F479783

General Info

Members Datasets Scaffolds Average Seq Length
765 253 1530 179

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10674374|Ga0105241_106743742
Length 217
Sequence MSLYWRWRAPTVARQLSFLSRHFPQLGEDDFMSAAQIYTHASTTNGERLHRPVLVLNSSFEPINVCAARRALVLVLKGVAAAEEHSVGHVHSARSAIKVPSVIRLLEYRRIPHQTRALSRKNILMRDRYTCQYCMKTMSSGDLTLDHVMPRSRKGETTWENLVACCHPCNNRKGSRTPEEANMRLARAPRPFSLHTSRHLMRLLGKSDDQWRKYLFY

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 1.31
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 18.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10674374 3300009174 Bacteria 941
2 Ga0058863_10055835 3300004799 Bacteria 2389
3 Ga0058861_10170871 3300004800 Bacteria 1995
4 Ga0058862_10277535 3300004803 Bacteria 981
5 Ga0070658_10011004 3300005327 Bacteria 7252
6 Ga0070658_10086655 3300005327 Bacteria 2576
7 Ga0070658_10145716 3300005327 Bacteria 1980
8 Ga0070683_100003970 3300005329 Bacteria 12112
9 Ga0070683_100060076 3300005329 Bacteria 3532
10 Ga0070683_100156038 3300005329 Bacteria 2165
11 Ga0070683_100200935 3300005329 Bacteria 1893
12 Ga0070683_100206871 3300005329 Bacteria 1864
13 Ga0070690_100095957 3300005330 Bacteria 1959
14 Ga0070670_100431481 3300005331 Bacteria 1166
15 Ga0068869_100221306 3300005334 Bacteria 1500
16 Ga0070666_10002074 3300005335 Bacteria 12170
17 Ga0070680_100004371 3300005336 Bacteria 10632
18 Ga0070680_100007756 3300005336 Bacteria 8182
19 Ga0070680_100084736 3300005336 Bacteria 2618
20 Ga0070680_100606093 3300005336 Unclassified 940
21 Ga0070680_100727432 3300005336 Unclassified 854
22 Ga0070682_100438668 3300005337 Bacteria 997
23 Ga0068868_100067563 3300005338 Bacteria 2845
24 Ga0068868_100089529 3300005338 Bacteria 2478
25 Ga0068868_100589972 3300005338 Bacteria 983
26 Ga0070660_100149958 3300005339 Bacteria 1874
27 Ga0070660_100373813 3300005339 Bacteria 1176
28 Ga0070689_100216629 3300005340 Bacteria 1569
29 Ga0070691_10003186 3300005341 Bacteria 7351
30 Ga0070687_100746379 3300005343 Bacteria 688
31 Ga0070661_100045220 3300005344 Bacteria 3218
32 Ga0070692_10604816 3300005345 Unclassified 726
33 Ga0070692_10664794 3300005345 Unclassified 697
34 Ga0070671_100041594 3300005355 Bacteria 3820
35 Ga0070671_100188257 3300005355 Bacteria 1749
36 Ga0070673_100064763 3300005364 Bacteria 2913
37 Ga0070688_100898971 3300005365 Bacteria 698
38 Ga0070659_100070829 3300005366 Unclassified 2771
39 Ga0070667_100228103 3300005367 Bacteria 1660
40 Ga0070667_100295727 3300005367 Bacteria 1457
41 Ga0070714_100029297 3300005435 Bacteria 4577
42 Ga0070714_100163108 3300005435 Bacteria 2018
43 Ga0070714_100385129 3300005435 Bacteria 1323
44 Ga0070714_101008855 3300005435 Bacteria 810
45 Ga0070713_100001832 3300005436 Bacteria 13720
46 Ga0070713_100107197 3300005436 Unclassified 2430
47 Ga0070713_100146163 3300005436 Bacteria 2099
48 Ga0070713_100277271 3300005436 Unclassified 1537
49 Ga0070713_100329021 3300005436 Bacteria 1413
50 Ga0070713_100349892 3300005436 Bacteria 1371
51 Ga0070711_100004301 3300005439 Bacteria 8385
52 Ga0070711_100073460 3300005439 Bacteria 2416
53 Ga0070711_100238174 3300005439 Bacteria 1422
54 Ga0070711_100559380 3300005439 Bacteria 950
55 Ga0070705_100522251 3300005440 Bacteria 905
56 Ga0070694_100080231 3300005444 Bacteria 2267
57 Ga0070694_100548032 3300005444 Bacteria 926
58 Ga0070708_100343449 3300005445 Bacteria 1407
59 Ga0070678_100748586 3300005456 Unclassified 884
60 Ga0070678_101058232 3300005456 Bacteria 748
61 Ga0070678_101748839 3300005456 Unclassified 586
62 Ga0070662_100258981 3300005457 Bacteria 1401
63 Ga0070662_100547027 3300005457 Bacteria 970
64 Ga0070662_100908751 3300005457 Unclassified 751
65 Ga0070681_10040816 3300005458 Bacteria 4648
66 Ga0070681_10056361 3300005458 Bacteria 3911
67 Ga0070681_10189740 3300005458 Bacteria 1975
68 Ga0070681_10193593 3300005458 Bacteria 1953
69 Ga0070681_10283542 3300005458 Bacteria 1567
70 Ga0070681_10340837 3300005458 Bacteria 1409
71 Ga0070681_10386525 3300005458 Bacteria 1310
72 Ga0070681_10723419 3300005458 Bacteria 911
73 Ga0068867_100018808 3300005459 Bacteria 4914
74 Ga0068867_100059711 3300005459 Bacteria 2827
75 Ga0068867_100210624 3300005459 Bacteria 1561
76 Ga0068867_100358671 3300005459 Bacteria 1219
77 Ga0068867_100874504 3300005459 Unclassified 807
78 Ga0070685_10601786 3300005466 Unclassified 791
79 Ga0070707_100947143 3300005468 Unclassified 826
80 Ga0070679_100004603 3300005530 Bacteria 12733
81 Ga0070679_100034993 3300005530 Bacteria 4981
82 Ga0070679_100050498 3300005530 Bacteria 4143
83 Ga0070679_100059639 3300005530 Unclassified 3803
84 Ga0070679_100406386 3300005530 Bacteria 1307
85 Ga0070679_100890068 3300005530 Bacteria 834
86 Ga0070684_100006622 3300005535 Bacteria 8973
87 Ga0070684_100077168 3300005535 Bacteria 2942
88 Ga0070684_100079422 3300005535 Bacteria 2900
89 Ga0070684_100091797 3300005535 Bacteria 2702
90 Ga0070684_100205767 3300005535 Bacteria 1793
91 Ga0070684_100333998 3300005535 Unclassified 1393
92 Ga0070684_100343205 3300005535 Bacteria 1373
93 Ga0070684_100457052 3300005535 Bacteria 1181
94 Ga0070684_100842975 3300005535 Bacteria 858
95 Ga0070684_101698582 3300005535 Unclassified 596
96 Ga0070697_100106128 3300005536 Bacteria 2337
97 Ga0068853_100021237 3300005539 Bacteria 5409
98 Ga0068853_100025646 3300005539 Bacteria 4947
99 Ga0068853_100118462 3300005539 Bacteria 2360
100 Ga0068853_100221284 3300005539 Bacteria 1729
101 Ga0068853_100597237 3300005539 Bacteria 1048
102 Ga0070686_100290608 3300005544 Bacteria 1209
103 Ga0070686_100580061 3300005544 Unclassified 881
104 Ga0070695_100143724 3300005545 Bacteria 1657
105 Ga0070695_100284577 3300005545 Bacteria 1216
106 Ga0070695_100787441 3300005545 Unclassified 761
107 Ga0070696_101173192 3300005546 Unclassified 648
108 Ga0070693_100244017 3300005547 Unclassified 1188
109 Ga0070693_100273370 3300005547 Bacteria 1129
110 Ga0070665_100041606 3300005548 Bacteria 4620
111 Ga0070665_100079556 3300005548 Bacteria 3284
112 Ga0070665_100665222 3300005548 Bacteria 1054
113 Ga0070665_101171180 3300005548 Bacteria 780
114 Ga0070665_102202673 3300005548 Bacteria 555
115 Ga0070704_100853788 3300005549 Bacteria 816
116 Ga0068855_100003950 3300005563 Bacteria 18100
117 Ga0068855_100008856 3300005563 Bacteria 12166
118 Ga0068855_100033651 3300005563 Bacteria 6115
119 Ga0068855_100100143 3300005563 Bacteria 3337
120 Ga0068855_100113906 3300005563 Bacteria 3101
121 Ga0068855_100167415 3300005563 Bacteria 2491
122 Ga0068855_100321127 3300005563 Bacteria 1711
123 Ga0068855_100452613 3300005563 Unclassified 1400
124 Ga0068855_100880874 3300005563 Bacteria 947
125 Ga0070664_100024994 3300005564 Bacteria 4950
126 Ga0070664_100137603 3300005564 Bacteria 2148
127 Ga0070664_100140691 3300005564 Bacteria 2125
128 Ga0068857_100007886 3300005577 Bacteria 9185
129 Ga0068857_100026970 3300005577 Bacteria 5067
130 Ga0068857_100047994 3300005577 Bacteria 3791
131 Ga0068857_100167934 3300005577 Unclassified 1993
132 Ga0068856_100001598 3300005614 Bacteria 23676
133 Ga0068856_100001644 3300005614 Bacteria 23431
