000015 3300005441 Bacteria 149873
42 Ga0070700_100098301 3300005441 Bacteria 1924
43 Ga0070700_100268226 3300005441 Bacteria 1232
44 Ga0070694_100328920 3300005444 Bacteria 1178
45 Ga0070708_100029661 3300005445 Bacteria 4719
46 Ga0070708_100105684 3300005445 Bacteria 2583
47 Ga0070708_100117936 3300005445 Bacteria 2445
48 Ga0070708_100347061 3300005445 Bacteria 1398
49 Ga0070708_100479470 3300005445 Bacteria 1174
50 Ga0070708_100631974 3300005445 Bacteria 1009
51 Ga0070708_100725409 3300005445 Bacteria 935
52 Ga0070678_100507729 3300005456 Bacteria 1065
53 Ga0070662_100040413 3300005457 Bacteria 3320
54 Ga0070662_100305818 3300005457 Bacteria 1293
55 Ga0070662_100983035 3300005457 Bacteria 722
56 Ga0070681_10127709 3300005458 Bacteria 2475
57 Ga0070681_10400525 3300005458 Bacteria 1284
58 Ga0068867_100783394 3300005459 Bacteria 849
59 Ga0068867_100967087 3300005459 Bacteria 770
60 Ga0070685_10573913 3300005466 Bacteria 808
61 Ga0070706_100000389 3300005467 Bacteria 52751
62 Ga0070706_100002491 3300005467 Bacteria 18548
63 Ga0070706_100024044 3300005467 Bacteria 5610
64 Ga0070706_100081957 3300005467 Bacteria 2988
65 Ga0070706_100090120 3300005467 Bacteria 2844
66 Ga0070706_100125032 3300005467 Bacteria 2398
67 Ga0070706_100221409 3300005467 Bacteria 1766
68 Ga0070706_100589565 3300005467 Bacteria 1033
69 Ga0070707_100030692 3300005468 Bacteria 5119
70 Ga0070707_100664949 3300005468 Bacteria 1004
71 Ga0070698_100006147 3300005471 Bacteria 13078
72 Ga0070698_100007098 3300005471 Bacteria 12134
73 Ga0070698_100015154 3300005471 Bacteria 8152
74 Ga0070698_100146994 3300005471 Bacteria 2306
75 Ga0070698_100211549 3300005471 Bacteria 1874
76 Ga0070698_100260793 3300005471 Bacteria 1665
77 Ga0070698_100276798 3300005471 Bacteria 1610
78 Ga0070698_100573578 3300005471 Bacteria 1068
79 Ga0070699_100104729 3300005518 Bacteria 2481
80 Ga0070699_100407401 3300005518 Bacteria 1230
81 Ga0070679_100023832 3300005530 Bacteria 5996
82 Ga0070679_100257733 3300005530 Bacteria 1699
83 Ga0070684_100180325 3300005535 Bacteria 1920
84 Ga0070697_100275108 3300005536 Bacteria 1444
85 Ga0070697_100386264 3300005536 Bacteria 1213
86 Ga0068853_100462251 3300005539 Bacteria 1194
87 Ga0070672_100494135 3300005543 Bacteria 1058
88 Ga0070686_100523898 3300005544 Bacteria 923
89 Ga0070695_100187587 3300005545 Bacteria 1469
90 Ga0070696_100316638 3300005546 Bacteria 1199
91 Ga0070696_100326580 3300005546 Bacteria 1182
92 Ga0070693_100002461 3300005547 Bacteria 8532
93 Ga0070693_100265170 3300005547 Bacteria 1144
94 Ga0070665_100199813 3300005548 Bacteria 2000
95 Ga0070665_100311806 3300005548 Bacteria 1577
96 Ga0068855_100020107 3300005563 Bacteria 8017
97 Ga0070664_100046236 3300005564 Bacteria 3677
98 Ga0070664_100088268 3300005564 Bacteria 2681
99 Ga0070664_100293363 3300005564 Bacteria 1468
100 Ga0068857_100171628 3300005577 Bacteria 1971
101 Ga0068857_100173531 3300005577 Bacteria 1960
102 Ga0068854_100193751 3300005578 Bacteria 1594
103 Ga0068856_100015947 3300005614 Bacteria 7264
104 Ga0068856_100171529 3300005614 Bacteria 2181
105 Ga0068856_100196300 3300005614 Bacteria 2032
106 Ga0070702_100039079 3300005615 Bacteria 2646
107 Ga0068859_100035415 3300005617 Bacteria 5008
108 Ga0068864_100005825 3300005618 Bacteria 10104
109 Ga0068864_100144935 3300005618 Bacteria 2146
110 Ga0068861_100005682 3300005719 Bacteria 8456
111 Ga0068870_10001166 3300005840 Bacteria 10515
112 Ga0068870_10101798 3300005840 Bacteria 1625
113 Ga0068863_100004915 3300005841 Bacteria 13171
114 Ga0068858_100010914 3300005842 Bacteria 8586
115 Ga0068860_100426421 3300005843 Bacteria 1315
116 Ga0068862_100303372 3300005844 Bacteria 1470
117 Ga0081455_10001317 3300005937 Bacteria 30783
118 Ga0081455_10026864 3300005937 Bacteria 5286
119 Ga0081455_10046793 3300005937 Bacteria 3750
120 Ga0081455_10102770 3300005937 Bacteria 2290
121 Ga0081538_10000160 3300005981 Bacteria 70950
122 Ga0081538_10000644 3300005981 Bacteria 38607
123 Ga0081538_10001199 3300005981 Bacteria 27245
124 Ga0081538_10001426 3300005981 Bacteria 24565
125 Ga0081538_10002618 3300005981 Bacteria 17402
126 Ga0081538_10013368 3300005981 Bacteria 6503
127 Ga0081540_1066144 3300005983 Bacteria 1695
128 Ga0081540_1129457 3300005983 Bacteria 1033
129 Ga0081539_10008555 3300005985 Bacteria 8857
130 Ga0081539_10009033 3300005985 Bacteria 8462
131 Ga0081539_10009590 3300005985 Bacteria 8046
132 Ga0081539_10015869 3300005985 Bacteria 5432
133 Ga0081539_10018672 3300005985 Bacteria 4796
134 Ga0081539_10046368 3300005985 Bacteria 2491
135 Ga0081539_10084542 3300005985 Bacteria 1658
136 Ga0070717_10055800 3300006028 Bacteria 3261
137 Ga0075432_10000088 3300006058 Bacteria 18887
138 Ga0075432_10003237 3300006058 Bacteria 5491
139 Ga0075432_10082064 3300006058 Bacteria 1170
140 Ga0070716_100162198 3300006173 Bacteria 1450
141 Ga0070712_100764822 3300006175 Bacteria 827
142 Ga0070712_100974731 3300006175 Bacteria 733
143 Ga0075427_10001098 3300006194 Bacteria 3402
144 Ga0068871_100101515 3300006358 Bacteria 2411
145 Ga0075428_100135919 3300006844 Bacteria 2673
146 Ga0075428_100188024 3300006844 Bacteria 2234
147 Ga0075428_100241013 3300006844 Bacteria 1951
148 Ga0075428_100455731 3300006844 Bacteria 1370
149 Ga0075430_100004897 3300006846 Bacteria 11259
150 Ga0075431_100015095 3300006847 Bacteria 7822
151 Ga0075431_100128296 3300006847 Bacteria 2617
152 Ga0075431_100243438 3300006847 Bacteria 1829
153 Ga0075433_10000120 3300006852 Bacteria 39459
154 Ga0075433_10013181 3300006852 Bacteria 6711
155 Ga0075433_10028474 3300006852 Bacteria 4749
156 Ga0075433_10044476 3300006852 Bacteria 3858
157 Ga0075434_100000217 3300006871 Bacteria 39496
158 Ga0075434_100005189 3300006871 Bacteria 11827
159 Ga0075434_100060564 3300006871 Bacteria 3765
160 Ga0075434_100089123 3300006871 Bacteria 3087
161 Ga0075434_100105446 3300006871 Bacteria 2829
162 Ga0075434_100180812 3300006871 Bacteria 2129
163 Ga0075434_100185471 3300006871 Bacteria 2101
164 Ga0075429_100002805 3300006880 Bacteria 14745
165 Ga0075429_100025411 3300006880 Bacteria 5140
166 Ga0075429_100235176 3300006880 Bacteria 1605
167 Ga0075429_100365572 3300006880 Bacteria 1263
168 Ga0068865_100513576 3300006881 Bacteria 1001
169 Ga0075436_100012090 3300006914 Bacteria 5919
170 Ga0075436_100045934 3300006914 Bacteria 3013
171 Ga0097620_100035416 3300006931 Bacteria 5008
172 Ga0075435_100028391 3300007076 Bacteria 4388
173 Ga0075435_100029692 3300007076 Bacteria 4293
174 Ga0075435_100534814 3300007076 Bacteria 1014
175 Ga0099794_10313207 3300007265 Bacteria 813
176 Ga0111539_10000029 3300009094 Bacteria 184798
177 Ga0111539_10008386 3300009094 Bacteria 13147
178 Ga0111539_10073081 3300009094 Bacteria 4043
179 Ga0111539_10151569 3300009094 Bacteria 2713
180 Ga0111539_10612851 3300009094 Bacteria 1268
181 Ga0111539_10780451 3300009094 Bacteria 1112
