F479783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 253 | 1530 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10674374|Ga0105241_106743742 |
| Length | 217 |
| Sequence | MSLYWRWRAPTVARQLSFLSRHFPQLGEDDFMSAAQIYTHASTTNGERLHRPVLVLNSSFEPINVCAARRALVLVLKGVAAAEEHSVGHVHSARSAIKVPSVIRLLEYRRIPHQTRALSRKNILMRDRYTCQYCMKTMSSGDLTLDHVMPRSRKGETTWENLVACCHPCNNRKGSRTPEEANMRLARAPRPFSLHTSRHLMRLLGKSDDQWRKYLFY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 163 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 243 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 244 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 1.31 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10674374 | 3300009174 | Bacteria | 941 |
| 2 | Ga0058863_10055835 | 3300004799 | Bacteria | 2389 |
| 3 | Ga0058861_10170871 | 3300004800 | Bacteria | 1995 |
| 4 | Ga0058862_10277535 | 3300004803 | Bacteria | 981 |
| 5 | Ga0070658_10011004 | 3300005327 | Bacteria | 7252 |
| 6 | Ga0070658_10086655 | 3300005327 | Bacteria | 2576 |
| 7 | Ga0070658_10145716 | 3300005327 | Bacteria | 1980 |
| 8 | Ga0070683_100003970 | 3300005329 | Bacteria | 12112 |
| 9 | Ga0070683_100060076 | 3300005329 | Bacteria | 3532 |
| 10 | Ga0070683_100156038 | 3300005329 | Bacteria | 2165 |
| 11 | Ga0070683_100200935 | 3300005329 | Bacteria | 1893 |
| 12 | Ga0070683_100206871 | 3300005329 | Bacteria | 1864 |
| 13 | Ga0070690_100095957 | 3300005330 | Bacteria | 1959 |
| 14 | Ga0070670_100431481 | 3300005331 | Bacteria | 1166 |
| 15 | Ga0068869_100221306 | 3300005334 | Bacteria | 1500 |
| 16 | Ga0070666_10002074 | 3300005335 | Bacteria | 12170 |
| 17 | Ga0070680_100004371 | 3300005336 | Bacteria | 10632 |
| 18 | Ga0070680_100007756 | 3300005336 | Bacteria | 8182 |
| 19 | Ga0070680_100084736 | 3300005336 | Bacteria | 2618 |
| 20 | Ga0070680_100606093 | 3300005336 | Unclassified | 940 |
| 21 | Ga0070680_100727432 | 3300005336 | Unclassified | 854 |
| 22 | Ga0070682_100438668 | 3300005337 | Bacteria | 997 |
| 23 | Ga0068868_100067563 | 3300005338 | Bacteria | 2845 |
| 24 | Ga0068868_100089529 | 3300005338 | Bacteria | 2478 |
| 25 | Ga0068868_100589972 | 3300005338 | Bacteria | 983 |
| 26 | Ga0070660_100149958 | 3300005339 | Bacteria | 1874 |
| 27 | Ga0070660_100373813 | 3300005339 | Bacteria | 1176 |
| 28 | Ga0070689_100216629 | 3300005340 | Bacteria | 1569 |
| 29 | Ga0070691_10003186 | 3300005341 | Bacteria | 7351 |
| 30 | Ga0070687_100746379 | 3300005343 | Bacteria | 688 |
| 31 | Ga0070661_100045220 | 3300005344 | Bacteria | 3218 |
| 32 | Ga0070692_10604816 | 3300005345 | Unclassified | 726 |
| 33 | Ga0070692_10664794 | 3300005345 | Unclassified | 697 |
| 34 | Ga0070671_100041594 | 3300005355 | Bacteria | 3820 |
| 35 | Ga0070671_100188257 | 3300005355 | Bacteria | 1749 |
| 36 | Ga0070673_100064763 | 3300005364 | Bacteria | 2913 |
| 37 | Ga0070688_100898971 | 3300005365 | Bacteria | 698 |
| 38 | Ga0070659_100070829 | 3300005366 | Unclassified | 2771 |
| 39 | Ga0070667_100228103 | 3300005367 | Bacteria | 1660 |
| 40 | Ga0070667_100295727 | 3300005367 | Bacteria | 1457 |
| 41 | Ga0070714_100029297 | 3300005435 | Bacteria | 4577 |
| 42 | Ga0070714_100163108 | 3300005435 | Bacteria | 2018 |
| 43 | Ga0070714_100385129 | 3300005435 | Bacteria | 1323 |
| 44 | Ga0070714_101008855 | 3300005435 | Bacteria | 810 |
| 45 | Ga0070713_100001832 | 3300005436 | Bacteria | 13720 |
| 46 | Ga0070713_100107197 | 3300005436 | Unclassified | 2430 |
| 47 | Ga0070713_100146163 | 3300005436 | Bacteria | 2099 |
| 48 | Ga0070713_100277271 | 3300005436 | Unclassified | 1537 |
| 49 | Ga0070713_100329021 | 3300005436 | Bacteria | 1413 |
| 50 | Ga0070713_100349892 | 3300005436 | Bacteria | 1371 |
| 51 | Ga0070711_100004301 | 3300005439 | Bacteria | 8385 |
| 52 | Ga0070711_100073460 | 3300005439 | Bacteria | 2416 |
| 53 | Ga0070711_100238174 | 3300005439 | Bacteria | 1422 |
| 54 | Ga0070711_100559380 | 3300005439 | Bacteria | 950 |
| 55 | Ga0070705_100522251 | 3300005440 | Bacteria | 905 |
| 56 | Ga0070694_100080231 | 3300005444 | Bacteria | 2267 |
| 57 | Ga0070694_100548032 | 3300005444 | Bacteria | 926 |
| 58 | Ga0070708_100343449 | 3300005445 | Bacteria | 1407 |
| 59 | Ga0070678_100748586 | 3300005456 | Unclassified | 884 |
| 60 | Ga0070678_101058232 | 3300005456 | Bacteria | 748 |
| 61 | Ga0070678_101748839 | 3300005456 | Unclassified | 586 |
| 62 | Ga0070662_100258981 | 3300005457 | Bacteria | 1401 |
| 63 | Ga0070662_100547027 | 3300005457 | Bacteria | 970 |
| 64 | Ga0070662_100908751 | 3300005457 | Unclassified | 751 |
| 65 | Ga0070681_10040816 | 3300005458 | Bacteria | 4648 |
| 66 | Ga0070681_10056361 | 3300005458 | Bacteria | 3911 |
| 67 | Ga0070681_10189740 | 3300005458 | Bacteria | 1975 |
| 68 | Ga0070681_10193593 | 3300005458 | Bacteria | 1953 |
| 69 | Ga0070681_10283542 | 3300005458 | Bacteria | 1567 |
| 70 | Ga0070681_10340837 | 3300005458 | Bacteria | 1409 |
| 71 | Ga0070681_10386525 | 3300005458 | Bacteria | 1310 |
| 72 | Ga0070681_10723419 | 3300005458 | Bacteria | 911 |
| 73 | Ga0068867_100018808 | 3300005459 | Bacteria | 4914 |
| 74 | Ga0068867_100059711 | 3300005459 | Bacteria | 2827 |
| 75 | Ga0068867_100210624 | 3300005459 | Bacteria | 1561 |
| 76 | Ga0068867_100358671 | 3300005459 | Bacteria | 1219 |
| 77 | Ga0068867_100874504 | 3300005459 | Unclassified | 807 |
| 78 | Ga0070685_10601786 | 3300005466 | Unclassified | 791 |
| 79 | Ga0070707_100947143 | 3300005468 | Unclassified | 826 |
| 80 | Ga0070679_100004603 | 3300005530 | Bacteria | 12733 |
| 81 | Ga0070679_100034993 | 3300005530 | Bacteria | 4981 |
| 82 | Ga0070679_100050498 | 3300005530 | Bacteria | 4143 |
| 83 | Ga0070679_100059639 | 3300005530 | Unclassified | 3803 |
| 84 | Ga0070679_100406386 | 3300005530 | Bacteria | 1307 |
| 85 | Ga0070679_100890068 | 3300005530 | Bacteria | 834 |
| 86 | Ga0070684_100006622 | 3300005535 | Bacteria | 8973 |
| 87 | Ga0070684_100077168 | 3300005535 | Bacteria | 2942 |
| 88 | Ga0070684_100079422 | 3300005535 | Bacteria | 2900 |
| 89 | Ga0070684_100091797 | 3300005535 | Bacteria | 2702 |
| 90 | Ga0070684_100205767 | 3300005535 | Bacteria | 1793 |
| 91 | Ga0070684_100333998 | 3300005535 | Unclassified | 1393 |
| 92 | Ga0070684_100343205 | 3300005535 | Bacteria | 1373 |
| 93 | Ga0070684_100457052 | 3300005535 | Bacteria | 1181 |
| 94 | Ga0070684_100842975 | 3300005535 | Bacteria | 858 |
| 95 | Ga0070684_101698582 | 3300005535 | Unclassified | 596 |
| 96 | Ga0070697_100106128 | 3300005536 | Bacteria | 2337 |
| 97 | Ga0068853_100021237 | 3300005539 | Bacteria | 5409 |
| 98 | Ga0068853_100025646 | 3300005539 | Bacteria | 4947 |
| 99 | Ga0068853_100118462 | 3300005539 | Bacteria | 2360 |
| 100 | Ga0068853_100221284 | 3300005539 | Bacteria | 1729 |
| 101 | Ga0068853_100597237 | 3300005539 | Bacteria | 1048 |
| 102 | Ga0070686_100290608 | 3300005544 | Bacteria | 1209 |
| 103 | Ga0070686_100580061 | 3300005544 | Unclassified | 881 |
| 104 | Ga0070695_100143724 | 3300005545 | Bacteria | 1657 |
| 105 | Ga0070695_100284577 | 3300005545 | Bacteria | 1216 |
| 106 | Ga0070695_100787441 | 3300005545 | Unclassified | 761 |
| 107 | Ga0070696_101173192 | 3300005546 | Unclassified | 648 |
| 108 | Ga0070693_100244017 | 3300005547 | Unclassified | 1188 |
| 109 | Ga0070693_100273370 | 3300005547 | Bacteria | 1129 |
| 110 | Ga0070665_100041606 | 3300005548 | Bacteria | 4620 |
| 111 | Ga0070665_100079556 | 3300005548 | Bacteria | 3284 |
| 112 | Ga0070665_100665222 | 3300005548 | Bacteria | 1054 |
| 113 | Ga0070665_101171180 | 3300005548 | Bacteria | 780 |
| 114 | Ga0070665_102202673 | 3300005548 | Bacteria | 555 |
| 115 | Ga0070704_100853788 | 3300005549 | Bacteria | 816 |
| 116 | Ga0068855_100003950 | 3300005563 | Bacteria | 18100 |
| 117 | Ga0068855_100008856 | 3300005563 | Bacteria | 12166 |
| 118 | Ga0068855_100033651 | 3300005563 | Bacteria | 6115 |
| 119 | Ga0068855_100100143 | 3300005563 | Bacteria | 3337 |
| 120 | Ga0068855_100113906 | 3300005563 | Bacteria | 3101 |
| 121 | Ga0068855_100167415 | 3300005563 | Bacteria | 2491 |
| 122 | Ga0068855_100321127 | 3300005563 | Bacteria | 1711 |
| 123 | Ga0068855_100452613 | 3300005563 | Unclassified | 1400 |
| 124 | Ga0068855_100880874 | 3300005563 | Bacteria | 947 |
| 125 | Ga0070664_100024994 | 3300005564 | Bacteria | 4950 |
| 126 | Ga0070664_100137603 | 3300005564 | Bacteria | 2148 |
| 127 | Ga0070664_100140691 | 3300005564 | Bacteria | 2125 |
| 128 | Ga0068857_100007886 | 3300005577 | Bacteria | 9185 |
| 129 | Ga0068857_100026970 | 3300005577 | Bacteria | 5067 |
| 130 | Ga0068857_100047994 | 3300005577 | Bacteria | 3791 |
| 131 | Ga0068857_100167934 | 3300005577 | Unclassified | 1993 |
| 132 | Ga0068856_100001598 | 3300005614 | Bacteria | 23676 |
| 133 | Ga0068856_100001644 | 3300005614 | Bacteria | 23431 |
| 134 | Ga0068856_100004643 | 3300005614 | Bacteria | 13644 |
| 135 | Ga0068856_100011439 | 3300005614 | Bacteria | 8610 |
| 136 | Ga0068856_100050979 | 3300005614 | Bacteria | 4081 |
| 137 | Ga0068856_100162700 | 3300005614 | Bacteria | 2243 |
| 138 | Ga0068856_100247607 | 3300005614 | Bacteria | 1797 |
| 139 | Ga0068856_100334776 | 3300005614 | Bacteria | 1531 |