134 Ga0068856_100004643 3300005614 Bacteria 13644
135 Ga0068856_100011439 3300005614 Bacteria 8610
136 Ga0068856_100050979 3300005614 Bacteria 4081
137 Ga0068856_100162700 3300005614 Bacteria 2243
138 Ga0068856_100247607 3300005614 Bacteria 1797
139 Ga0068856_100334776 3300005614 Bacteria 1531
140 Ga0070702_100804184 3300005615 Unclassified 727
141 Ga0068852_100006920 3300005616 Bacteria 8247
142 Ga0068852_100015096 3300005616 Bacteria 5976
143 Ga0068852_100020042 3300005616 Bacteria 5311
144 Ga0068852_100218597 3300005616 Bacteria 1811
145 Ga0068852_100344335 3300005616 Bacteria 1454
146 Ga0068852_101086638 3300005616 Unclassified 820
147 Ga0068859_100026188 3300005617 Bacteria 5850
148 Ga0068859_100068866 3300005617 Bacteria 3573
149 Ga0068859_100265476 3300005617 Bacteria 1808
150 Ga0068859_100722760 3300005617 Bacteria 1086
151 Ga0068859_100793224 3300005617 Unclassified 1035
152 Ga0068864_100292559 3300005618 Bacteria 1523
153 Ga0068861_100057971 3300005719 Unclassified 2959
154 Ga0068870_10079181 3300005840 Bacteria 1812
155 Ga0068863_100024305 3300005841 Bacteria 5779
156 Ga0068863_100063568 3300005841 Bacteria 3491
157 Ga0068863_100107998 3300005841 Bacteria 2649
158 Ga0068863_100654497 3300005841 Bacteria 1042
159 Ga0068863_101710286 3300005841 Bacteria 639
160 Ga0068858_100075905 3300005842 Bacteria 3122
161 Ga0068858_100149192 3300005842 Bacteria 2197
162 Ga0068858_100234318 3300005842 Bacteria 1741
163 Ga0068858_100317893 3300005842 Bacteria 1487
164 Ga0068860_100401030 3300005843 Bacteria 1357
165 Ga0068860_100541225 3300005843 Bacteria 1166
166 Ga0068860_100924687 3300005843 Bacteria 889
167 Ga0070717_10005593 3300006028 Bacteria 9175
168 Ga0070717_10184516 3300006028 Unclassified 1820
169 Ga0070715_10293715 3300006163 Bacteria 867
170 Ga0070712_100071867 3300006175 Bacteria 2477
171 Ga0070712_100395022 3300006175 Bacteria 1141
172 Ga0097621_100014410 3300006237 Bacteria 5916
173 Ga0097621_100016164 3300006237 Bacteria 5634
174 Ga0097621_100026708 3300006237 Bacteria 4532
175 Ga0097621_100037955 3300006237 Bacteria 3864
176 Ga0097621_100184552 3300006237 Bacteria 1804
177 Ga0097621_100198941 3300006237 Bacteria 1739
178 Ga0097621_100389035 3300006237 Unclassified 1247
179 Ga0097621_100824273 3300006237 Bacteria 861
180 Ga0097621_101049005 3300006237 Bacteria 764
181 Ga0097621_101223130 3300006237 Bacteria 708
182 Ga0068871_100020605 3300006358 Bacteria 5054
183 Ga0068871_100085841 3300006358 Unclassified 2614
184 Ga0068871_100200435 3300006358 Bacteria 1723
185 Ga0068871_100220556 3300006358 Bacteria 1643
186 Ga0068871_100286774 3300006358 Bacteria 1442
187 Ga0068871_100364807 3300006358 Bacteria 1280
188 Ga0068871_100381380 3300006358 Unclassified 1252
189 Ga0068871_100587220 3300006358 Bacteria 1012
190 Ga0075430_100065444 3300006846 Bacteria 3054
191 Ga0075430_100070082 3300006846 Bacteria 2941
192 Ga0075430_100691407 3300006846 Bacteria 841
193 Ga0075431_100052832 3300006847 Unclassified 4189
194 Ga0075431_100071695 3300006847 Bacteria 3575
195 Ga0075431_100379014 3300006847 Bacteria 1419
196 Ga0075434_100730743 3300006871 Bacteria 1007
197 Ga0075429_100145662 3300006880 Bacteria 2073
198 Ga0075429_100714923 3300006880 Bacteria 877
199 Ga0075429_101102806 3300006880 Unclassified 693
200 Ga0068865_100055118 3300006881 Bacteria 2765
201 Ga0068865_100333085 3300006881 Unclassified 1224
202 Ga0075436_100000433 3300006914 Bacteria 26867
203 Ga0075436_100000610 3300006914 Bacteria 23409
204 Ga0075436_100740348 3300006914 Unclassified 730
205 Ga0097620_100026188 3300006931 Bacteria 5850
206 Ga0097620_100068868 3300006931 Bacteria 3573
207 Ga0097620_100265476 3300006931 Bacteria 1808
208 Ga0097620_100722757 3300006931 Bacteria 1086
209 Ga0097620_100793309 3300006931 Unclassified 1035
210 Ga0075435_100416547 3300007076 Bacteria 1157
211 Ga0075435_101155071 3300007076 Bacteria 677
212 Ga0105240_10000349 3300009093 Bacteria 86505
213 Ga0105240_10001515 3300009093 Bacteria 39538
214 Ga0105240_10002790 3300009093 Bacteria 27622
215 Ga0105240_10006796 3300009093 Bacteria 16736
216 Ga0105240_10072107 3300009093 Unclassified 4269
217 Ga0105240_10100225 3300009093 Bacteria 3525
218 Ga0105240_10154719 3300009093 Unclassified 2728
219 Ga0105240_10217670 3300009093 Bacteria 2227
220 Ga0105240_10229613 3300009093 Bacteria 2158
221 Ga0105240_10340313 3300009093 Bacteria 1704
222 Ga0105240_10468019 3300009093 Unclassified 1407
223 Ga0105240_10552846 3300009093 Unclassified 1273
224 Ga0105240_10559090 3300009093 Bacteria 1265
225 Ga0105240_10635804 3300009093 Bacteria 1171
226 Ga0105245_10005156 3300009098 Bacteria 11479
227 Ga0105245_10008021 3300009098 Bacteria 9235
228 Ga0105245_10010932 3300009098 Bacteria 7897
229 Ga0105245_10058437 3300009098 Bacteria 3471
230 Ga0105245_10087747 3300009098 Bacteria 2856
231 Ga0105245_10104426 3300009098 Bacteria 2627
232 Ga0105245_10169090 3300009098 Bacteria 2080
233 Ga0105245_10213413 3300009098 Bacteria 1859
234 Ga0105245_10781176 3300009098 Bacteria 992
235 Ga0105245_10964719 3300009098 Bacteria 896
236 Ga0105245_11057382 3300009098 Unclassified 857
237 Ga0105245_11103576 3300009098 Unclassified 840
238 Ga0114129_10200933 3300009147 Bacteria 2699
239 Ga0114129_11210486 3300009147 Unclassified 940
240 Ga0105243_10200729 3300009148 Unclassified 1749
241 Ga0105243_10581625 3300009148 Bacteria 1075
242 Ga0105243_10592581 3300009148 Bacteria 1066
243 Ga0105241_10020683 3300009174 Bacteria 4862
244 Ga0105241_10041193 3300009174 Bacteria 3489
245 Ga0105241_10069983 3300009174 Bacteria 2721
246 Ga0105241_10130027 3300009174 Unclassified 2037
247 Ga0105241_10233603 3300009174 Bacteria 1551
248 Ga0105241_11051554 3300009174 Unclassified 764
249 Ga0105241_11175597 3300009174 Unclassified 725
250 Ga0105241_11377655 3300009174 Bacteria 674
251 Ga0105242_10011002 3300009176 Bacteria 6950
252 Ga0105242_10020652 3300009176 Bacteria 5167
253 Ga0105242_10078416 3300009176 Bacteria 2757
254 Ga0105242_10095244 3300009176 Bacteria 2513
255 Ga0105242_10096982 3300009176 Bacteria 2492
256 Ga0105242_10275025 3300009176 Bacteria 1527
257 Ga0105242_10499093 3300009176 Bacteria 1157
258 Ga0105242_10630404 3300009176 Bacteria 1040
259 Ga0105248_10037550 3300009177 Bacteria 5419
260 Ga0105248_10075116 3300009177 Bacteria 3799
261 Ga0105248_10126153 3300009177 Bacteria 2887
262 Ga0105248_10299027 3300009177 Bacteria 1812
263 Ga0105248_10765772 3300009177 Bacteria 1089
264 Ga0105248_10833522 3300009177 Bacteria 1041
265 Ga0105248_10931661 3300009177 Bacteria 981
266 Ga0105248_10996406 3300009177 Bacteria 946
267 Ga0105237_10053637 3300009545 Bacteria 4043
268 Ga0105237_10073049 3300009545 Bacteria 3423
269 Ga0105237_10103568 3300009545 Bacteria 2838
270 Ga0105237_10105477 3300009545 Bacteria 2809
271 Ga0105237_10209612 3300009545 Bacteria 1949
272 Ga0105237_10275703 3300009545 Bacteria 1684
273 Ga0105237_10339084 3300009545 Unclassified 1508
274 Ga0105237_10382690 3300009545 Bacteria 1412
275 Ga0105237_10764610 3300009545 Unclassified 973