182 Ga0105245_10084210 3300009098 Bacteria 2912
183 Ga0105245_10335544 3300009098 Bacteria 1494
184 Ga0105245_10457392 3300009098 Bacteria 1286
185 Ga0105245_10856995 3300009098 Bacteria 949
186 Ga0105245_11096577 3300009098 Bacteria 842
187 Ga0105247_10016351 3300009101 Bacteria 4445
188 Ga0105247_10040962 3300009101 Bacteria 2833
189 Ga0114129_10014489 3300009147 Bacteria 11237
190 Ga0114129_10039161 3300009147 Bacteria 6684
191 Ga0114129_10095836 3300009147 Bacteria 4109
192 Ga0114129_10121864 3300009147 Bacteria 3588
193 Ga0114129_10160093 3300009147 Bacteria 3076
194 Ga0114129_10184591 3300009147 Bacteria 2836
195 Ga0114129_11086490 3300009147 Bacteria 1002
196 Ga0114129_11110152 3300009147 Bacteria 990
197 Ga0114129_11294105 3300009147 Bacteria 904
198 Ga0105243_10115955 3300009148 Bacteria 2249
199 Ga0105243_10162142 3300009148 Bacteria 1929
200 Ga0105243_10472193 3300009148 Bacteria 1182
201 Ga0105241_10038304 3300009174 Bacteria 3614
202 Ga0105248_10481496 3300009177 Bacteria 1399
203 Ga0105248_10485611 3300009177 Bacteria 1392
204 Ga0105237_10586460 3300009545 Bacteria 1122
205 Ga0105238_10012420 3300009551 Bacteria 8590
206 Ga0105249_10011797 3300009553 Bacteria 7683
207 Ga0105249_10565792 3300009553 Bacteria 1189
208 Ga0105249_10596450 3300009553 Bacteria 1159
209 Ga0105239_10070594 3300010375 Bacteria 3837
210 Ga0105239_10714474 3300010375 Bacteria 1146
211 Ga0105239_11685677 3300010375 Bacteria 734
212 Ga0105246_10014841 3300011119 Bacteria 4907
213 Ga0157338_1025011 3300012515 Bacteria 724
214 Ga0157373_10031514 3300013100 Bacteria 3817
215 Ga0157370_10054707 3300013104 Bacteria 3804
216 Ga0157369_10024123 3300013105 Bacteria 6770
217 Ga0157369_10115413 3300013105 Bacteria 2852
218 Ga0157369_11100613 3300013105 Bacteria 812
219 Ga0157374_10119114 3300013296 Bacteria 2546
220 Ga0163162_10130758 3300013306 Bacteria 2619
221 Ga0163162_10146143 3300013306 Bacteria 2481
222 Ga0163162_10539398 3300013306 Unclassified 1295
223 Ga0163162_11115270 3300013306 Bacteria 894
224 Ga0157372_10206603 3300013307 Bacteria 2275
225 Ga0157372_10368209 3300013307 Bacteria 1674
226 Ga0157372_11007918 3300013307 Bacteria 964
227 Ga0157372_11636493 3300013307 Bacteria 741
228 Ga0157375_10236434 3300013308 Bacteria 1986
229 Ga0157375_10745479 3300013308 Bacteria 1131
230 Ga0157375_11239822 3300013308 Bacteria 876
231 Ga0163163_10071358 3300014325 Bacteria 3461
232 Ga0163163_10091695 3300014325 Bacteria 3053
233 Ga0163163_10115622 3300014325 Bacteria 2714
234 Ga0163163_10186024 3300014325 Bacteria 2125
235 Ga0163163_10263252 3300014325 Bacteria 1775
236 Ga0163163_10601601 3300014325 Bacteria 1163
237 Ga0157380_10021163 3300014326 Bacteria 4875
238 Ga0157377_10036889 3300014745 Bacteria 2691
239 Ga0163161_10874702 3300017792 Bacteria 760
240 Ga0197907_10404563 3300020069 Bacteria 3603
241 Ga0206356_10979849 3300020070 Bacteria 1421
242 Ga0206353_10992205 3300020082 Bacteria 1744
243 Ga0206353_11588720 3300020082 Bacteria 3179
244 Ga0213873_10061453 3300021358 Bacteria 1018
245 Ga0213876_10006797 3300021384 Bacteria 6247
246 Ga0213875_10046272 3300021388 Bacteria 2042
247 Ga0213875_10357758 3300021388 Bacteria 694
248 Ga0207656_10069320 3300025321 Bacteria 1564
249 Ga0207710_10013754 3300025900 Bacteria 3406
250 Ga0207688_10080608 3300025901 Bacteria 1858
251 Ga0207688_10099159 3300025901 Bacteria 1680
252 Ga0207680_10242525 3300025903 Bacteria 1242
253 Ga0207647_10045216 3300025904 Bacteria 2748
254 Ga0207699_10056903 3300025906 Bacteria 2333
255 Ga0207643_10309963 3300025908 Bacteria 984
256 Ga0207705_10130475 3300025909 Bacteria 1870
257 Ga0207684_10000336 3300025910 Bacteria 65671
258 Ga0207684_10020581 3300025910 Bacteria 5637
259 Ga0207684_10037363 3300025910 Bacteria 4120
260 Ga0207684_10116111 3300025910 Bacteria 2293
261 Ga0207707_10012852 3300025912 Bacteria 7284
262 Ga0207707_10492492 3300025912 Bacteria 1046
263 Ga0207707_10641614 3300025912 Bacteria 896
264 Ga0207671_10160834 3300025914 Bacteria 1739
265 Ga0207693_10034192 3300025915 Bacteria 4010
266 Ga0207663_10063055 3300025916 Bacteria 2359
267 Ga0207663_10194733 3300025916 Bacteria 1458
268 Ga0207660_10267093 3300025917 Bacteria 1354
269 Ga0207662_10218649 3300025918 Bacteria 1240
270 Ga0207657_10040090 3300025919 Bacteria 4153
271 Ga0207657_10042100 3300025919 Bacteria 4032
272 Ga0207649_10003295 3300025920 Bacteria 8837
273 Ga0207652_10043736 3300025921 Bacteria 3814
274 Ga0207652_10069244 3300025921 Bacteria 3063
275 Ga0207646_10004251 3300025922 Bacteria 15652
276 Ga0207646_10025026 3300025922 Bacteria 5463
277 Ga0207646_10099275 3300025922 Bacteria 2609
278 Ga0207646_10209707 3300025922 Bacteria 1759
279 Ga0207694_10027499 3300025924 Bacteria 4332
280 Ga0207650_10052111 3300025925 Bacteria 3030
281 Ga0207659_10099343 3300025926 Bacteria 2191
282 Ga0207687_10131997 3300025927 Bacteria 1884
283 Ga0207687_10355114 3300025927 Bacteria 1195
284 Ga0207687_10363870 3300025927 Bacteria 1181
285 Ga0207687_10821997 3300025927 Bacteria 793
286 Ga0207700_10004207 3300025928 Bacteria 8452
287 Ga0207700_10016507 3300025928 Bacteria 4908
288 Ga0207664_10038422 3300025929 Bacteria 3712
289 Ga0207644_10168187 3300025931 Bacteria 1709
290 Ga0207644_10279282 3300025931 Bacteria 1341
291 Ga0207690_10022567 3300025932 Bacteria 3917
292 Ga0207706_10002030 3300025933 Bacteria 19845
293 Ga0207706_10319259 3300025933 Bacteria 1352
294 Ga0207706_10787493 3300025933 Bacteria 808
295 Ga0207709_10113537 3300025935 Bacteria 1816
296 Ga0207670_10107681 3300025936 Bacteria 2002
297 Ga0207669_10374651 3300025937 Bacteria 1107
298 Ga0207704_10166549 3300025938 Bacteria 1575
299 Ga0207665_10010759 3300025939 Bacteria 6007
300 Ga0207691_10257383 3300025940 Bacteria 1505
301 Ga0207691_10306143 3300025940 Bacteria 1364
302 Ga0207711_10335524 3300025941 Bacteria 1399
303 Ga0207689_10002561 3300025942 Bacteria 16847
304 Ga0207661_10003605 3300025944 Bacteria 10772
305 Ga0207661_10341802 3300025944 Bacteria 1349
306 Ga0207661_10752309 3300025944 Bacteria 897
307 Ga0207661_10862702 3300025944 Bacteria 834
308 Ga0207679_10027364 3300025945 Bacteria 3942
309 Ga0207651_10155181 3300025960 Bacteria 1787
310 Ga0207651_10637544 3300025960 Bacteria 935
311 Ga0207712_10052097 3300025961 Bacteria 2866
312 Ga0207712_10086150 3300025961 Bacteria 2301
313 Ga0207712_10253152 3300025961 Bacteria 1425
314 Ga0207668_10030887 3300025972 Bacteria 3524
315 Ga0207668_10561855 3300025972 Bacteria 990
316 Ga0207677_10080555 3300026023 Bacteria 2333
317 Ga0207703_10122966 3300026035 Bacteria 2230
318 Ga0207678_10001737 3300026067 Bacteria 19932
319 Ga0207708_10068135 3300026075 Bacteria 2723
320 Ga0207702_10015128 3300026078 Bacteria 6398
321 Ga0207702_10064100 3300026078 Bacteria 3144
322 Ga0207641_10114791 3300026088 Bacteria 2393