| 140 | Ga0070702_100804184 | 3300005615 | Unclassified | 727 |
| 141 | Ga0068852_100006920 | 3300005616 | Bacteria | 8247 |
| 142 | Ga0068852_100015096 | 3300005616 | Bacteria | 5976 |
| 143 | Ga0068852_100020042 | 3300005616 | Bacteria | 5311 |
| 144 | Ga0068852_100218597 | 3300005616 | Bacteria | 1811 |
| 145 | Ga0068852_100344335 | 3300005616 | Bacteria | 1454 |
| 146 | Ga0068852_101086638 | 3300005616 | Unclassified | 820 |
| 147 | Ga0068859_100026188 | 3300005617 | Bacteria | 5850 |
| 148 | Ga0068859_100068866 | 3300005617 | Bacteria | 3573 |
| 149 | Ga0068859_100265476 | 3300005617 | Bacteria | 1808 |
| 150 | Ga0068859_100722760 | 3300005617 | Bacteria | 1086 |
| 151 | Ga0068859_100793224 | 3300005617 | Unclassified | 1035 |
| 152 | Ga0068864_100292559 | 3300005618 | Bacteria | 1523 |
| 153 | Ga0068861_100057971 | 3300005719 | Unclassified | 2959 |
| 154 | Ga0068870_10079181 | 3300005840 | Bacteria | 1812 |
| 155 | Ga0068863_100024305 | 3300005841 | Bacteria | 5779 |
| 156 | Ga0068863_100063568 | 3300005841 | Bacteria | 3491 |
| 157 | Ga0068863_100107998 | 3300005841 | Bacteria | 2649 |
| 158 | Ga0068863_100654497 | 3300005841 | Bacteria | 1042 |
| 159 | Ga0068863_101710286 | 3300005841 | Bacteria | 639 |
| 160 | Ga0068858_100075905 | 3300005842 | Bacteria | 3122 |
| 161 | Ga0068858_100149192 | 3300005842 | Bacteria | 2197 |
| 162 | Ga0068858_100234318 | 3300005842 | Bacteria | 1741 |
| 163 | Ga0068858_100317893 | 3300005842 | Bacteria | 1487 |
| 164 | Ga0068860_100401030 | 3300005843 | Bacteria | 1357 |
| 165 | Ga0068860_100541225 | 3300005843 | Bacteria | 1166 |
| 166 | Ga0068860_100924687 | 3300005843 | Bacteria | 889 |
| 167 | Ga0070717_10005593 | 3300006028 | Bacteria | 9175 |
| 168 | Ga0070717_10184516 | 3300006028 | Unclassified | 1820 |
| 169 | Ga0070715_10293715 | 3300006163 | Bacteria | 867 |
| 170 | Ga0070712_100071867 | 3300006175 | Bacteria | 2477 |
| 171 | Ga0070712_100395022 | 3300006175 | Bacteria | 1141 |
| 172 | Ga0097621_100014410 | 3300006237 | Bacteria | 5916 |
| 173 | Ga0097621_100016164 | 3300006237 | Bacteria | 5634 |
| 174 | Ga0097621_100026708 | 3300006237 | Bacteria | 4532 |
| 175 | Ga0097621_100037955 | 3300006237 | Bacteria | 3864 |
| 176 | Ga0097621_100184552 | 3300006237 | Bacteria | 1804 |
| 177 | Ga0097621_100198941 | 3300006237 | Bacteria | 1739 |
| 178 | Ga0097621_100389035 | 3300006237 | Unclassified | 1247 |
| 179 | Ga0097621_100824273 | 3300006237 | Bacteria | 861 |
| 180 | Ga0097621_101049005 | 3300006237 | Bacteria | 764 |
| 181 | Ga0097621_101223130 | 3300006237 | Bacteria | 708 |
| 182 | Ga0068871_100020605 | 3300006358 | Bacteria | 5054 |
| 183 | Ga0068871_100085841 | 3300006358 | Unclassified | 2614 |
| 184 | Ga0068871_100200435 | 3300006358 | Bacteria | 1723 |
| 185 | Ga0068871_100220556 | 3300006358 | Bacteria | 1643 |
| 186 | Ga0068871_100286774 | 3300006358 | Bacteria | 1442 |
| 187 | Ga0068871_100364807 | 3300006358 | Bacteria | 1280 |
| 188 | Ga0068871_100381380 | 3300006358 | Unclassified | 1252 |
| 189 | Ga0068871_100587220 | 3300006358 | Bacteria | 1012 |
| 190 | Ga0075430_100065444 | 3300006846 | Bacteria | 3054 |
| 191 | Ga0075430_100070082 | 3300006846 | Bacteria | 2941 |
| 192 | Ga0075430_100691407 | 3300006846 | Bacteria | 841 |
| 193 | Ga0075431_100052832 | 3300006847 | Unclassified | 4189 |
| 194 | Ga0075431_100071695 | 3300006847 | Bacteria | 3575 |
| 195 | Ga0075431_100379014 | 3300006847 | Bacteria | 1419 |
| 196 | Ga0075434_100730743 | 3300006871 | Bacteria | 1007 |
| 197 | Ga0075429_100145662 | 3300006880 | Bacteria | 2073 |
| 198 | Ga0075429_100714923 | 3300006880 | Bacteria | 877 |
| 199 | Ga0075429_101102806 | 3300006880 | Unclassified | 693 |
| 200 | Ga0068865_100055118 | 3300006881 | Bacteria | 2765 |
| 201 | Ga0068865_100333085 | 3300006881 | Unclassified | 1224 |
| 202 | Ga0075436_100000433 | 3300006914 | Bacteria | 26867 |
| 203 | Ga0075436_100000610 | 3300006914 | Bacteria | 23409 |
| 204 | Ga0075436_100740348 | 3300006914 | Unclassified | 730 |
| 205 | Ga0097620_100026188 | 3300006931 | Bacteria | 5850 |
| 206 | Ga0097620_100068868 | 3300006931 | Bacteria | 3573 |
| 207 | Ga0097620_100265476 | 3300006931 | Bacteria | 1808 |
| 208 | Ga0097620_100722757 | 3300006931 | Bacteria | 1086 |
| 209 | Ga0097620_100793309 | 3300006931 | Unclassified | 1035 |
| 210 | Ga0075435_100416547 | 3300007076 | Bacteria | 1157 |
| 211 | Ga0075435_101155071 | 3300007076 | Bacteria | 677 |
| 212 | Ga0105240_10000349 | 3300009093 | Bacteria | 86505 |
| 213 | Ga0105240_10001515 | 3300009093 | Bacteria | 39538 |
| 214 | Ga0105240_10002790 | 3300009093 | Bacteria | 27622 |
| 215 | Ga0105240_10006796 | 3300009093 | Bacteria | 16736 |
| 216 | Ga0105240_10072107 | 3300009093 | Unclassified | 4269 |
| 217 | Ga0105240_10100225 | 3300009093 | Bacteria | 3525 |
| 218 | Ga0105240_10154719 | 3300009093 | Unclassified | 2728 |
| 219 | Ga0105240_10217670 | 3300009093 | Bacteria | 2227 |
| 220 | Ga0105240_10229613 | 3300009093 | Bacteria | 2158 |
| 221 | Ga0105240_10340313 | 3300009093 | Bacteria | 1704 |
| 222 | Ga0105240_10468019 | 3300009093 | Unclassified | 1407 |
| 223 | Ga0105240_10552846 | 3300009093 | Unclassified | 1273 |
| 224 | Ga0105240_10559090 | 3300009093 | Bacteria | 1265 |
| 225 | Ga0105240_10635804 | 3300009093 | Bacteria | 1171 |
| 226 | Ga0105245_10005156 | 3300009098 | Bacteria | 11479 |
| 227 | Ga0105245_10008021 | 3300009098 | Bacteria | 9235 |
| 228 | Ga0105245_10010932 | 3300009098 | Bacteria | 7897 |
| 229 | Ga0105245_10058437 | 3300009098 | Bacteria | 3471 |
| 230 | Ga0105245_10087747 | 3300009098 | Bacteria | 2856 |
| 231 | Ga0105245_10104426 | 3300009098 | Bacteria | 2627 |
| 232 | Ga0105245_10169090 | 3300009098 | Bacteria | 2080 |
| 233 | Ga0105245_10213413 | 3300009098 | Bacteria | 1859 |
| 234 | Ga0105245_10781176 | 3300009098 | Bacteria | 992 |
| 235 | Ga0105245_10964719 | 3300009098 | Bacteria | 896 |
| 236 | Ga0105245_11057382 | 3300009098 | Unclassified | 857 |
| 237 | Ga0105245_11103576 | 3300009098 | Unclassified | 840 |
| 238 | Ga0114129_10200933 | 3300009147 | Bacteria | 2699 |
| 239 | Ga0114129_11210486 | 3300009147 | Unclassified | 940 |
| 240 | Ga0105243_10200729 | 3300009148 | Unclassified | 1749 |
| 241 | Ga0105243_10581625 | 3300009148 | Bacteria | 1075 |
| 242 | Ga0105243_10592581 | 3300009148 | Bacteria | 1066 |
| 243 | Ga0105241_10020683 | 3300009174 | Bacteria | 4862 |
| 244 | Ga0105241_10041193 | 3300009174 | Bacteria | 3489 |
| 245 | Ga0105241_10069983 | 3300009174 | Bacteria | 2721 |
| 246 | Ga0105241_10130027 | 3300009174 | Unclassified | 2037 |
| 247 | Ga0105241_10233603 | 3300009174 | Bacteria | 1551 |
| 248 | Ga0105241_11051554 | 3300009174 | Unclassified | 764 |
| 249 | Ga0105241_11175597 | 3300009174 | Unclassified | 725 |
| 250 | Ga0105241_11377655 | 3300009174 | Bacteria | 674 |
| 251 | Ga0105242_10011002 | 3300009176 | Bacteria | 6950 |
| 252 | Ga0105242_10020652 | 3300009176 | Bacteria | 5167 |
| 253 | Ga0105242_10078416 | 3300009176 | Bacteria | 2757 |
| 254 | Ga0105242_10095244 | 3300009176 | Bacteria | 2513 |
| 255 | Ga0105242_10096982 | 3300009176 | Bacteria | 2492 |
| 256 | Ga0105242_10275025 | 3300009176 | Bacteria | 1527 |
| 257 | Ga0105242_10499093 | 3300009176 | Bacteria | 1157 |
| 258 | Ga0105242_10630404 | 3300009176 | Bacteria | 1040 |
| 259 | Ga0105248_10037550 | 3300009177 | Bacteria | 5419 |
| 260 | Ga0105248_10075116 | 3300009177 | Bacteria | 3799 |
| 261 | Ga0105248_10126153 | 3300009177 | Bacteria | 2887 |
| 262 | Ga0105248_10299027 | 3300009177 | Bacteria | 1812 |
| 263 | Ga0105248_10765772 | 3300009177 | Bacteria | 1089 |
| 264 | Ga0105248_10833522 | 3300009177 | Bacteria | 1041 |
| 265 | Ga0105248_10931661 | 3300009177 | Bacteria | 981 |
| 266 | Ga0105248_10996406 | 3300009177 | Bacteria | 946 |
| 267 | Ga0105237_10053637 | 3300009545 | Bacteria | 4043 |
| 268 | Ga0105237_10073049 | 3300009545 | Bacteria | 3423 |
| 269 | Ga0105237_10103568 | 3300009545 | Bacteria | 2838 |
| 270 | Ga0105237_10105477 | 3300009545 | Bacteria | 2809 |
| 271 | Ga0105237_10209612 | 3300009545 | Bacteria | 1949 |
| 272 | Ga0105237_10275703 | 3300009545 | Bacteria | 1684 |
| 273 | Ga0105237_10339084 | 3300009545 | Unclassified | 1508 |
| 274 | Ga0105237_10382690 | 3300009545 | Bacteria | 1412 |
| 275 | Ga0105237_10764610 | 3300009545 | Unclassified | 973 |
| 276 | Ga0105238_10002354 | 3300009551 | Bacteria | 19010 |
| 277 | Ga0105238_10012086 | 3300009551 | Bacteria | 8701 |
| 278 | Ga0105238_10062533 | 3300009551 | Bacteria | 3723 |
| 279 | Ga0105238_10064021 | 3300009551 | Bacteria | 3678 |
| 280 | Ga0105238_10203759 | 3300009551 | Bacteria | 1954 |
| 281 | Ga0105238_10209366 | 3300009551 | Bacteria | 1926 |
| 282 | Ga0105238_10210433 | 3300009551 | Bacteria | 1921 |
| 283 | Ga0105238_10266133 | 3300009551 | Bacteria | 1694 |
| 284 | Ga0105238_10569373 | 3300009551 | Bacteria | 1138 |
| 285 | Ga0105238_11651757 | 3300009551 | Unclassified | 671 |
| 286 | Ga0105249_10072999 | 3300009553 | Bacteria | 3173 |
| 287 | Ga0105249_10885992 | 3300009553 | Bacteria | 959 |
| 288 | Ga0105249_10988568 | 3300009553 | Bacteria | 910 |