276 Ga0105238_10002354 3300009551 Bacteria 19010
277 Ga0105238_10012086 3300009551 Bacteria 8701
278 Ga0105238_10062533 3300009551 Bacteria 3723
279 Ga0105238_10064021 3300009551 Bacteria 3678
280 Ga0105238_10203759 3300009551 Bacteria 1954
281 Ga0105238_10209366 3300009551 Bacteria 1926
282 Ga0105238_10210433 3300009551 Bacteria 1921
283 Ga0105238_10266133 3300009551 Bacteria 1694
284 Ga0105238_10569373 3300009551 Bacteria 1138
285 Ga0105238_11651757 3300009551 Unclassified 671
286 Ga0105249_10072999 3300009553 Bacteria 3173
287 Ga0105249_10885992 3300009553 Bacteria 959
288 Ga0105249_10988568 3300009553 Bacteria 910
289 Ga0105239_10016402 3300010375 Bacteria 8192
290 Ga0105239_10050610 3300010375 Bacteria 4556
291 Ga0105239_10064060 3300010375 Bacteria 4035
292 Ga0105239_10104959 3300010375 Bacteria 3129
293 Ga0105239_10267789 3300010375 Unclassified 1921
294 Ga0105246_10012166 3300011119 Bacteria 5361
295 Ga0105246_10021960 3300011119 Bacteria 4114
296 Ga0105246_10127408 3300011119 Bacteria 1896
297 Ga0105246_10168132 3300011119 Bacteria 1677
298 Ga0105246_10197928 3300011119 Unclassified 1560
299 Ga0157370_10001930 3300013104 Bacteria 25516
300 Ga0157370_10005751 3300013104 Bacteria 13869
301 Ga0157370_10039967 3300013104 Bacteria 4531
302 Ga0157370_10058352 3300013104 Bacteria 3669
303 Ga0157370_10180674 3300013104 Bacteria 1961
304 Ga0157370_10421135 3300013104 Bacteria 1228
305 Ga0157370_10422110 3300013104 Bacteria 1227
306 Ga0157370_10669056 3300013104 Unclassified 948
307 Ga0157369_10002355 3300013105 Bacteria 22728
308 Ga0157369_10003128 3300013105 Bacteria 19781
309 Ga0157369_10004900 3300013105 Bacteria 15699
310 Ga0157369_10053159 3300013105 Bacteria 4379
311 Ga0157369_10055113 3300013105 Bacteria 4292
312 Ga0157369_10094341 3300013105 Bacteria 3194
313 Ga0157369_10399913 3300013105 Bacteria 1425
314 Ga0157369_10518765 3300013105 Bacteria 1233
315 Ga0157369_11445447 3300013105 Bacteria 700
316 Ga0157374_10007562 3300013296 Bacteria 9273
317 Ga0157374_10019718 3300013296 Bacteria 5973
318 Ga0157374_10050444 3300013296 Bacteria 3868
319 Ga0157374_10103084 3300013296 Bacteria 2737
320 Ga0157374_10184458 3300013296 Bacteria 2039
321 Ga0157374_10266257 3300013296 Bacteria 1689
322 Ga0157374_10301838 3300013296 Bacteria 1584
323 Ga0157374_10312738 3300013296 Bacteria 1555
324 Ga0157378_10004469 3300013297 Bacteria 12281
325 Ga0157378_10044690 3300013297 Bacteria 3934
326 Ga0157378_10085598 3300013297 Bacteria 2856
327 Ga0157378_10127603 3300013297 Unclassified 2351
328 Ga0157378_10254977 3300013297 Unclassified 1681
329 Ga0157378_10293365 3300013297 Unclassified 1571
330 Ga0157378_10663523 3300013297 Bacteria 1059
331 Ga0163162_10034883 3300013306 Bacteria 5008
332 Ga0163162_10159915 3300013306 Bacteria 2374
333 Ga0163162_10288399 3300013306 Bacteria 1773
334 Ga0163162_10438724 3300013306 Unclassified 1438
335 Ga0163162_10547935 3300013306 Bacteria 1285
336 Ga0157372_10006227 3300013307 Bacteria 12685
337 Ga0157372_10013396 3300013307 Bacteria 8756
338 Ga0157372_10020489 3300013307 Bacteria 7136
339 Ga0157372_10042054 3300013307 Bacteria 5053
340 Ga0157372_10102357 3300013307 Bacteria 3272
341 Ga0157372_10140275 3300013307 Bacteria 2784
342 Ga0157372_10863619 3300013307 Bacteria 1050
343 Ga0157375_10460108 3300013308 Bacteria 1438
344 Ga0157375_10522069 3300013308 Bacteria 1351
345 Ga0157375_10762912 3300013308 Bacteria 1118
346 Ga0163163_10013925 3300014325 Bacteria 7379
347 Ga0163163_10032380 3300014325 Bacteria 5048
348 Ga0163163_10073508 3300014325 Unclassified 3410
349 Ga0163163_10086019 3300014325 Bacteria 3152
350 Ga0163163_10149662 3300014325 Bacteria 2378
351 Ga0163163_10198573 3300014325 Bacteria 2054
352 Ga0163163_10286181 3300014325 Unclassified 1700
353 Ga0157380_11558862 3300014326 Unclassified 715
354 Ga0157379_10080358 3300014968 Bacteria 2920
355 Ga0157379_10154880 3300014968 Bacteria 2067
356 Ga0157379_10472029 3300014968 Bacteria 1160
357 Ga0157379_11009331 3300014968 Bacteria 794
358 Ga0157376_10070175 3300014969 Bacteria 2973
359 Ga0157376_10089344 3300014969 Bacteria 2664
360 Ga0157376_10600138 3300014969 Bacteria 1096
361 Ga0157376_10780711 3300014969 Bacteria 967
362 Ga0206354_10342106 3300020081 Bacteria 630
363 Ga0213872_10000499 3300021361 Bacteria 31417
364 Ga0213874_10002410 3300021377 Bacteria 4024
365 Ga0213874_10040610 3300021377 Bacteria 1390
366 Ga0213875_10000006 3300021388 Bacteria 579005
367 Ga0213875_10001205 3300021388 Bacteria 17615
368 Ga0213875_10007434 3300021388 Bacteria 5659
369 Ga0213875_10011894 3300021388 Bacteria 4315
370 Ga0213875_10034521 3300021388 Bacteria 2388
371 Ga0213875_10135508 3300021388 Bacteria 1152
372 Ga0213875_10157315 3300021388 Bacteria 1066
373 Ga0224712_10019972 3300022467 Unclassified 2267
374 Ga0207682_10315192 3300025893 Unclassified 734
375 Ga0207692_10102166 3300025898 Bacteria 1576
376 Ga0207680_10037048 3300025903 Bacteria 2813
377 Ga0207680_10929485 3300025903 Unclassified 623
378 Ga0207699_10007985 3300025906 Bacteria 5197
379 Ga0207699_10323141 3300025906 Unclassified 1083
380 Ga0207705_10247308 3300025909 Bacteria 1359
381 Ga0207705_10368079 3300025909 Unclassified 1109
382 Ga0207705_10645425 3300025909 Unclassified 823
383 Ga0207654_10043017 3300025911 Unclassified 2558
384 Ga0207654_10054089 3300025911 Bacteria 2319
385 Ga0207654_10103046 3300025911 Bacteria 1761
386 Ga0207654_10420462 3300025911 Bacteria 932
387 Ga0207654_10514308 3300025911 Unclassified 847
388 Ga0207707_10089526 3300025912 Bacteria 2690
389 Ga0207707_10116084 3300025912 Bacteria 2339
390 Ga0207707_10290157 3300025912 Bacteria 1415
391 Ga0207707_10370002 3300025912 Bacteria 1233
392 Ga0207707_10453000 3300025912 Unclassified 1098
393 Ga0207707_10555091 3300025912 Bacteria 975
394 Ga0207707_10701752 3300025912 Unclassified 849
395 Ga0207695_10001613 3300025913 Bacteria 36581
396 Ga0207695_10005025 3300025913 Bacteria 17763
397 Ga0207695_10010155 3300025913 Bacteria 11552
398 Ga0207695_10012905 3300025913 Bacteria 9998
399 Ga0207695_10030330 3300025913 Bacteria 5954
400 Ga0207695_10125235 3300025913 Unclassified 2533
401 Ga0207695_10228318 3300025913 Unclassified 1767
402 Ga0207695_10290866 3300025913 Bacteria 1526
403 Ga0207695_10637301 3300025913 Bacteria 947
404 Ga0207671_10009573 3300025914 Bacteria 8079
405 Ga0207671_10091422 3300025914 Bacteria 2293
406 Ga0207671_10146229 3300025914 Bacteria 1824
407 Ga0207671_10176028 3300025914 Bacteria 1663
408 Ga0207671_10312073 3300025914 Bacteria 1243
409 Ga0207693_10488256 3300025915 Bacteria 962
410 Ga0207663_10070662 3300025916 Bacteria 2250
411 Ga0207663_10126872 3300025916 Bacteria 1756
412 Ga0207660_10019312 3300025917 Bacteria 4554
413 Ga0207660_10232574 3300025917 Bacteria 1450
414 Ga0207662_10208959 3300025918 Bacteria 1266
415 Ga0207657_10086368 3300025919 Bacteria 2626
416 Ga0207657_10123370 3300025919 Bacteria 2129
417 Ga0207657_10126212 3300025919 Bacteria 2101
418 Ga0207657_10160796 3300025919 Bacteria 1824
419 Ga0207649_10072938 3300025920 Bacteria 2198