323 Ga0207648_10125715 3300026089 Bacteria 2256
324 Ga0207676_10044335 3300026095 Bacteria 3431
325 Ga0207676_10052179 3300026095 Bacteria 3195
326 Ga0207674_10060591 3300026116 Bacteria 3826
327 Ga0207675_100004231 3300026118 Bacteria 13886
328 Ga0207683_10002124 3300026121 Bacteria 17409
329 Ga0207683_10128216 3300026121 Bacteria 2281
330 Ga0207683_10176297 3300026121 Bacteria 1937
331 Ga0207698_10338575 3300026142 Bacteria 1416
332 Ga0207428_10000192 3300027907 Bacteria 84942
333 Ga0207428_10003066 3300027907 Bacteria 16447
334 Ga0207428_10039383 3300027907 Bacteria 3839
335 Ga0268266_10090568 3300028379 Bacteria 2681
336 Ga0268266_10110306 3300028379 Bacteria 2437
337 Ga0268266_10121987 3300028379 Bacteria 2320
338 Ga0268266_10147970 3300028379 Bacteria 2114
339 Ga0268265_10629025 3300028380 Bacteria 1029
340 Ga0268264_10065859 3300028381 Bacteria 3054
341 Ga0268264_10475177 3300028381 Bacteria 1215
342 Ga0307515_10064385 3300028794 Bacteria 5126
343 Ga0307515_10381511 3300028794 Bacteria 1042
344 Ga0307512_10082388 3300030522 Bacteria 2302
345 Ga0316183_1185493 3300030742 Bacteria 766
346 Ga0265762_1043830 3300030760 Bacteria 882
347 Ga0265340_10000226 3300031247 Bacteria 28801
348 Ga0307408_100016488 3300031548 Bacteria 4932
349 Ga0307408_100024652 3300031548 Bacteria 4111
350 Ga0307408_100112800 3300031548 Bacteria 2091
351 Ga0307408_100586887 3300031548 Bacteria 988
352 Ga0307408_101064593 3300031548 Bacteria 748
353 Ga0307508_10000914 3300031616 Bacteria 34391
354 Ga0316579_10000110 3300031691 Bacteria 21796
355 Ga0316576_10019312 3300031727 Bacteria 4668
356 Ga0307405_10002805 3300031731 Bacteria 7823
357 Ga0307405_10004672 3300031731 Bacteria 6508
358 Ga0307405_10023208 3300031731 Bacteria 3522
359 Ga0307405_10121596 3300031731 Bacteria 1787
360 Ga0307405_10136483 3300031731 Bacteria 1703
361 Ga0307405_10218045 3300031731 Bacteria 1398
362 Ga0307405_10282315 3300031731 Bacteria 1250
363 Ga0307405_10514172 3300031731 Bacteria 962
364 Ga0307413_10007557 3300031824 Bacteria 5057
365 Ga0307413_10007988 3300031824 Bacteria 4959
366 Ga0307413_10037549 3300031824 Bacteria 2799
367 Ga0307413_10044433 3300031824 Bacteria 2626
368 Ga0307413_10105336 3300031824 Bacteria 1875
369 Ga0307413_10163490 3300031824 Bacteria 1566
370 Ga0307413_10226679 3300031824 Bacteria 1369
371 Ga0307413_10231509 3300031824 Unclassified 1357
372 Ga0307410_10001251 3300031852 Bacteria 11308
373 Ga0307410_10003671 3300031852 Bacteria 7754
374 Ga0307410_10006519 3300031852 Bacteria 6305
375 Ga0307410_10041085 3300031852 Bacteria 3048
376 Ga0307410_10060205 3300031852 Bacteria 2594
377 Ga0307410_10109425 3300031852 Bacteria 1997
378 Ga0307410_10132554 3300031852 Bacteria 1832
379 Ga0307410_10183540 3300031852 Bacteria 1585
380 Ga0307410_10288902 3300031852 Bacteria 1290
381 Ga0307410_10506148 3300031852 Bacteria 994
382 Ga0307406_10000617 3300031901 Bacteria 20308
383 Ga0307406_10005535 3300031901 Bacteria 6907
384 Ga0307406_10021080 3300031901 Bacteria 3849
385 Ga0307406_10028515 3300031901 Bacteria 3373
386 Ga0307406_10088959 3300031901 Bacteria 2073
387 Ga0307406_10117356 3300031901 Bacteria 1843
388 Ga0307406_10182001 3300031901 Bacteria 1531
389 Ga0307406_10208996 3300031901 Bacteria 1442
390 Ga0307407_10001836 3300031903 Bacteria 7979
391 Ga0307407_10007595 3300031903 Bacteria 4920
392 Ga0307407_10019448 3300031903 Bacteria 3458
393 Ga0307407_10054063 3300031903 Bacteria 2313
394 Ga0307407_10072432 3300031903 Bacteria 2055
395 Ga0307407_10086008 3300031903 Bacteria 1914
396 Ga0307407_10086859 3300031903 Bacteria 1906
397 Ga0307407_10116964 3300031903 Bacteria 1683
398 Ga0307407_10443780 3300031903 Bacteria 940
399 Ga0307407_10682969 3300031903 Bacteria 772
400 Ga0307412_10046828 3300031911 Bacteria 2836
401 Ga0307412_10051314 3300031911 Bacteria 2725
402 Ga0307412_10077101 3300031911 Bacteria 2292
403 Ga0307412_10320869 3300031911 Bacteria 1232
404 Ga0307412_10399613 3300031911 Bacteria 1118
405 Ga0307412_10540305 3300031911 Bacteria 977
406 Ga0307412_10631080 3300031911 Bacteria 911
407 Ga0307409_100000008 3300031995 Bacteria 71624
408 Ga0307409_100000609 3300031995 Bacteria 15621
409 Ga0307409_100002865 3300031995 Bacteria 9135
410 Ga0307409_100017461 3300031995 Bacteria 4784
411 Ga0307409_100036723 3300031995 Bacteria 3605
412 Ga0307409_100077757 3300031995 Bacteria 2666
413 Ga0307409_100083244 3300031995 Bacteria 2593
414 Ga0307409_100178878 3300031995 Bacteria 1875
415 Ga0307409_100208709 3300031995 Bacteria 1753
416 Ga0307409_100243958 3300031995 Bacteria 1637
417 Ga0307409_100372170 3300031995 Bacteria 1355
418 Ga0307409_100487924 3300031995 Bacteria 1197
419 Ga0307409_101141439 3300031995 Bacteria 801
420 Ga0307409_101421467 3300031995 Unclassified 720
421 Ga0307416_100000067 3300032002 Bacteria 86975
422 Ga0307416_100000596 3300032002 Bacteria 18579
423 Ga0307416_100000807 3300032002 Bacteria 16471
424 Ga0307416_100007607 3300032002 Bacteria 6910
425 Ga0307416_100019412 3300032002 Bacteria 4819
426 Ga0307416_100029167 3300032002 Bacteria 4117
427 Ga0307416_100034866 3300032002 Bacteria 3836
428 Ga0307416_100035439 3300032002 Bacteria 3811
429 Ga0307416_100035751 3300032002 Bacteria 3799
430 Ga0307416_100058640 3300032002 Bacteria 3123
431 Ga0307416_100224327 3300032002 Bacteria 1805
432 Ga0307416_100231559 3300032002 Bacteria 1782
433 Ga0307416_100911210 3300032002 Bacteria 979
434 Ga0307416_100969607 3300032002 Bacteria 953
435 Ga0307416_101221331 3300032002 Bacteria 857
436 Ga0307414_10009121 3300032004 Bacteria 5681
437 Ga0307414_10013107 3300032004 Bacteria 4927
438 Ga0307414_10021223 3300032004 Bacteria 4069
439 Ga0307414_10587398 3300032004 Bacteria 997
440 Ga0307411_10002425 3300032005 Bacteria 8239
441 Ga0307411_10295621 3300032005 Bacteria 1296
442 Ga0307415_100000595 3300032126 Bacteria 15827
443 Ga0307415_100001584 3300032126 Bacteria 10974
444 Ga0307415_100002919 3300032126 Bacteria 8573
445 Ga0307415_100012058 3300032126 Bacteria 4982
446 Ga0307415_100021703 3300032126 Bacteria 3952
447 Ga0307415_100023592 3300032126 Bacteria 3822
448 Ga0307415_100044508 3300032126 Bacteria 2968
449 Ga0307415_100053090 3300032126 Bacteria 2760
450 Ga0307415_100176812 3300032126 Bacteria 1670
451 Ga0307415_100325498 3300032126 Bacteria 1283
452 Ga0307415_100403652 3300032126 Bacteria 1167
453 Ga0307415_100456627 3300032126 Bacteria 1106
454 Ga0307415_100478705 3300032126 Bacteria 1083
455 Ga0307415_100491049 3300032126 Bacteria 1071
456 Ga0307415_100785771 3300032126 Unclassified 867
457 Ga0307507_10042802 3300033179 Bacteria 4504
458 Ga0373951_0000188 3300035091 Bacteria 22431
459 Ga0373932_0134418 3300035112 Bacteria 836
460 Ga0316574_0602080 3300035398 Unclassified 679
461 Ga0373933_0378891 3300035724 Bacteria 921
462 Ga0373937_0606708 3300036401 Bacteria 1039