| 289 | Ga0105239_10016402 | 3300010375 | Bacteria | 8192 |
| 290 | Ga0105239_10050610 | 3300010375 | Bacteria | 4556 |
| 291 | Ga0105239_10064060 | 3300010375 | Bacteria | 4035 |
| 292 | Ga0105239_10104959 | 3300010375 | Bacteria | 3129 |
| 293 | Ga0105239_10267789 | 3300010375 | Unclassified | 1921 |
| 294 | Ga0105246_10012166 | 3300011119 | Bacteria | 5361 |
| 295 | Ga0105246_10021960 | 3300011119 | Bacteria | 4114 |
| 296 | Ga0105246_10127408 | 3300011119 | Bacteria | 1896 |
| 297 | Ga0105246_10168132 | 3300011119 | Bacteria | 1677 |
| 298 | Ga0105246_10197928 | 3300011119 | Unclassified | 1560 |
| 299 | Ga0157370_10001930 | 3300013104 | Bacteria | 25516 |
| 300 | Ga0157370_10005751 | 3300013104 | Bacteria | 13869 |
| 301 | Ga0157370_10039967 | 3300013104 | Bacteria | 4531 |
| 302 | Ga0157370_10058352 | 3300013104 | Bacteria | 3669 |
| 303 | Ga0157370_10180674 | 3300013104 | Bacteria | 1961 |
| 304 | Ga0157370_10421135 | 3300013104 | Bacteria | 1228 |
| 305 | Ga0157370_10422110 | 3300013104 | Bacteria | 1227 |
| 306 | Ga0157370_10669056 | 3300013104 | Unclassified | 948 |
| 307 | Ga0157369_10002355 | 3300013105 | Bacteria | 22728 |
| 308 | Ga0157369_10003128 | 3300013105 | Bacteria | 19781 |
| 309 | Ga0157369_10004900 | 3300013105 | Bacteria | 15699 |
| 310 | Ga0157369_10053159 | 3300013105 | Bacteria | 4379 |
| 311 | Ga0157369_10055113 | 3300013105 | Bacteria | 4292 |
| 312 | Ga0157369_10094341 | 3300013105 | Bacteria | 3194 |
| 313 | Ga0157369_10399913 | 3300013105 | Bacteria | 1425 |
| 314 | Ga0157369_10518765 | 3300013105 | Bacteria | 1233 |
| 315 | Ga0157369_11445447 | 3300013105 | Bacteria | 700 |
| 316 | Ga0157374_10007562 | 3300013296 | Bacteria | 9273 |
| 317 | Ga0157374_10019718 | 3300013296 | Bacteria | 5973 |
| 318 | Ga0157374_10050444 | 3300013296 | Bacteria | 3868 |
| 319 | Ga0157374_10103084 | 3300013296 | Bacteria | 2737 |
| 320 | Ga0157374_10184458 | 3300013296 | Bacteria | 2039 |
| 321 | Ga0157374_10266257 | 3300013296 | Bacteria | 1689 |
| 322 | Ga0157374_10301838 | 3300013296 | Bacteria | 1584 |
| 323 | Ga0157374_10312738 | 3300013296 | Bacteria | 1555 |
| 324 | Ga0157378_10004469 | 3300013297 | Bacteria | 12281 |
| 325 | Ga0157378_10044690 | 3300013297 | Bacteria | 3934 |
| 326 | Ga0157378_10085598 | 3300013297 | Bacteria | 2856 |
| 327 | Ga0157378_10127603 | 3300013297 | Unclassified | 2351 |
| 328 | Ga0157378_10254977 | 3300013297 | Unclassified | 1681 |
| 329 | Ga0157378_10293365 | 3300013297 | Unclassified | 1571 |
| 330 | Ga0157378_10663523 | 3300013297 | Bacteria | 1059 |
| 331 | Ga0163162_10034883 | 3300013306 | Bacteria | 5008 |
| 332 | Ga0163162_10159915 | 3300013306 | Bacteria | 2374 |
| 333 | Ga0163162_10288399 | 3300013306 | Bacteria | 1773 |
| 334 | Ga0163162_10438724 | 3300013306 | Unclassified | 1438 |
| 335 | Ga0163162_10547935 | 3300013306 | Bacteria | 1285 |
| 336 | Ga0157372_10006227 | 3300013307 | Bacteria | 12685 |
| 337 | Ga0157372_10013396 | 3300013307 | Bacteria | 8756 |
| 338 | Ga0157372_10020489 | 3300013307 | Bacteria | 7136 |
| 339 | Ga0157372_10042054 | 3300013307 | Bacteria | 5053 |
| 340 | Ga0157372_10102357 | 3300013307 | Bacteria | 3272 |
| 341 | Ga0157372_10140275 | 3300013307 | Bacteria | 2784 |
| 342 | Ga0157372_10863619 | 3300013307 | Bacteria | 1050 |
| 343 | Ga0157375_10460108 | 3300013308 | Bacteria | 1438 |
| 344 | Ga0157375_10522069 | 3300013308 | Bacteria | 1351 |
| 345 | Ga0157375_10762912 | 3300013308 | Bacteria | 1118 |
| 346 | Ga0163163_10013925 | 3300014325 | Bacteria | 7379 |
| 347 | Ga0163163_10032380 | 3300014325 | Bacteria | 5048 |
| 348 | Ga0163163_10073508 | 3300014325 | Unclassified | 3410 |
| 349 | Ga0163163_10086019 | 3300014325 | Bacteria | 3152 |
| 350 | Ga0163163_10149662 | 3300014325 | Bacteria | 2378 |
| 351 | Ga0163163_10198573 | 3300014325 | Bacteria | 2054 |
| 352 | Ga0163163_10286181 | 3300014325 | Unclassified | 1700 |
| 353 | Ga0157380_11558862 | 3300014326 | Unclassified | 715 |
| 354 | Ga0157379_10080358 | 3300014968 | Bacteria | 2920 |
| 355 | Ga0157379_10154880 | 3300014968 | Bacteria | 2067 |
| 356 | Ga0157379_10472029 | 3300014968 | Bacteria | 1160 |
| 357 | Ga0157379_11009331 | 3300014968 | Bacteria | 794 |
| 358 | Ga0157376_10070175 | 3300014969 | Bacteria | 2973 |
| 359 | Ga0157376_10089344 | 3300014969 | Bacteria | 2664 |
| 360 | Ga0157376_10600138 | 3300014969 | Bacteria | 1096 |
| 361 | Ga0157376_10780711 | 3300014969 | Bacteria | 967 |
| 362 | Ga0206354_10342106 | 3300020081 | Bacteria | 630 |
| 363 | Ga0213872_10000499 | 3300021361 | Bacteria | 31417 |
| 364 | Ga0213874_10002410 | 3300021377 | Bacteria | 4024 |
| 365 | Ga0213874_10040610 | 3300021377 | Bacteria | 1390 |
| 366 | Ga0213875_10000006 | 3300021388 | Bacteria | 579005 |
| 367 | Ga0213875_10001205 | 3300021388 | Bacteria | 17615 |
| 368 | Ga0213875_10007434 | 3300021388 | Bacteria | 5659 |
| 369 | Ga0213875_10011894 | 3300021388 | Bacteria | 4315 |
| 370 | Ga0213875_10034521 | 3300021388 | Bacteria | 2388 |
| 371 | Ga0213875_10135508 | 3300021388 | Bacteria | 1152 |
| 372 | Ga0213875_10157315 | 3300021388 | Bacteria | 1066 |
| 373 | Ga0224712_10019972 | 3300022467 | Unclassified | 2267 |
| 374 | Ga0207682_10315192 | 3300025893 | Unclassified | 734 |
| 375 | Ga0207692_10102166 | 3300025898 | Bacteria | 1576 |
| 376 | Ga0207680_10037048 | 3300025903 | Bacteria | 2813 |
| 377 | Ga0207680_10929485 | 3300025903 | Unclassified | 623 |
| 378 | Ga0207699_10007985 | 3300025906 | Bacteria | 5197 |
| 379 | Ga0207699_10323141 | 3300025906 | Unclassified | 1083 |
| 380 | Ga0207705_10247308 | 3300025909 | Bacteria | 1359 |
| 381 | Ga0207705_10368079 | 3300025909 | Unclassified | 1109 |
| 382 | Ga0207705_10645425 | 3300025909 | Unclassified | 823 |
| 383 | Ga0207654_10043017 | 3300025911 | Unclassified | 2558 |
| 384 | Ga0207654_10054089 | 3300025911 | Bacteria | 2319 |
| 385 | Ga0207654_10103046 | 3300025911 | Bacteria | 1761 |
| 386 | Ga0207654_10420462 | 3300025911 | Bacteria | 932 |
| 387 | Ga0207654_10514308 | 3300025911 | Unclassified | 847 |
| 388 | Ga0207707_10089526 | 3300025912 | Bacteria | 2690 |
| 389 | Ga0207707_10116084 | 3300025912 | Bacteria | 2339 |
| 390 | Ga0207707_10290157 | 3300025912 | Bacteria | 1415 |
| 391 | Ga0207707_10370002 | 3300025912 | Bacteria | 1233 |
| 392 | Ga0207707_10453000 | 3300025912 | Unclassified | 1098 |
| 393 | Ga0207707_10555091 | 3300025912 | Bacteria | 975 |
| 394 | Ga0207707_10701752 | 3300025912 | Unclassified | 849 |
| 395 | Ga0207695_10001613 | 3300025913 | Bacteria | 36581 |
| 396 | Ga0207695_10005025 | 3300025913 | Bacteria | 17763 |
| 397 | Ga0207695_10010155 | 3300025913 | Bacteria | 11552 |
| 398 | Ga0207695_10012905 | 3300025913 | Bacteria | 9998 |
| 399 | Ga0207695_10030330 | 3300025913 | Bacteria | 5954 |
| 400 | Ga0207695_10125235 | 3300025913 | Unclassified | 2533 |
| 401 | Ga0207695_10228318 | 3300025913 | Unclassified | 1767 |
| 402 | Ga0207695_10290866 | 3300025913 | Bacteria | 1526 |
| 403 | Ga0207695_10637301 | 3300025913 | Bacteria | 947 |
| 404 | Ga0207671_10009573 | 3300025914 | Bacteria | 8079 |
| 405 | Ga0207671_10091422 | 3300025914 | Bacteria | 2293 |
| 406 | Ga0207671_10146229 | 3300025914 | Bacteria | 1824 |
| 407 | Ga0207671_10176028 | 3300025914 | Bacteria | 1663 |
| 408 | Ga0207671_10312073 | 3300025914 | Bacteria | 1243 |
| 409 | Ga0207693_10488256 | 3300025915 | Bacteria | 962 |
| 410 | Ga0207663_10070662 | 3300025916 | Bacteria | 2250 |
| 411 | Ga0207663_10126872 | 3300025916 | Bacteria | 1756 |
| 412 | Ga0207660_10019312 | 3300025917 | Bacteria | 4554 |
| 413 | Ga0207660_10232574 | 3300025917 | Bacteria | 1450 |
| 414 | Ga0207662_10208959 | 3300025918 | Bacteria | 1266 |
| 415 | Ga0207657_10086368 | 3300025919 | Bacteria | 2626 |
| 416 | Ga0207657_10123370 | 3300025919 | Bacteria | 2129 |
| 417 | Ga0207657_10126212 | 3300025919 | Bacteria | 2101 |
| 418 | Ga0207657_10160796 | 3300025919 | Bacteria | 1824 |
| 419 | Ga0207649_10072938 | 3300025920 | Bacteria | 2198 |
| 420 | Ga0207649_10436673 | 3300025920 | Bacteria | 986 |
| 421 | Ga0207652_10234898 | 3300025921 | Bacteria | 1652 |
| 422 | Ga0207652_10492513 | 3300025921 | Bacteria | 1104 |
| 423 | Ga0207652_10823769 | 3300025921 | Unclassified | 823 |
| 424 | Ga0207652_11055082 | 3300025921 | Bacteria | 712 |
| 425 | Ga0207694_10002147 | 3300025924 | Bacteria | 16201 |
| 426 | Ga0207694_10006310 | 3300025924 | Bacteria | 9052 |
| 427 | Ga0207694_10010361 | 3300025924 | Bacteria | 7027 |
| 428 | Ga0207694_10049427 | 3300025924 | Bacteria | 3256 |
| 429 | Ga0207694_10057282 | 3300025924 | Bacteria | 3029 |
| 430 | Ga0207694_10064261 | 3300025924 | Unclassified | 2860 |
| 431 | Ga0207694_10244441 | 3300025924 | Bacteria | 1467 |
| 432 | Ga0207650_10614701 | 3300025925 | Unclassified | 914 |
| 433 | Ga0207687_10000181 | 3300025927 | Bacteria | 41696 |
| 434 | Ga0207687_10003605 | 3300025927 | Bacteria | 10423 |
| 435 | Ga0207687_10049914 | 3300025927 | Bacteria | 2911 |
| 436 | Ga0207687_10053378 | 3300025927 | Bacteria | 2824 |
| 437 | Ga0207687_10063500 | 3300025927 | Bacteria | 2615 |
| 438 | Ga0207687_10278717 | 3300025927 | Bacteria | 1339 |