420 Ga0207649_10436673 3300025920 Bacteria 986
421 Ga0207652_10234898 3300025921 Bacteria 1652
422 Ga0207652_10492513 3300025921 Bacteria 1104
423 Ga0207652_10823769 3300025921 Unclassified 823
424 Ga0207652_11055082 3300025921 Bacteria 712
425 Ga0207694_10002147 3300025924 Bacteria 16201
426 Ga0207694_10006310 3300025924 Bacteria 9052
427 Ga0207694_10010361 3300025924 Bacteria 7027
428 Ga0207694_10049427 3300025924 Bacteria 3256
429 Ga0207694_10057282 3300025924 Bacteria 3029
430 Ga0207694_10064261 3300025924 Unclassified 2860
431 Ga0207694_10244441 3300025924 Bacteria 1467
432 Ga0207650_10614701 3300025925 Unclassified 914
433 Ga0207687_10000181 3300025927 Bacteria 41696
434 Ga0207687_10003605 3300025927 Bacteria 10423
435 Ga0207687_10049914 3300025927 Bacteria 2911
436 Ga0207687_10053378 3300025927 Bacteria 2824
437 Ga0207687_10063500 3300025927 Bacteria 2615
438 Ga0207687_10278717 3300025927 Bacteria 1339
439 Ga0207687_10282308 3300025927 Unclassified 1331
440 Ga0207687_10372949 3300025927 Bacteria 1167
441 Ga0207687_10570774 3300025927 Bacteria 951
442 Ga0207700_10001815 3300025928 Bacteria 12132
443 Ga0207700_10221550 3300025928 Bacteria 1604
444 Ga0207700_10242428 3300025928 Unclassified 1537
445 Ga0207700_10365108 3300025928 Bacteria 1259
446 Ga0207700_10551946 3300025928 Unclassified 1023
447 Ga0207664_10012079 3300025929 Bacteria 6167
448 Ga0207664_10051951 3300025929 Unclassified 3239
449 Ga0207664_10333575 3300025929 Bacteria 1340
450 Ga0207644_10028476 3300025931 Bacteria 3868
451 Ga0207644_10532988 3300025931 Unclassified 971
452 Ga0207690_10029369 3300025932 Bacteria 3495
453 Ga0207690_10205791 3300025932 Bacteria 1497
454 Ga0207706_10054690 3300025933 Bacteria 3522
455 Ga0207686_10002190 3300025934 Bacteria 10754
456 Ga0207686_10010199 3300025934 Bacteria 5108
457 Ga0207686_10017270 3300025934 Bacteria 4064
458 Ga0207686_10198089 3300025934 Unclassified 1436
459 Ga0207686_10222864 3300025934 Bacteria 1363
460 Ga0207709_10424539 3300025935 Unclassified 1022
461 Ga0207669_10232981 3300025937 Bacteria 1360
462 Ga0207704_10228075 3300025938 Unclassified 1383
463 Ga0207704_10783241 3300025938 Bacteria 795
464 Ga0207665_10550076 3300025939 Bacteria 897
465 Ga0207665_10843285 3300025939 Bacteria 725
466 Ga0207711_10004497 3300025941 Bacteria 11880
467 Ga0207711_10009349 3300025941 Bacteria 8185
468 Ga0207711_10200042 3300025941 Bacteria 1823
469 Ga0207711_10230651 3300025941 Bacteria 1695
470 Ga0207711_10369854 3300025941 Bacteria 1329
471 Ga0207711_10502564 3300025941 Bacteria 1130
472 Ga0207711_11114318 3300025941 Bacteria 730
473 Ga0207689_10060470 3300025942 Bacteria 3116
474 Ga0207689_10336951 3300025942 Bacteria 1253
475 Ga0207661_10000376 3300025944 Bacteria 28667
476 Ga0207661_10024773 3300025944 Bacteria 4552
477 Ga0207661_10087213 3300025944 Bacteria 2591
478 Ga0207661_10211598 3300025944 Bacteria 1709
479 Ga0207679_10115811 3300025945 Bacteria 2124
480 Ga0207679_10152875 3300025945 Bacteria 1881
481 Ga0207667_10000253 3300025949 Bacteria 75314
482 Ga0207667_10004724 3300025949 Bacteria 16679
483 Ga0207667_10005315 3300025949 Bacteria 15692
484 Ga0207667_10009573 3300025949 Bacteria 11401
485 Ga0207667_10011851 3300025949 Bacteria 10100
486 Ga0207667_10027727 3300025949 Bacteria 6161
487 Ga0207667_10129228 3300025949 Bacteria 2602
488 Ga0207667_10194823 3300025949 Bacteria 2079
489 Ga0207667_10281655 3300025949 Bacteria 1699
490 Ga0207667_10517156 3300025949 Bacteria 1209
491 Ga0207667_10714399 3300025949 Unclassified 1004
492 Ga0207651_10043824 3300025960 Unclassified 2989
493 Ga0207651_10252053 3300025960 Bacteria 1445
494 Ga0207712_10008857 3300025961 Bacteria 6363
495 Ga0207712_10076871 3300025961 Bacteria 2418
496 Ga0207712_10224234 3300025961 Bacteria 1504
497 Ga0207640_10278370 3300025981 Bacteria 1313
498 Ga0207640_10761731 3300025981 Bacteria 835
499 Ga0207658_10074034 3300025986 Bacteria 2587
500 Ga0207658_10141989 3300025986 Unclassified 1944
501 Ga0207658_10252923 3300025986 Bacteria 1498
502 Ga0207658_10845548 3300025986 Unclassified 832
503 Ga0207677_10011910 3300026023 Bacteria 4979
504 Ga0207677_10056195 3300026023 Bacteria 2695
505 Ga0207677_10906240 3300026023 Bacteria 795
506 Ga0207639_10031605 3300026041 Bacteria 3892
507 Ga0207639_10227783 3300026041 Bacteria 1614
508 Ga0207702_10002817 3300026078 Bacteria 16263
509 Ga0207702_10029471 3300026078 Bacteria 4567
510 Ga0207702_10031362 3300026078 Bacteria 4430
511 Ga0207702_10075440 3300026078 Bacteria 2913
512 Ga0207702_10121069 3300026078 Bacteria 2342
513 Ga0207702_10121644 3300026078 Bacteria 2337
514 Ga0207702_10148128 3300026078 Bacteria 2132
515 Ga0207702_10254993 3300026078 Unclassified 1649
516 Ga0207702_10382196 3300026078 Bacteria 1354
517 Ga0207702_11003902 3300026078 Unclassified 828
518 Ga0207641_10051693 3300026088 Bacteria 3480
519 Ga0207641_10086199 3300026088 Bacteria 2738
520 Ga0207641_10259427 3300026088 Bacteria 1626
521 Ga0207648_10030543 3300026089 Bacteria 4770
522 Ga0207648_10117602 3300026089 Bacteria 2336
523 Ga0207648_10193762 3300026089 Bacteria 1802
524 Ga0207676_10189159 3300026095 Bacteria 1810
525 Ga0207676_10223026 3300026095 Bacteria 1680
526 Ga0207674_10000097 3300026116 Bacteria 98549
527 Ga0207674_10001765 3300026116 Bacteria 27659
528 Ga0207674_10013528 3300026116 Bacteria 9048
529 Ga0207674_10027603 3300026116 Bacteria 6002
530 Ga0207674_11040235 3300026116 Bacteria 788
531 Ga0207683_10134007 3300026121 Bacteria 2229
532 Ga0207683_11233600 3300026121 Unclassified 693
533 Ga0207683_11671559 3300026121 Unclassified 586
534 Ga0207698_10009971 3300026142 Bacteria 6079
535 Ga0207698_10014353 3300026142 Bacteria 5263
536 Ga0207698_10193627 3300026142 Bacteria 1814
537 Ga0207698_10208145 3300026142 Bacteria 1758
538 Ga0207698_10571568 3300026142 Bacteria 1111
539 Ga0207698_11128972 3300026142 Unclassified 797
540 Ga0207698_11541182 3300026142 Bacteria 680
541 Ga0268266_10031482 3300028379 Bacteria 4505
542 Ga0268266_10244099 3300028379 Unclassified 1659
543 Ga0268266_11217620 3300028379 Bacteria 728
544 Ga0268264_10053776 3300028381 Bacteria 3360
545 Ga0268264_10179158 3300028381 Bacteria 1923
546 Ga0268264_10928311 3300028381 Bacteria 875
547 Ga0268264_11070067 3300028381 Bacteria 814
548 Ga0265336_10023881 3300028666 Bacteria 1936
549 Ga0265338_10015521 3300028800 Bacteria 8359
550 Ga0265338_10161674 3300028800 Bacteria 1729
551 Ga0265338_10219751 3300028800 Unclassified 1420
552 Ga0265330_10205696 3300031235 Bacteria 832
553 Ga0265332_10020979 3300031238 Bacteria 2885
554 Ga0265325_10004072 3300031241 Bacteria 9313
555 Ga0265325_10078581 3300031241 Bacteria 1643
556 Ga0265325_10091117 3300031241 Unclassified 1503
557 Ga0265325_10226670 3300031241 Bacteria 853
558 Ga0265329_10005782 3300031242 Bacteria 4966
559 Ga0265340_10013791 3300031247 Unclassified 4237
560 Ga0265340_10127810 3300031247 Bacteria 1167
561 Ga0265339_10085273 3300031249 Unclassified 1663
562 Ga0265331_10089202 3300031250 Bacteria 1426
563 Ga0265331_10111950 3300031250 Bacteria 1252
564 Ga0265316_10002549 3300031344 Bacteria 18826