463 Ga0373925_0380670 3300037068 Bacteria 1149
464 Ga0395899_0094370 3300037312 Bacteria 2165
465 Ga0395900_0093886 3300037418 Bacteria 3082
466 Ga0395900_0420981 3300037418 Bacteria 1296
467 Ga0395900_0781541 3300037418 Bacteria 884
468 Ga0395898_0165046 3300037466 Bacteria 2118
469 Ga0395898_0176331 3300037466 Bacteria 2043
470 Ga0395898_0684140 3300037466 Bacteria 968
471 Ga0395898_1159096 3300037466 Bacteria 705
472 Ga0395905_0312723 3300037471 Bacteria 1459
473 Ga0395905_0353429 3300037471 Bacteria 1362
474 Ga0436364_0384449 3300037853 Bacteria 1444
475 Ga0436364_0758705 3300037853 Bacteria 5010
476 Ga0436364_1292600 3300037853 Bacteria 1700
477 Ga0395901_0003711 3300038443 Bacteria 15395
478 Ga0395901_0019646 3300038443 Bacteria 6906
479 Ga0395901_0031689 3300038443 Bacteria 5451
480 Ga0395901_0095165 3300038443 Bacteria 3121
481 Ga0395901_0113542 3300038443 Bacteria 2845
482 Ga0395901_0170926 3300038443 Bacteria 2281
483 Ga0395901_0232926 3300038443 Bacteria 1922
484 Ga0395901_0448567 3300038443 Bacteria 1320
485 Ga0395901_0498749 3300038443 Bacteria 1240
486 Ga0395901_0524712 3300038443 Bacteria 1203
487 Ga0436365_0058408 3300039437 Bacteria 971
488 Ga0436365_0724282 3300039437 Bacteria 2910
489 Ga0436365_0826211 3300039437 Bacteria 2214
490 Ga0436365_0875967 3300039437 Bacteria 2621
491 Ga0436365_1431448 3300039437 Bacteria 6349
492 Ga0436363_1302349 3300039450 Bacteria 1215
493 Ga0436362_0519821 3300039453 Bacteria 1127
494 Ga0451835_0624321 3300041492 Bacteria 849
495 Ga0451853_0067848 3300041512 Bacteria 6015
496 Ga0451853_1189754 3300041512 Bacteria 1847
497 Ga0451853_2772895 3300041512 Bacteria 1096
498 Ga0439448_0002004 3300042005 Bacteria 5445
499 Ga0439448_0003942 3300042005 Bacteria 4163
500 Ga0439448_0027022 3300042005 Bacteria 1807
501 Ga0439448_0038493 3300042005 Bacteria 1539
502 Ga0439448_0186583 3300042005 Bacteria 725
503 Ga0439450_000310 3300042008 Bacteria 6055
504 Ga0439450_009108 3300042008 Bacteria 1875
505 Ga0439450_043473 3300042008 Bacteria 1050
506 Ga0439451_030547 3300042009 Bacteria 1083
507 Ga0439454_000876 3300042011 Bacteria 2652
508 Ga0439454_002270 3300042011 Bacteria 1997
509 Ga0439455_0000387 3300042012 Bacteria 5804
510 Ga0439455_0169584 3300042012 Bacteria 626
511 Ga0439463_001580 3300042016 Bacteria 6005
512 Ga0439463_002640 3300042016 Bacteria 4548
513 Ga0439463_020673 3300042016 Bacteria 1643
514 Ga0439463_022222 3300042016 Bacteria 1587
515 Ga0439463_050769 3300042016 Bacteria 1058
516 Ga0439463_065001 3300042016 Bacteria 933
517 Ga0450888_003444 3300042126 Bacteria 1603
518 Ga0450904_005768 3300042139 Bacteria 1245
519 Ga0450889_016418 3300042144 Bacteria 799
520 Ga0439458_0006683 3300042157 Bacteria 2570
521 Ga0439444_0001766 3300042437 Bacteria 2858
522 Ga0439444_0005031 3300042437 Bacteria 1947
523 Ga0439459_0091311 3300042438 Bacteria 733
524 Ga0439464_0001945 3300042439 Bacteria 5001
525 Ga0439464_0017764 3300042439 Bacteria 1931
526 Ga0439464_0068679 3300042439 Bacteria 1046
527 Ga0439460_0000466 3300042461 Bacteria 8769
528 Ga0439460_0014365 3300042461 Bacteria 2081
529 Ga0450916_005821 3300042530 Bacteria 1437
530 Ga0450893_0053627 3300042532 Bacteria 760
531 Ga0439440_0000208 3300042993 Bacteria 9121
532 Ga0439440_0002002 3300042993 Bacteria 3794
533 Ga0439440_0032229 3300042993 Bacteria 1243
534 Ga0439440_0107521 3300042993 Bacteria 764
535 Ga0466965_0252139 3300044683 Bacteria 947
536 Ga0466965_0468127 3300044683 Bacteria 703
537 Ga0466966_0009231 3300044684 Bacteria 6532
538 Ga0466966_0164503 3300044684 Bacteria 1350
539 Ga0466961_0132072 3300044693 Bacteria 1565
540 Ga0466961_0401127 3300044693 Bacteria 832
541 Ga0466963_0154060 3300044694 Bacteria 1597
542 Ga0466963_0201167 3300044694 Bacteria 1393
543 Ga0466964_0464495 3300044706 Bacteria 674
544 Ga0466957_0125362 3300044842 Bacteria 1640
545 Ga0466957_0174330 3300044842 Bacteria 1402
546 Ga0466960_0004962 3300044901 Bacteria 5240
547 Ga0466960_0086584 3300044901 Bacteria 1589
548 Ga0466960_0180744 3300044901 Bacteria 1143
549 Ga0466960_0250516 3300044901 Unclassified 984
550 Ga0466959_0041128 3300045049 Bacteria 3413
551 Ga0466959_0308572 3300045049 Bacteria 1083
552 Ga0466958_0012869 3300045836 Bacteria 4749
553 Ga0466958_0047154 3300045836 Bacteria 2602
554 Ga0466967_0011786 3300045976 Bacteria 6648
555 Ga0466967_0055934 3300045976 Bacteria 3477
556 Ga0466967_0132876 3300045976 Bacteria 2312
557 Ga0466967_1296467 3300045976 Bacteria 725
558 Ga0466967_1754352 3300045976 Bacteria 618
559 Ga0495629_0606106 3300046459 Bacteria 732
560 Ga0495653_0471234 3300046463 Bacteria 787
561 Ga0495582_0111858 3300046473 Bacteria 1534
562 Ga0495582_0183369 3300046473 Bacteria 1193
563 Ga0495607_0341212 3300046501 Bacteria 694
564 Ga0495630_0927813 3300046517 Bacteria 663
565 Ga0495631_0172280 3300046518 Unclassified 928
566 Ga0495644_0108876 3300046523 Unclassified 1051
567 Ga0495645_0191759 3300046543 Bacteria 1392
568 Ga0495667_0177744 3300046559 Bacteria 1367
569 Ga0495656_0094804 3300046615 Bacteria 1371
570 Ga0495656_0517515 3300046615 Bacteria 634
571 Ga0495668_0395023 3300046616 Unclassified 760
572 Ga0495661_0129154 3300046665 Bacteria 1387
573 Ga0495599_0073442 3300046678 Bacteria 2135
574 Ga0495658_0242271 3300046683 Bacteria 1133
575 Ga0495670_0100113 3300046691 Unclassified 1492
576 Ga0495649_0388024 3300046694 Bacteria 702
577 Ga0495581_0390071 3300047315 Bacteria 813
578 Ga0495680_0199740 3300047322 Bacteria 1435
579 Ga0495680_0280417 3300047322 Bacteria 1175
580 Ga0495680_0297496 3300047322 Bacteria 1134
581 Ga0495602_0409147 3300048088 Bacteria 966
582 Ga0495615_0096491 3300048090 Unclassified 830
583 Ga0496100_0009391 3300048903 Bacteria 5498
584 Ga0496100_0016105 3300048903 Bacteria 4382
585 Ga0496100_0768608 3300048903 Bacteria 754
586 Ga0496101_0051017 3300048904 Bacteria 2980
587 Ga0496101_0135461 3300048904 Bacteria 1874
588 Ga0496101_0195696 3300048904 Bacteria 1562
589 Ga0496102_0004221 3300048905 Bacteria 12145
590 Ga0496102_0068027 3300048905 Bacteria 3268
591 Ga0496103_0061786 3300048906 Bacteria 2331
592 Ga0496103_0098206 3300048906 Bacteria 1852
593 Ga0496103_0117434 3300048906 Bacteria 1693
594 Ga0496104_0058820 3300048907 Bacteria 3638
595 Ga0496104_0102136 3300048907 Bacteria 2746
596 Ga0496104_0145088 3300048907 Bacteria 2279
597 Ga0496104_0226429 3300048907 Bacteria 1782
598 Ga0496104_0314010 3300048907 Bacteria 1480
599 Ga0496105_0007851 3300048908 Bacteria 8285
600 Ga0496105_0170638 3300048908 Bacteria 1783
601 Ga0496105_0401428 3300048908 Bacteria 1088
602 Ga0496105_0900900 3300048908 Bacteria 667
603 Ga0496107_0077221 3300048910 Bacteria 2426
604 Ga0496107_0235556 3300048910 Bacteria 1362
605 Ga0496107_0296565 3300048910 Bacteria 1203
606 Ga0496108_0046048 3300048911 Bacteria 3643
607 Ga0496108_0205627 3300048911 Bacteria 1708