| 439 | Ga0207687_10282308 | 3300025927 | Unclassified | 1331 |
| 440 | Ga0207687_10372949 | 3300025927 | Bacteria | 1167 |
| 441 | Ga0207687_10570774 | 3300025927 | Bacteria | 951 |
| 442 | Ga0207700_10001815 | 3300025928 | Bacteria | 12132 |
| 443 | Ga0207700_10221550 | 3300025928 | Bacteria | 1604 |
| 444 | Ga0207700_10242428 | 3300025928 | Unclassified | 1537 |
| 445 | Ga0207700_10365108 | 3300025928 | Bacteria | 1259 |
| 446 | Ga0207700_10551946 | 3300025928 | Unclassified | 1023 |
| 447 | Ga0207664_10012079 | 3300025929 | Bacteria | 6167 |
| 448 | Ga0207664_10051951 | 3300025929 | Unclassified | 3239 |
| 449 | Ga0207664_10333575 | 3300025929 | Bacteria | 1340 |
| 450 | Ga0207644_10028476 | 3300025931 | Bacteria | 3868 |
| 451 | Ga0207644_10532988 | 3300025931 | Unclassified | 971 |
| 452 | Ga0207690_10029369 | 3300025932 | Bacteria | 3495 |
| 453 | Ga0207690_10205791 | 3300025932 | Bacteria | 1497 |
| 454 | Ga0207706_10054690 | 3300025933 | Bacteria | 3522 |
| 455 | Ga0207686_10002190 | 3300025934 | Bacteria | 10754 |
| 456 | Ga0207686_10010199 | 3300025934 | Bacteria | 5108 |
| 457 | Ga0207686_10017270 | 3300025934 | Bacteria | 4064 |
| 458 | Ga0207686_10198089 | 3300025934 | Unclassified | 1436 |
| 459 | Ga0207686_10222864 | 3300025934 | Bacteria | 1363 |
| 460 | Ga0207709_10424539 | 3300025935 | Unclassified | 1022 |
| 461 | Ga0207669_10232981 | 3300025937 | Bacteria | 1360 |
| 462 | Ga0207704_10228075 | 3300025938 | Unclassified | 1383 |
| 463 | Ga0207704_10783241 | 3300025938 | Bacteria | 795 |
| 464 | Ga0207665_10550076 | 3300025939 | Bacteria | 897 |
| 465 | Ga0207665_10843285 | 3300025939 | Bacteria | 725 |
| 466 | Ga0207711_10004497 | 3300025941 | Bacteria | 11880 |
| 467 | Ga0207711_10009349 | 3300025941 | Bacteria | 8185 |
| 468 | Ga0207711_10200042 | 3300025941 | Bacteria | 1823 |
| 469 | Ga0207711_10230651 | 3300025941 | Bacteria | 1695 |
| 470 | Ga0207711_10369854 | 3300025941 | Bacteria | 1329 |
| 471 | Ga0207711_10502564 | 3300025941 | Bacteria | 1130 |
| 472 | Ga0207711_11114318 | 3300025941 | Bacteria | 730 |
| 473 | Ga0207689_10060470 | 3300025942 | Bacteria | 3116 |
| 474 | Ga0207689_10336951 | 3300025942 | Bacteria | 1253 |
| 475 | Ga0207661_10000376 | 3300025944 | Bacteria | 28667 |
| 476 | Ga0207661_10024773 | 3300025944 | Bacteria | 4552 |
| 477 | Ga0207661_10087213 | 3300025944 | Bacteria | 2591 |
| 478 | Ga0207661_10211598 | 3300025944 | Bacteria | 1709 |
| 479 | Ga0207679_10115811 | 3300025945 | Bacteria | 2124 |
| 480 | Ga0207679_10152875 | 3300025945 | Bacteria | 1881 |
| 481 | Ga0207667_10000253 | 3300025949 | Bacteria | 75314 |
| 482 | Ga0207667_10004724 | 3300025949 | Bacteria | 16679 |
| 483 | Ga0207667_10005315 | 3300025949 | Bacteria | 15692 |
| 484 | Ga0207667_10009573 | 3300025949 | Bacteria | 11401 |
| 485 | Ga0207667_10011851 | 3300025949 | Bacteria | 10100 |
| 486 | Ga0207667_10027727 | 3300025949 | Bacteria | 6161 |
| 487 | Ga0207667_10129228 | 3300025949 | Bacteria | 2602 |
| 488 | Ga0207667_10194823 | 3300025949 | Bacteria | 2079 |
| 489 | Ga0207667_10281655 | 3300025949 | Bacteria | 1699 |
| 490 | Ga0207667_10517156 | 3300025949 | Bacteria | 1209 |
| 491 | Ga0207667_10714399 | 3300025949 | Unclassified | 1004 |
| 492 | Ga0207651_10043824 | 3300025960 | Unclassified | 2989 |
| 493 | Ga0207651_10252053 | 3300025960 | Bacteria | 1445 |
| 494 | Ga0207712_10008857 | 3300025961 | Bacteria | 6363 |
| 495 | Ga0207712_10076871 | 3300025961 | Bacteria | 2418 |
| 496 | Ga0207712_10224234 | 3300025961 | Bacteria | 1504 |
| 497 | Ga0207640_10278370 | 3300025981 | Bacteria | 1313 |
| 498 | Ga0207640_10761731 | 3300025981 | Bacteria | 835 |
| 499 | Ga0207658_10074034 | 3300025986 | Bacteria | 2587 |
| 500 | Ga0207658_10141989 | 3300025986 | Unclassified | 1944 |
| 501 | Ga0207658_10252923 | 3300025986 | Bacteria | 1498 |
| 502 | Ga0207658_10845548 | 3300025986 | Unclassified | 832 |
| 503 | Ga0207677_10011910 | 3300026023 | Bacteria | 4979 |
| 504 | Ga0207677_10056195 | 3300026023 | Bacteria | 2695 |
| 505 | Ga0207677_10906240 | 3300026023 | Bacteria | 795 |
| 506 | Ga0207639_10031605 | 3300026041 | Bacteria | 3892 |
| 507 | Ga0207639_10227783 | 3300026041 | Bacteria | 1614 |
| 508 | Ga0207702_10002817 | 3300026078 | Bacteria | 16263 |
| 509 | Ga0207702_10029471 | 3300026078 | Bacteria | 4567 |
| 510 | Ga0207702_10031362 | 3300026078 | Bacteria | 4430 |
| 511 | Ga0207702_10075440 | 3300026078 | Bacteria | 2913 |
| 512 | Ga0207702_10121069 | 3300026078 | Bacteria | 2342 |
| 513 | Ga0207702_10121644 | 3300026078 | Bacteria | 2337 |
| 514 | Ga0207702_10148128 | 3300026078 | Bacteria | 2132 |
| 515 | Ga0207702_10254993 | 3300026078 | Unclassified | 1649 |
| 516 | Ga0207702_10382196 | 3300026078 | Bacteria | 1354 |
| 517 | Ga0207702_11003902 | 3300026078 | Unclassified | 828 |
| 518 | Ga0207641_10051693 | 3300026088 | Bacteria | 3480 |
| 519 | Ga0207641_10086199 | 3300026088 | Bacteria | 2738 |
| 520 | Ga0207641_10259427 | 3300026088 | Bacteria | 1626 |
| 521 | Ga0207648_10030543 | 3300026089 | Bacteria | 4770 |
| 522 | Ga0207648_10117602 | 3300026089 | Bacteria | 2336 |
| 523 | Ga0207648_10193762 | 3300026089 | Bacteria | 1802 |
| 524 | Ga0207676_10189159 | 3300026095 | Bacteria | 1810 |
| 525 | Ga0207676_10223026 | 3300026095 | Bacteria | 1680 |
| 526 | Ga0207674_10000097 | 3300026116 | Bacteria | 98549 |
| 527 | Ga0207674_10001765 | 3300026116 | Bacteria | 27659 |
| 528 | Ga0207674_10013528 | 3300026116 | Bacteria | 9048 |
| 529 | Ga0207674_10027603 | 3300026116 | Bacteria | 6002 |
| 530 | Ga0207674_11040235 | 3300026116 | Bacteria | 788 |
| 531 | Ga0207683_10134007 | 3300026121 | Bacteria | 2229 |
| 532 | Ga0207683_11233600 | 3300026121 | Unclassified | 693 |
| 533 | Ga0207683_11671559 | 3300026121 | Unclassified | 586 |
| 534 | Ga0207698_10009971 | 3300026142 | Bacteria | 6079 |
| 535 | Ga0207698_10014353 | 3300026142 | Bacteria | 5263 |
| 536 | Ga0207698_10193627 | 3300026142 | Bacteria | 1814 |
| 537 | Ga0207698_10208145 | 3300026142 | Bacteria | 1758 |
| 538 | Ga0207698_10571568 | 3300026142 | Bacteria | 1111 |
| 539 | Ga0207698_11128972 | 3300026142 | Unclassified | 797 |
| 540 | Ga0207698_11541182 | 3300026142 | Bacteria | 680 |
| 541 | Ga0268266_10031482 | 3300028379 | Bacteria | 4505 |
| 542 | Ga0268266_10244099 | 3300028379 | Unclassified | 1659 |
| 543 | Ga0268266_11217620 | 3300028379 | Bacteria | 728 |
| 544 | Ga0268264_10053776 | 3300028381 | Bacteria | 3360 |
| 545 | Ga0268264_10179158 | 3300028381 | Bacteria | 1923 |
| 546 | Ga0268264_10928311 | 3300028381 | Bacteria | 875 |
| 547 | Ga0268264_11070067 | 3300028381 | Bacteria | 814 |
| 548 | Ga0265336_10023881 | 3300028666 | Bacteria | 1936 |
| 549 | Ga0265338_10015521 | 3300028800 | Bacteria | 8359 |
| 550 | Ga0265338_10161674 | 3300028800 | Bacteria | 1729 |
| 551 | Ga0265338_10219751 | 3300028800 | Unclassified | 1420 |
| 552 | Ga0265330_10205696 | 3300031235 | Bacteria | 832 |
| 553 | Ga0265332_10020979 | 3300031238 | Bacteria | 2885 |
| 554 | Ga0265325_10004072 | 3300031241 | Bacteria | 9313 |
| 555 | Ga0265325_10078581 | 3300031241 | Bacteria | 1643 |
| 556 | Ga0265325_10091117 | 3300031241 | Unclassified | 1503 |
| 557 | Ga0265325_10226670 | 3300031241 | Bacteria | 853 |
| 558 | Ga0265329_10005782 | 3300031242 | Bacteria | 4966 |
| 559 | Ga0265340_10013791 | 3300031247 | Unclassified | 4237 |
| 560 | Ga0265340_10127810 | 3300031247 | Bacteria | 1167 |
| 561 | Ga0265339_10085273 | 3300031249 | Unclassified | 1663 |
| 562 | Ga0265331_10089202 | 3300031250 | Bacteria | 1426 |
| 563 | Ga0265331_10111950 | 3300031250 | Bacteria | 1252 |
| 564 | Ga0265316_10002549 | 3300031344 | Bacteria | 18826 |
| 565 | Ga0265316_10056234 | 3300031344 | Bacteria | 3074 |
| 566 | Ga0265316_10161347 | 3300031344 | Bacteria | 1676 |
| 567 | Ga0265316_10293501 | 3300031344 | Bacteria | 1186 |
| 568 | Ga0265316_10508226 | 3300031344 | Unclassified | 860 |
| 569 | Ga0265313_10010912 | 3300031595 | Bacteria | 5696 |
| 570 | Ga0265313_10084650 | 3300031595 | Bacteria | 1434 |
| 571 | Ga0265314_10000880 | 3300031711 | Bacteria | 35806 |
| 572 | Ga0265314_10001640 | 3300031711 | Bacteria | 24496 |
| 573 | Ga0265314_10039808 | 3300031711 | Bacteria | 3381 |
| 574 | Ga0265342_10119206 | 3300031712 | Bacteria | 1487 |
| 575 | Ga0265342_10342493 | 3300031712 | Bacteria | 780 |
| 576 | Ga0373926_0066464 | 3300035083 | Unclassified | 1320 |
| 577 | Ga0373926_0346829 | 3300035083 | Bacteria | 583 |
| 578 | Ga0373934_0003152 | 3300035086 | Bacteria | 6016 |
| 579 | Ga0373934_0004127 | 3300035086 | Bacteria | 5354 |
| 580 | Ga0373934_0016384 | 3300035086 | Bacteria | 2818 |
| 581 | Ga0373934_0028295 | 3300035086 | Bacteria | 2183 |
| 582 | Ga0373944_0050323 | 3300035089 | Bacteria | 1312 |
| 583 | Ga0373923_0220825 | 3300035111 | Bacteria | 881 |
| 584 | Ga0373932_0160668 | 3300035112 | Bacteria | 777 |
| 585 | Ga0373953_0076521 | 3300035117 | Unclassified | 1387 |
| 586 | Ga0373953_0215763 | 3300035117 | Bacteria | 831 |
| 587 | Ga0373954_0025290 | 3300035118 | Bacteria | 2713 |
| 588 | Ga0373954_0035817 | 3300035118 | Bacteria | 2302 |
| 589 | Ga0373954_0045442 | 3300035118 | Bacteria | 2052 |