565 Ga0265316_10056234 3300031344 Bacteria 3074
566 Ga0265316_10161347 3300031344 Bacteria 1676
567 Ga0265316_10293501 3300031344 Bacteria 1186
568 Ga0265316_10508226 3300031344 Unclassified 860
569 Ga0265313_10010912 3300031595 Bacteria 5696
570 Ga0265313_10084650 3300031595 Bacteria 1434
571 Ga0265314_10000880 3300031711 Bacteria 35806
572 Ga0265314_10001640 3300031711 Bacteria 24496
573 Ga0265314_10039808 3300031711 Bacteria 3381
574 Ga0265342_10119206 3300031712 Bacteria 1487
575 Ga0265342_10342493 3300031712 Bacteria 780
576 Ga0373926_0066464 3300035083 Unclassified 1320
577 Ga0373926_0346829 3300035083 Bacteria 583
578 Ga0373934_0003152 3300035086 Bacteria 6016
579 Ga0373934_0004127 3300035086 Bacteria 5354
580 Ga0373934_0016384 3300035086 Bacteria 2818
581 Ga0373934_0028295 3300035086 Bacteria 2183
582 Ga0373944_0050323 3300035089 Bacteria 1312
583 Ga0373923_0220825 3300035111 Bacteria 881
584 Ga0373932_0160668 3300035112 Bacteria 777
585 Ga0373953_0076521 3300035117 Unclassified 1387
586 Ga0373953_0215763 3300035117 Bacteria 831
587 Ga0373954_0025290 3300035118 Bacteria 2713
588 Ga0373954_0035817 3300035118 Bacteria 2302
589 Ga0373954_0045442 3300035118 Bacteria 2052
590 Ga0373954_0079532 3300035118 Bacteria 1565
591 Ga0373956_0011548 3300035119 Bacteria 3643
592 Ga0373956_0081449 3300035119 Bacteria 1485
593 Ga0373956_0394414 3300035119 Unclassified 660
594 Ga0373957_0007300 3300035120 Bacteria 3533
595 Ga0373957_0021688 3300035120 Bacteria 2283
596 Ga0373957_0045201 3300035120 Bacteria 1668
597 Ga0373957_0060443 3300035120 Bacteria 1467
598 Ga0373943_0015346 3300035170 Unclassified 3478
599 Ga0373943_0046728 3300035170 Unclassified 2114
600 Ga0373943_0496394 3300035170 Unclassified 713
601 Ga0373946_0015396 3300035171 Unclassified 2900
602 Ga0373955_0056544 3300035172 Bacteria 2153
603 Ga0373955_0130398 3300035172 Bacteria 1467
604 Ga0373924_0096668 3300035410 Bacteria 1268
605 Ga0373924_0121725 3300035410 Bacteria 1132
606 Ga0373931_0264083 3300035691 Unclassified 1051
607 Ga0373935_0043269 3300035692 Bacteria 2834
608 Ga0373935_0254418 3300035692 Bacteria 1230
609 Ga0373935_0320602 3300035692 Unclassified 1099
610 Ga0373935_0817598 3300035692 Unclassified 688
611 Ga0373927_0002387 3300035695 Bacteria 13689
612 Ga0373927_0006265 3300035695 Bacteria 8122
613 Ga0373927_0007986 3300035695 Bacteria 7146
614 Ga0373927_0018595 3300035695 Bacteria 4563
615 Ga0373927_0036209 3300035695 Unclassified 3210
616 Ga0373933_0006835 3300035724 Bacteria 6210
617 Ga0373933_0040651 3300035724 Bacteria 2741
618 Ga0373933_0119701 3300035724 Bacteria 1648
619 Ga0373947_0002406 3300035725 Bacteria 11308
620 Ga0373947_0584069 3300035725 Bacteria 761
621 Ga0373947_0664277 3300035725 Bacteria 711
622 Ga0373937_0004600 3300036401 Bacteria 11706
623 Ga0373937_0009692 3300036401 Bacteria 8393
624 Ga0373937_0011634 3300036401 Bacteria 7725
625 Ga0373937_0035714 3300036401 Bacteria 4525
626 Ga0373937_0052970 3300036401 Bacteria 3722
627 Ga0373937_0095679 3300036401 Bacteria 2754
628 Ga0373937_0325270 3300036401 Bacteria 1455
629 Ga0373937_1389082 3300036401 Bacteria 650
630 Ga0373937_1597048 3300036401 Bacteria 599
631 Ga0373925_0000325 3300037068 Bacteria 49853
632 Ga0373925_0028204 3300037068 Unclassified 4112
633 Ga0373925_0051155 3300037068 Bacteria 3083
634 Ga0373925_0116196 3300037068 Bacteria 2072
635 Ga0373925_0355131 3300037068 Bacteria 1191
636 Ga0373925_0560195 3300037068 Unclassified 940
637 Ga0373925_0746959 3300037068 Bacteria 807
638 Ga0395900_0248024 3300037418 Bacteria 1783
639 Ga0436364_0073099 3300037853 Bacteria 1882
640 Ga0436364_0294229 3300037853 Bacteria 17589
641 Ga0436364_0359395 3300037853 Bacteria 10817
642 Ga0436364_0540800 3300037853 Bacteria 976
643 Ga0436364_0761931 3300037853 Bacteria 1407
644 Ga0436364_0842705 3300037853 Bacteria 2216
645 Ga0436364_0871212 3300037853 Bacteria 2157
646 Ga0436364_1279185 3300037853 Unclassified 1506
647 Ga0436364_1343448 3300037853 Bacteria 154245
648 Ga0436364_1349279 3300037853 Bacteria 2860
649 Ga0436364_1410943 3300037853 Bacteria 26265
650 Ga0436365_0155868 3300039437 Bacteria 1431
651 Ga0436365_0203521 3300039437 Bacteria 5658
652 Ga0436365_0492829 3300039437 Bacteria 870
653 Ga0436365_0621920 3300039437 Bacteria 7307
654 Ga0436365_0867765 3300039437 Bacteria 6831
655 Ga0436365_0990910 3300039437 Bacteria 1633
656 Ga0436365_1017858 3300039437 Bacteria 6482
657 Ga0436365_1337599 3300039437 Bacteria 2388
658 Ga0436365_1801777 3300039437 Bacteria 2319
659 Ga0436360_0457504 3300039438 Bacteria 1533
660 Ga0436361_0682149 3300039447 Bacteria 833
661 Ga0436363_0056399 3300039450 Bacteria 1576
662 Ga0436363_0115085 3300039450 Bacteria 5275
663 Ga0436363_0150889 3300039450 Bacteria 7062
664 Ga0436363_0953899 3300039450 Bacteria 2211
665 Ga0436362_1277351 3300039453 Unclassified 1421
666 Ga0451833_0603392 3300041491 Unclassified 669
667 Ga0451853_0296708 3300041512 Unclassified 663
668 Ga0451577_0256055 3300042876 Bacteria 1585
669 Ga0466965_0571439 3300044683 Unclassified 640
670 Ga0466966_0064999 3300044684 Bacteria 2295
671 Ga0453684_0751079 3300044712 Unclassified 1056
672 Ga0466957_0105518 3300044842 Bacteria 1781
673 Ga0466959_0522949 3300045049 Unclassified 801
674 Ga0466958_0599926 3300045836 Unclassified 716
675 Ga0466967_0163995 3300045976 Bacteria 2088
676 Ga0466967_0724548 3300045976 Bacteria 986
677 Ga0466967_1780378 3300045976 Unclassified 613
678 Ga0495592_0150576 3300046454 Bacteria 1609
679 Ga0495603_0215954 3300046455 Bacteria 1107
680 Ga0495651_0411288 3300046462 Bacteria 881
681 Ga0495653_0459241 3300046463 Unclassified 800
682 Ga0495580_0051986 3300046472 Bacteria 2895
683 Ga0495580_0060084 3300046472 Bacteria 2671
684 Ga0495580_0067801 3300046472 Bacteria 2496
685 Ga0495580_0082909 3300046472 Bacteria 2235
686 Ga0495580_0252384 3300046472 Bacteria 1207
687 Ga0495580_0280862 3300046472 Bacteria 1136
688 Ga0495580_0726271 3300046472 Bacteria 648
689 Ga0495582_0021058 3300046473 Bacteria 3570
690 Ga0495639_0242709 3300046475 Bacteria 889
691 Ga0495608_0212760 3300046511 Bacteria 1215
692 Ga0495618_0316001 3300046514 Bacteria 968
693 Ga0495628_0178714 3300046516 Bacteria 1606
694 Ga0495652_0048218 3300046529 Bacteria 3651
695 Ga0495652_0114357 3300046529 Bacteria 2165
696 Ga0495652_0383377 3300046529 Bacteria 999
697 Ga0495652_0728735 3300046529 Bacteria 665
698 Ga0495665_0031271 3300046531 Unclassified 2849
699 Ga0495665_0103480 3300046531 Bacteria 1494
700 Ga0495665_0132957 3300046531 Unclassified 1302
701 Ga0495665_0190836 3300046531 Bacteria 1063
702 Ga0495640_0146184 3300046533 Bacteria 1521
703 Ga0495586_0261117 3300046535 Bacteria 989
704 Ga0495587_0002353 3300046536 Bacteria 12629
705 Ga0495645_0199887 3300046543 Bacteria 1357
706 Ga0495667_0065292 3300046559 Unclassified 2381
707 Ga0495667_0154273 3300046559 Bacteria 1478
708 Ga0495667_0276495 3300046559 Bacteria 1066
709 Ga0495635_0208472 3300046663 Bacteria 1324
710 Ga0495635_0253505 3300046663 Bacteria 1186