608 Ga0496108_0388139 3300048911 Bacteria 1219
609 Ga0496108_0912101 3300048911 Bacteria 754
610 Ga0496109_0061817 3300048912 Bacteria 3424
611 Ga0496109_0259647 3300048912 Bacteria 1636
612 Ga0496109_0378745 3300048912 Bacteria 1337
613 Ga0496109_0599635 3300048912 Bacteria 1037
614 Ga0496109_0736481 3300048912 Bacteria 924
615 Ga0496110_0001739 3300048913 Bacteria 16060
616 Ga0496110_0115191 3300048913 Bacteria 2419
617 Ga0496111_0001057 3300048914 Bacteria 15165
618 Ga0496111_0081993 3300048914 Bacteria 2355
619 Ga0496111_0168418 3300048914 Bacteria 1627
620 Ga0496111_0204014 3300048914 Bacteria 1469
621 Ga0496112_0055005 3300048915 Bacteria 3911
622 Ga0496112_0123007 3300048915 Bacteria 2565
623 Ga0496112_0163555 3300048915 Bacteria 2191
624 Ga0496112_0512159 3300048915 Unclassified 1135
625 Ga0496113_0020315 3300048916 Bacteria 4667
626 Ga0496113_0049651 3300048916 Bacteria 3125
627 Ga0496113_0059339 3300048916 Bacteria 2882
628 Ga0496113_0104899 3300048916 Bacteria 2194
629 Ga0496113_0326843 3300048916 Unclassified 1230
630 Ga0496114_0009405 3300048917 Bacteria 7760
631 Ga0496114_0027223 3300048917 Bacteria 4681
632 Ga0496114_0034871 3300048917 Bacteria 4154
633 Ga0496114_0177933 3300048917 Bacteria 1856
634 Ga0496114_0197158 3300048917 Bacteria 1763
635 Ga0496114_0411356 3300048917 Bacteria 1198
636 Ga0496114_0468697 3300048917 Bacteria 1115
637 Ga0496114_0551005 3300048917 Bacteria 1019
638 Ga0496115_0197016 3300048918 Bacteria 1664
639 Ga0496115_0312494 3300048918 Bacteria 1287
640 Ga0496115_0369900 3300048918 Bacteria 1167
641 Ga0496115_0773135 3300048918 Bacteria 749
642 Ga0496126_0103916 3300048929 Bacteria 2482
643 Ga0496126_0301451 3300048929 Bacteria 1322
644 Ga0501031_0000971 3300049568 Bacteria 17414
645 Ga0501031_0027737 3300049568 Bacteria 3691
646 Ga0501032_0028299 3300049569 Bacteria 3851
647 Ga0501033_0010886 3300049570 Bacteria 6974
648 Ga0501034_0151117 3300049571 Bacteria 2298
649 Ga0501036_0000074 3300049572 Bacteria 61249
650 Ga0501036_0005783 3300049572 Bacteria 10024
651 Ga0501037_0006264 3300049573 Bacteria 8698
652 Ga0501037_0006974 3300049573 Bacteria 8251
653 Ga0501038_0000316 3300049574 Bacteria 41356
654 Ga0501038_0018014 3300049574 Bacteria 6379
655 Ga0501039_0000190 3300049575 Bacteria 44153
656 Ga0501039_0000222 3300049575 Bacteria 41722
657 Ga0501040_0000140 3300049576 Bacteria 38841
658 Ga0501040_0000424 3300049576 Bacteria 25065
659 Ga0501041_0000572 3300049577 Bacteria 19173
660 Ga0501041_0003210 3300049577 Bacteria 9400
661 Ga0501042_0000173 3300049578 Bacteria 29754
662 Ga0501042_0006390 3300049578 Bacteria 7641
663 Ga0501042_0570013 3300049578 Bacteria 823
664 Ga0501043_0018290 3300049579 Bacteria 5495
665 Ga0501046_0001292 3300049580 Bacteria 24253
666 Ga0501046_0002551 3300049580 Bacteria 17036
667 Ga0501047_0319488 3300049581 Bacteria 1393
668 Ga0501048_0000155 3300049582 Bacteria 42224
669 Ga0501048_0000590 3300049582 Bacteria 25751
670 Ga0501067_0007531 3300049583 Bacteria 6051
671 Ga0501067_0208044 3300049583 Bacteria 1090
672 Ga0501068_0205298 3300049584 Bacteria 1250
673 Ga0501068_0260946 3300049584 Bacteria 1105
674 Ga0501071_0000461 3300049587 Bacteria 20530
675 Ga0501072_0000867 3300049588 Bacteria 22170
676 Ga0501072_0037552 3300049588 Bacteria 3799
677 Ga0501074_0012882 3300049590 Bacteria 6081
678 Ga0501074_0027872 3300049590 Bacteria 4094
679 Ga0501075_0000552 3300049591 Bacteria 22736
680 Ga0501075_0002120 3300049591 Bacteria 13124
681 Ga0501076_0000408 3300049592 Bacteria 26917
682 Ga0501076_0003045 3300049592 Bacteria 11658
683 Ga0501076_0740653 3300049592 Bacteria 811
684 Ga0501077_0000353 3300049593 Bacteria 27157
685 Ga0501077_0037932 3300049593 Bacteria 3068
686 Ga0501221_101210 3300049704 Bacteria 716
687 Ga0501079_0000271 3300049741 Bacteria 31924
688 Ga0501079_0002637 3300049741 Bacteria 13057
689 Ga0501080_0003696 3300049742 Bacteria 13504
690 Ga0501081_0000803 3300049743 Bacteria 18535
691 Ga0501081_0004997 3300049743 Bacteria 8536
692 Ga0501083_0045507 3300049744 Bacteria 2969
693 Ga0501083_0342934 3300049744 Bacteria 971
694 Ga0501035_0007317 3300049822 Bacteria 10321
695 Ga0501035_0230306 3300049822 Bacteria 1579
696 Ga0501044_0004123 3300049823 Bacteria 16306
697 Ga0501044_0461894 3300049823 Bacteria 1175
698 Ga0501045_0000168 3300049824 Bacteria 35721
699 Ga0501045_0001679 3300049824 Bacteria 14899
700 nmdc:mga05p37_178620_c1 3300050507 Bacteria 2584
701 nmdc:mga05p37_179161_c1 3300050507 Bacteria 2580
702 nmdc:mga05p37_210928_c1 3300050507 Bacteria 2348
703 nmdc:mga05p37_29020_c1 3300050507 Bacteria 6751
704 nmdc:mga05p37_465535_c1 3300050507 Bacteria 1460
705 nmdc:mga09592_17209_c1 3300050508 Bacteria 5920
706 nmdc:mga09592_655607_c1 3300050508 Bacteria 896
707 nmdc:mga0qj67_15709_c1 3300050509 Bacteria 5735
708 nmdc:mga06r32_466623_c1 3300050510 Bacteria 1241
709 nmdc:mga06r32_5300_c1 3300050510 Bacteria 11607
710 nmdc:mga06r32_74209_c1 3300050510 Bacteria 3297
711 nmdc:mga08y16_129_c1 3300050511 Bacteria 65199
712 nmdc:mga08y16_181103_c1 3300050511 Bacteria 2188
713 nmdc:mga08y16_319389_c1 3300050511 Bacteria 1599
714 nmdc:mga08y16_4512_c1 3300050511 Bacteria 14539
715 nmdc:mga08y16_9435_c1 3300050511 Bacteria 10235
716 nmdc:mga0n895_172863_c1 3300050512 Bacteria 2192
717 nmdc:mga0n895_33795_c1 3300050512 Bacteria 4916
718 nmdc:mga0n895_4980_c1 3300050512 Bacteria 11025
719 nmdc:mga0n895_549619_c1 3300050512 Unclassified 1161
720 nmdc:mga0n895_74471_c1 3300050512 Bacteria 3373
721 nmdc:mga0n895_771723_c1 3300050512 Bacteria 953
722 nmdc:mga0n895_91151_c1 3300050512 Bacteria 3050
723 nmdc:mga0rr50_347475_c1 3300050513 Unclassified 1247
724 nmdc:mga0rr50_5833_c1 3300050513 Bacteria 7401
725 nmdc:mga08x19_11094_c1 3300050514 Bacteria 5424
726 nmdc:mga08x19_4888_c1 3300050514 Bacteria 7922
727 nmdc:mga08x19_666451_c1 3300050514 Bacteria 738
728 nmdc:mga0a205_108685_c1 3300050515 Bacteria 2672
729 nmdc:mga0a205_152006_c1 3300050515 Bacteria 2214
730 nmdc:mga0a205_193415_c1 3300050515 Bacteria 1926
731 nmdc:mga0a205_4905_c1 3300050515 Bacteria 12031
732 nmdc:mga0a205_72409_c1 3300050515 Bacteria 3329
733 nmdc:mga0a205_86_c1 3300050515 Bacteria 51154
734 Ga0495619_0038911 3300053085 Bacteria 3104
735 Ga0495619_0143563 3300053085 Bacteria 1645
736 Ga0495619_0224505 3300053085 Bacteria 1301
737 Ga0495619_0231434 3300053085 Bacteria 1280
738 Ga0500646_0001191 3300053090 Bacteria 6989
739 Ga0500641_0156983 3300053096 Bacteria 981
740 Ga0500594_0022229 3300053118 Bacteria 1598
741 Ga0500588_0021256 3300053146 Bacteria 1750
742 Ga0501084_0002121 3300054114 Bacteria 15857
743 Ga0501084_0002913 3300054114 Bacteria 13861
744 Ga0590074_004826 3300059423 Bacteria 2225
745 Ga0590075_002459 3300059424 Bacteria 4430
746 Ga0590077_001665 3300059426 Bacteria 5081
747 Ga0590077_007514 3300059426 Unclassified 2230