| 590 | Ga0373954_0079532 | 3300035118 | Bacteria | 1565 |
| 591 | Ga0373956_0011548 | 3300035119 | Bacteria | 3643 |
| 592 | Ga0373956_0081449 | 3300035119 | Bacteria | 1485 |
| 593 | Ga0373956_0394414 | 3300035119 | Unclassified | 660 |
| 594 | Ga0373957_0007300 | 3300035120 | Bacteria | 3533 |
| 595 | Ga0373957_0021688 | 3300035120 | Bacteria | 2283 |
| 596 | Ga0373957_0045201 | 3300035120 | Bacteria | 1668 |
| 597 | Ga0373957_0060443 | 3300035120 | Bacteria | 1467 |
| 598 | Ga0373943_0015346 | 3300035170 | Unclassified | 3478 |
| 599 | Ga0373943_0046728 | 3300035170 | Unclassified | 2114 |
| 600 | Ga0373943_0496394 | 3300035170 | Unclassified | 713 |
| 601 | Ga0373946_0015396 | 3300035171 | Unclassified | 2900 |
| 602 | Ga0373955_0056544 | 3300035172 | Bacteria | 2153 |
| 603 | Ga0373955_0130398 | 3300035172 | Bacteria | 1467 |
| 604 | Ga0373924_0096668 | 3300035410 | Bacteria | 1268 |
| 605 | Ga0373924_0121725 | 3300035410 | Bacteria | 1132 |
| 606 | Ga0373931_0264083 | 3300035691 | Unclassified | 1051 |
| 607 | Ga0373935_0043269 | 3300035692 | Bacteria | 2834 |
| 608 | Ga0373935_0254418 | 3300035692 | Bacteria | 1230 |
| 609 | Ga0373935_0320602 | 3300035692 | Unclassified | 1099 |
| 610 | Ga0373935_0817598 | 3300035692 | Unclassified | 688 |
| 611 | Ga0373927_0002387 | 3300035695 | Bacteria | 13689 |
| 612 | Ga0373927_0006265 | 3300035695 | Bacteria | 8122 |
| 613 | Ga0373927_0007986 | 3300035695 | Bacteria | 7146 |
| 614 | Ga0373927_0018595 | 3300035695 | Bacteria | 4563 |
| 615 | Ga0373927_0036209 | 3300035695 | Unclassified | 3210 |
| 616 | Ga0373933_0006835 | 3300035724 | Bacteria | 6210 |
| 617 | Ga0373933_0040651 | 3300035724 | Bacteria | 2741 |
| 618 | Ga0373933_0119701 | 3300035724 | Bacteria | 1648 |
| 619 | Ga0373947_0002406 | 3300035725 | Bacteria | 11308 |
| 620 | Ga0373947_0584069 | 3300035725 | Bacteria | 761 |
| 621 | Ga0373947_0664277 | 3300035725 | Bacteria | 711 |
| 622 | Ga0373937_0004600 | 3300036401 | Bacteria | 11706 |
| 623 | Ga0373937_0009692 | 3300036401 | Bacteria | 8393 |
| 624 | Ga0373937_0011634 | 3300036401 | Bacteria | 7725 |
| 625 | Ga0373937_0035714 | 3300036401 | Bacteria | 4525 |
| 626 | Ga0373937_0052970 | 3300036401 | Bacteria | 3722 |
| 627 | Ga0373937_0095679 | 3300036401 | Bacteria | 2754 |
| 628 | Ga0373937_0325270 | 3300036401 | Bacteria | 1455 |
| 629 | Ga0373937_1389082 | 3300036401 | Bacteria | 650 |
| 630 | Ga0373937_1597048 | 3300036401 | Bacteria | 599 |
| 631 | Ga0373925_0000325 | 3300037068 | Bacteria | 49853 |
| 632 | Ga0373925_0028204 | 3300037068 | Unclassified | 4112 |
| 633 | Ga0373925_0051155 | 3300037068 | Bacteria | 3083 |
| 634 | Ga0373925_0116196 | 3300037068 | Bacteria | 2072 |
| 635 | Ga0373925_0355131 | 3300037068 | Bacteria | 1191 |
| 636 | Ga0373925_0560195 | 3300037068 | Unclassified | 940 |
| 637 | Ga0373925_0746959 | 3300037068 | Bacteria | 807 |
| 638 | Ga0395900_0248024 | 3300037418 | Bacteria | 1783 |
| 639 | Ga0436364_0073099 | 3300037853 | Bacteria | 1882 |
| 640 | Ga0436364_0294229 | 3300037853 | Bacteria | 17589 |
| 641 | Ga0436364_0359395 | 3300037853 | Bacteria | 10817 |
| 642 | Ga0436364_0540800 | 3300037853 | Bacteria | 976 |
| 643 | Ga0436364_0761931 | 3300037853 | Bacteria | 1407 |
| 644 | Ga0436364_0842705 | 3300037853 | Bacteria | 2216 |
| 645 | Ga0436364_0871212 | 3300037853 | Bacteria | 2157 |
| 646 | Ga0436364_1279185 | 3300037853 | Unclassified | 1506 |
| 647 | Ga0436364_1343448 | 3300037853 | Bacteria | 154245 |
| 648 | Ga0436364_1349279 | 3300037853 | Bacteria | 2860 |
| 649 | Ga0436364_1410943 | 3300037853 | Bacteria | 26265 |
| 650 | Ga0436365_0155868 | 3300039437 | Bacteria | 1431 |
| 651 | Ga0436365_0203521 | 3300039437 | Bacteria | 5658 |
| 652 | Ga0436365_0492829 | 3300039437 | Bacteria | 870 |
| 653 | Ga0436365_0621920 | 3300039437 | Bacteria | 7307 |
| 654 | Ga0436365_0867765 | 3300039437 | Bacteria | 6831 |
| 655 | Ga0436365_0990910 | 3300039437 | Bacteria | 1633 |
| 656 | Ga0436365_1017858 | 3300039437 | Bacteria | 6482 |
| 657 | Ga0436365_1337599 | 3300039437 | Bacteria | 2388 |
| 658 | Ga0436365_1801777 | 3300039437 | Bacteria | 2319 |
| 659 | Ga0436360_0457504 | 3300039438 | Bacteria | 1533 |
| 660 | Ga0436361_0682149 | 3300039447 | Bacteria | 833 |
| 661 | Ga0436363_0056399 | 3300039450 | Bacteria | 1576 |
| 662 | Ga0436363_0115085 | 3300039450 | Bacteria | 5275 |
| 663 | Ga0436363_0150889 | 3300039450 | Bacteria | 7062 |
| 664 | Ga0436363_0953899 | 3300039450 | Bacteria | 2211 |
| 665 | Ga0436362_1277351 | 3300039453 | Unclassified | 1421 |
| 666 | Ga0451833_0603392 | 3300041491 | Unclassified | 669 |
| 667 | Ga0451853_0296708 | 3300041512 | Unclassified | 663 |
| 668 | Ga0451577_0256055 | 3300042876 | Bacteria | 1585 |
| 669 | Ga0466965_0571439 | 3300044683 | Unclassified | 640 |
| 670 | Ga0466966_0064999 | 3300044684 | Bacteria | 2295 |
| 671 | Ga0453684_0751079 | 3300044712 | Unclassified | 1056 |
| 672 | Ga0466957_0105518 | 3300044842 | Bacteria | 1781 |
| 673 | Ga0466959_0522949 | 3300045049 | Unclassified | 801 |
| 674 | Ga0466958_0599926 | 3300045836 | Unclassified | 716 |
| 675 | Ga0466967_0163995 | 3300045976 | Bacteria | 2088 |
| 676 | Ga0466967_0724548 | 3300045976 | Bacteria | 986 |
| 677 | Ga0466967_1780378 | 3300045976 | Unclassified | 613 |
| 678 | Ga0495592_0150576 | 3300046454 | Bacteria | 1609 |
| 679 | Ga0495603_0215954 | 3300046455 | Bacteria | 1107 |
| 680 | Ga0495651_0411288 | 3300046462 | Bacteria | 881 |
| 681 | Ga0495653_0459241 | 3300046463 | Unclassified | 800 |
| 682 | Ga0495580_0051986 | 3300046472 | Bacteria | 2895 |
| 683 | Ga0495580_0060084 | 3300046472 | Bacteria | 2671 |
| 684 | Ga0495580_0067801 | 3300046472 | Bacteria | 2496 |
| 685 | Ga0495580_0082909 | 3300046472 | Bacteria | 2235 |
| 686 | Ga0495580_0252384 | 3300046472 | Bacteria | 1207 |
| 687 | Ga0495580_0280862 | 3300046472 | Bacteria | 1136 |
| 688 | Ga0495580_0726271 | 3300046472 | Bacteria | 648 |
| 689 | Ga0495582_0021058 | 3300046473 | Bacteria | 3570 |
| 690 | Ga0495639_0242709 | 3300046475 | Bacteria | 889 |
| 691 | Ga0495608_0212760 | 3300046511 | Bacteria | 1215 |
| 692 | Ga0495618_0316001 | 3300046514 | Bacteria | 968 |
| 693 | Ga0495628_0178714 | 3300046516 | Bacteria | 1606 |
| 694 | Ga0495652_0048218 | 3300046529 | Bacteria | 3651 |
| 695 | Ga0495652_0114357 | 3300046529 | Bacteria | 2165 |
| 696 | Ga0495652_0383377 | 3300046529 | Bacteria | 999 |
| 697 | Ga0495652_0728735 | 3300046529 | Bacteria | 665 |
| 698 | Ga0495665_0031271 | 3300046531 | Unclassified | 2849 |
| 699 | Ga0495665_0103480 | 3300046531 | Bacteria | 1494 |
| 700 | Ga0495665_0132957 | 3300046531 | Unclassified | 1302 |
| 701 | Ga0495665_0190836 | 3300046531 | Bacteria | 1063 |
| 702 | Ga0495640_0146184 | 3300046533 | Bacteria | 1521 |
| 703 | Ga0495586_0261117 | 3300046535 | Bacteria | 989 |
| 704 | Ga0495587_0002353 | 3300046536 | Bacteria | 12629 |
| 705 | Ga0495645_0199887 | 3300046543 | Bacteria | 1357 |
| 706 | Ga0495667_0065292 | 3300046559 | Unclassified | 2381 |
| 707 | Ga0495667_0154273 | 3300046559 | Bacteria | 1478 |
| 708 | Ga0495667_0276495 | 3300046559 | Bacteria | 1066 |
| 709 | Ga0495635_0208472 | 3300046663 | Bacteria | 1324 |
| 710 | Ga0495635_0253505 | 3300046663 | Bacteria | 1186 |
| 711 | Ga0495588_0230184 | 3300046674 | Bacteria | 978 |
| 712 | Ga0495599_0114665 | 3300046678 | Bacteria | 1677 |
| 713 | Ga0495599_0339641 | 3300046678 | Bacteria | 902 |
| 714 | Ga0495623_0478592 | 3300046679 | Unclassified | 660 |
| 715 | Ga0495658_0020114 | 3300046683 | Bacteria | 3497 |
| 716 | Ga0495658_0291366 | 3300046683 | Bacteria | 1031 |
| 717 | Ga0495669_0033341 | 3300046684 | Bacteria | 2266 |
| 718 | Ga0495624_0136034 | 3300046690 | Unclassified | 1506 |
| 719 | Ga0495600_0318125 | 3300046809 | Bacteria | 979 |
| 720 | Ga0495604_0172362 | 3300047317 | Unclassified | 1520 |
| 721 | Ga0495636_0033889 | 3300047318 | Unclassified | 2100 |
| 722 | Ga0495636_0213278 | 3300047318 | Bacteria | 884 |
| 723 | Ga0495674_0082234 | 3300047319 | Unclassified | 2761 |
| 724 | Ga0495674_0489290 | 3300047319 | Unclassified | 985 |
| 725 | Ga0495674_0623826 | 3300047319 | Bacteria | 852 |
| 726 | Ga0495674_0745504 | 3300047319 | Bacteria | 766 |
| 727 | Ga0495674_0954440 | 3300047319 | Bacteria | 659 |
| 728 | Ga0495680_0211861 | 3300047322 | Bacteria | 1387 |
| 729 | Ga0495680_0344324 | 3300047322 | Bacteria | 1039 |
| 730 | Ga0495675_0070922 | 3300047444 | Bacteria | 2200 |
| 731 | Ga0495675_0491226 | 3300047444 | Unclassified | 706 |
| 732 | Ga0495677_0099701 | 3300047445 | Bacteria | 1099 |
| 733 | Ga0495684_0012410 | 3300047471 | Bacteria | 6571 |
| 734 | Ga0495684_0045337 | 3300047471 | Bacteria | 3365 |
| 735 | Ga0495684_0328869 | 3300047471 | Unclassified | 1091 |
| 736 | Ga0495602_0003189 | 3300048088 | Bacteria | 16916 |
| 737 | Ga0495602_0294378 | 3300048088 | Unclassified | 1190 |
| 738 | Ga0495614_0336735 | 3300048089 | Unclassified | 702 |
| 739 | Ga0496102_0261696 | 3300048905 | Bacteria | 1631 |
| 740 | Ga0496104_0262035 | 3300048907 | Bacteria | 1641 |
| 741 | Ga0496104_0294841 | 3300048907 | Bacteria | 1534 |