711 Ga0495588_0230184 3300046674 Bacteria 978
712 Ga0495599_0114665 3300046678 Bacteria 1677
713 Ga0495599_0339641 3300046678 Bacteria 902
714 Ga0495623_0478592 3300046679 Unclassified 660
715 Ga0495658_0020114 3300046683 Bacteria 3497
716 Ga0495658_0291366 3300046683 Bacteria 1031
717 Ga0495669_0033341 3300046684 Bacteria 2266
718 Ga0495624_0136034 3300046690 Unclassified 1506
719 Ga0495600_0318125 3300046809 Bacteria 979
720 Ga0495604_0172362 3300047317 Unclassified 1520
721 Ga0495636_0033889 3300047318 Unclassified 2100
722 Ga0495636_0213278 3300047318 Bacteria 884
723 Ga0495674_0082234 3300047319 Unclassified 2761
724 Ga0495674_0489290 3300047319 Unclassified 985
725 Ga0495674_0623826 3300047319 Bacteria 852
726 Ga0495674_0745504 3300047319 Bacteria 766
727 Ga0495674_0954440 3300047319 Bacteria 659
728 Ga0495680_0211861 3300047322 Bacteria 1387
729 Ga0495680_0344324 3300047322 Bacteria 1039
730 Ga0495675_0070922 3300047444 Bacteria 2200
731 Ga0495675_0491226 3300047444 Unclassified 706
732 Ga0495677_0099701 3300047445 Bacteria 1099
733 Ga0495684_0012410 3300047471 Bacteria 6571
734 Ga0495684_0045337 3300047471 Bacteria 3365
735 Ga0495684_0328869 3300047471 Unclassified 1091
736 Ga0495602_0003189 3300048088 Bacteria 16916
737 Ga0495602_0294378 3300048088 Unclassified 1190
738 Ga0495614_0336735 3300048089 Unclassified 702
739 Ga0496102_0261696 3300048905 Bacteria 1631
740 Ga0496104_0262035 3300048907 Bacteria 1641
741 Ga0496104_0294841 3300048907 Bacteria 1534
742 Ga0496108_0913554 3300048911 Bacteria 753
743 Ga0496109_0709884 3300048912 Bacteria 943
744 Ga0496112_0301117 3300048915 Bacteria 1549
745 Ga0496112_0816357 3300048915 Unclassified 857
746 Ga0496113_0638428 3300048916 Unclassified 852
747 Ga0496115_0046749 3300048918 Bacteria 3460
748 Ga0496115_0438772 3300048918 Bacteria 1056
749 Ga0501239_013228 3300049672 Bacteria 942
750 Ga0501249_018513 3300049679 Bacteria 1507
751 Ga0501253_007754 3300049683 Bacteria 1513
752 Ga0501257_100015 3300049686 Unclassified 761
753 Ga0501273_012369 3300049770 Bacteria 1075
754 nmdc:mga05p37_177700_c1 3300050507 Bacteria 1493
755 nmdc:mga09592_1072220_c1 3300050508 Unclassified 671
756 nmdc:mga09592_149842_c1 3300050508 Unclassified 2012
757 nmdc:mga0qj67_56946_c1 3300050509 Bacteria 3099
758 nmdc:mga0qj67_651406_c1 3300050509 Bacteria 840
759 nmdc:mga06r32_20323_c1 3300050510 Bacteria 6111
760 nmdc:mga06r32_97234_c1 3300050510 Unclassified 2885
761 nmdc:mga0n895_586204_c1 3300050512 Bacteria 1118
762 Ga0495601_0386129 3300053077 Unclassified 908
763 Ga0495619_0079994 3300053085 Bacteria 2199
764 Ga0500616_0095242 3300053153 Bacteria 1466
765 Ga0501082_0930079 3300060353 Bacteria 760
766 Ga0105241_10674374
767 Ga0058863_10055835
768 Ga0058861_10170871
769 Ga0058862_10277535
770 Ga0070658_10011004
771 Ga0070658_10086655
772 Ga0070658_10145716
773 Ga0070683_100003970
774 Ga0070683_100060076
775 Ga0070683_100156038
776 Ga0070683_100200935
777 Ga0070683_100206871
778 Ga0070690_100095957
779 Ga0070670_100431481
780 Ga0068869_100221306
781 Ga0070666_10002074
782 Ga0070680_100004371
783 Ga0070680_100007756
784 Ga0070680_100084736
785 Ga0070680_100606093
786 Ga0070680_100727432
787 Ga0070682_100438668
788 Ga0068868_100067563
789 Ga0068868_100089529
790 Ga0068868_100589972
791 Ga0070660_100149958
792 Ga0070660_100373813
793 Ga0070689_100216629
794 Ga0070691_10003186
795 Ga0070687_100746379
796 Ga0070661_100045220
797 Ga0070692_10604816
798 Ga0070692_10664794
799 Ga0070671_100041594
800 Ga0070671_100188257
801 Ga0070673_100064763
802 Ga0070688_100898971
803 Ga0070659_100070829
804 Ga0070667_100228103
805 Ga0070667_100295727
806 Ga0070714_100029297
807 Ga0070714_100163108
808 Ga0070714_100385129
809 Ga0070714_101008855
810 Ga0070713_100001832
811 Ga0070713_100107197
812 Ga0070713_100146163
813 Ga0070713_100277271
814 Ga0070713_100329021
815 Ga0070713_100349892
816 Ga0070711_100004301
817 Ga0070711_100073460
818 Ga0070711_100238174
819 Ga0070711_100559380
820 Ga0070705_100522251
821 Ga0070694_100080231
822 Ga0070694_100548032
823 Ga0070708_100343449
824 Ga0070678_100748586
825 Ga0070678_101058232
826 Ga0070678_101748839
827 Ga0070662_100258981
828 Ga0070662_100547027
829 Ga0070662_100908751
830 Ga0070681_10040816
831 Ga0070681_10056361
832 Ga0070681_10189740
833 Ga0070681_10193593
834 Ga0070681_10283542
835 Ga0070681_10340837
836 Ga0070681_10386525
837 Ga0070681_10723419
838 Ga0068867_100018808
839 Ga0068867_100059711
840 Ga0068867_100210624
841 Ga0068867_100358671
842 Ga0068867_100874504
843 Ga0070685_10601786
844 Ga0070707_100947143
845 Ga0070679_100004603
846 Ga0070679_100034993
847 Ga0070679_100050498
848 Ga0070679_100059639
849 Ga0070679_100406386
850 Ga0070679_100890068
851 Ga0070684_100006622
852 Ga0070684_100077168
853 Ga0070684_100079422
854 Ga0070684_100091797
855 Ga0070684_100205767
856 Ga0070684_100333998
857 Ga0070684_100343205
858 Ga0070684_100457052
859 Ga0070684_100842975
860 Ga0070684_101698582
861 Ga0070697_100106128
862 Ga0068853_100021237
863 Ga0068853_100025646
864 Ga0068853_100118462
865 Ga0068853_100221284
866 Ga0068853_100597237
867 Ga0070686_100290608
868 Ga0070686_100580061
869 Ga0070695_100143724
870 Ga0070695_100284577
871 Ga0070695_100787441
872 Ga0070696_101173192
873 Ga0070693_100244017
874 Ga0070693_100273370
875 Ga0070665_100041606
876 Ga0070665_100079556
877 Ga0070665_100665222
878 Ga0070665_101171180
879 Ga0070665_102202673
880 Ga0070704_100853788
881 Ga0068855_100003950
882 Ga0068855_100008856
883 Ga0068855_100033651
884 Ga0068855_100100143
885 Ga0068855_100113906
886 Ga0068855_100167415
887 Ga0068855_100321127
888 Ga0068855_100452613
889 Ga0068855_100880874
890 Ga0070664_100024994
891 Ga0070664_100137603
892 Ga0070664_100140691
893 Ga0068857_100007886
894 Ga0068857_100026970
895 Ga0068857_100047994
896 Ga0068857_100167934
897 Ga0068856_100001598
898 Ga0068856_100001644
899 Ga0068856_100004643
900 Ga0068856_100011439
901 Ga0068856_100050979
902 Ga0068856_100162700
903 Ga0068856_100247607
904 Ga0068856_100334776
905 Ga0070702_100804184
906 Ga0068852_100006920
907 Ga0068852_100015096
908 Ga0068852_100020042
909 Ga0068852_100218597
910 Ga0068852_100344335
911 Ga0068852_101086638
912 Ga0068859_100026188
913 Ga0068859_100068866
914 Ga0068859_100265476
915 Ga0068859_100722760
916 Ga0068859_100793224
917 Ga0068864_100292559
918 Ga0068861_100057971
919 Ga0068870_10079181
920 Ga0068863_100024305
921 Ga0068863_100063568
922 Ga0068863_100107998
923 Ga0068863_100654497
924 Ga0068863_101710286
925 Ga0068858_100075905
926 Ga0068858_100149192
927 Ga0068858_100234318
928 Ga0068858_100317893
929 Ga0068860_100401030
930 Ga0068860_100541225
931 Ga0068860_100924687
932 Ga0070717_10005593
933 Ga0070717_10184516
934 Ga0070715_10293715
935 Ga0070712_100071867
936 Ga0070712_100395022
937 Ga0097621_100014410
938 Ga0097621_100016164
939 Ga0097621_100026708
940 Ga0097621_100037955
941 Ga0097621_100184552
942 Ga0097621_100198941
943 Ga0097621_100389035
944 Ga0097621_100824273
945 Ga0097621_101049005
946 Ga0097621_101223130
947 Ga0068871_100020605