748 Ga0590077_011388 3300059426 Bacteria 1836
749 Ga0501082_0000435 3300060353 Bacteria 37081
750 Ga0501082_0001424 3300060353 Bacteria 21028
751 Ga0501082_1060343 3300060353 Bacteria 709
752 Ga0530510_0000096 3300061734 Bacteria 47876
753 2643850416 2643221567 Bacteria 4163945
754 2644134174 2643221624 Bacteria 4384879
755 2644444937 2643221679 Bacteria 3839507
756 2774396016 2773857762 Bacteria 5971770
757 2809197679 2808606439 Bacteria 5952208
758 2812347851 2811994878 Bacteria 5992952
759 2812374695 2811994882 Bacteria 4688362
760 2816426558 2816332119 Bacteria 8120218
761 2819427290 2818991318 Bacteria 5266538
762 2819693153 2818991462 Bacteria 4320267
763 2819730207 2818991469 Bacteria 4644110
764 2891968753 2891968417 Bacteria 5821697
765 2919449997 2919446982 Bacteria 3994487
766 Ga0451843_0733621
767 JGI24735J21928_10079593
768 JGI24751J29686_10002230
769 JGI25407J50210_10005672
770 JGI25407J50210_10010793
771 Ga0006562J51391_1185136
772 Ga0065715_10128788
773 Ga0070658_10084104
774 Ga0070658_10532757
775 Ga0070676_10270198
776 Ga0070683_100143746
777 Ga0070683_100155006
778 Ga0070683_100485972
779 Ga0070670_100013557
780 Ga0068869_100004413
781 Ga0068869_100135660
782 Ga0068869_100351781
783 Ga0070666_10226631
784 Ga0070680_100090405
785 Ga0070682_100057896
786 Ga0070682_100160744
787 Ga0070660_100006740
788 Ga0070687_100211066
789 Ga0070661_100030676
790 Ga0070668_100025037
791 Ga0070668_100030060
792 Ga0070674_100229323
793 Ga0070673_100144493
794 Ga0070688_100061278
795 Ga0070659_100038461
796 Ga0070659_100089791
797 Ga0070709_10031728
798 Ga0070714_100205627
799 Ga0070714_100669368
800 Ga0070713_100001253
801 Ga0070713_100056089
802 Ga0070710_10014422
803 Ga0070701_10114935
804 Ga0070705_100150830
805 Ga0070705_100347578
806 Ga0070700_100000015
807 Ga0070700_100098301
808 Ga0070700_100268226
809 Ga0070694_100328920
810 Ga0070708_100029661
811 Ga0070708_100105684
812 Ga0070708_100117936
813 Ga0070708_100347061
814 Ga0070708_100479470
815 Ga0070708_100631974
816 Ga0070708_100725409
817 Ga0070678_100507729
818 Ga0070662_100040413
819 Ga0070662_100305818
820 Ga0070662_100983035
821 Ga0070681_10127709
822 Ga0070681_10400525
823 Ga0068867_100783394
824 Ga0068867_100967087
825 Ga0070685_10573913
826 Ga0070706_100000389
827 Ga0070706_100002491
828 Ga0070706_100024044
829 Ga0070706_100081957
830 Ga0070706_100090120
831 Ga0070706_100125032
832 Ga0070706_100221409
833 Ga0070706_100589565
834 Ga0070707_100030692
835 Ga0070707_100664949
836 Ga0070698_100006147
837 Ga0070698_100007098
838 Ga0070698_100015154
839 Ga0070698_100146994
840 Ga0070698_100211549
841 Ga0070698_100260793
842 Ga0070698_100276798
843 Ga0070698_100573578
844 Ga0070699_100104729
845 Ga0070699_100407401
846 Ga0070679_100023832
847 Ga0070679_100257733
848 Ga0070684_100180325
849 Ga0070697_100275108
850 Ga0070697_100386264
851 Ga0068853_100462251
852 Ga0070672_100494135
853 Ga0070686_100523898
854 Ga0070695_100187587
855 Ga0070696_100316638
856 Ga0070696_100326580
857 Ga0070693_100002461
858 Ga0070693_100265170
859 Ga0070665_100199813
860 Ga0070665_100311806
861 Ga0068855_100020107
862 Ga0070664_100046236
863 Ga0070664_100088268
864 Ga0070664_100293363
865 Ga0068857_100171628
866 Ga0068857_100173531
867 Ga0068854_100193751
868 Ga0068856_100015947
869 Ga0068856_100171529
870 Ga0068856_100196300
871 Ga0070702_100039079
872 Ga0068859_100035415
873 Ga0068864_100005825
874 Ga0068864_100144935
875 Ga0068861_100005682
876 Ga0068870_10001166
877 Ga0068870_10101798
878 Ga0068863_100004915
879 Ga0068858_100010914
880 Ga0068860_100426421
881 Ga0068862_100303372
882 Ga0081455_10001317
883 Ga0081455_10026864
884 Ga0081455_10046793
885 Ga0081455_10102770
886 Ga0081538_10000160
887 Ga0081538_10000644
888 Ga0081538_10001199
889 Ga0081538_10001426
890 Ga0081538_10002618
891 Ga0081538_10013368
892 Ga0081540_1066144
893 Ga0081540_1129457
894 Ga0081539_10008555
895 Ga0081539_10009033
896 Ga0081539_10009590
897 Ga0081539_10015869
898 Ga0081539_10018672
899 Ga0081539_10046368
900 Ga0081539_10084542
901 Ga0070717_10055800
902 Ga0075432_10000088
903 Ga0075432_10003237
904 Ga0075432_10082064
905 Ga0070716_100162198
906 Ga0070712_100764822
907 Ga0070712_100974731
908 Ga0075427_10001098
909 Ga0068871_100101515
910 Ga0075428_100135919
911 Ga0075428_100188024
912 Ga0075428_100241013
913 Ga0075428_100455731
914 Ga0075430_100004897
915 Ga0075431_100015095
916 Ga0075431_100128296
917 Ga0075431_100243438
918 Ga0075433_10000120
919 Ga0075433_10013181
920 Ga0075433_10028474
921 Ga0075433_10044476
922 Ga0075434_100000217
923 Ga0075434_100005189
924 Ga0075434_100060564
925 Ga0075434_100089123
926 Ga0075434_100105446
927 Ga0075434_100180812
928 Ga0075434_100185471
929 Ga0075429_100002805
930 Ga0075429_100025411
931 Ga0075429_100235176
932 Ga0075429_100365572
933 Ga0068865_100513576
934 Ga0075436_100012090
935 Ga0075436_100045934
936 Ga0097620_100035416
937 Ga0075435_100028391
938 Ga0075435_100029692
939 Ga0075435_100534814
940 Ga0099794_10313207
941 Ga0111539_10000029
942 Ga0111539_10008386
943 Ga0111539_10073081
944 Ga0111539_10151569
945 Ga0111539_10612851
946 Ga0111539_10780451
947 Ga0105245_10084210
948 Ga0105245_10335544
949 Ga0105245_10457392
950 Ga0105245_10856995
951 Ga0105245_11096577
952 Ga0105247_10016351
953 Ga0105247_10040962
954 Ga0114129_10014489
955 Ga0114129_10039161
956 Ga0114129_10095836
957 Ga0114129_10121864
958 Ga0114129_10160093
959 Ga0114129_10184591
960 Ga0114129_11086490
961 Ga0114129_11110152
962 Ga0114129_11294105
963 Ga0105243_10115955
964 Ga0105243_10162142
965 Ga0105243_10472193
966 Ga0105241_10038304
967 Ga0105248_10481496
968 Ga0105248_10485611
969 Ga0105237_10586460
970 Ga0105238_10012420
971 Ga0105249_10011797
972 Ga0105249_10565792
973 Ga0105249_10596450
974 Ga0105239_10070594
975 Ga0105239_10714474
976 Ga0105239_11685677
977 Ga0105246_10014841
978 Ga0157338_1025011
979 Ga0157373_10031514
980 Ga0157370_10054707
981 Ga0157369_10024123
982 Ga0157369_10115413
983 Ga0157369_11100613
984 Ga0157374_10119114
985 Ga0163162_10130758
986 Ga0163162_10146143
987 Ga0163162_10539398
988 Ga0163162_11115270
989 Ga0157372_10206603
990 Ga0157372_10368209
991 Ga0157372_11007918
992 Ga0157372_11636493
993 Ga0157375_10236434
994 Ga0157375_10745479
995 Ga0157375_11239822
996 Ga0163163_10071358
997 Ga0163163_10091695
998 Ga0163163_10115622
999 Ga0163163_10186024
1000 Ga0163163_10263252
1001 Ga0163163_10601601
1002 Ga0157380_10021163
1003 Ga0157377_10036889
1004 Ga0163161_10874702
1005 Ga0197907_10404563
1006 Ga0206356_10979849
1007 Ga0206353_10992205
1008 Ga0206353_11588720
1009 Ga0213873_10061453
1010 Ga0213876_10006797
1011 Ga0213875_10046272
1012 Ga0213875_10357758
1013 Ga0207656_10069320
1014 Ga0207710_10013754
1015 Ga0207688_10080608
1016 Ga0207688_10099159
1017 Ga0207680_10242525
1018 Ga0207647_10045216