| 742 | Ga0496108_0913554 | 3300048911 | Bacteria | 753 |
| 743 | Ga0496109_0709884 | 3300048912 | Bacteria | 943 |
| 744 | Ga0496112_0301117 | 3300048915 | Bacteria | 1549 |
| 745 | Ga0496112_0816357 | 3300048915 | Unclassified | 857 |
| 746 | Ga0496113_0638428 | 3300048916 | Unclassified | 852 |
| 747 | Ga0496115_0046749 | 3300048918 | Bacteria | 3460 |
| 748 | Ga0496115_0438772 | 3300048918 | Bacteria | 1056 |
| 749 | Ga0501239_013228 | 3300049672 | Bacteria | 942 |
| 750 | Ga0501249_018513 | 3300049679 | Bacteria | 1507 |
| 751 | Ga0501253_007754 | 3300049683 | Bacteria | 1513 |
| 752 | Ga0501257_100015 | 3300049686 | Unclassified | 761 |
| 753 | Ga0501273_012369 | 3300049770 | Bacteria | 1075 |
| 754 | nmdc:mga05p37_177700_c1 | 3300050507 | Bacteria | 1493 |
| 755 | nmdc:mga09592_1072220_c1 | 3300050508 | Unclassified | 671 |
| 756 | nmdc:mga09592_149842_c1 | 3300050508 | Unclassified | 2012 |
| 757 | nmdc:mga0qj67_56946_c1 | 3300050509 | Bacteria | 3099 |
| 758 | nmdc:mga0qj67_651406_c1 | 3300050509 | Bacteria | 840 |
| 759 | nmdc:mga06r32_20323_c1 | 3300050510 | Bacteria | 6111 |
| 760 | nmdc:mga06r32_97234_c1 | 3300050510 | Unclassified | 2885 |
| 761 | nmdc:mga0n895_586204_c1 | 3300050512 | Bacteria | 1118 |
| 762 | Ga0495601_0386129 | 3300053077 | Unclassified | 908 |
| 763 | Ga0495619_0079994 | 3300053085 | Bacteria | 2199 |
| 764 | Ga0500616_0095242 | 3300053153 | Bacteria | 1466 |
| 765 | Ga0501082_0930079 | 3300060353 | Bacteria | 760 |
| 766 | Ga0105241_10674374 | |||
| 767 | Ga0058863_10055835 | |||
| 768 | Ga0058861_10170871 | |||
| 769 | Ga0058862_10277535 | |||
| 770 | Ga0070658_10011004 | |||
| 771 | Ga0070658_10086655 | |||
| 772 | Ga0070658_10145716 | |||
| 773 | Ga0070683_100003970 | |||
| 774 | Ga0070683_100060076 | |||
| 775 | Ga0070683_100156038 | |||
| 776 | Ga0070683_100200935 | |||
| 777 | Ga0070683_100206871 | |||
| 778 | Ga0070690_100095957 | |||
| 779 | Ga0070670_100431481 | |||
| 780 | Ga0068869_100221306 | |||
| 781 | Ga0070666_10002074 | |||
| 782 | Ga0070680_100004371 | |||
| 783 | Ga0070680_100007756 | |||
| 784 | Ga0070680_100084736 | |||
| 785 | Ga0070680_100606093 | |||
| 786 | Ga0070680_100727432 | |||
| 787 | Ga0070682_100438668 | |||
| 788 | Ga0068868_100067563 | |||
| 789 | Ga0068868_100089529 | |||
| 790 | Ga0068868_100589972 | |||
| 791 | Ga0070660_100149958 | |||
| 792 | Ga0070660_100373813 | |||
| 793 | Ga0070689_100216629 | |||
| 794 | Ga0070691_10003186 | |||
| 795 | Ga0070687_100746379 | |||
| 796 | Ga0070661_100045220 | |||
| 797 | Ga0070692_10604816 | |||
| 798 | Ga0070692_10664794 | |||
| 799 | Ga0070671_100041594 | |||
| 800 | Ga0070671_100188257 | |||
| 801 | Ga0070673_100064763 | |||
| 802 | Ga0070688_100898971 | |||
| 803 | Ga0070659_100070829 | |||
| 804 | Ga0070667_100228103 | |||
| 805 | Ga0070667_100295727 | |||
| 806 | Ga0070714_100029297 | |||
| 807 | Ga0070714_100163108 | |||
| 808 | Ga0070714_100385129 | |||
| 809 | Ga0070714_101008855 | |||
| 810 | Ga0070713_100001832 | |||
| 811 | Ga0070713_100107197 | |||
| 812 | Ga0070713_100146163 | |||
| 813 | Ga0070713_100277271 | |||
| 814 | Ga0070713_100329021 | |||
| 815 | Ga0070713_100349892 | |||
| 816 | Ga0070711_100004301 | |||
| 817 | Ga0070711_100073460 | |||
| 818 | Ga0070711_100238174 | |||
| 819 | Ga0070711_100559380 | |||
| 820 | Ga0070705_100522251 | |||
| 821 | Ga0070694_100080231 | |||
| 822 | Ga0070694_100548032 | |||
| 823 | Ga0070708_100343449 | |||
| 824 | Ga0070678_100748586 | |||
| 825 | Ga0070678_101058232 | |||
| 826 | Ga0070678_101748839 | |||
| 827 | Ga0070662_100258981 | |||
| 828 | Ga0070662_100547027 | |||
| 829 | Ga0070662_100908751 | |||
| 830 | Ga0070681_10040816 | |||
| 831 | Ga0070681_10056361 | |||
| 832 | Ga0070681_10189740 | |||
| 833 | Ga0070681_10193593 | |||
| 834 | Ga0070681_10283542 | |||
| 835 | Ga0070681_10340837 | |||
| 836 | Ga0070681_10386525 | |||
| 837 | Ga0070681_10723419 | |||
| 838 | Ga0068867_100018808 | |||
| 839 | Ga0068867_100059711 | |||
| 840 | Ga0068867_100210624 | |||
| 841 | Ga0068867_100358671 | |||
| 842 | Ga0068867_100874504 | |||
| 843 | Ga0070685_10601786 | |||
| 844 | Ga0070707_100947143 | |||
| 845 | Ga0070679_100004603 | |||
| 846 | Ga0070679_100034993 | |||
| 847 | Ga0070679_100050498 | |||
| 848 | Ga0070679_100059639 | |||
| 849 | Ga0070679_100406386 | |||
| 850 | Ga0070679_100890068 | |||
| 851 | Ga0070684_100006622 | |||
| 852 | Ga0070684_100077168 | |||
| 853 | Ga0070684_100079422 | |||
| 854 | Ga0070684_100091797 | |||
| 855 | Ga0070684_100205767 | |||
| 856 | Ga0070684_100333998 | |||
| 857 | Ga0070684_100343205 | |||
| 858 | Ga0070684_100457052 | |||
| 859 | Ga0070684_100842975 | |||
| 860 | Ga0070684_101698582 | |||
| 861 | Ga0070697_100106128 | |||
| 862 | Ga0068853_100021237 | |||
| 863 | Ga0068853_100025646 | |||
| 864 | Ga0068853_100118462 | |||
| 865 | Ga0068853_100221284 | |||
| 866 | Ga0068853_100597237 | |||
| 867 | Ga0070686_100290608 | |||
| 868 | Ga0070686_100580061 | |||
| 869 | Ga0070695_100143724 | |||
| 870 | Ga0070695_100284577 | |||
| 871 | Ga0070695_100787441 | |||
| 872 | Ga0070696_101173192 | |||
| 873 | Ga0070693_100244017 | |||
| 874 | Ga0070693_100273370 | |||
| 875 | Ga0070665_100041606 | |||
| 876 | Ga0070665_100079556 | |||
| 877 | Ga0070665_100665222 | |||
| 878 | Ga0070665_101171180 | |||
| 879 | Ga0070665_102202673 | |||
| 880 | Ga0070704_100853788 | |||
| 881 | Ga0068855_100003950 | |||
| 882 | Ga0068855_100008856 | |||
| 883 | Ga0068855_100033651 | |||
| 884 | Ga0068855_100100143 | |||
| 885 | Ga0068855_100113906 | |||
| 886 | Ga0068855_100167415 | |||
| 887 | Ga0068855_100321127 | |||
| 888 | Ga0068855_100452613 | |||
| 889 | Ga0068855_100880874 | |||
| 890 | Ga0070664_100024994 | |||
| 891 | Ga0070664_100137603 | |||
| 892 | Ga0070664_100140691 | |||
| 893 | Ga0068857_100007886 | |||
| 894 | Ga0068857_100026970 | |||
| 895 | Ga0068857_100047994 | |||
| 896 | Ga0068857_100167934 | |||
| 897 | Ga0068856_100001598 | |||
| 898 | Ga0068856_100001644 | |||
| 899 | Ga0068856_100004643 | |||
| 900 | Ga0068856_100011439 | |||
| 901 | Ga0068856_100050979 | |||
| 902 | Ga0068856_100162700 | |||
| 903 | Ga0068856_100247607 | |||
| 904 | Ga0068856_100334776 | |||
| 905 | Ga0070702_100804184 | |||
| 906 | Ga0068852_100006920 | |||
| 907 | Ga0068852_100015096 | |||
| 908 | Ga0068852_100020042 | |||
| 909 | Ga0068852_100218597 | |||
| 910 | Ga0068852_100344335 | |||
| 911 | Ga0068852_101086638 | |||
| 912 | Ga0068859_100026188 | |||
| 913 | Ga0068859_100068866 | |||
| 914 | Ga0068859_100265476 | |||
| 915 | Ga0068859_100722760 | |||
| 916 | Ga0068859_100793224 | |||
| 917 | Ga0068864_100292559 | |||
| 918 | Ga0068861_100057971 | |||
| 919 | Ga0068870_10079181 | |||
| 920 | Ga0068863_100024305 | |||
| 921 | Ga0068863_100063568 | |||
| 922 | Ga0068863_100107998 | |||
| 923 | Ga0068863_100654497 | |||
| 924 | Ga0068863_101710286 | |||
| 925 | Ga0068858_100075905 | |||
| 926 | Ga0068858_100149192 | |||
| 927 | Ga0068858_100234318 | |||
| 928 | Ga0068858_100317893 | |||
| 929 | Ga0068860_100401030 | |||
| 930 | Ga0068860_100541225 | |||
| 931 | Ga0068860_100924687 | |||
| 932 | Ga0070717_10005593 | |||
| 933 | Ga0070717_10184516 | |||
| 934 | Ga0070715_10293715 | |||
| 935 | Ga0070712_100071867 | |||
| 936 | Ga0070712_100395022 | |||
| 937 | Ga0097621_100014410 | |||
| 938 | Ga0097621_100016164 | |||
| 939 | Ga0097621_100026708 | |||
| 940 | Ga0097621_100037955 | |||
| 941 | Ga0097621_100184552 | |||
| 942 | Ga0097621_100198941 | |||
| 943 | Ga0097621_100389035 | |||
| 944 | Ga0097621_100824273 | |||
| 945 | Ga0097621_101049005 | |||
| 946 | Ga0097621_101223130 | |||
| 947 | Ga0068871_100020605 | |||
| 948 | Ga0068871_100085841 | |||
| 949 | Ga0068871_100200435 | |||
| 950 | Ga0068871_100220556 | |||
| 951 | Ga0068871_100286774 | |||
| 952 | Ga0068871_100364807 | |||
| 953 | Ga0068871_100381380 | |||
| 954 | Ga0068871_100587220 | |||
| 955 | Ga0075430_100065444 | |||
| 956 | Ga0075430_100070082 | |||
| 957 | Ga0075430_100691407 | |||
| 958 | Ga0075431_100052832 | |||
| 959 | Ga0075431_100071695 | |||
| 960 | Ga0075431_100379014 | |||
| 961 | Ga0075434_100730743 | |||
| 962 | Ga0075429_100145662 | |||
| 963 | Ga0075429_100714923 | |||
| 964 | Ga0075429_101102806 | |||
| 965 | Ga0068865_100055118 | |||
| 966 | Ga0068865_100333085 | |||
| 967 | Ga0075436_100000433 | |||
| 968 | Ga0075436_100000610 | |||
| 969 | Ga0075436_100740348 | |||
| 970 | Ga0097620_100026188 | |||
| 971 | Ga0097620_100068868 | |||
| 972 | Ga0097620_100265476 | |||
| 973 | Ga0097620_100722757 | |||
| 974 | Ga0097620_100793309 | |||
| 975 | Ga0075435_100416547 | |||
| 976 | Ga0075435_101155071 | |||
| 977 | Ga0105240_10000349 | |||
| 978 | Ga0105240_10001515 | |||
| 979 | Ga0105240_10002790 | |||
| 980 | Ga0105240_10006796 | |||
| 981 | Ga0105240_10072107 | |||
| 982 | Ga0105240_10100225 | |||
| 983 | Ga0105240_10154719 | |||
| 984 | Ga0105240_10217670 | |||
| 985 | Ga0105240_10229613 | |||
| 986 | Ga0105240_10340313 | |||
| 987 | Ga0105240_10468019 | |||
| 988 | Ga0105240_10552846 | |||
| 989 | Ga0105240_10559090 | |||
| 990 | Ga0105240_10635804 | |||
| 991 | Ga0105245_10005156 | |||