948 Ga0068871_100085841
949 Ga0068871_100200435
950 Ga0068871_100220556
951 Ga0068871_100286774
952 Ga0068871_100364807
953 Ga0068871_100381380
954 Ga0068871_100587220
955 Ga0075430_100065444
956 Ga0075430_100070082
957 Ga0075430_100691407
958 Ga0075431_100052832
959 Ga0075431_100071695
960 Ga0075431_100379014
961 Ga0075434_100730743
962 Ga0075429_100145662
963 Ga0075429_100714923
964 Ga0075429_101102806
965 Ga0068865_100055118
966 Ga0068865_100333085
967 Ga0075436_100000433
968 Ga0075436_100000610
969 Ga0075436_100740348
970 Ga0097620_100026188
971 Ga0097620_100068868
972 Ga0097620_100265476
973 Ga0097620_100722757
974 Ga0097620_100793309
975 Ga0075435_100416547
976 Ga0075435_101155071
977 Ga0105240_10000349
978 Ga0105240_10001515
979 Ga0105240_10002790
980 Ga0105240_10006796
981 Ga0105240_10072107
982 Ga0105240_10100225
983 Ga0105240_10154719
984 Ga0105240_10217670
985 Ga0105240_10229613
986 Ga0105240_10340313
987 Ga0105240_10468019
988 Ga0105240_10552846
989 Ga0105240_10559090
990 Ga0105240_10635804
991 Ga0105245_10005156
992 Ga0105245_10008021
993 Ga0105245_10010932
994 Ga0105245_10058437
995 Ga0105245_10087747
996 Ga0105245_10104426
997 Ga0105245_10169090
998 Ga0105245_10213413
999 Ga0105245_10781176
1000 Ga0105245_10964719
1001 Ga0105245_11057382
1002 Ga0105245_11103576
1003 Ga0114129_10200933
1004 Ga0114129_11210486
1005 Ga0105243_10200729
1006 Ga0105243_10581625
1007 Ga0105243_10592581
1008 Ga0105241_10020683
1009 Ga0105241_10041193
1010 Ga0105241_10069983
1011 Ga0105241_10130027
1012 Ga0105241_10233603
1013 Ga0105241_11051554
1014 Ga0105241_11175597
1015 Ga0105241_11377655
1016 Ga0105242_10011002
1017 Ga0105242_10020652
1018 Ga0105242_10078416
1019 Ga0105242_10095244
1020 Ga0105242_10096982
1021 Ga0105242_10275025
1022 Ga0105242_10499093
1023 Ga0105242_10630404
1024 Ga0105248_10037550
1025 Ga0105248_10075116
1026 Ga0105248_10126153
1027 Ga0105248_10299027
1028 Ga0105248_10765772
1029 Ga0105248_10833522
1030 Ga0105248_10931661
1031 Ga0105248_10996406
1032 Ga0105237_10053637
1033 Ga0105237_10073049
1034 Ga0105237_10103568
1035 Ga0105237_10105477
1036 Ga0105237_10209612
1037 Ga0105237_10275703
1038 Ga0105237_10339084
1039 Ga0105237_10382690
1040 Ga0105237_10764610
1041 Ga0105238_10002354
1042 Ga0105238_10012086
1043 Ga0105238_10062533
1044 Ga0105238_10064021
1045 Ga0105238_10203759
1046 Ga0105238_10209366
1047 Ga0105238_10210433
1048 Ga0105238_10266133
1049 Ga0105238_10569373
1050 Ga0105238_11651757
1051 Ga0105249_10072999
1052 Ga0105249_10885992
1053 Ga0105249_10988568
1054 Ga0105239_10016402
1055 Ga0105239_10050610
1056 Ga0105239_10064060
1057 Ga0105239_10104959
1058 Ga0105239_10267789
1059 Ga0105246_10012166
1060 Ga0105246_10021960
1061 Ga0105246_10127408
1062 Ga0105246_10168132
1063 Ga0105246_10197928
1064 Ga0157370_10001930
1065 Ga0157370_10005751
1066 Ga0157370_10039967
1067 Ga0157370_10058352
1068 Ga0157370_10180674
1069 Ga0157370_10421135
1070 Ga0157370_10422110
1071 Ga0157370_10669056
1072 Ga0157369_10002355
1073 Ga0157369_10003128
1074 Ga0157369_10004900
1075 Ga0157369_10053159
1076 Ga0157369_10055113
1077 Ga0157369_10094341
1078 Ga0157369_10399913
1079 Ga0157369_10518765
1080 Ga0157369_11445447
1081 Ga0157374_10007562
1082 Ga0157374_10019718
1083 Ga0157374_10050444
1084 Ga0157374_10103084
1085 Ga0157374_10184458
1086 Ga0157374_10266257
1087 Ga0157374_10301838
1088 Ga0157374_10312738
1089 Ga0157378_10004469
1090 Ga0157378_10044690
1091 Ga0157378_10085598
1092 Ga0157378_10127603
1093 Ga0157378_10254977
1094 Ga0157378_10293365
1095 Ga0157378_10663523
1096 Ga0163162_10034883
1097 Ga0163162_10159915
1098 Ga0163162_10288399
1099 Ga0163162_10438724
1100 Ga0163162_10547935
1101 Ga0157372_10006227
1102 Ga0157372_10013396
1103 Ga0157372_10020489
1104 Ga0157372_10042054
1105 Ga0157372_10102357
1106 Ga0157372_10140275
1107 Ga0157372_10863619
1108 Ga0157375_10460108
1109 Ga0157375_10522069
1110 Ga0157375_10762912
1111 Ga0163163_10013925
1112 Ga0163163_10032380
1113 Ga0163163_10073508
1114 Ga0163163_10086019
1115 Ga0163163_10149662
1116 Ga0163163_10198573
1117 Ga0163163_10286181
1118 Ga0157380_11558862
1119 Ga0157379_10080358
1120 Ga0157379_10154880
1121 Ga0157379_10472029
1122 Ga0157379_11009331
1123 Ga0157376_10070175
1124 Ga0157376_10089344
1125 Ga0157376_10600138
1126 Ga0157376_10780711
1127 Ga0206354_10342106
1128 Ga0213872_10000499
1129 Ga0213874_10002410
1130 Ga0213874_10040610
1131 Ga0213875_10000006
1132 Ga0213875_10001205
1133 Ga0213875_10007434
1134 Ga0213875_10011894
1135 Ga0213875_10034521
1136 Ga0213875_10135508
1137 Ga0213875_10157315
1138 Ga0224712_10019972
1139 Ga0207682_10315192
1140 Ga0207692_10102166
1141 Ga0207680_10037048
1142 Ga0207680_10929485
1143 Ga0207699_10007985
1144 Ga0207699_10323141
1145 Ga0207705_10247308
1146 Ga0207705_10368079
1147 Ga0207705_10645425
1148 Ga0207654_10043017
1149 Ga0207654_10054089
1150 Ga0207654_10103046
1151 Ga0207654_10420462
1152 Ga0207654_10514308
1153 Ga0207707_10089526
1154 Ga0207707_10116084
1155 Ga0207707_10290157
1156 Ga0207707_10370002
1157 Ga0207707_10453000
1158 Ga0207707_10555091
1159 Ga0207707_10701752
1160 Ga0207695_10001613
1161 Ga0207695_10005025
1162 Ga0207695_10010155
1163 Ga0207695_10012905
1164 Ga0207695_10030330
1165 Ga0207695_10125235
1166 Ga0207695_10228318
1167 Ga0207695_10290866
1168 Ga0207695_10637301
1169 Ga0207671_10009573
1170 Ga0207671_10091422
1171 Ga0207671_10146229
1172 Ga0207671_10176028
1173 Ga0207671_10312073
1174 Ga0207693_10488256
1175 Ga0207663_10070662
1176 Ga0207663_10126872
1177 Ga0207660_10019312
1178 Ga0207660_10232574
1179 Ga0207662_10208959
1180 Ga0207657_10086368
1181 Ga0207657_10123370
1182 Ga0207657_10126212
1183 Ga0207657_10160796
1184 Ga0207649_10072938
1185 Ga0207649_10436673
1186 Ga0207652_10234898
1187 Ga0207652_10492513
1188 Ga0207652_10823769
1189 Ga0207652_11055082
1190 Ga0207694_10002147
1191 Ga0207694_10006310
1192 Ga0207694_10010361
1193 Ga0207694_10049427
1194 Ga0207694_10057282
1195 Ga0207694_10064261
1196 Ga0207694_10244441
1197 Ga0207650_10614701
1198 Ga0207687_10000181
1199 Ga0207687_10003605
1200 Ga0207687_10049914
1201 Ga0207687_10053378
1202 Ga0207687_10063500
1203 Ga0207687_10278717
1204 Ga0207687_10282308
1205 Ga0207687_10372949
1206 Ga0207687_10570774
1207 Ga0207700_10001815
1208 Ga0207700_10221550
1209 Ga0207700_10242428
1210 Ga0207700_10365108
1211 Ga0207700_10551946
1212 Ga0207664_10012079
1213 Ga0207664_10051951
1214 Ga0207664_10333575
1215 Ga0207644_10028476
1216 Ga0207644_10532988
1217 Ga0207690_10029369
1218 Ga0207690_10205791
1219 Ga0207706_10054690
1220 Ga0207686_10002190
1221 Ga0207686_10010199
1222 Ga0207686_10017270
1223 Ga0207686_10198089
1224 Ga0207686_10222864
1225 Ga0207709_10424539
1226 Ga0207669_10232981
1227 Ga0207704_10228075
1228 Ga0207704_10783241
1229 Ga0207665_10550076
1230 Ga0207665_10843285
1231 Ga0207711_10004497
1232 Ga0207711_10009349
1233 Ga0207711_10200042
1234 Ga0207711_10230651
1235 Ga0207711_10369854
1236 Ga0207711_10502564
1237 Ga0207711_11114318
1238 Ga0207689_10060470
1239 Ga0207689_10336951
1240 Ga0207661_10000376