1019 Ga0207699_10056903
1020 Ga0207643_10309963
1021 Ga0207705_10130475
1022 Ga0207684_10000336
1023 Ga0207684_10020581
1024 Ga0207684_10037363
1025 Ga0207684_10116111
1026 Ga0207707_10012852
1027 Ga0207707_10492492
1028 Ga0207707_10641614
1029 Ga0207671_10160834
1030 Ga0207693_10034192
1031 Ga0207663_10063055
1032 Ga0207663_10194733
1033 Ga0207660_10267093
1034 Ga0207662_10218649
1035 Ga0207657_10040090
1036 Ga0207657_10042100
1037 Ga0207649_10003295
1038 Ga0207652_10043736
1039 Ga0207652_10069244
1040 Ga0207646_10004251
1041 Ga0207646_10025026
1042 Ga0207646_10099275
1043 Ga0207646_10209707
1044 Ga0207694_10027499
1045 Ga0207650_10052111
1046 Ga0207659_10099343
1047 Ga0207687_10131997
1048 Ga0207687_10355114
1049 Ga0207687_10363870
1050 Ga0207687_10821997
1051 Ga0207700_10004207
1052 Ga0207700_10016507
1053 Ga0207664_10038422
1054 Ga0207644_10168187
1055 Ga0207644_10279282
1056 Ga0207690_10022567
1057 Ga0207706_10002030
1058 Ga0207706_10319259
1059 Ga0207706_10787493
1060 Ga0207709_10113537
1061 Ga0207670_10107681
1062 Ga0207669_10374651
1063 Ga0207704_10166549
1064 Ga0207665_10010759
1065 Ga0207691_10257383
1066 Ga0207691_10306143
1067 Ga0207711_10335524
1068 Ga0207689_10002561
1069 Ga0207661_10003605
1070 Ga0207661_10341802
1071 Ga0207661_10752309
1072 Ga0207661_10862702
1073 Ga0207679_10027364
1074 Ga0207651_10155181
1075 Ga0207651_10637544
1076 Ga0207712_10052097
1077 Ga0207712_10086150
1078 Ga0207712_10253152
1079 Ga0207668_10030887
1080 Ga0207668_10561855
1081 Ga0207677_10080555
1082 Ga0207703_10122966
1083 Ga0207678_10001737
1084 Ga0207708_10068135
1085 Ga0207702_10015128
1086 Ga0207702_10064100
1087 Ga0207641_10114791
1088 Ga0207648_10125715
1089 Ga0207676_10044335
1090 Ga0207676_10052179
1091 Ga0207674_10060591
1092 Ga0207675_100004231
1093 Ga0207683_10002124
1094 Ga0207683_10128216
1095 Ga0207683_10176297
1096 Ga0207698_10338575
1097 Ga0207428_10000192
1098 Ga0207428_10003066
1099 Ga0207428_10039383
1100 Ga0268266_10090568
1101 Ga0268266_10110306
1102 Ga0268266_10121987
1103 Ga0268266_10147970
1104 Ga0268265_10629025
1105 Ga0268264_10065859
1106 Ga0268264_10475177
1107 Ga0307515_10064385
1108 Ga0307515_10381511
1109 Ga0307512_10082388
1110 Ga0316183_1185493
1111 Ga0265762_1043830
1112 Ga0265340_10000226
1113 Ga0307408_100016488
1114 Ga0307408_100024652
1115 Ga0307408_100112800
1116 Ga0307408_100586887
1117 Ga0307408_101064593
1118 Ga0307508_10000914
1119 Ga0316579_10000110
1120 Ga0316576_10019312
1121 Ga0307405_10002805
1122 Ga0307405_10004672
1123 Ga0307405_10023208
1124 Ga0307405_10121596
1125 Ga0307405_10136483
1126 Ga0307405_10218045
1127 Ga0307405_10282315
1128 Ga0307405_10514172
1129 Ga0307413_10007557
1130 Ga0307413_10007988
1131 Ga0307413_10037549
1132 Ga0307413_10044433
1133 Ga0307413_10105336
1134 Ga0307413_10163490
1135 Ga0307413_10226679
1136 Ga0307413_10231509
1137 Ga0307410_10001251
1138 Ga0307410_10003671
1139 Ga0307410_10006519
1140 Ga0307410_10041085
1141 Ga0307410_10060205
1142 Ga0307410_10109425
1143 Ga0307410_10132554
1144 Ga0307410_10183540
1145 Ga0307410_10288902
1146 Ga0307410_10506148
1147 Ga0307406_10000617
1148 Ga0307406_10005535
1149 Ga0307406_10021080
1150 Ga0307406_10028515
1151 Ga0307406_10088959
1152 Ga0307406_10117356
1153 Ga0307406_10182001
1154 Ga0307406_10208996
1155 Ga0307407_10001836
1156 Ga0307407_10007595
1157 Ga0307407_10019448
1158 Ga0307407_10054063
1159 Ga0307407_10072432
1160 Ga0307407_10086008
1161 Ga0307407_10086859
1162 Ga0307407_10116964
1163 Ga0307407_10443780
1164 Ga0307407_10682969
1165 Ga0307412_10046828
1166 Ga0307412_10051314
1167 Ga0307412_10077101
1168 Ga0307412_10320869
1169 Ga0307412_10399613
1170 Ga0307412_10540305
1171 Ga0307412_10631080
1172 Ga0307409_100000008
1173 Ga0307409_100000609
1174 Ga0307409_100002865
1175 Ga0307409_100017461
1176 Ga0307409_100036723
1177 Ga0307409_100077757
1178 Ga0307409_100083244
1179 Ga0307409_100178878
1180 Ga0307409_100208709
1181 Ga0307409_100243958
1182 Ga0307409_100372170
1183 Ga0307409_100487924
1184 Ga0307409_101141439
1185 Ga0307409_101421467
1186 Ga0307416_100000067
1187 Ga0307416_100000596
1188 Ga0307416_100000807
1189 Ga0307416_100007607
1190 Ga0307416_100019412
1191 Ga0307416_100029167
1192 Ga0307416_100034866
1193 Ga0307416_100035439
1194 Ga0307416_100035751
1195 Ga0307416_100058640
1196 Ga0307416_100224327
1197 Ga0307416_100231559
1198 Ga0307416_100911210
1199 Ga0307416_100969607
1200 Ga0307416_101221331
1201 Ga0307414_10009121
1202 Ga0307414_10013107
1203 Ga0307414_10021223
1204 Ga0307414_10587398
1205 Ga0307411_10002425
1206 Ga0307411_10295621
1207 Ga0307415_100000595
1208 Ga0307415_100001584
1209 Ga0307415_100002919
1210 Ga0307415_100012058
1211 Ga0307415_100021703
1212 Ga0307415_100023592
1213 Ga0307415_100044508
1214 Ga0307415_100053090
1215 Ga0307415_100176812
1216 Ga0307415_100325498
1217 Ga0307415_100403652
1218 Ga0307415_100456627
1219 Ga0307415_100478705
1220 Ga0307415_100491049
1221 Ga0307415_100785771
1222 Ga0307507_10042802
1223 Ga0373951_0000188
1224 Ga0373932_0134418
1225 Ga0316574_0602080
1226 Ga0373933_0378891
1227 Ga0373937_0606708
1228 Ga0373925_0380670
1229 Ga0395899_0094370
1230 Ga0395900_0093886
1231 Ga0395900_0420981
1232 Ga0395900_0781541
1233 Ga0395898_0165046
1234 Ga0395898_0176331
1235 Ga0395898_0684140
1236 Ga0395898_1159096
1237 Ga0395905_0312723
1238 Ga0395905_0353429
1239 Ga0436364_0384449
1240 Ga0436364_0758705
1241 Ga0436364_1292600
1242 Ga0395901_0003711
1243 Ga0395901_0019646
1244 Ga0395901_0031689
1245 Ga0395901_0095165
1246 Ga0395901_0113542
1247 Ga0395901_0170926
1248 Ga0395901_0232926
1249 Ga0395901_0448567
1250 Ga0395901_0498749
1251 Ga0395901_0524712
1252 Ga0436365_0058408
1253 Ga0436365_0724282
1254 Ga0436365_0826211
1255 Ga0436365_0875967
1256 Ga0436365_1431448
1257 Ga0436363_1302349
1258 Ga0436362_0519821
1259 Ga0451835_0624321
1260 Ga0451853_0067848
1261 Ga0451853_1189754
1262 Ga0451853_2772895
1263 Ga0439448_0002004
1264 Ga0439448_0003942
1265 Ga0439448_0027022
1266 Ga0439448_0038493
1267 Ga0439448_0186583
1268 Ga0439450_000310
1269 Ga0439450_009108
1270 Ga0439450_043473
1271 Ga0439451_030547
1272 Ga0439454_000876
1273 Ga0439454_002270
1274 Ga0439455_0000387
1275 Ga0439455_0169584
1276 Ga0439463_001580
1277 Ga0439463_002640
1278 Ga0439463_020673
1279 Ga0439463_022222
1280 Ga0439463_050769
1281 Ga0439463_065001
1282 Ga0450888_003444
1283 Ga0450904_005768
1284 Ga0450889_016418
1285 Ga0439458_0006683
1286 Ga0439444_0001766
1287 Ga0439444_0005031
1288 Ga0439459_0091311
1289 Ga0439464_0001945
1290 Ga0439464_0017764
1291 Ga0439464_0068679
1292 Ga0439460_0000466
1293 Ga0439460_0014365
1294 Ga0450916_005821
1295 Ga0450893_0053627
1296 Ga0439440_0000208
1297 Ga0439440_0002002
1298 Ga0439440_0032229
1299 Ga0439440_0107521
1300 Ga0466965_0252139
1301 Ga0466965_0468127
1302 Ga0466966_0009231
1303 Ga0466966_0164503
1304 Ga0466961_0132072
1305 Ga0466961_0401127
1306 Ga0466963_0154060
1307 Ga0466963_0201167
1308 Ga0466964_0464495
1309 Ga0466957_0125362
1310 Ga0466957_0174330
1311 Ga0466960_0004962
1312 Ga0466960_0086584
1313 Ga0466960_0180744
1314 Ga0466960_0250516
1315 Ga0466959_0041128
1316 Ga0466959_0308572
1317 Ga0466958_0012869
1318 Ga0466958_0047154
1319 Ga0466967_0011786
1320 Ga0466967_0055934
1321 Ga0466967_0132876
1322 Ga0466967_1296467
1323 Ga0466967_1754352
1324 Ga0495629_0606106
1325 Ga0495653_0471234
1326 Ga0495582_0111858
1327 Ga0495582_0183369
1328 Ga0495607_0341212
1329 Ga0495630_0927813
1330 Ga0495631_0172280
1331 Ga0495644_0108876
1332 Ga0495645_0191759
1333 Ga0495667_0177744
1334 Ga0495656_0094804
1335 Ga0495656_0517515
1336 Ga0495668_0395023
1337 Ga0495661_0129154
1338 Ga0495599_0073442
1339 Ga0495658_0242271
1340 Ga0495670_0100113
1341 Ga0495649_0388024
1342 Ga0495581_0390071
1343 Ga0495680_0199740
1344 Ga0495680_0280417
1345 Ga0495680_0297496
1346 Ga0495602_0409147
1347 Ga0495615_0096491
1348 Ga0496100_0009391
1349 Ga0496100_0016105
1350 Ga0496100_0768608
1351 Ga0496101_0051017
1352 Ga0496101_0135461
1353 Ga0496101_0195696
1354 Ga0496102_0004221
1355 Ga0496102_0068027
1356 Ga0496103_0061786
1357 Ga0496103_0098206
1358 Ga0496103_0117434
1359 Ga0496104_0058820
1360 Ga0496104_0102136
1361 Ga0496104_0145088
1362 Ga0496104_0226429
1363 Ga0496104_0314010
1364 Ga0496105_0007851
1365 Ga0496105_0170638
1366 Ga0496105_0401428
1367 Ga0496105_0900900
1368 Ga0496107_0077221
1369 Ga0496107_0235556
1370 Ga0496107_0296565
1371 Ga0496108_0046048
1372 Ga0496108_0205627
1373 Ga0496108_0388139
1374 Ga0496108_0912101
1375 Ga0496109_0061817
1376 Ga0496109_0259647
1377 Ga0496109_0378745
1378 Ga0496109_0599635
1379 Ga0496109_0736481
1380 Ga0496110_0001739
1381 Ga0496110_0115191
1382 Ga0496111_0001057
1383 Ga0496111_0081993
1384 Ga0496111_0168418
1385 Ga0496111_0204014
1386 Ga0496112_0055005
1387 Ga0496112_0123007
1388 Ga0496112_0163555
1389 Ga0496112_0512159
1390 Ga0496113_0020315
1391 Ga0496113_0049651
1392 Ga0496113_0059339
1393 Ga0496113_0104899
1394 Ga0496113_0326843
1395 Ga0496114_0009405
1396 Ga0496114_0027223
1397 Ga0496114_0034871
1398 Ga0496114_0177933
1399 Ga0496114_0197158
1400 Ga0496114_0411356
1401 Ga0496114_0468697
1402 Ga0496114_0551005
1403 Ga0496115_0197016
1404 Ga0496115_0312494
1405 Ga0496115_0369900
1406 Ga0496115_0773135
1407 Ga0496126_0103916
1408 Ga0496126_0301451
1409 Ga0501031_0000971
1410 Ga0501031_0027737
1411 Ga0501032_0028299
1412 Ga0501033_0010886
1413 Ga0501034_0151117
1414 Ga0501036_0000074
1415 Ga0501036_0005783
1416 Ga0501037_0006264
1417 Ga0501037_0006974
1418 Ga0501038_0000316
1419 Ga0501038_0018014
1420 Ga0501039_0000190
1421 Ga0501039_0000222
1422 Ga0501040_0000140
1423 Ga0501040_0000424
1424 Ga0501041_0000572
1425 Ga0501041_0003210
1426 Ga0501042_0000173
1427 Ga0501042_0006390
1428 Ga0501042_0570013
1429 Ga0501043_0018290
1430 Ga0501046_0001292
1431 Ga0501046_0002551
1432 Ga0501047_0319488
1433 Ga0501048_0000155
1434 Ga0501048_0000590
1435 Ga0501067_0007531
1436 Ga0501067_0208044
1437 Ga0501068_0205298
1438 Ga0501068_0260946
1439 Ga0501071_0000461
1440 Ga0501072_0000867
1441 Ga0501072_0037552
1442 Ga0501074_0012882
1443 Ga0501074_0027872
1444 Ga0501075_0000552
1445 Ga0501075_0002120
1446 Ga0501076_0000408
1447 Ga0501076_0003045
1448 Ga0501076_0740653
1449 Ga0501077_0000353
1450 Ga0501077_0037932
1451 Ga0501221_101210
1452 Ga0501079_0000271
1453 Ga0501079_0002637
1454 Ga0501080_0003696
1455 Ga0501081_0000803
1456 Ga0501081_0004997
1457 Ga0501083_0045507
1458 Ga0501083_0342934
1459 Ga0501035_0007317
1460 Ga0501035_0230306
1461 Ga0501044_0004123
1462 Ga0501044_0461894
1463 Ga0501045_0000168
1464 Ga0501045_0001679
1465 nmdc:mga05p37_178620_c1
1466 nmdc:mga05p37_179161_c1
1467 nmdc:mga05p37_210928_c1
1468 nmdc:mga05p37_29020_c1
1469 nmdc:mga05p37_465535_c1
1470 nmdc:mga09592_17209_c1
1471 nmdc:mga09592_655607_c1
1472 nmdc:mga0qj67_15709_c1
1473 nmdc:mga06r32_466623_c1
1474 nmdc:mga06r32_5300_c1
1475 nmdc:mga06r32_74209_c1
1476 nmdc:mga08y16_129_c1
1477 nmdc:mga08y16_181103_c1
1478 nmdc:mga08y16_319389_c1
1479 nmdc:mga08y16_4512_c1
1480 nmdc:mga08y16_9435_c1
1481 nmdc:mga0n895_172863_c1
1482 nmdc:mga0n895_33795_c1
1483 nmdc:mga0n895_4980_c1
1484 nmdc:mga0n895_549619_c1
1485 nmdc:mga0n895_74471_c1
1486 nmdc:mga0n895_771723_c1
1487 nmdc:mga0n895_91151_c1
1488 nmdc:mga0rr50_347475_c1
1489 nmdc:mga0rr50_5833_c1
1490 nmdc:mga08x19_11094_c1
1491 nmdc:mga08x19_4888_c1
1492 nmdc:mga08x19_666451_c1
1493 nmdc:mga0a205_108685_c1
1494 nmdc:mga0a205_152006_c1
1495 nmdc:mga0a205_193415_c1
1496 nmdc:mga0a205_4905_c1
1497 nmdc:mga0a205_72409_c1
1498 nmdc:mga0a205_86_c1
1499 Ga0495619_0038911
1500 Ga0495619_0143563
1501 Ga0495619_0224505
1502 Ga0495619_0231434
1503 Ga0500646_0001191
1504 Ga0500641_0156983
1505 Ga0500594_0022229
1506 Ga0500588_0021256
1507 Ga0501084_0002121
1508 Ga0501084_0002913
1509 Ga0590074_004826
1510 Ga0590075_002459
1511 Ga0590077_001665
1512 Ga0590077_007514
1513 Ga0590077_011388
1514 Ga0501082_0000435
1515 Ga0501082_0001424
1516 Ga0501082_1060343
1517 Ga0530510_0000096
1518 2643850416
1519 2644134174
1520 2644444937
1521 2774396016
1522 2809197679
1523 2812347851
1524 2812374695
1525 2816426558
1526 2819427290
1527 2819693153
1528 2819730207
1529 2891968753
1530 2919449997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

7

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.8962 2 195
3to0-assembly1.cif.gz_A crystal structure of mus musculus iodotyrosine deiodinase (iyd) c217a, c239a bound to fmn 0.8952 2 195
3h4o-assembly1.cif.gz_A crystal structure of a nitroreductase family protein (cd3355) from clostridium difficile 630 at 1.50 a resolution 0.8633 1 198
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.8586 1 198
3h4o-assembly1.cif.gz_A crystal structure of a nitroreductase family protein (cd3355) from clostridium difficile 630 at 1.50 a resolution 0.8586 1 198
ID Description Score Start End Superfamily
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8962 2 195 3.40.109.10
3h4oA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8541 6 198 3.40.109.10
3ge5B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8447 7 198 3.40.109.10
3qdlD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8443 4 195 3.40.109.10
3m5kB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8415 1 198 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A4Y9N302-F1-model_v4 Nitroreductase family protein 0.9867 1 174 GO:0016491
AF-A0A4Y9N302-F1-model_v4 Nitroreductase family protein 0.9812 1 174 GO:0016491
AF-A0A2W4LIZ4-F1-model_v4 Nitroreductase 0.9719 1 198 GO:0016491
AF-A0A7W1GPE8-F1-model_v4 Nitroreductase family protein 0.9712 1 198 GO:0016491
AF-A0A846M1Q3-F1-model_v4 Nitroreductase 0.971 1 198 GO:0016491

Map