| 992 | Ga0105245_10008021 | |||
| 993 | Ga0105245_10010932 | |||
| 994 | Ga0105245_10058437 | |||
| 995 | Ga0105245_10087747 | |||
| 996 | Ga0105245_10104426 | |||
| 997 | Ga0105245_10169090 | |||
| 998 | Ga0105245_10213413 | |||
| 999 | Ga0105245_10781176 | |||
| 1000 | Ga0105245_10964719 | |||
| 1001 | Ga0105245_11057382 | |||
| 1002 | Ga0105245_11103576 | |||
| 1003 | Ga0114129_10200933 | |||
| 1004 | Ga0114129_11210486 | |||
| 1005 | Ga0105243_10200729 | |||
| 1006 | Ga0105243_10581625 | |||
| 1007 | Ga0105243_10592581 | |||
| 1008 | Ga0105241_10020683 | |||
| 1009 | Ga0105241_10041193 | |||
| 1010 | Ga0105241_10069983 | |||
| 1011 | Ga0105241_10130027 | |||
| 1012 | Ga0105241_10233603 | |||
| 1013 | Ga0105241_11051554 | |||
| 1014 | Ga0105241_11175597 | |||
| 1015 | Ga0105241_11377655 | |||
| 1016 | Ga0105242_10011002 | |||
| 1017 | Ga0105242_10020652 | |||
| 1018 | Ga0105242_10078416 | |||
| 1019 | Ga0105242_10095244 | |||
| 1020 | Ga0105242_10096982 | |||
| 1021 | Ga0105242_10275025 | |||
| 1022 | Ga0105242_10499093 | |||
| 1023 | Ga0105242_10630404 | |||
| 1024 | Ga0105248_10037550 | |||
| 1025 | Ga0105248_10075116 | |||
| 1026 | Ga0105248_10126153 | |||
| 1027 | Ga0105248_10299027 | |||
| 1028 | Ga0105248_10765772 | |||
| 1029 | Ga0105248_10833522 | |||
| 1030 | Ga0105248_10931661 | |||
| 1031 | Ga0105248_10996406 | |||
| 1032 | Ga0105237_10053637 | |||
| 1033 | Ga0105237_10073049 | |||
| 1034 | Ga0105237_10103568 | |||
| 1035 | Ga0105237_10105477 | |||
| 1036 | Ga0105237_10209612 | |||
| 1037 | Ga0105237_10275703 | |||
| 1038 | Ga0105237_10339084 | |||
| 1039 | Ga0105237_10382690 | |||
| 1040 | Ga0105237_10764610 | |||
| 1041 | Ga0105238_10002354 | |||
| 1042 | Ga0105238_10012086 | |||
| 1043 | Ga0105238_10062533 | |||
| 1044 | Ga0105238_10064021 | |||
| 1045 | Ga0105238_10203759 | |||
| 1046 | Ga0105238_10209366 | |||
| 1047 | Ga0105238_10210433 | |||
| 1048 | Ga0105238_10266133 | |||
| 1049 | Ga0105238_10569373 | |||
| 1050 | Ga0105238_11651757 | |||
| 1051 | Ga0105249_10072999 | |||
| 1052 | Ga0105249_10885992 | |||
| 1053 | Ga0105249_10988568 | |||
| 1054 | Ga0105239_10016402 | |||
| 1055 | Ga0105239_10050610 | |||
| 1056 | Ga0105239_10064060 | |||
| 1057 | Ga0105239_10104959 | |||
| 1058 | Ga0105239_10267789 | |||
| 1059 | Ga0105246_10012166 | |||
| 1060 | Ga0105246_10021960 | |||
| 1061 | Ga0105246_10127408 | |||
| 1062 | Ga0105246_10168132 | |||
| 1063 | Ga0105246_10197928 | |||
| 1064 | Ga0157370_10001930 | |||
| 1065 | Ga0157370_10005751 | |||
| 1066 | Ga0157370_10039967 | |||
| 1067 | Ga0157370_10058352 | |||
| 1068 | Ga0157370_10180674 | |||
| 1069 | Ga0157370_10421135 | |||
| 1070 | Ga0157370_10422110 | |||
| 1071 | Ga0157370_10669056 | |||
| 1072 | Ga0157369_10002355 | |||
| 1073 | Ga0157369_10003128 | |||
| 1074 | Ga0157369_10004900 | |||
| 1075 | Ga0157369_10053159 | |||
| 1076 | Ga0157369_10055113 | |||
| 1077 | Ga0157369_10094341 | |||
| 1078 | Ga0157369_10399913 | |||
| 1079 | Ga0157369_10518765 | |||
| 1080 | Ga0157369_11445447 | |||
| 1081 | Ga0157374_10007562 | |||
| 1082 | Ga0157374_10019718 | |||
| 1083 | Ga0157374_10050444 | |||
| 1084 | Ga0157374_10103084 | |||
| 1085 | Ga0157374_10184458 | |||
| 1086 | Ga0157374_10266257 | |||
| 1087 | Ga0157374_10301838 | |||
| 1088 | Ga0157374_10312738 | |||
| 1089 | Ga0157378_10004469 | |||
| 1090 | Ga0157378_10044690 | |||
| 1091 | Ga0157378_10085598 | |||
| 1092 | Ga0157378_10127603 | |||
| 1093 | Ga0157378_10254977 | |||
| 1094 | Ga0157378_10293365 | |||
| 1095 | Ga0157378_10663523 | |||
| 1096 | Ga0163162_10034883 | |||
| 1097 | Ga0163162_10159915 | |||
| 1098 | Ga0163162_10288399 | |||
| 1099 | Ga0163162_10438724 | |||
| 1100 | Ga0163162_10547935 | |||
| 1101 | Ga0157372_10006227 | |||
| 1102 | Ga0157372_10013396 | |||
| 1103 | Ga0157372_10020489 | |||
| 1104 | Ga0157372_10042054 | |||
| 1105 | Ga0157372_10102357 | |||
| 1106 | Ga0157372_10140275 | |||
| 1107 | Ga0157372_10863619 | |||
| 1108 | Ga0157375_10460108 | |||
| 1109 | Ga0157375_10522069 | |||
| 1110 | Ga0157375_10762912 | |||
| 1111 | Ga0163163_10013925 | |||
| 1112 | Ga0163163_10032380 | |||
| 1113 | Ga0163163_10073508 | |||
| 1114 | Ga0163163_10086019 | |||
| 1115 | Ga0163163_10149662 | |||
| 1116 | Ga0163163_10198573 | |||
| 1117 | Ga0163163_10286181 | |||
| 1118 | Ga0157380_11558862 | |||
| 1119 | Ga0157379_10080358 | |||
| 1120 | Ga0157379_10154880 | |||
| 1121 | Ga0157379_10472029 | |||
| 1122 | Ga0157379_11009331 | |||
| 1123 | Ga0157376_10070175 | |||
| 1124 | Ga0157376_10089344 | |||
| 1125 | Ga0157376_10600138 | |||
| 1126 | Ga0157376_10780711 | |||
| 1127 | Ga0206354_10342106 | |||
| 1128 | Ga0213872_10000499 | |||
| 1129 | Ga0213874_10002410 | |||
| 1130 | Ga0213874_10040610 | |||
| 1131 | Ga0213875_10000006 | |||
| 1132 | Ga0213875_10001205 | |||
| 1133 | Ga0213875_10007434 | |||
| 1134 | Ga0213875_10011894 | |||
| 1135 | Ga0213875_10034521 | |||
| 1136 | Ga0213875_10135508 | |||
| 1137 | Ga0213875_10157315 | |||
| 1138 | Ga0224712_10019972 | |||
| 1139 | Ga0207682_10315192 | |||
| 1140 | Ga0207692_10102166 | |||
| 1141 | Ga0207680_10037048 | |||
| 1142 | Ga0207680_10929485 | |||
| 1143 | Ga0207699_10007985 | |||
| 1144 | Ga0207699_10323141 | |||
| 1145 | Ga0207705_10247308 | |||
| 1146 | Ga0207705_10368079 | |||
| 1147 | Ga0207705_10645425 | |||
| 1148 | Ga0207654_10043017 | |||
| 1149 | Ga0207654_10054089 | |||
| 1150 | Ga0207654_10103046 | |||
| 1151 | Ga0207654_10420462 | |||
| 1152 | Ga0207654_10514308 | |||
| 1153 | Ga0207707_10089526 | |||
| 1154 | Ga0207707_10116084 | |||
| 1155 | Ga0207707_10290157 | |||
| 1156 | Ga0207707_10370002 | |||
| 1157 | Ga0207707_10453000 | |||
| 1158 | Ga0207707_10555091 | |||
| 1159 | Ga0207707_10701752 | |||
| 1160 | Ga0207695_10001613 | |||
| 1161 | Ga0207695_10005025 | |||
| 1162 | Ga0207695_10010155 | |||
| 1163 | Ga0207695_10012905 | |||
| 1164 | Ga0207695_10030330 | |||
| 1165 | Ga0207695_10125235 | |||
| 1166 | Ga0207695_10228318 | |||
| 1167 | Ga0207695_10290866 | |||
| 1168 | Ga0207695_10637301 | |||
| 1169 | Ga0207671_10009573 | |||
| 1170 | Ga0207671_10091422 | |||
| 1171 | Ga0207671_10146229 | |||
| 1172 | Ga0207671_10176028 | |||
| 1173 | Ga0207671_10312073 | |||
| 1174 | Ga0207693_10488256 | |||
| 1175 | Ga0207663_10070662 | |||
| 1176 | Ga0207663_10126872 | |||
| 1177 | Ga0207660_10019312 | |||
| 1178 | Ga0207660_10232574 | |||
| 1179 | Ga0207662_10208959 | |||
| 1180 | Ga0207657_10086368 | |||
| 1181 | Ga0207657_10123370 | |||
| 1182 | Ga0207657_10126212 | |||
| 1183 | Ga0207657_10160796 | |||
| 1184 | Ga0207649_10072938 | |||
| 1185 | Ga0207649_10436673 | |||
| 1186 | Ga0207652_10234898 | |||
| 1187 | Ga0207652_10492513 | |||
| 1188 | Ga0207652_10823769 | |||
| 1189 | Ga0207652_11055082 | |||
| 1190 | Ga0207694_10002147 | |||
| 1191 | Ga0207694_10006310 | |||
| 1192 | Ga0207694_10010361 | |||
| 1193 | Ga0207694_10049427 | |||
| 1194 | Ga0207694_10057282 | |||
| 1195 | Ga0207694_10064261 | |||
| 1196 | Ga0207694_10244441 | |||
| 1197 | Ga0207650_10614701 | |||
| 1198 | Ga0207687_10000181 | |||
| 1199 | Ga0207687_10003605 | |||
| 1200 | Ga0207687_10049914 | |||
| 1201 | Ga0207687_10053378 | |||
| 1202 | Ga0207687_10063500 | |||
| 1203 | Ga0207687_10278717 | |||
| 1204 | Ga0207687_10282308 | |||
| 1205 | Ga0207687_10372949 | |||
| 1206 | Ga0207687_10570774 | |||
| 1207 | Ga0207700_10001815 | |||
| 1208 | Ga0207700_10221550 | |||
| 1209 | Ga0207700_10242428 | |||
| 1210 | Ga0207700_10365108 | |||
| 1211 | Ga0207700_10551946 | |||
| 1212 | Ga0207664_10012079 | |||
| 1213 | Ga0207664_10051951 | |||
| 1214 | Ga0207664_10333575 | |||
| 1215 | Ga0207644_10028476 | |||
| 1216 | Ga0207644_10532988 | |||
| 1217 | Ga0207690_10029369 | |||
| 1218 | Ga0207690_10205791 | |||
| 1219 | Ga0207706_10054690 | |||
| 1220 | Ga0207686_10002190 | |||
| 1221 | Ga0207686_10010199 | |||
| 1222 | Ga0207686_10017270 | |||
| 1223 | Ga0207686_10198089 | |||
| 1224 | Ga0207686_10222864 | |||
| 1225 | Ga0207709_10424539 | |||
| 1226 | Ga0207669_10232981 | |||
| 1227 | Ga0207704_10228075 | |||
| 1228 | Ga0207704_10783241 | |||
| 1229 | Ga0207665_10550076 | |||
| 1230 | Ga0207665_10843285 | |||
| 1231 | Ga0207711_10004497 | |||
| 1232 | Ga0207711_10009349 | |||
| 1233 | Ga0207711_10200042 | |||
| 1234 | Ga0207711_10230651 | |||
| 1235 | Ga0207711_10369854 | |||
| 1236 | Ga0207711_10502564 | |||
| 1237 | Ga0207711_11114318 | |||
| 1238 | Ga0207689_10060470 | |||
| 1239 | Ga0207689_10336951 | |||
| 1240 | Ga0207661_10000376 | |||
| 1241 | Ga0207661_10024773 | |||
| 1242 | Ga0207661_10087213 | |||
| 1243 | Ga0207661_10211598 | |||
| 1244 | Ga0207679_10115811 | |||
| 1245 | Ga0207679_10152875 | |||
| 1246 | Ga0207667_10000253 | |||
| 1247 | Ga0207667_10004724 | |||
| 1248 | Ga0207667_10005315 | |||
| 1249 | Ga0207667_10009573 | |||
| 1250 | Ga0207667_10011851 | |||
| 1251 | Ga0207667_10027727 | |||
| 1252 | Ga0207667_10129228 | |||
| 1253 | Ga0207667_10194823 | |||
| 1254 | Ga0207667_10281655 | |||
| 1255 | Ga0207667_10517156 | |||
| 1256 | Ga0207667_10714399 | |||
| 1257 | Ga0207651_10043824 | |||
| 1258 | Ga0207651_10252053 | |||
| 1259 | Ga0207712_10008857 | |||