1241 Ga0207661_10024773
1242 Ga0207661_10087213
1243 Ga0207661_10211598
1244 Ga0207679_10115811
1245 Ga0207679_10152875
1246 Ga0207667_10000253
1247 Ga0207667_10004724
1248 Ga0207667_10005315
1249 Ga0207667_10009573
1250 Ga0207667_10011851
1251 Ga0207667_10027727
1252 Ga0207667_10129228
1253 Ga0207667_10194823
1254 Ga0207667_10281655
1255 Ga0207667_10517156
1256 Ga0207667_10714399
1257 Ga0207651_10043824
1258 Ga0207651_10252053
1259 Ga0207712_10008857
1260 Ga0207712_10076871
1261 Ga0207712_10224234
1262 Ga0207640_10278370
1263 Ga0207640_10761731
1264 Ga0207658_10074034
1265 Ga0207658_10141989
1266 Ga0207658_10252923
1267 Ga0207658_10845548
1268 Ga0207677_10011910
1269 Ga0207677_10056195
1270 Ga0207677_10906240
1271 Ga0207639_10031605
1272 Ga0207639_10227783
1273 Ga0207702_10002817
1274 Ga0207702_10029471
1275 Ga0207702_10031362
1276 Ga0207702_10075440
1277 Ga0207702_10121069
1278 Ga0207702_10121644
1279 Ga0207702_10148128
1280 Ga0207702_10254993
1281 Ga0207702_10382196
1282 Ga0207702_11003902
1283 Ga0207641_10051693
1284 Ga0207641_10086199
1285 Ga0207641_10259427
1286 Ga0207648_10030543
1287 Ga0207648_10117602
1288 Ga0207648_10193762
1289 Ga0207676_10189159
1290 Ga0207676_10223026
1291 Ga0207674_10000097
1292 Ga0207674_10001765
1293 Ga0207674_10013528
1294 Ga0207674_10027603
1295 Ga0207674_11040235
1296 Ga0207683_10134007
1297 Ga0207683_11233600
1298 Ga0207683_11671559
1299 Ga0207698_10009971
1300 Ga0207698_10014353
1301 Ga0207698_10193627
1302 Ga0207698_10208145
1303 Ga0207698_10571568
1304 Ga0207698_11128972
1305 Ga0207698_11541182
1306 Ga0268266_10031482
1307 Ga0268266_10244099
1308 Ga0268266_11217620
1309 Ga0268264_10053776
1310 Ga0268264_10179158
1311 Ga0268264_10928311
1312 Ga0268264_11070067
1313 Ga0265336_10023881
1314 Ga0265338_10015521
1315 Ga0265338_10161674
1316 Ga0265338_10219751
1317 Ga0265330_10205696
1318 Ga0265332_10020979
1319 Ga0265325_10004072
1320 Ga0265325_10078581
1321 Ga0265325_10091117
1322 Ga0265325_10226670
1323 Ga0265329_10005782
1324 Ga0265340_10013791
1325 Ga0265340_10127810
1326 Ga0265339_10085273
1327 Ga0265331_10089202
1328 Ga0265331_10111950
1329 Ga0265316_10002549
1330 Ga0265316_10056234
1331 Ga0265316_10161347
1332 Ga0265316_10293501
1333 Ga0265316_10508226
1334 Ga0265313_10010912
1335 Ga0265313_10084650
1336 Ga0265314_10000880
1337 Ga0265314_10001640
1338 Ga0265314_10039808
1339 Ga0265342_10119206
1340 Ga0265342_10342493
1341 Ga0373926_0066464
1342 Ga0373926_0346829
1343 Ga0373934_0003152
1344 Ga0373934_0004127
1345 Ga0373934_0016384
1346 Ga0373934_0028295
1347 Ga0373944_0050323
1348 Ga0373923_0220825
1349 Ga0373932_0160668
1350 Ga0373953_0076521
1351 Ga0373953_0215763
1352 Ga0373954_0025290
1353 Ga0373954_0035817
1354 Ga0373954_0045442
1355 Ga0373954_0079532
1356 Ga0373956_0011548
1357 Ga0373956_0081449
1358 Ga0373956_0394414
1359 Ga0373957_0007300
1360 Ga0373957_0021688
1361 Ga0373957_0045201
1362 Ga0373957_0060443
1363 Ga0373943_0015346
1364 Ga0373943_0046728
1365 Ga0373943_0496394
1366 Ga0373946_0015396
1367 Ga0373955_0056544
1368 Ga0373955_0130398
1369 Ga0373924_0096668
1370 Ga0373924_0121725
1371 Ga0373931_0264083
1372 Ga0373935_0043269
1373 Ga0373935_0254418
1374 Ga0373935_0320602
1375 Ga0373935_0817598
1376 Ga0373927_0002387
1377 Ga0373927_0006265
1378 Ga0373927_0007986
1379 Ga0373927_0018595
1380 Ga0373927_0036209
1381 Ga0373933_0006835
1382 Ga0373933_0040651
1383 Ga0373933_0119701
1384 Ga0373947_0002406
1385 Ga0373947_0584069
1386 Ga0373947_0664277
1387 Ga0373937_0004600
1388 Ga0373937_0009692
1389 Ga0373937_0011634
1390 Ga0373937_0035714
1391 Ga0373937_0052970
1392 Ga0373937_0095679
1393 Ga0373937_0325270
1394 Ga0373937_1389082
1395 Ga0373937_1597048
1396 Ga0373925_0000325
1397 Ga0373925_0028204
1398 Ga0373925_0051155
1399 Ga0373925_0116196
1400 Ga0373925_0355131
1401 Ga0373925_0560195
1402 Ga0373925_0746959
1403 Ga0395900_0248024
1404 Ga0436364_0073099
1405 Ga0436364_0294229
1406 Ga0436364_0359395
1407 Ga0436364_0540800
1408 Ga0436364_0761931
1409 Ga0436364_0842705
1410 Ga0436364_0871212
1411 Ga0436364_1279185
1412 Ga0436364_1343448
1413 Ga0436364_1349279
1414 Ga0436364_1410943
1415 Ga0436365_0155868
1416 Ga0436365_0203521
1417 Ga0436365_0492829
1418 Ga0436365_0621920
1419 Ga0436365_0867765
1420 Ga0436365_0990910
1421 Ga0436365_1017858
1422 Ga0436365_1337599
1423 Ga0436365_1801777
1424 Ga0436360_0457504
1425 Ga0436361_0682149
1426 Ga0436363_0056399
1427 Ga0436363_0115085
1428 Ga0436363_0150889
1429 Ga0436363_0953899
1430 Ga0436362_1277351
1431 Ga0451833_0603392
1432 Ga0451853_0296708
1433 Ga0451577_0256055
1434 Ga0466965_0571439
1435 Ga0466966_0064999
1436 Ga0453684_0751079
1437 Ga0466957_0105518
1438 Ga0466959_0522949
1439 Ga0466958_0599926
1440 Ga0466967_0163995
1441 Ga0466967_0724548
1442 Ga0466967_1780378
1443 Ga0495592_0150576
1444 Ga0495603_0215954
1445 Ga0495651_0411288
1446 Ga0495653_0459241
1447 Ga0495580_0051986
1448 Ga0495580_0060084
1449 Ga0495580_0067801
1450 Ga0495580_0082909
1451 Ga0495580_0252384
1452 Ga0495580_0280862
1453 Ga0495580_0726271
1454 Ga0495582_0021058
1455 Ga0495639_0242709
1456 Ga0495608_0212760
1457 Ga0495618_0316001
1458 Ga0495628_0178714
1459 Ga0495652_0048218
1460 Ga0495652_0114357
1461 Ga0495652_0383377
1462 Ga0495652_0728735
1463 Ga0495665_0031271
1464 Ga0495665_0103480
1465 Ga0495665_0132957
1466 Ga0495665_0190836
1467 Ga0495640_0146184
1468 Ga0495586_0261117
1469 Ga0495587_0002353
1470 Ga0495645_0199887
1471 Ga0495667_0065292
1472 Ga0495667_0154273
1473 Ga0495667_0276495
1474 Ga0495635_0208472
1475 Ga0495635_0253505
1476 Ga0495588_0230184
1477 Ga0495599_0114665
1478 Ga0495599_0339641
1479 Ga0495623_0478592
1480 Ga0495658_0020114
1481 Ga0495658_0291366
1482 Ga0495669_0033341
1483 Ga0495624_0136034
1484 Ga0495600_0318125
1485 Ga0495604_0172362
1486 Ga0495636_0033889
1487 Ga0495636_0213278
1488 Ga0495674_0082234
1489 Ga0495674_0489290
1490 Ga0495674_0623826
1491 Ga0495674_0745504
1492 Ga0495674_0954440
1493 Ga0495680_0211861
1494 Ga0495680_0344324
1495 Ga0495675_0070922
1496 Ga0495675_0491226
1497 Ga0495677_0099701
1498 Ga0495684_0012410
1499 Ga0495684_0045337
1500 Ga0495684_0328869
1501 Ga0495602_0003189
1502 Ga0495602_0294378
1503 Ga0495614_0336735
1504 Ga0496102_0261696
1505 Ga0496104_0262035
1506 Ga0496104_0294841
1507 Ga0496108_0913554
1508 Ga0496109_0709884
1509 Ga0496112_0301117
1510 Ga0496112_0816357
1511 Ga0496113_0638428
1512 Ga0496115_0046749
1513 Ga0496115_0438772
1514 Ga0501239_013228
1515 Ga0501249_018513
1516 Ga0501253_007754
1517 Ga0501257_100015
1518 Ga0501273_012369
1519 nmdc:mga05p37_177700_c1
1520 nmdc:mga09592_1072220_c1
1521 nmdc:mga09592_149842_c1
1522 nmdc:mga0qj67_56946_c1
1523 nmdc:mga0qj67_651406_c1
1524 nmdc:mga06r32_20323_c1
1525 nmdc:mga06r32_97234_c1
1526 nmdc:mga0n895_586204_c1
1527 Ga0495601_0386129
1528 Ga0495619_0079994
1529 Ga0500616_0095242
1530 Ga0501082_0930079

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14279

HNH_5

HNH endonuclease

131

186

0.97

PF01844

HNH

HNH endonuclease

131

176

0.96

PF13395

HNH_4

HNH endonuclease

131

179

0.94

Map