| 1260 | Ga0207712_10076871 | |||
| 1261 | Ga0207712_10224234 | |||
| 1262 | Ga0207640_10278370 | |||
| 1263 | Ga0207640_10761731 | |||
| 1264 | Ga0207658_10074034 | |||
| 1265 | Ga0207658_10141989 | |||
| 1266 | Ga0207658_10252923 | |||
| 1267 | Ga0207658_10845548 | |||
| 1268 | Ga0207677_10011910 | |||
| 1269 | Ga0207677_10056195 | |||
| 1270 | Ga0207677_10906240 | |||
| 1271 | Ga0207639_10031605 | |||
| 1272 | Ga0207639_10227783 | |||
| 1273 | Ga0207702_10002817 | |||
| 1274 | Ga0207702_10029471 | |||
| 1275 | Ga0207702_10031362 | |||
| 1276 | Ga0207702_10075440 | |||
| 1277 | Ga0207702_10121069 | |||
| 1278 | Ga0207702_10121644 | |||
| 1279 | Ga0207702_10148128 | |||
| 1280 | Ga0207702_10254993 | |||
| 1281 | Ga0207702_10382196 | |||
| 1282 | Ga0207702_11003902 | |||
| 1283 | Ga0207641_10051693 | |||
| 1284 | Ga0207641_10086199 | |||
| 1285 | Ga0207641_10259427 | |||
| 1286 | Ga0207648_10030543 | |||
| 1287 | Ga0207648_10117602 | |||
| 1288 | Ga0207648_10193762 | |||
| 1289 | Ga0207676_10189159 | |||
| 1290 | Ga0207676_10223026 | |||
| 1291 | Ga0207674_10000097 | |||
| 1292 | Ga0207674_10001765 | |||
| 1293 | Ga0207674_10013528 | |||
| 1294 | Ga0207674_10027603 | |||
| 1295 | Ga0207674_11040235 | |||
| 1296 | Ga0207683_10134007 | |||
| 1297 | Ga0207683_11233600 | |||
| 1298 | Ga0207683_11671559 | |||
| 1299 | Ga0207698_10009971 | |||
| 1300 | Ga0207698_10014353 | |||
| 1301 | Ga0207698_10193627 | |||
| 1302 | Ga0207698_10208145 | |||
| 1303 | Ga0207698_10571568 | |||
| 1304 | Ga0207698_11128972 | |||
| 1305 | Ga0207698_11541182 | |||
| 1306 | Ga0268266_10031482 | |||
| 1307 | Ga0268266_10244099 | |||
| 1308 | Ga0268266_11217620 | |||
| 1309 | Ga0268264_10053776 | |||
| 1310 | Ga0268264_10179158 | |||
| 1311 | Ga0268264_10928311 | |||
| 1312 | Ga0268264_11070067 | |||
| 1313 | Ga0265336_10023881 | |||
| 1314 | Ga0265338_10015521 | |||
| 1315 | Ga0265338_10161674 | |||
| 1316 | Ga0265338_10219751 | |||
| 1317 | Ga0265330_10205696 | |||
| 1318 | Ga0265332_10020979 | |||
| 1319 | Ga0265325_10004072 | |||
| 1320 | Ga0265325_10078581 | |||
| 1321 | Ga0265325_10091117 | |||
| 1322 | Ga0265325_10226670 | |||
| 1323 | Ga0265329_10005782 | |||
| 1324 | Ga0265340_10013791 | |||
| 1325 | Ga0265340_10127810 | |||
| 1326 | Ga0265339_10085273 | |||
| 1327 | Ga0265331_10089202 | |||
| 1328 | Ga0265331_10111950 | |||
| 1329 | Ga0265316_10002549 | |||
| 1330 | Ga0265316_10056234 | |||
| 1331 | Ga0265316_10161347 | |||
| 1332 | Ga0265316_10293501 | |||
| 1333 | Ga0265316_10508226 | |||
| 1334 | Ga0265313_10010912 | |||
| 1335 | Ga0265313_10084650 | |||
| 1336 | Ga0265314_10000880 | |||
| 1337 | Ga0265314_10001640 | |||
| 1338 | Ga0265314_10039808 | |||
| 1339 | Ga0265342_10119206 | |||
| 1340 | Ga0265342_10342493 | |||
| 1341 | Ga0373926_0066464 | |||
| 1342 | Ga0373926_0346829 | |||
| 1343 | Ga0373934_0003152 | |||
| 1344 | Ga0373934_0004127 | |||
| 1345 | Ga0373934_0016384 | |||
| 1346 | Ga0373934_0028295 | |||
| 1347 | Ga0373944_0050323 | |||
| 1348 | Ga0373923_0220825 | |||
| 1349 | Ga0373932_0160668 | |||
| 1350 | Ga0373953_0076521 | |||
| 1351 | Ga0373953_0215763 | |||
| 1352 | Ga0373954_0025290 | |||
| 1353 | Ga0373954_0035817 | |||
| 1354 | Ga0373954_0045442 | |||
| 1355 | Ga0373954_0079532 | |||
| 1356 | Ga0373956_0011548 | |||
| 1357 | Ga0373956_0081449 | |||
| 1358 | Ga0373956_0394414 | |||
| 1359 | Ga0373957_0007300 | |||
| 1360 | Ga0373957_0021688 | |||
| 1361 | Ga0373957_0045201 | |||
| 1362 | Ga0373957_0060443 | |||
| 1363 | Ga0373943_0015346 | |||
| 1364 | Ga0373943_0046728 | |||
| 1365 | Ga0373943_0496394 | |||
| 1366 | Ga0373946_0015396 | |||
| 1367 | Ga0373955_0056544 | |||
| 1368 | Ga0373955_0130398 | |||
| 1369 | Ga0373924_0096668 | |||
| 1370 | Ga0373924_0121725 | |||
| 1371 | Ga0373931_0264083 | |||
| 1372 | Ga0373935_0043269 | |||
| 1373 | Ga0373935_0254418 | |||
| 1374 | Ga0373935_0320602 | |||
| 1375 | Ga0373935_0817598 | |||
| 1376 | Ga0373927_0002387 | |||
| 1377 | Ga0373927_0006265 | |||
| 1378 | Ga0373927_0007986 | |||
| 1379 | Ga0373927_0018595 | |||
| 1380 | Ga0373927_0036209 | |||
| 1381 | Ga0373933_0006835 | |||
| 1382 | Ga0373933_0040651 | |||
| 1383 | Ga0373933_0119701 | |||
| 1384 | Ga0373947_0002406 | |||
| 1385 | Ga0373947_0584069 | |||
| 1386 | Ga0373947_0664277 | |||
| 1387 | Ga0373937_0004600 | |||
| 1388 | Ga0373937_0009692 | |||
| 1389 | Ga0373937_0011634 | |||
| 1390 | Ga0373937_0035714 | |||
| 1391 | Ga0373937_0052970 | |||
| 1392 | Ga0373937_0095679 | |||
| 1393 | Ga0373937_0325270 | |||
| 1394 | Ga0373937_1389082 | |||
| 1395 | Ga0373937_1597048 | |||
| 1396 | Ga0373925_0000325 | |||
| 1397 | Ga0373925_0028204 | |||
| 1398 | Ga0373925_0051155 | |||
| 1399 | Ga0373925_0116196 | |||
| 1400 | Ga0373925_0355131 | |||
| 1401 | Ga0373925_0560195 | |||
| 1402 | Ga0373925_0746959 | |||
| 1403 | Ga0395900_0248024 | |||
| 1404 | Ga0436364_0073099 | |||
| 1405 | Ga0436364_0294229 | |||
| 1406 | Ga0436364_0359395 | |||
| 1407 | Ga0436364_0540800 | |||
| 1408 | Ga0436364_0761931 | |||
| 1409 | Ga0436364_0842705 | |||
| 1410 | Ga0436364_0871212 | |||
| 1411 | Ga0436364_1279185 | |||
| 1412 | Ga0436364_1343448 | |||
| 1413 | Ga0436364_1349279 | |||
| 1414 | Ga0436364_1410943 | |||
| 1415 | Ga0436365_0155868 | |||
| 1416 | Ga0436365_0203521 | |||
| 1417 | Ga0436365_0492829 | |||
| 1418 | Ga0436365_0621920 | |||
| 1419 | Ga0436365_0867765 | |||
| 1420 | Ga0436365_0990910 | |||
| 1421 | Ga0436365_1017858 | |||
| 1422 | Ga0436365_1337599 | |||
| 1423 | Ga0436365_1801777 | |||
| 1424 | Ga0436360_0457504 | |||
| 1425 | Ga0436361_0682149 | |||
| 1426 | Ga0436363_0056399 | |||
| 1427 | Ga0436363_0115085 | |||
| 1428 | Ga0436363_0150889 | |||
| 1429 | Ga0436363_0953899 | |||
| 1430 | Ga0436362_1277351 | |||
| 1431 | Ga0451833_0603392 | |||
| 1432 | Ga0451853_0296708 | |||
| 1433 | Ga0451577_0256055 | |||
| 1434 | Ga0466965_0571439 | |||
| 1435 | Ga0466966_0064999 | |||
| 1436 | Ga0453684_0751079 | |||
| 1437 | Ga0466957_0105518 | |||
| 1438 | Ga0466959_0522949 | |||
| 1439 | Ga0466958_0599926 | |||
| 1440 | Ga0466967_0163995 | |||
| 1441 | Ga0466967_0724548 | |||
| 1442 | Ga0466967_1780378 | |||
| 1443 | Ga0495592_0150576 | |||
| 1444 | Ga0495603_0215954 | |||
| 1445 | Ga0495651_0411288 | |||
| 1446 | Ga0495653_0459241 | |||
| 1447 | Ga0495580_0051986 | |||
| 1448 | Ga0495580_0060084 | |||
| 1449 | Ga0495580_0067801 | |||
| 1450 | Ga0495580_0082909 | |||
| 1451 | Ga0495580_0252384 | |||
| 1452 | Ga0495580_0280862 | |||
| 1453 | Ga0495580_0726271 | |||
| 1454 | Ga0495582_0021058 | |||
| 1455 | Ga0495639_0242709 | |||
| 1456 | Ga0495608_0212760 | |||
| 1457 | Ga0495618_0316001 | |||
| 1458 | Ga0495628_0178714 | |||
| 1459 | Ga0495652_0048218 | |||
| 1460 | Ga0495652_0114357 | |||
| 1461 | Ga0495652_0383377 | |||
| 1462 | Ga0495652_0728735 | |||
| 1463 | Ga0495665_0031271 | |||
| 1464 | Ga0495665_0103480 | |||
| 1465 | Ga0495665_0132957 | |||
| 1466 | Ga0495665_0190836 | |||
| 1467 | Ga0495640_0146184 | |||
| 1468 | Ga0495586_0261117 | |||
| 1469 | Ga0495587_0002353 | |||
| 1470 | Ga0495645_0199887 | |||
| 1471 | Ga0495667_0065292 | |||
| 1472 | Ga0495667_0154273 | |||
| 1473 | Ga0495667_0276495 | |||
| 1474 | Ga0495635_0208472 | |||
| 1475 | Ga0495635_0253505 | |||
| 1476 | Ga0495588_0230184 | |||
| 1477 | Ga0495599_0114665 | |||
| 1478 | Ga0495599_0339641 | |||
| 1479 | Ga0495623_0478592 | |||
| 1480 | Ga0495658_0020114 | |||
| 1481 | Ga0495658_0291366 | |||
| 1482 | Ga0495669_0033341 | |||
| 1483 | Ga0495624_0136034 | |||
| 1484 | Ga0495600_0318125 | |||
| 1485 | Ga0495604_0172362 | |||
| 1486 | Ga0495636_0033889 | |||
| 1487 | Ga0495636_0213278 | |||
| 1488 | Ga0495674_0082234 | |||
| 1489 | Ga0495674_0489290 | |||
| 1490 | Ga0495674_0623826 | |||
| 1491 | Ga0495674_0745504 | |||
| 1492 | Ga0495674_0954440 | |||
| 1493 | Ga0495680_0211861 | |||
| 1494 | Ga0495680_0344324 | |||
| 1495 | Ga0495675_0070922 | |||
| 1496 | Ga0495675_0491226 | |||
| 1497 | Ga0495677_0099701 | |||
| 1498 | Ga0495684_0012410 | |||
| 1499 | Ga0495684_0045337 | |||
| 1500 | Ga0495684_0328869 | |||
| 1501 | Ga0495602_0003189 | |||
| 1502 | Ga0495602_0294378 | |||
| 1503 | Ga0495614_0336735 | |||
| 1504 | Ga0496102_0261696 | |||
| 1505 | Ga0496104_0262035 | |||
| 1506 | Ga0496104_0294841 | |||
| 1507 | Ga0496108_0913554 | |||
| 1508 | Ga0496109_0709884 | |||
| 1509 | Ga0496112_0301117 | |||
| 1510 | Ga0496112_0816357 | |||
| 1511 | Ga0496113_0638428 | |||
| 1512 | Ga0496115_0046749 | |||
| 1513 | Ga0496115_0438772 | |||
| 1514 | Ga0501239_013228 | |||
| 1515 | Ga0501249_018513 | |||
| 1516 | Ga0501253_007754 | |||
| 1517 | Ga0501257_100015 | |||
| 1518 | Ga0501273_012369 | |||
| 1519 | nmdc:mga05p37_177700_c1 | |||
| 1520 | nmdc:mga09592_1072220_c1 | |||
| 1521 | nmdc:mga09592_149842_c1 | |||
| 1522 | nmdc:mga0qj67_56946_c1 | |||
| 1523 | nmdc:mga0qj67_651406_c1 | |||
| 1524 | nmdc:mga06r32_20323_c1 | |||
| 1525 | nmdc:mga06r32_97234_c1 | |||
| 1526 | nmdc:mga0n895_586204_c1 | |||
| 1527 | Ga0495601_0386129 | |||
| 1528 | Ga0495619_0079994 | |||
| 1529 | Ga0500616_0095242 | |||
| 1530 | Ga0501082_0930079 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy