F479754

General Info

Members Datasets Scaffolds Average Seq Length
764 342 1528 112

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_140769_c1|nmdc:mga0qj67_140769_c1_793_1125
Length 110
Sequence MTAPRQYYDDGLIQLDREAITLRRYHFPSGTSKIIPLSAIRGYKAEPLGLFNMRFRLWGTDLRRWLPLDVWRPIKSTLVTLDVPGVRPKPAFTPQRPKEFLAMLDELLAS

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
220 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
223 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
322 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
323 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
329 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
332 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
336 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
337 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
338 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
339 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
340 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
341 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
342 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 0.13
Rhizoplane 11.52
Rhizosphere 69.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_140769_c1 3300050509 Bacteria 1956
2 CNXas_1006957 3300000545 Bacteria 799
3 JGI24746J21847_1000883 3300001977 Bacteria 4671
4 JGI24739J22299_10088410 3300001989 Bacteria 945
5 JGI24737J22298_10148152 3300001990 Bacteria 693
6 JGI24743J22301_10005061 3300001991 Bacteria 2183
7 JGI24743J22301_10079780 3300001991 Bacteria 690
8 JGI24750J21931_1010996 3300002070 Bacteria 1186
9 JGI24745J21846_1009302 3300002073 Bacteria 1112
10 JGI24738J21930_10030387 3300002075 Bacteria 1103
11 JGI24744J21845_10003930 3300002077 Bacteria 3064
12 JGI24744J21845_10048137 3300002077 Bacteria 788
13 JGI24744J21845_10091115 3300002077 Bacteria 560
14 JGI24034J26672_10019505 3300002239 Bacteria 1058
15 JGI24034J26672_10022505 3300002239 Bacteria 996
16 JGI24742J22300_10004107 3300002244 Bacteria 2371
17 Ga0055540_1000038 3300003792 Bacteria 161988
18 Ga0055540_1002436 3300003792 Bacteria 9823
19 Ga0055540_1003290 3300003792 Bacteria 7896
20 Ga0055540_1006422 3300003792 Bacteria 4675
21 Ga0055540_1021751 3300003792 Bacteria 1657
22 Ga0070676_10123672 3300005328 Bacteria 1627
23 Ga0070683_101748718 3300005329 Bacteria 598
24 Ga0070690_100018561 3300005330 Bacteria 4204
25 Ga0070690_100400419 3300005330 Bacteria 1008
26 Ga0070670_100922052 3300005331 Bacteria 792
27 Ga0070670_101108632 3300005331 Bacteria 722
28 Ga0070677_10450894 3300005333 Bacteria 688
29 Ga0068869_100012907 3300005334 Bacteria 5534
30 Ga0068869_100099188 3300005334 Bacteria 2201
31 Ga0070666_10058079 3300005335 Bacteria 2616
32 Ga0070666_10421098 3300005335 Bacteria 962
33 Ga0070680_100269026 3300005336 Bacteria 1443
34 Ga0070682_100032049 3300005337 Bacteria 3184
35 Ga0070682_100042707 3300005337 Bacteria 2801
36 Ga0070682_100066688 3300005337 Bacteria 2290
37 Ga0068868_100080870 3300005338 Bacteria 2604
38 Ga0068868_100851082 3300005338 Bacteria 826
39 Ga0068868_100865225 3300005338 Bacteria 819
40 Ga0068868_101371978 3300005338 Bacteria 658
41 Ga0068868_101797665 3300005338 Bacteria 579
42 Ga0070660_100932968 3300005339 Bacteria 732
43 Ga0070689_100008473 3300005340 Bacteria 7244
44 Ga0070689_100455969 3300005340 Bacteria 1089
45 Ga0070691_10262866 3300005341 Bacteria 930
46 Ga0070692_10050111 3300005345 Bacteria 2167
47 Ga0070692_10270886 3300005345 Bacteria 1025
48 Ga0070668_100006600 3300005347 Bacteria 8596
49 Ga0070668_100050726 3300005347 Bacteria 3195
50 Ga0070668_100094142 3300005347 Bacteria 2365
51 Ga0070668_100178611 3300005347 Bacteria 1733
52 Ga0070669_100018503 3300005353 Bacteria 4979
53 Ga0070669_100054965 3300005353 Bacteria 2917
54 Ga0070669_100144581 3300005353 Bacteria 1836
55 Ga0070675_100790305 3300005354 Bacteria 867
56 Ga0070671_100047317 3300005355 Bacteria 3577
57 Ga0070671_100090416 3300005355 Bacteria 2563
58 Ga0070671_101308790 3300005355 Bacteria 639
59 Ga0070674_100001087 3300005356 Bacteria 14241
60 Ga0070674_100026920 3300005356 Bacteria 3763
61 Ga0070674_100122834 3300005356 Bacteria 1924
62 Ga0070673_100082584 3300005364 Bacteria 2608
63 Ga0070673_100375938 3300005364 Bacteria 1266
64 Ga0070688_100008732 3300005365 Bacteria 5510
65 Ga0070688_100046664 3300005365 Bacteria 2684
66 Ga0070688_100388855 3300005365 Bacteria 1030
67 Ga0070688_101696979 3300005365 Bacteria 517
68 Ga0070659_100115670 3300005366 Bacteria 2168
69 Ga0070667_100000099 3300005367 Bacteria 108662
70 Ga0070667_100000883 3300005367 Bacteria 27691
71 Ga0070667_100003549 3300005367 Bacteria 13294
72 Ga0070667_100011479 3300005367 Bacteria 7325
73 Ga0070667_100079308 3300005367 Bacteria 2807
74 Ga0070667_100467383 3300005367 Bacteria 1154
75 Ga0070703_10272343 3300005406 Bacteria 695
76 Ga0070709_10078267 3300005434 Bacteria 2151
77 Ga0070714_100122617 3300005435 Bacteria 2313
78 Ga0070713_100478243 3300005436 Bacteria 1173
79 Ga0070713_101237355 3300005436 Bacteria 723
80 Ga0070710_10117778 3300005437 Bacteria 1603
81 Ga0070710_10124710 3300005437 Bacteria 1563
82 Ga0070710_10529321 3300005437 Bacteria 811
83 Ga0070701_10001043 3300005438 Bacteria 10106
84 Ga0070701_10086247 3300005438 Bacteria 1711
85 Ga0070701_10220697 3300005438 Bacteria 1130
86 Ga0070711_100000430 3300005439 Bacteria 21892
87 Ga0070711_100022902 3300005439 Bacteria 4055
88 Ga0070711_100688347 3300005439 Bacteria 860
89 Ga0070705_100025834 3300005440 Bacteria 3189
90 Ga0070705_100098966 3300005440 Bacteria 1837
91 Ga0070700_100021392 3300005441 Bacteria 3759
92 Ga0070700_100189308 3300005441 Bacteria 1438
93 Ga0070694_100143506 3300005444 Bacteria 1737
94 Ga0070694_101900859 3300005444 Bacteria 508
95 Ga0070708_100826271 3300005445 Bacteria 871
96 Ga0070663_100023196 3300005455 Bacteria 4157
97 Ga0070663_100100148 3300005455 Bacteria 2161
98 Ga0070663_100103139 3300005455 Bacteria 2132
99 Ga0070663_100147015 3300005455 Bacteria 1804
100 Ga0070678_100000296 3300005456 Bacteria 23040
101 Ga0070678_100078482 3300005456 Bacteria 2494
102 Ga0070678_100261352 3300005456 Bacteria 1456
103 Ga0070678_101464045 3300005456 Bacteria 639
104 Ga0070662_100006688 3300005457 Bacteria 7449
105 Ga0070662_100445240 3300005457 Bacteria 1074
106 Ga0068867_100664832 3300005459 Bacteria 915
107 Ga0068867_100807313 3300005459 Bacteria 837
108 Ga0070685_10228277 3300005466 Bacteria 1223
109 Ga0070685_10355345 3300005466 Bacteria 1003
110 Ga0070685_10440791 3300005466 Bacteria 910
111 Ga0070679_100305550 3300005530 Bacteria 1541
112 Ga0070684_100221720 3300005535 Bacteria 1725
113 Ga0070697_100586737 3300005536 Bacteria 979
114 Ga0068853_100027907 3300005539 Bacteria 4746
115 Ga0070672_100136080 3300005543 Bacteria 2024
116 Ga0070686_100292772 3300005544 Bacteria 1205
117 Ga0070686_101217859 3300005544 Bacteria 626
118 Ga0070695_100008828 3300005545 Bacteria 5988
119 Ga0070696_100007202 3300005546 Bacteria 7429
120 Ga0070696_100460119 3300005546 Bacteria 1005
121 Ga0070693_100229888 3300005547 Bacteria 1220
122 Ga0070693_101653624 3300005547 Bacteria 504
123 Ga0070665_100004453 3300005548 Bacteria 14715
124 Ga0070665_100013600 3300005548 Bacteria 8185
125 Ga0070665_100041302 3300005548 Bacteria 4635
126 Ga0070665_100225567 3300005548 Bacteria 1874
127 Ga0070704_100000484 3300005549 Bacteria 18886
128 Ga0070704_100226580 3300005549 Bacteria 1522
129 Ga0068855_100110121 3300005563 Bacteria 3162
130 Ga0068855_100456549 3300005563 Bacteria 1394
131 Ga0070664_100754619 3300005564 Bacteria 908
132 Ga0070664_101083791 3300005564 Bacteria 754
133 Ga0068854_100001737 3300005578 Bacteria 13297
134 Ga0068854_100158150 3300005578 Bacteria 1753
135 Ga0068856_100131040 3300005614 Bacteria 2512
136 Ga0068856_101469930 3300005614 Bacteria 695
137 Ga0070702_100006999 3300005615 Bacteria 5375
138 Ga0070702_100167640 3300005615 Bacteria 1426
139 Ga0070702_100430631 3300005615 Bacteria 952
140 Ga0068852_100049700 3300005616 Bacteria 3589
141 Ga0068852_100105532 3300005616 Bacteria 2553
142 Ga0068852_100399042 3300005616 Bacteria 1352
143 Ga0068859_100002520 3300005617 Bacteria 18593
144 Ga0068859_100033579 3300005617 Bacteria 5153
145 Ga0068859_102146558 3300005617 Bacteria 617
146 Ga0068859_103021453 3300005617 Bacteria 514
147 Ga0068864_100425882 3300005618 Bacteria 1265
148 Ga0068864_100479316 3300005618 Bacteria 1194
149 Ga0068864_101080750 3300005618 Bacteria 798
150 Ga0068866_10008033 3300005718 Bacteria 4433
151 Ga0068866_10241420 3300005718 Bacteria 1100
152 Ga0068861_100659237 3300005719 Bacteria 968
153 Ga0068861_101043680 3300005719 Bacteria 783
154 Ga0068861_102678231 3300005719 Bacteria 503
155 Ga0068851_10032741 3300005834 Bacteria 2587
156 Ga0068870_10118219 3300005840 Bacteria 1523
157 Ga0068870_10688189 3300005840 Bacteria 704
158 Ga0068863_100004183 3300005841 Bacteria 14247
159 Ga0068863_100020294 3300005841 Bacteria 6356
160 Ga0068863_100064328 3300005841 Bacteria 3469
161 Ga0068863_100353172 3300005841 Bacteria 1432
162 Ga0068863_100805851 3300005841 Bacteria 937
163 Ga0068858_100001766 3300005842 Bacteria 22051
164 Ga0068858_100005212 3300005842 Bacteria 12736
165 Ga0068858_100030133 3300005842 Bacteria 5038
166 Ga0068858_100435684 3300005842 Bacteria 1262
167 Ga0068858_102041115 3300005842 Bacteria 567
168 Ga0068860_100000163 3300005843 Bacteria 108836
169 Ga0068860_100002020 3300005843 Bacteria 21414
170 Ga0068860_100238935 3300005843 Bacteria 1767
171 Ga0068860_100518753 3300005843 Bacteria 1191
172 Ga0068862_100000089 3300005844 Bacteria 109047
173 Ga0068862_100026898 3300005844 Bacteria 4838
174 Ga0081455_10013048 3300005937 Bacteria 8235
175 Ga0081455_10121865 3300005937 Bacteria 2053
176 Ga0081538_10163191 3300005981 Bacteria 986
177 Ga0081538_10211276 3300005981 Bacteria 782
178 Ga0070717_10762168 3300006028 Bacteria 880
179 Ga0075365_10006240 3300006038 Bacteria 6536
180 Ga0075365_10126677 3300006038 Bacteria 1765
181 Ga0075365_10345223 3300006038 Bacteria 1049
182 Ga0075365_10354895 3300006038 Bacteria 1034
183 Ga0075363_100000380 3300006048 Bacteria 13452
184 Ga0075363_100005995 3300006048 Bacteria 5477
185 Ga0075363_100055529 3300006048 Bacteria 2122
186 Ga0075363_100275747 3300006048 Bacteria 972
187 Ga0075363_100324104 3300006048 Bacteria 896
188 Ga0075363_100387109 3300006048 Bacteria 820
189 Ga0075363_100540284 3300006048 Bacteria 695
190 Ga0075364_10002787 3300006051 Bacteria 9824
191 Ga0075364_10027182 3300006051 Bacteria 3654
192 Ga0075364_10124320 3300006051 Bacteria 1728
193 Ga0075364_10221712 3300006051 Bacteria 1283
194 Ga0075364_10375362 3300006051 Bacteria 970
195 Ga0075364_10648213 3300006051 Bacteria 721
196 Ga0070715_10005981 3300006163 Bacteria 4101
197 Ga0070715_10510242 3300006163 Bacteria 690
198 Ga0070716_100003803 3300006173 Bacteria 7159
199 Ga0070716_100250263 3300006173 Bacteria 1207
200 Ga0070716_100337768 3300006173 Bacteria 1061
201 Ga0070712_100000975 3300006175 Bacteria 17221
202 Ga0070712_100006327 3300006175 Bacteria 7342
203 Ga0070712_100468778 3300006175 Bacteria 1051
204 Ga0070712_101931097 3300006175 Bacteria 517
205 Ga0075362_10022281 3300006177 Bacteria 2668
206 Ga0075362_10479833 3300006177 Bacteria 634
207 Ga0075367_10133924 3300006178 Bacteria 1533
208 Ga0075367_10646161 3300006178 Bacteria 673
209 Ga0075369_10003154 3300006186 Bacteria 5975
210 Ga0075369_10008468 3300006186 Bacteria 3957
211 Ga0075369_10020039 3300006186 Bacteria 2737
212 Ga0075369_10057496 3300006186 Bacteria 1692
213 Ga0075369_10069164 3300006186 Bacteria 1552
214 Ga0075369_10105529 3300006186 Bacteria 1267
215 Ga0075369_10125015 3300006186 Bacteria 1166
216 Ga0075369_10199166 3300006186 Bacteria 924
217 Ga0097621_100195233 3300006237 Bacteria 1755
218 Ga0097621_100813663 3300006237 Bacteria 866
219 Ga0075370_10021837 3300006353 Bacteria 3509
220 Ga0068871_100024660 3300006358 Bacteria 4667
221 Ga0075428_100003226 3300006844 Bacteria 17845
222 Ga0075430_100169928 3300006846 Bacteria 1814
223 Ga0075430_100207734 3300006846 Bacteria 1625
224 Ga0075431_100024868 3300006847 Bacteria 6141
225 Ga0075429_100349182 3300006880 Bacteria 1295
226 Ga0068865_100000952 3300006881 Bacteria 16483
227 Ga0068865_100558166 3300006881 Bacteria 962
228 Ga0068865_101224622 3300006881 Bacteria 665
229 Ga0097620_100002520 3300006931 Bacteria 18593
230 Ga0097620_100033579 3300006931 Bacteria 5153
231 Ga0097620_102146393 3300006931 Bacteria 617
232 Ga0097620_103019966 3300006931 Bacteria 514
233 Ga0099795_10012991 3300007788 Bacteria 2542
234 Ga0105250_10097750 3300009092 Bacteria 1197
235 Ga0111539_10199014 3300009094 Bacteria 2337
236 Ga0105245_10003572 3300009098 Bacteria 13876
237 Ga0105245_10042426 3300009098 Bacteria 4059
238 Ga0105245_11204085 3300009098 Bacteria 805
239 Ga0105245_12671619 3300009098 Bacteria 552
240 Ga0105245_13208363 3300009098 Bacteria 507
241 Ga0105247_10000987 3300009101 Bacteria 21438
242 Ga0105247_10541138 3300009101 Bacteria 855
243 Ga0105247_11282994 3300009101 Bacteria 587
244 Ga0114129_10006072 3300009147 Bacteria 17120
245 Ga0114129_11396977 3300009147 Bacteria 864
246 Ga0105243_10002294 3300009148 Bacteria 16036
247 Ga0105243_10014510 3300009148 Bacteria 5960
248 Ga0105241_10063994 3300009174 Bacteria 2839
249 Ga0105241_10071447 3300009174 Bacteria 2694
250 Ga0105241_10429266 3300009174 Bacteria 1165
251 Ga0105242_10002156 3300009176 Bacteria 15520
252 Ga0105242_10988914 3300009176 Bacteria 848
253 Ga0105242_11068488 3300009176 Bacteria 819
254 Ga0105242_12111745 3300009176 Bacteria 607
255 Ga0105248_10003302 3300009177 Bacteria 17900
256 Ga0105248_10154796 3300009177 Bacteria 2587
257 Ga0105248_10233534 3300009177 Bacteria 2070
258 Ga0105248_11232819 3300009177 Bacteria 846
259 Ga0105237_10004951 3300009545 Bacteria 15208
260 Ga0105237_10516588 3300009545 Bacteria 1201
261 Ga0105237_10526128 3300009545 Bacteria 1189
262 Ga0105249_10001271 3300009553 Bacteria 22130
263 Ga0105249_11474002 3300009553 Bacteria 753
264 Ga0105249_12467294 3300009553 Bacteria 592
265 Ga0105249_13322341 3300009553 Bacteria 518
266 Ga0099796_10015934 3300010159 Bacteria 2209
267 Ga0099796_10497555 3300010159 Bacteria 546
268 Ga0105239_10014830 3300010375 Bacteria 8643
269 Ga0105239_10125917 3300010375 Bacteria 2847
270 Ga0105239_10435432 3300010375 Bacteria 1486
271 Ga0105239_10572443 3300010375 Bacteria 1287
272 Ga0105239_11602919 3300010375 Bacteria 753
273 Ga0105246_10289636 3300011119 Bacteria 1317
274 Ga0105246_12289847 3300011119 Bacteria 528
275 Ga0157371_10128554 3300013102 Bacteria 1802
276 Ga0157370_10743771 3300013104 Bacteria 894
277 Ga0157369_10211219 3300013105 Bacteria 2034
278 Ga0157369_10451626 3300013105 Bacteria 1331
279 Ga0157369_10651346 3300013105 Bacteria 1086
280 Ga0157369_11365138 3300013105 Bacteria 722
281 Ga0157374_10009219 3300013296 Bacteria 8460
282 Ga0157374_10321273 3300013296 Bacteria 1534
283 Ga0157378_10008792 3300013297 Bacteria 8791
284 Ga0157378_10626175 3300013297 Bacteria 1089
285 Ga0163162_10001807 3300013306 Bacteria 20088
286 Ga0163162_10340642 3300013306 Bacteria 1632
287 Ga0163162_10479326 3300013306 Bacteria 1375
288 Ga0163162_10651244 3300013306 Bacteria 1177
289 Ga0163162_11058166 3300013306 Bacteria 918
290 Ga0157372_10010172 3300013307 Bacteria 9987
291 Ga0157372_10134099 3300013307 Bacteria 2851
292 Ga0157372_13442802 3300013307 Bacteria 503
293 Ga0157375_10008317 3300013308 Bacteria 9084
294 Ga0157375_10579126 3300013308 Bacteria 1283
295 Ga0157375_10610370 3300013308 Bacteria 1249
296 Ga0157375_12805537 3300013308 Bacteria 582
297 Ga0163163_10295841 3300014325 Bacteria 1671
298 Ga0163163_10800492 3300014325 Bacteria 1006
299 Ga0163163_10982190 3300014325 Bacteria 908
300 Ga0163163_12438299 3300014325 Bacteria 581
301 Ga0157380_10005410 3300014326 Bacteria 8922
302 Ga0157380_10371697 3300014326 Bacteria 1346
303 Ga0157377_10110551 3300014745 Bacteria 1651
304 Ga0157379_10003999 3300014968 Bacteria 12572
305 Ga0157379_10271181 3300014968 Bacteria 1543
306 Ga0157379_10681472 3300014968 Bacteria 964
307 Ga0157379_11260164 3300014968 Bacteria 713
308 Ga0157376_10032896 3300014969 Bacteria 4168
309 Ga0163161_10002119 3300017792 Bacteria 14352
310 Ga0163161_10077056 3300017792 Bacteria 2448
311 Ga0213876_10003522 3300021384 Bacteria 8928
312 Ga0213876_10100747 3300021384 Bacteria 1531
313 Ga0213875_10019301 3300021388 Bacteria 3280
314 Ga0213875_10021732 3300021388 Bacteria 3070
315 Ga0209673_1004821 3300025273 Bacteria 7070
316 Ga0209051_1000014 3300025303 Bacteria 552732
317 Ga0209051_1000865 3300025303 Bacteria 30711
318 Ga0209051_1004861 3300025303 Bacteria 8071
319 Ga0209051_1008335 3300025303 Bacteria 5498
320 Ga0209051_1031642 3300025303 Bacteria 2031
321 Ga0209051_1031723 3300025303 Bacteria 2027
322 Ga0207656_10062897 3300025321 Bacteria 1633
323 Ga0207653_10087304 3300025885 Bacteria 1088
324 Ga0207692_10052908 3300025898 Bacteria 2065
325 Ga0207692_10173106 3300025898 Bacteria 1252
326 Ga0207692_10225768 3300025898 Bacteria 1112
327 Ga0207642_10588487 3300025899 Bacteria 691
328 Ga0207710_10000117 3300025900 Bacteria 98934
329 Ga0207710_10000775 3300025900 Bacteria 17389
330 Ga0207710_10030443 3300025900 Bacteria 2355
331 Ga0207688_10000617 3300025901 Bacteria 17505
332 Ga0207688_10003543 3300025901 Bacteria 8518
333 Ga0207647_10034038 3300025904 Bacteria 3256
334 Ga0207647_10514054 3300025904 Bacteria 667
335 Ga0207685_10051161 3300025905 Bacteria 1595
336 Ga0207645_10029887 3300025907 Bacteria 3512
337 Ga0207645_10119702 3300025907 Bacteria 1709
338 Ga0207643_10377365 3300025908 Bacteria 893
339 Ga0207654_10135548 3300025911 Bacteria 1563
340 Ga0207654_10424735 3300025911 Bacteria 928
341 Ga0207671_10026472 3300025914 Bacteria 4345
342 Ga0207671_10553932 3300025914 Bacteria 917
343 Ga0207693_10000681 3300025915 Bacteria 30511
344 Ga0207693_10000765 3300025915 Bacteria 28902
345 Ga0207693_10278290 3300025915 Bacteria 1311
346 Ga0207663_10007432 3300025916 Bacteria 5680
347 Ga0207663_10023101 3300025916 Bacteria 3564
348 Ga0207660_10255241 3300025917 Bacteria 1385
349 Ga0207657_10330357 3300025919 Bacteria 1204
350 Ga0207646_10526793 3300025922 Bacteria 1064
351 Ga0207681_10013910 3300025923 Bacteria 4985
352 Ga0207681_10093402 3300025923 Bacteria 2153
353 Ga0207694_11127793 3300025924 Bacteria 664
354 Ga0207650_10285078 3300025925 Bacteria 1346
355 Ga0207659_10165281 3300025926 Bacteria 1741
356 Ga0207687_10000262 3300025927 Bacteria 35881
357 Ga0207687_10259225 3300025927 Bacteria 1385
358 Ga0207687_10860480 3300025927 Bacteria 775
359 Ga0207664_10201300 3300025929 Bacteria 1719
360 Ga0207644_10008870 3300025931 Bacteria 6586
361 Ga0207644_10276461 3300025931 Bacteria 1347
362 Ga0207644_10965575 3300025931 Bacteria 715
363 Ga0207690_10069000 3300025932 Bacteria 2431
364 Ga0207706_10029716 3300025933 Bacteria 4878
365 Ga0207706_10093414 3300025933 Bacteria 2645
366 Ga0207706_11235790 3300025933 Bacteria 620
367 Ga0207686_10002679 3300025934 Bacteria 9667
368 Ga0207686_10489909 3300025934 Bacteria 952
369 Ga0207686_11209840 3300025934 Bacteria 619
370 Ga0207709_10004066 3300025935 Bacteria 8518
371 Ga0207709_10160594 3300025935 Bacteria 1567
372 Ga0207670_10028681 3300025936 Bacteria 3538
373 Ga0207669_10013908 3300025937 Bacteria 4017
374 Ga0207669_10173828 3300025937 Bacteria 1536
375 Ga0207669_10317744 3300025937 Bacteria 1190
376 Ga0207669_11720450 3300025937 Bacteria 536
377 Ga0207704_10000495 3300025938 Bacteria 17545
378 Ga0207665_10015066 3300025939 Bacteria 5077
379 Ga0207665_10042950 3300025939 Bacteria 3022
380 Ga0207665_10292091 3300025939 Bacteria 1216
381 Ga0207665_10647490 3300025939 Bacteria 828
382 Ga0207691_10142832 3300025940 Bacteria 2108
383 Ga0207711_10000096 3300025941 Bacteria 93552
384 Ga0207711_10042460 3300025941 Bacteria 3875
385 Ga0207711_10232845 3300025941 Bacteria 1687
386 Ga0207689_10366440 3300025942 Bacteria 1198
387 Ga0207689_10745421 3300025942 Bacteria 826
388 Ga0207661_10201491 3300025944 Bacteria 1750
389 Ga0207661_11982612 3300025944 Bacteria 528
390 Ga0207679_10862226 3300025945 Bacteria 827
391 Ga0207667_10427041 3300025949 Bacteria 1348
392 Ga0207651_10115987 3300025960 Bacteria 2021
393 Ga0207651_10696016 3300025960 Bacteria 895
394 Ga0207712_10000083 3300025961 Bacteria 108319
395 Ga0207712_10002296 3300025961 Bacteria 12414
396 Ga0207712_10031961 3300025961 Bacteria 3549
397 Ga0207668_10010883 3300025972 Bacteria 5513
398 Ga0207668_10079644 3300025972 Bacteria 2370
399 Ga0207668_10108663 3300025972 Bacteria 2076
400 Ga0207668_10188497 3300025972 Bacteria 1632
401 Ga0207668_10780642 3300025972 Bacteria 844
402 Ga0207668_11122647 3300025972 Bacteria 705
403 Ga0207640_10175165 3300025981 Bacteria 1603
404 Ga0207640_10191346 3300025981 Bacteria 1542
405 Ga0207640_10502228 3300025981 Bacteria 1010
406 Ga0207658_10000085 3300025986 Bacteria 104042
407 Ga0207658_10008607 3300025986 Bacteria 6943
408 Ga0207658_10013063 3300025986 Bacteria 5671
409 Ga0207658_10163837 3300025986 Bacteria 1824
410 Ga0207658_10332705 3300025986 Bacteria 1318
411 Ga0207677_10031778 3300026023 Bacteria 3384
412 Ga0207677_10082213 3300026023 Bacteria 2314
413 Ga0207677_10465508 3300026023 Bacteria 1086
414 Ga0207677_10661552 3300026023 Bacteria 923
415 Ga0207703_10041273 3300026035 Bacteria 3695
416 Ga0207703_10187982 3300026035 Bacteria 1827
417 Ga0207703_10889952 3300026035 Bacteria 852
418 Ga0207703_11777951 3300026035 Bacteria 592
419 Ga0207639_10009143 3300026041 Bacteria 6830
420 Ga0207639_10121274 3300026041 Bacteria 2148
421 Ga0207639_10291760 3300026041 Bacteria 1438
422 Ga0207678_10002286 3300026067 Bacteria 17345
423 Ga0207678_10046392 3300026067 Bacteria 3757
424 Ga0207678_10072908 3300026067 Bacteria 2943
425 Ga0207678_10168389 3300026067 Bacteria 1871
426 Ga0207678_11025970 3300026067 Bacteria 730
427 Ga0207708_10012484 3300026075 Bacteria 6332
428 Ga0207708_10013474 3300026075 Bacteria 6113
429 Ga0207708_11374733 3300026075 Bacteria 619
430 Ga0207702_10399916 3300026078 Bacteria 1325
431 Ga0207641_10000762 3300026088 Bacteria 34691
432 Ga0207641_10011187 3300026088 Bacteria 7361
433 Ga0207641_10050019 3300026088 Bacteria 3535
434 Ga0207641_10287783 3300026088 Bacteria 1548
435 Ga0207648_10001087 3300026089 Bacteria 30469
436 Ga0207676_10637518 3300026095 Bacteria 1027
437 Ga0207676_10726203 3300026095 Bacteria 964
438 Ga0207675_100000092 3300026118 Bacteria 70351
439 Ga0207675_100023186 3300026118 Bacteria 5772
440 Ga0207675_100496364 3300026118 Bacteria 1215
441 Ga0207683_10001707 3300026121 Bacteria 19650
442 Ga0207683_10009447 3300026121 Bacteria 8308
443 Ga0207683_10078668 3300026121 Bacteria 2923
444 Ga0207698_10085733 3300026142 Bacteria 2559
445 Ga0207698_10213277 3300026142 Bacteria 1739
446 Ga0207698_10297780 3300026142 Bacteria 1500
447 Ga0207428_10624064 3300027907 Bacteria 775
448 Ga0268266_10005521 3300028379 Bacteria 11771
449 Ga0268266_10011534 3300028379 Bacteria 7674
450 Ga0268266_10083810 3300028379 Bacteria 2783
451 Ga0268266_10311102 3300028379 Bacteria 1472
452 Ga0268266_10674964 3300028379 Bacteria 995
453 Ga0268266_11921807 3300028379 Bacteria 566
454 Ga0268265_10000099 3300028380 Bacteria 109591
455 Ga0268265_10076709 3300028380 Bacteria 2622
456 Ga0268265_10429662 3300028380 Bacteria 1228
457 Ga0268265_11540289 3300028380 Bacteria 669
458 Ga0268265_12492498 3300028380 Bacteria 523
459 Ga0268264_10000225 3300028381 Bacteria 109852
460 Ga0268264_10011261 3300028381 Bacteria 7391
461 Ga0265327_10000718 3300031251 Bacteria 52146
462 Ga0307413_10044755 3300031824 Bacteria 2619
463 Ga0307413_10547178 3300031824 Bacteria 938
464 Ga0307410_10062088 3300031852 Bacteria 2559
465 Ga0307410_10094172 3300031852 Bacteria 2133
466 Ga0307407_10941038 3300031903 Bacteria 665
467 Ga0307409_101074039 3300031995 Bacteria 825
468 Ga0307416_100817047 3300032002 Bacteria 1029
469 Ga0307416_100906096 3300032002 Bacteria 982
470 Ga0307415_101097020 3300032126 Bacteria 745
471 Ga0373948_0118545 3300034817 Bacteria 638
472 Ga0373950_0124442 3300034818 Bacteria 573
473 Ga0373938_0094428 3300034957 Bacteria 744
474 Ga0373938_0107245 3300034957 Bacteria 708
475 Ga0373928_0022102 3300035084 Bacteria 1347
476 Ga0373952_0065278 3300035092 Bacteria 899
477 Ga0373961_0445534 3300035241 Bacteria 504
478 Ga0373962_0046287 3300035242 Bacteria 1241
479 Ga0373931_0069217 3300035691 Bacteria 1923
480 Ga0373931_0371888 3300035691 Bacteria 899
481 Ga0395899_0755680 3300037312 Bacteria 605
482 Ga0395905_0487277 3300037471 Bacteria 1133
483 Ga0436364_0609204 3300037853 Bacteria 2607
484 Ga0436364_0923236 3300037853 Bacteria 10911
485 Ga0436364_1009445 3300037853 Bacteria 41017
486 Ga0436365_0739235 3300039437 Bacteria 18954
487 Ga0436365_1125299 3300039437 Bacteria 10241
488 Ga0436365_1129068 3300039437 Bacteria 8742
489 Ga0436365_1374583 3300039437 Bacteria 4871
490 Ga0436360_1026989 3300039438 Bacteria 3514
491 Ga0436363_0081253 3300039450 Bacteria 1164
492 Ga0439461_0056680 3300041410 Bacteria 881
493 Ga0439466_0017375 3300041411 Bacteria 2593
494 Ga0439466_0032041 3300041411 Bacteria 1794
495 Ga0439466_0033557 3300041411 Bacteria 1744
496 Ga0439465_0014714 3300041413 Bacteria 2439
497 Ga0439465_0096698 3300041413 Bacteria 1016
498 Ga0439465_0205039 3300041413 Bacteria 719
499 Ga0451791_0046380 3300041451 Bacteria 1200
500 Ga0451793_0139229 3300041452 Bacteria 582
501 Ga0451793_0914824 3300041452 Bacteria 521
502 Ga0451800_0575380 3300041459 Bacteria 814
503 Ga0451806_812570 3300041462 Bacteria 1017
504 Ga0451807_2265682 3300041486 Bacteria 661
505 Ga0451841_1195422 3300041498 Bacteria 801
506 Ga0451851_0151221 3300041507 Bacteria 737
507 Ga0451853_2119384 3300041512 Bacteria 1188
508 Ga0451853_3043390 3300041512 Bacteria 1208
509 Ga0439431_0073400 3300041997 Bacteria 914
510 Ga0439442_070304 3300042002 Bacteria 745
511 Ga0439445_0041403 3300042004 Bacteria 1225
512 Ga0439445_0109639 3300042004 Bacteria 787
513 Ga0439448_0050146 3300042005 Bacteria 1365
514 Ga0439448_0069373 3300042005 Bacteria 1173
515 Ga0439448_0223466 3300042005 Bacteria 662
516 Ga0439434_0009592 3300042435 Bacteria 2848
517 Ga0439434_0073109 3300042435 Bacteria 1081
518 Ga0439464_0242347 3300042439 Bacteria 581
519 Ga0466972_0025194 3300044658 Bacteria 2950
520 Ga0466972_0069720 3300044658 Bacteria 1678
521 Ga0466972_0107901 3300044658 Bacteria 1316
522 Ga0466972_0141937 3300044658 Bacteria 1130
523 Ga0466965_0046421 3300044683 Bacteria 2150
524 Ga0466965_0091736 3300044683 Bacteria 1546
525 Ga0466966_0035723 3300044684 Bacteria 3209
526 Ga0466966_0053142 3300044684 Bacteria 2570
527 Ga0466966_0587352 3300044684 Bacteria 670
528 Ga0466961_0012784 3300044693 Bacteria 5374
529 Ga0466963_0608918 3300044694 Bacteria 771
530 Ga0466964_0205024 3300044706 Bacteria 949
531 Ga0466964_0392420 3300044706 Bacteria 723
532 Ga0466971_0024518 3300044719 Bacteria 2691
533 Ga0466971_0299170 3300044719 Bacteria 772
534 Ga0466968_0294447 3300044735 Bacteria 779
535 Ga0466970_0094495 3300044765 Bacteria 1624
536 Ga0466970_0146477 3300044765 Bacteria 1303
537 Ga0466970_0752457 3300044765 Bacteria 569
538 Ga0466957_0236255 3300044842 Bacteria 1211
539 Ga0466960_0029040 3300044901 Bacteria 2535
540 Ga0466960_0050540 3300044901 Bacteria 2005
541 Ga0466959_0122168 3300045049 Bacteria 1850
542 Ga0466959_0338708 3300045049 Bacteria 1026
543 Ga0466958_0021179 3300045836 Bacteria 3796
544 Ga0466967_0059170 3300045976 Bacteria 3390
545 Ga0466967_0170337 3300045976 Bacteria 2048
546 Ga0466967_0463621 3300045976 Bacteria 1240
547 Ga0466967_1136840 3300045976 Bacteria 778
548 Ga0495603_0020307 3300046455 Bacteria 4026
549 Ga0495629_0128285 3300046459 Bacteria 1767
550 Ga0495638_0000303 3300046460 Bacteria 63516
551 Ga0495638_0028539 3300046460 Bacteria 3602
552 Ga0495582_0080815 3300046473 Bacteria 1805
553 Ga0495639_0033579 3300046475 Bacteria 2292
554 Ga0495594_0040604 3300046499 Bacteria 2547
555 Ga0495606_0021415 3300046507 Bacteria 4735
556 Ga0495630_0206952 3300046517 Bacteria 1498
557 Ga0495648_0040945 3300046524 Bacteria 2931
558 Ga0495640_0020602 3300046533 Bacteria 4851
559 Ga0495640_0458620 3300046533 Bacteria 778
560 Ga0495668_0031974 3300046616 Bacteria 2963
561 Ga0495611_0021350 3300046648 Bacteria 2797
562 Ga0495624_0059748 3300046690 Bacteria 2391
563 Ga0495671_0041514 3300046692 Bacteria 2316
564 Ga0495649_0418837 3300046694 Bacteria 671
565 Ga0495674_0038871 3300047319 Bacteria 4268
566 Ga0495672_0002698 3300047320 Bacteria 15941
567 Ga0495672_0192862 3300047320 Bacteria 1023
568 Ga0495672_0440875 3300047320 Bacteria 589
569 Ga0495672_0464739 3300047320 Bacteria 568
570 Ga0495676_0056885 3300047321 Bacteria 3090
571 Ga0495673_0001039 3300047469 Bacteria 24467
572 Ga0495686_0001351 3300047472 Bacteria 27403
573 Ga0495593_0068495 3300047673 Bacteria 1846
574 Ga0495626_0328803 3300048091 Bacteria 600
575 Ga0496100_0000214 3300048903 Bacteria 31974
576 Ga0496100_0000706 3300048903 Bacteria 15941
577 Ga0496100_0004157 3300048903 Bacteria 7631
578 Ga0496100_0021987 3300048903 Bacteria 3852
579 Ga0496100_0204616 3300048903 Bacteria 1441
580 Ga0496101_0000034 3300048904 Bacteria 178045
581 Ga0496101_0001539 3300048904 Bacteria 13816
582 Ga0496101_0006642 3300048904 Bacteria 7455
583 Ga0496101_0265177 3300048904 Bacteria 1340
584 Ga0496101_0548822 3300048904 Bacteria 914
585 Ga0496101_0664123 3300048904 Bacteria 823
586 Ga0496102_0003014 3300048905 Bacteria 14265
587 Ga0496102_0003734 3300048905 Bacteria 12870
588 Ga0496102_0012407 3300048905 Bacteria 7374
589 Ga0496102_0044791 3300048905 Bacteria 4016
590 Ga0496102_0066724 3300048905 Bacteria 3298
591 Ga0496102_0073198 3300048905 Bacteria 3149
592 Ga0496102_0091717 3300048905 Bacteria 2812
593 Ga0496102_0120656 3300048905 Bacteria 2448
594 Ga0496102_0205744 3300048905 Bacteria 1856
595 Ga0496102_0805311 3300048905 Bacteria 862
596 Ga0496103_0001837 3300048906 Bacteria 13797
597 Ga0496103_0014660 3300048906 Bacteria 4657
598 Ga0496103_0098664 3300048906 Bacteria 1847
599 Ga0496103_0143419 3300048906 Bacteria 1528
600 Ga0496103_0275136 3300048906 Bacteria 1083
601 Ga0496103_0522487 3300048906 Bacteria 759
602 Ga0496104_0002711 3300048907 Bacteria 15248
603 Ga0496104_0007127 3300048907 Bacteria 9857
604 Ga0496104_0061970 3300048907 Bacteria 3546
605 Ga0496104_0975346 3300048907 Bacteria 752
606 Ga0496105_0008132 3300048908 Bacteria 8156
607 Ga0496105_0023417 3300048908 Bacteria 5008
608 Ga0496105_0104425 3300048908 Bacteria 2340
609 Ga0496105_0833712 3300048908 Bacteria 699
610 Ga0496106_0000843 3300048909 Bacteria 22268
611 Ga0496106_0000972 3300048909 Bacteria 20919
612 Ga0496106_0013011 3300048909 Bacteria 6138
613 Ga0496106_1003289 3300048909 Bacteria 656
614 Ga0496107_0000108 3300048910 Bacteria 40403
615 Ga0496107_0020919 3300048910 Bacteria 4625
616 Ga0496107_0088346 3300048910 Bacteria 2263
617 Ga0496107_0200980 3300048910 Bacteria 1481
618 Ga0496107_0516610 3300048910 Bacteria 885
619 Ga0496107_0567007 3300048910 Bacteria 840
620 Ga0496108_0001375 3300048911 Bacteria 19133
621 Ga0496108_0002193 3300048911 Bacteria 15653
622 Ga0496108_0011924 3300048911 Bacteria 7072
623 Ga0496108_0029867 3300048911 Bacteria 4517
624 Ga0496109_0000127 3300048912 Bacteria 77905
625 Ga0496109_0002455 3300048912 Bacteria 15539
626 Ga0496109_0100799 3300048912 Bacteria 2679
627 Ga0496109_0119504 3300048912 Bacteria 2454
628 Ga0496109_0546598 3300048912 Bacteria 1093
629 Ga0496109_1603142 3300048912 Bacteria 585
630 Ga0496110_0023466 3300048913 Bacteria 5248
631 Ga0496110_0141619 3300048913 Bacteria 2174
632 Ga0496110_0268733 3300048913 Bacteria 1552
633 Ga0496111_0032381 3300048914 Bacteria 3727
634 Ga0496111_0065061 3300048914 Bacteria 2646
635 Ga0496111_0186534 3300048914 Bacteria 1542
636 Ga0496111_0449747 3300048914 Bacteria 950
637 Ga0496111_0815688 3300048914 Bacteria 675
638 Ga0496112_0000750 3300048915 Bacteria 22692
639 Ga0496112_0021457 3300048915 Bacteria 6143
640 Ga0496112_0052373 3300048915 Bacteria 4005
641 Ga0496112_0133876 3300048915 Bacteria 2449
642 Ga0496112_0442969 3300048915 Bacteria 1237
643 Ga0496113_0083435 3300048916 Bacteria 2452
644 Ga0496113_0166805 3300048916 Bacteria 1743
645 Ga0496113_0325958 3300048916 Bacteria 1231
646 Ga0496113_0443919 3300048916 Bacteria 1042
647 Ga0496113_0512360 3300048916 Bacteria 963
648 Ga0496114_0000196 3300048917 Bacteria 43970
649 Ga0496114_0000277 3300048917 Bacteria 37457
650 Ga0496114_0001176 3300048917 Bacteria 19820
651 Ga0496114_0111165 3300048917 Bacteria 2348
652 Ga0496114_1094402 3300048917 Bacteria 682
653 Ga0496115_0002281 3300048918 Bacteria 13734
654 Ga0496115_0006820 3300048918 Bacteria 8378
655 Ga0496115_0019244 3300048918 Bacteria 5252
656 Ga0496115_0579855 3300048918 Bacteria 894
657 Ga0496116_0008130 3300048919 Bacteria 9165
658 Ga0496117_0040452 3300048920 Bacteria 3428
659 Ga0496117_0468013 3300048920 Bacteria 619
660 Ga0496118_0001772 3300048921 Bacteria 31254
661 Ga0496118_0021761 3300048921 Bacteria 5631
662 Ga0496119_0002179 3300048922 Bacteria 21959
663 Ga0496120_0088036 3300048923 Bacteria 1665
664 Ga0496121_0000048 3300048924 Bacteria 330242
665 Ga0496122_0002047 3300048925 Bacteria 29932
666 Ga0496122_0314343 3300048925 Bacteria 837
667 Ga0496123_0018590 3300048926 Bacteria 5518
668 Ga0496124_0000044 3300048927 Bacteria 289064
669 Ga0496125_0000037 3300048928 Bacteria 330242
670 Ga0496126_0000046 3300048929 Bacteria 330242
671 Ga0496126_0321576 3300048929 Bacteria 1271
672 Ga0496126_0627661 3300048929 Bacteria 844
673 Ga0496126_0706700 3300048929 Bacteria 783
674 Ga0501032_0038473 3300049569 Bacteria 3258
675 Ga0501033_0061972 3300049570 Bacteria 2755
676 Ga0501033_0610429 3300049570 Bacteria 747
677 Ga0501043_0420928 3300049579 Bacteria 1007
678 Ga0501046_0102875 3300049580 Bacteria 2190
679 Ga0501047_0023340 3300049581 Bacteria 5941
680 Ga0501047_0825548 3300049581 Bacteria 741
681 Ga0501048_0296478 3300049582 Bacteria 1150
682 Ga0501070_0222711 3300049586 Bacteria 1547
683 Ga0501074_1233946 3300049590 Bacteria 524
684 Ga0501035_0000818 3300049822 Bacteria 33183
685 Ga0501044_0000373 3300049823 Bacteria 56176
686 Ga0501044_0529660 3300049823 Bacteria 1077
687 Ga0501044_0962041 3300049823 Bacteria 727
688 nmdc:mga03683_112444_c1 3300050489 Bacteria 1205
689 nmdc:mga03683_157323_c1 3300050489 Bacteria 1028
690 nmdc:mga03683_420603_c1 3300050489 Bacteria 640
691 nmdc:mga03683_83444_c1 3300050489 Bacteria 1383
692 nmdc:mga03n38_157366_c1 3300050490 Bacteria 1148
693 nmdc:mga03n38_16609_c2 3300050490 Bacteria 1408
694 nmdc:mga03n38_180267_c1 3300050490 Bacteria 1082
695 nmdc:mga03n38_195082_c1 3300050490 Bacteria 1045
696 nmdc:mga03n38_229023_c1 3300050490 Bacteria 973
697 nmdc:mga03n38_32458_c1 3300050490 Bacteria 2212
698 nmdc:mga03n38_479606_c1 3300050490 Bacteria 695
699 nmdc:mga03n38_812260_c1 3300050490 Bacteria 545
700 nmdc:mga03n38_8140_c1 3300050490 Bacteria 3747
701 nmdc:mga00v17_22269_c1 3300050491 Bacteria 3655
702 nmdc:mga00v17_24506_c1 3300050491 Bacteria 3501
703 nmdc:mga00v17_3751_c1 3300050491 Bacteria 7843
704 nmdc:mga00v17_695565_c1 3300050491 Bacteria 652
705 nmdc:mga0yw44_1012880_c1 3300050492 Bacteria 562
706 nmdc:mga0yw44_1140296_c1 3300050492 Bacteria 526
707 nmdc:mga0yw44_1162210_c1 3300050492 Bacteria 521
708 nmdc:mga0yw44_267661_c1 3300050492 Bacteria 1140
709 nmdc:mga0yw44_420198_c1 3300050492 Bacteria 905
710 nmdc:mga0yw44_42568_c1 3300050492 Bacteria 2708
711 nmdc:mga06z11_191450_c1 3300050494 Bacteria 1184
712 nmdc:mga06z11_45199_c1 3300050494 Bacteria 2225
713 nmdc:mga06z11_472811_c1 3300050494 Bacteria 758
714 nmdc:mga06z11_719662_c1 3300050494 Bacteria 608
715 nmdc:mga07m45_19712_c1 3300050496 Bacteria 3655
716 nmdc:mga07m45_39964_c1 3300050496 Bacteria 2624
717 nmdc:mga07m45_41644_c2 3300050496 Bacteria 2018
718 nmdc:mga07m45_711375_c1 3300050496 Bacteria 577
719 nmdc:mga05p37_1106217_c1 3300050507 Bacteria 829
720 nmdc:mga05p37_131574_c1 3300050507 Bacteria 3070
721 nmdc:mga0qj67_12818_c1 3300050509 Bacteria 6323
722 nmdc:mga06r32_167978_c1 3300050510 Bacteria 2177
723 nmdc:mga08y16_693016_c1 3300050511 Bacteria 1019
724 nmdc:mga0sz30_102090_c1 3300050516 Bacteria 1253
725 nmdc:mga0sz30_137604_c1 3300050516 Bacteria 1078
726 nmdc:mga0sz30_152746_c1 3300050516 Bacteria 1021
727 nmdc:mga0sz30_17068_c1 3300050516 Bacteria 2891
728 nmdc:mga0sz30_26127_c1 3300050516 Bacteria 2391
729 nmdc:mga0sz30_275038_c1 3300050516 Bacteria 750
730 nmdc:mga0sz30_3159_c1 3300050516 Bacteria 5898
731 nmdc:mga0sz30_3321_c1 3300050516 Bacteria 5787
732 nmdc:mga0sz30_38843_c1 3300050516 Bacteria 1995
733 nmdc:mga0sz30_89968_c1 3300050516 Bacteria 1335
734 Ga0500610_0000961 3300053079 Bacteria 9356
735 Ga0500635_0085056 3300053080 Bacteria 1142
736 Ga0495655_0001286 3300053083 Bacteria 3863
737 Ga0500578_0572478 3300053086 Bacteria 625
738 Ga0500643_013179 3300053087 Bacteria 2930
739 Ga0500581_161565 3300053089 Bacteria 1040
740 Ga0500641_0148442 3300053096 Bacteria 1012
741 Ga0500556_0013472 3300053104 Bacteria 2475
742 Ga0500557_264330 3300053105 Bacteria 534
743 Ga0500562_071794 3300053108 Bacteria 934
744 Ga0500595_039535 3300053119 Bacteria 1526
745 Ga0500608_161571 3300053122 Bacteria 970
746 Ga0500628_029505 3300053129 Bacteria 1179
747 Ga0500559_0106707 3300053136 Bacteria 1295
748 Ga0500559_0196510 3300053136 Bacteria 951
749 Ga0500564_363625 3300053138 Bacteria 534
750 Ga0500589_314812 3300053147 Bacteria 549
751 Ga0500627_0021169 3300053158 Bacteria 2621
752 Ga0500633_0380602 3300053160 Bacteria 511
753 Ga0500611_067285 3300053727 Bacteria 864
754 Ga0500645_000004 3300053730 Bacteria 305014
755 Ga0500645_035787 3300053730 Bacteria 1478
756 Ga0466962_0081620 3300061719 Bacteria 1546
757 2644488325 2643221687 Bacteria 6500351
758 2738663824 2738541264 Bacteria 5935393
759 2738703172 2738541274 Bacteria 6909446
760 2739142959 2738541356 Bacteria 5935017
761 2739329364 2738543028 Bacteria 6917070
762 2842136155 2842134933 Bacteria 5847019
763 2902800422 2902799365 Bacteria 5419524
764 2902841417 2902837492 Bacteria 6697721
765 nmdc:mga0qj67_140769_c1
766 CNXas_1006957
767 JGI24746J21847_1000883
768 JGI24739J22299_10088410
769 JGI24737J22298_10148152
770 JGI24743J22301_10005061
771 JGI24743J22301_10079780
772 JGI24750J21931_1010996
773 JGI24745J21846_1009302
774 JGI24738J21930_10030387
775 JGI24744J21845_10003930
776 JGI24744J21845_10048137
777 JGI24744J21845_10091115
778 JGI24034J26672_10019505
779 JGI24034J26672_10022505
780 JGI24742J22300_10004107
781 Ga0055540_1000038
782 Ga0055540_1002436
783 Ga0055540_1003290
784 Ga0055540_1006422
785 Ga0055540_1021751
786 Ga0070676_10123672
787 Ga0070683_101748718
788 Ga0070690_100018561
789 Ga0070690_100400419
790 Ga0070670_100922052
791 Ga0070670_101108632
792 Ga0070677_10450894
793 Ga0068869_100012907
794 Ga0068869_100099188
795 Ga0070666_10058079
796 Ga0070666_10421098
797 Ga0070680_100269026
798 Ga0070682_100032049
799 Ga0070682_100042707
800 Ga0070682_100066688
801 Ga0068868_100080870
802 Ga0068868_100851082
803 Ga0068868_100865225
804 Ga0068868_101371978
805 Ga0068868_101797665
806 Ga0070660_100932968
807 Ga0070689_100008473
808 Ga0070689_100455969
809 Ga0070691_10262866
810 Ga0070692_10050111
811 Ga0070692_10270886
812 Ga0070668_100006600
813 Ga0070668_100050726
814 Ga0070668_100094142
815 Ga0070668_100178611
816 Ga0070669_100018503
817 Ga0070669_100054965
818 Ga0070669_100144581
819 Ga0070675_100790305
820 Ga0070671_100047317
821 Ga0070671_100090416
822 Ga0070671_101308790
823 Ga0070674_100001087
824 Ga0070674_100026920
825 Ga0070674_100122834
826 Ga0070673_100082584
827 Ga0070673_100375938
828 Ga0070688_100008732
829 Ga0070688_100046664
830 Ga0070688_100388855
831 Ga0070688_101696979
832 Ga0070659_100115670
833 Ga0070667_100000099
834 Ga0070667_100000883
835 Ga0070667_100003549
836 Ga0070667_100011479
837 Ga0070667_100079308
838 Ga0070667_100467383
839 Ga0070703_10272343
840 Ga0070709_10078267
841 Ga0070714_100122617
842 Ga0070713_100478243
843 Ga0070713_101237355
844 Ga0070710_10117778
845 Ga0070710_10124710
846 Ga0070710_10529321
847 Ga0070701_10001043
848 Ga0070701_10086247
849 Ga0070701_10220697
850 Ga0070711_100000430
851 Ga0070711_100022902
852 Ga0070711_100688347
853 Ga0070705_100025834
854 Ga0070705_100098966
855 Ga0070700_100021392
856 Ga0070700_100189308
857 Ga0070694_100143506
858 Ga0070694_101900859
859 Ga0070708_100826271
860 Ga0070663_100023196
861 Ga0070663_100100148
862 Ga0070663_100103139
863 Ga0070663_100147015
864 Ga0070678_100000296
865 Ga0070678_100078482
866 Ga0070678_100261352
867 Ga0070678_101464045
868 Ga0070662_100006688
869 Ga0070662_100445240
870 Ga0068867_100664832
871 Ga0068867_100807313
872 Ga0070685_10228277
873 Ga0070685_10355345
874 Ga0070685_10440791
875 Ga0070679_100305550
876 Ga0070684_100221720
877 Ga0070697_100586737
878 Ga0068853_100027907
879 Ga0070672_100136080
880 Ga0070686_100292772
881 Ga0070686_101217859
882 Ga0070695_100008828
883 Ga0070696_100007202
884 Ga0070696_100460119
885 Ga0070693_100229888
886 Ga0070693_101653624
887 Ga0070665_100004453
888 Ga0070665_100013600
889 Ga0070665_100041302
890 Ga0070665_100225567
891 Ga0070704_100000484
892 Ga0070704_100226580
893 Ga0068855_100110121
894 Ga0068855_100456549
895 Ga0070664_100754619
896 Ga0070664_101083791
897 Ga0068854_100001737
898 Ga0068854_100158150
899 Ga0068856_100131040
900 Ga0068856_101469930
901 Ga0070702_100006999
902 Ga0070702_100167640
903 Ga0070702_100430631
904 Ga0068852_100049700
905 Ga0068852_100105532
906 Ga0068852_100399042
907 Ga0068859_100002520
908 Ga0068859_100033579
909 Ga0068859_102146558
910 Ga0068859_103021453
911 Ga0068864_100425882
912 Ga0068864_100479316
913 Ga0068864_101080750
914 Ga0068866_10008033
915 Ga0068866_10241420
916 Ga0068861_100659237
917 Ga0068861_101043680
918 Ga0068861_102678231
919 Ga0068851_10032741
920 Ga0068870_10118219
921 Ga0068870_10688189
922 Ga0068863_100004183
923 Ga0068863_100020294
924 Ga0068863_100064328
925 Ga0068863_100353172
926 Ga0068863_100805851
927 Ga0068858_100001766
928 Ga0068858_100005212
929 Ga0068858_100030133
930 Ga0068858_100435684
931 Ga0068858_102041115
932 Ga0068860_100000163
933 Ga0068860_100002020
934 Ga0068860_100238935
935 Ga0068860_100518753
936 Ga0068862_100000089
937 Ga0068862_100026898
938 Ga0081455_10013048
939 Ga0081455_10121865
940 Ga0081538_10163191
941 Ga0081538_10211276
942 Ga0070717_10762168
943 Ga0075365_10006240
944 Ga0075365_10126677
945 Ga0075365_10345223
946 Ga0075365_10354895
947 Ga0075363_100000380
948 Ga0075363_100005995
949 Ga0075363_100055529
950 Ga0075363_100275747
951 Ga0075363_100324104
952 Ga0075363_100387109
953 Ga0075363_100540284
954 Ga0075364_10002787
955 Ga0075364_10027182
956 Ga0075364_10124320
957 Ga0075364_10221712
958 Ga0075364_10375362
959 Ga0075364_10648213
960 Ga0070715_10005981
961 Ga0070715_10510242
962 Ga0070716_100003803
963 Ga0070716_100250263
964 Ga0070716_100337768
965 Ga0070712_100000975
966 Ga0070712_100006327
967 Ga0070712_100468778
968 Ga0070712_101931097
969 Ga0075362_10022281
970 Ga0075362_10479833
971 Ga0075367_10133924
972 Ga0075367_10646161
973 Ga0075369_10003154
974 Ga0075369_10008468
975 Ga0075369_10020039
976 Ga0075369_10057496
977 Ga0075369_10069164
978 Ga0075369_10105529
979 Ga0075369_10125015
980 Ga0075369_10199166
981 Ga0097621_100195233
982 Ga0097621_100813663
983 Ga0075370_10021837
984 Ga0068871_100024660
985 Ga0075428_100003226
986 Ga0075430_100169928
987 Ga0075430_100207734
988 Ga0075431_100024868
989 Ga0075429_100349182
990 Ga0068865_100000952
991 Ga0068865_100558166
992 Ga0068865_101224622
993 Ga0097620_100002520
994 Ga0097620_100033579
995 Ga0097620_102146393
996 Ga0097620_103019966
997 Ga0099795_10012991
998 Ga0105250_10097750
999 Ga0111539_10199014
1000 Ga0105245_10003572
1001 Ga0105245_10042426
1002 Ga0105245_11204085
1003 Ga0105245_12671619
1004 Ga0105245_13208363
1005 Ga0105247_10000987
1006 Ga0105247_10541138
1007 Ga0105247_11282994
1008 Ga0114129_10006072
1009 Ga0114129_11396977
1010 Ga0105243_10002294
1011 Ga0105243_10014510
1012 Ga0105241_10063994
1013 Ga0105241_10071447
1014 Ga0105241_10429266
1015 Ga0105242_10002156
1016 Ga0105242_10988914
1017 Ga0105242_11068488
1018 Ga0105242_12111745
1019 Ga0105248_10003302
1020 Ga0105248_10154796
1021 Ga0105248_10233534
1022 Ga0105248_11232819
1023 Ga0105237_10004951
1024 Ga0105237_10516588
1025 Ga0105237_10526128
1026 Ga0105249_10001271
1027 Ga0105249_11474002
1028 Ga0105249_12467294
1029 Ga0105249_13322341
1030 Ga0099796_10015934
1031 Ga0099796_10497555
1032 Ga0105239_10014830
1033 Ga0105239_10125917
1034 Ga0105239_10435432
1035 Ga0105239_10572443
1036 Ga0105239_11602919
1037 Ga0105246_10289636
1038 Ga0105246_12289847
1039 Ga0157371_10128554
1040 Ga0157370_10743771
1041 Ga0157369_10211219
1042 Ga0157369_10451626
1043 Ga0157369_10651346
1044 Ga0157369_11365138
1045 Ga0157374_10009219
1046 Ga0157374_10321273
1047 Ga0157378_10008792
1048 Ga0157378_10626175
1049 Ga0163162_10001807
1050 Ga0163162_10340642
1051 Ga0163162_10479326
1052 Ga0163162_10651244
1053 Ga0163162_11058166
1054 Ga0157372_10010172
1055 Ga0157372_10134099
1056 Ga0157372_13442802
1057 Ga0157375_10008317
1058 Ga0157375_10579126
1059 Ga0157375_10610370
1060 Ga0157375_12805537
1061 Ga0163163_10295841
1062 Ga0163163_10800492
1063 Ga0163163_10982190
1064 Ga0163163_12438299
1065 Ga0157380_10005410
1066 Ga0157380_10371697
1067 Ga0157377_10110551
1068 Ga0157379_10003999
1069 Ga0157379_10271181
1070 Ga0157379_10681472
1071 Ga0157379_11260164
1072 Ga0157376_10032896
1073 Ga0163161_10002119
1074 Ga0163161_10077056
1075 Ga0213876_10003522
1076 Ga0213876_10100747
1077 Ga0213875_10019301
1078 Ga0213875_10021732
1079 Ga0209673_1004821
1080 Ga0209051_1000014
1081 Ga0209051_1000865
1082 Ga0209051_1004861
1083 Ga0209051_1008335
1084 Ga0209051_1031642
1085 Ga0209051_1031723
1086 Ga0207656_10062897
1087 Ga0207653_10087304
1088 Ga0207692_10052908
1089 Ga0207692_10173106
1090 Ga0207692_10225768
1091 Ga0207642_10588487
1092 Ga0207710_10000117
1093 Ga0207710_10000775
1094 Ga0207710_10030443
1095 Ga0207688_10000617
1096 Ga0207688_10003543
1097 Ga0207647_10034038
1098 Ga0207647_10514054
1099 Ga0207685_10051161
1100 Ga0207645_10029887
1101 Ga0207645_10119702
1102 Ga0207643_10377365
1103 Ga0207654_10135548
1104 Ga0207654_10424735
1105 Ga0207671_10026472
1106 Ga0207671_10553932
1107 Ga0207693_10000681
1108 Ga0207693_10000765
1109 Ga0207693_10278290
1110 Ga0207663_10007432
1111 Ga0207663_10023101
1112 Ga0207660_10255241
1113 Ga0207657_10330357
1114 Ga0207646_10526793
1115 Ga0207681_10013910
1116 Ga0207681_10093402
1117 Ga0207694_11127793
1118 Ga0207650_10285078
1119 Ga0207659_10165281
1120 Ga0207687_10000262
1121 Ga0207687_10259225
1122 Ga0207687_10860480
1123 Ga0207664_10201300
1124 Ga0207644_10008870
1125 Ga0207644_10276461
1126 Ga0207644_10965575
1127 Ga0207690_10069000
1128 Ga0207706_10029716
1129 Ga0207706_10093414
1130 Ga0207706_11235790
1131 Ga0207686_10002679
1132 Ga0207686_10489909
1133 Ga0207686_11209840
1134 Ga0207709_10004066
1135 Ga0207709_10160594
1136 Ga0207670_10028681
1137 Ga0207669_10013908
1138 Ga0207669_10173828
1139 Ga0207669_10317744
1140 Ga0207669_11720450
1141 Ga0207704_10000495
1142 Ga0207665_10015066
1143 Ga0207665_10042950
1144 Ga0207665_10292091
1145 Ga0207665_10647490
1146 Ga0207691_10142832
1147 Ga0207711_10000096
1148 Ga0207711_10042460
1149 Ga0207711_10232845
1150 Ga0207689_10366440
1151 Ga0207689_10745421
1152 Ga0207661_10201491
1153 Ga0207661_11982612
1154 Ga0207679_10862226
1155 Ga0207667_10427041
1156 Ga0207651_10115987
1157 Ga0207651_10696016
1158 Ga0207712_10000083
1159 Ga0207712_10002296
1160 Ga0207712_10031961
1161 Ga0207668_10010883
1162 Ga0207668_10079644
1163 Ga0207668_10108663
1164 Ga0207668_10188497
1165 Ga0207668_10780642
1166 Ga0207668_11122647
1167 Ga0207640_10175165
1168 Ga0207640_10191346
1169 Ga0207640_10502228
1170 Ga0207658_10000085
1171 Ga0207658_10008607
1172 Ga0207658_10013063
1173 Ga0207658_10163837
1174 Ga0207658_10332705
1175 Ga0207677_10031778
1176 Ga0207677_10082213
1177 Ga0207677_10465508
1178 Ga0207677_10661552
1179 Ga0207703_10041273
1180 Ga0207703_10187982
1181 Ga0207703_10889952
1182 Ga0207703_11777951
1183 Ga0207639_10009143
1184 Ga0207639_10121274
1185 Ga0207639_10291760
1186 Ga0207678_10002286
1187 Ga0207678_10046392
1188 Ga0207678_10072908
1189 Ga0207678_10168389
1190 Ga0207678_11025970
1191 Ga0207708_10012484
1192 Ga0207708_10013474
1193 Ga0207708_11374733
1194 Ga0207702_10399916
1195 Ga0207641_10000762
1196 Ga0207641_10011187
1197 Ga0207641_10050019
1198 Ga0207641_10287783
1199 Ga0207648_10001087
1200 Ga0207676_10637518
1201 Ga0207676_10726203
1202 Ga0207675_100000092
1203 Ga0207675_100023186
1204 Ga0207675_100496364
1205 Ga0207683_10001707
1206 Ga0207683_10009447
1207 Ga0207683_10078668
1208 Ga0207698_10085733
1209 Ga0207698_10213277
1210 Ga0207698_10297780
1211 Ga0207428_10624064
1212 Ga0268266_10005521
1213 Ga0268266_10011534
1214 Ga0268266_10083810
1215 Ga0268266_10311102
1216 Ga0268266_10674964
1217 Ga0268266_11921807
1218 Ga0268265_10000099
1219 Ga0268265_10076709
1220 Ga0268265_10429662
1221 Ga0268265_11540289
1222 Ga0268265_12492498
1223 Ga0268264_10000225
1224 Ga0268264_10011261
1225 Ga0265327_10000718
1226 Ga0307413_10044755
1227 Ga0307413_10547178
1228 Ga0307410_10062088
1229 Ga0307410_10094172
1230 Ga0307407_10941038
1231 Ga0307409_101074039
1232 Ga0307416_100817047
1233 Ga0307416_100906096
1234 Ga0307415_101097020
1235 Ga0373948_0118545
1236 Ga0373950_0124442
1237 Ga0373938_0094428
1238 Ga0373938_0107245
1239 Ga0373928_0022102
1240 Ga0373952_0065278
1241 Ga0373961_0445534
1242 Ga0373962_0046287
1243 Ga0373931_0069217
1244 Ga0373931_0371888
1245 Ga0395899_0755680
1246 Ga0395905_0487277
1247 Ga0436364_0609204
1248 Ga0436364_0923236
1249 Ga0436364_1009445
1250 Ga0436365_0739235
1251 Ga0436365_1125299
1252 Ga0436365_1129068
1253 Ga0436365_1374583
1254 Ga0436360_1026989
1255 Ga0436363_0081253
1256 Ga0439461_0056680
1257 Ga0439466_0017375
1258 Ga0439466_0032041
1259 Ga0439466_0033557
1260 Ga0439465_0014714
1261 Ga0439465_0096698
1262 Ga0439465_0205039
1263 Ga0451791_0046380
1264 Ga0451793_0139229
1265 Ga0451793_0914824
1266 Ga0451800_0575380
1267 Ga0451806_812570
1268 Ga0451807_2265682
1269 Ga0451841_1195422
1270 Ga0451851_0151221
1271 Ga0451853_2119384
1272 Ga0451853_3043390
1273 Ga0439431_0073400
1274 Ga0439442_070304
1275 Ga0439445_0041403
1276 Ga0439445_0109639
1277 Ga0439448_0050146
1278 Ga0439448_0069373
1279 Ga0439448_0223466
1280 Ga0439434_0009592
1281 Ga0439434_0073109
1282 Ga0439464_0242347
1283 Ga0466972_0025194
1284 Ga0466972_0069720
1285 Ga0466972_0107901
1286 Ga0466972_0141937
1287 Ga0466965_0046421
1288 Ga0466965_0091736
1289 Ga0466966_0035723
1290 Ga0466966_0053142
1291 Ga0466966_0587352
1292 Ga0466961_0012784
1293 Ga0466963_0608918
1294 Ga0466964_0205024
1295 Ga0466964_0392420
1296 Ga0466971_0024518
1297 Ga0466971_0299170
1298 Ga0466968_0294447
1299 Ga0466970_0094495
1300 Ga0466970_0146477
1301 Ga0466970_0752457
1302 Ga0466957_0236255
1303 Ga0466960_0029040
1304 Ga0466960_0050540
1305 Ga0466959_0122168
1306 Ga0466959_0338708
1307 Ga0466958_0021179
1308 Ga0466967_0059170
1309 Ga0466967_0170337
1310 Ga0466967_0463621
1311 Ga0466967_1136840
1312 Ga0495603_0020307
1313 Ga0495629_0128285
1314 Ga0495638_0000303
1315 Ga0495638_0028539
1316 Ga0495582_0080815
1317 Ga0495639_0033579
1318 Ga0495594_0040604
1319 Ga0495606_0021415
1320 Ga0495630_0206952
1321 Ga0495648_0040945
1322 Ga0495640_0020602
1323 Ga0495640_0458620
1324 Ga0495668_0031974
1325 Ga0495611_0021350
1326 Ga0495624_0059748
1327 Ga0495671_0041514
1328 Ga0495649_0418837
1329 Ga0495674_0038871
1330 Ga0495672_0002698
1331 Ga0495672_0192862
1332 Ga0495672_0440875
1333 Ga0495672_0464739
1334 Ga0495676_0056885
1335 Ga0495673_0001039
1336 Ga0495686_0001351
1337 Ga0495593_0068495
1338 Ga0495626_0328803
1339 Ga0496100_0000214
1340 Ga0496100_0000706
1341 Ga0496100_0004157
1342 Ga0496100_0021987
1343 Ga0496100_0204616
1344 Ga0496101_0000034
1345 Ga0496101_0001539
1346 Ga0496101_0006642
1347 Ga0496101_0265177
1348 Ga0496101_0548822
1349 Ga0496101_0664123
1350 Ga0496102_0003014
1351 Ga0496102_0003734
1352 Ga0496102_0012407
1353 Ga0496102_0044791
1354 Ga0496102_0066724
1355 Ga0496102_0073198
1356 Ga0496102_0091717
1357 Ga0496102_0120656
1358 Ga0496102_0205744
1359 Ga0496102_0805311
1360 Ga0496103_0001837
1361 Ga0496103_0014660
1362 Ga0496103_0098664
1363 Ga0496103_0143419
1364 Ga0496103_0275136
1365 Ga0496103_0522487
1366 Ga0496104_0002711
1367 Ga0496104_0007127
1368 Ga0496104_0061970
1369 Ga0496104_0975346
1370 Ga0496105_0008132
1371 Ga0496105_0023417
1372 Ga0496105_0104425
1373 Ga0496105_0833712
1374 Ga0496106_0000843
1375 Ga0496106_0000972
1376 Ga0496106_0013011
1377 Ga0496106_1003289
1378 Ga0496107_0000108
1379 Ga0496107_0020919
1380 Ga0496107_0088346
1381 Ga0496107_0200980
1382 Ga0496107_0516610
1383 Ga0496107_0567007
1384 Ga0496108_0001375
1385 Ga0496108_0002193
1386 Ga0496108_0011924
1387 Ga0496108_0029867
1388 Ga0496109_0000127
1389 Ga0496109_0002455
1390 Ga0496109_0100799
1391 Ga0496109_0119504
1392 Ga0496109_0546598
1393 Ga0496109_1603142
1394 Ga0496110_0023466
1395 Ga0496110_0141619
1396 Ga0496110_0268733
1397 Ga0496111_0032381
1398 Ga0496111_0065061
1399 Ga0496111_0186534
1400 Ga0496111_0449747
1401 Ga0496111_0815688
1402 Ga0496112_0000750
1403 Ga0496112_0021457
1404 Ga0496112_0052373
1405 Ga0496112_0133876
1406 Ga0496112_0442969
1407 Ga0496113_0083435
1408 Ga0496113_0166805
1409 Ga0496113_0325958
1410 Ga0496113_0443919
1411 Ga0496113_0512360
1412 Ga0496114_0000196
1413 Ga0496114_0000277
1414 Ga0496114_0001176
1415 Ga0496114_0111165
1416 Ga0496114_1094402
1417 Ga0496115_0002281
1418 Ga0496115_0006820
1419 Ga0496115_0019244
1420 Ga0496115_0579855
1421 Ga0496116_0008130
1422 Ga0496117_0040452
1423 Ga0496117_0468013
1424 Ga0496118_0001772
1425 Ga0496118_0021761
1426 Ga0496119_0002179
1427 Ga0496120_0088036
1428 Ga0496121_0000048
1429 Ga0496122_0002047
1430 Ga0496122_0314343
1431 Ga0496123_0018590
1432 Ga0496124_0000044
1433 Ga0496125_0000037
1434 Ga0496126_0000046
1435 Ga0496126_0321576
1436 Ga0496126_0627661
1437 Ga0496126_0706700
1438 Ga0501032_0038473
1439 Ga0501033_0061972
1440 Ga0501033_0610429
1441 Ga0501043_0420928
1442 Ga0501046_0102875
1443 Ga0501047_0023340
1444 Ga0501047_0825548
1445 Ga0501048_0296478
1446 Ga0501070_0222711
1447 Ga0501074_1233946
1448 Ga0501035_0000818
1449 Ga0501044_0000373
1450 Ga0501044_0529660
1451 Ga0501044_0962041
1452 nmdc:mga03683_112444_c1
1453 nmdc:mga03683_157323_c1
1454 nmdc:mga03683_420603_c1
1455 nmdc:mga03683_83444_c1
1456 nmdc:mga03n38_157366_c1
1457 nmdc:mga03n38_16609_c2
1458 nmdc:mga03n38_180267_c1
1459 nmdc:mga03n38_195082_c1
1460 nmdc:mga03n38_229023_c1
1461 nmdc:mga03n38_32458_c1
1462 nmdc:mga03n38_479606_c1
1463 nmdc:mga03n38_812260_c1
1464 nmdc:mga03n38_8140_c1
1465 nmdc:mga00v17_22269_c1
1466 nmdc:mga00v17_24506_c1
1467 nmdc:mga00v17_3751_c1
1468 nmdc:mga00v17_695565_c1
1469 nmdc:mga0yw44_1012880_c1
1470 nmdc:mga0yw44_1140296_c1
1471 nmdc:mga0yw44_1162210_c1
1472 nmdc:mga0yw44_267661_c1
1473 nmdc:mga0yw44_420198_c1
1474 nmdc:mga0yw44_42568_c1
1475 nmdc:mga06z11_191450_c1
1476 nmdc:mga06z11_45199_c1
1477 nmdc:mga06z11_472811_c1
1478 nmdc:mga06z11_719662_c1
1479 nmdc:mga07m45_19712_c1
1480 nmdc:mga07m45_39964_c1
1481 nmdc:mga07m45_41644_c2
1482 nmdc:mga07m45_711375_c1
1483 nmdc:mga05p37_1106217_c1
1484 nmdc:mga05p37_131574_c1
1485 nmdc:mga0qj67_12818_c1
1486 nmdc:mga06r32_167978_c1
1487 nmdc:mga08y16_693016_c1
1488 nmdc:mga0sz30_102090_c1
1489 nmdc:mga0sz30_137604_c1
1490 nmdc:mga0sz30_152746_c1
1491 nmdc:mga0sz30_17068_c1
1492 nmdc:mga0sz30_26127_c1
1493 nmdc:mga0sz30_275038_c1
1494 nmdc:mga0sz30_3159_c1
1495 nmdc:mga0sz30_3321_c1
1496 nmdc:mga0sz30_38843_c1
1497 nmdc:mga0sz30_89968_c1
1498 Ga0500610_0000961
1499 Ga0500635_0085056
1500 Ga0495655_0001286
1501 Ga0500578_0572478
1502 Ga0500643_013179
1503 Ga0500581_161565
1504 Ga0500641_0148442
1505 Ga0500556_0013472
1506 Ga0500557_264330
1507 Ga0500562_071794
1508 Ga0500595_039535
1509 Ga0500608_161571
1510 Ga0500628_029505
1511 Ga0500559_0106707
1512 Ga0500559_0196510
1513 Ga0500564_363625
1514 Ga0500589_314812
1515 Ga0500627_0021169
1516 Ga0500633_0380602
1517 Ga0500611_067285
1518 Ga0500645_000004
1519 Ga0500645_035787
1520 Ga0466962_0081620
1521 2644488325
1522 2738663824
1523 2738703172
1524 2739142959
1525 2739329364
1526 2842136155
1527 2902800422
1528 2902841417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yqr-assembly1.cif.gz_A crystal structure of the ph-like domain of lam6 0.7231 13 110
3dcx-assembly1.cif.gz_E crystal structure of a duf1696 family protein with a pleckstrin-homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution 0.7146 13 109
7mp5-assembly1.cif.gz_A autoinhibited neurofibrobmin 0.699 13 110
3hsa-assembly1.cif.gz_B crystal structure of pleckstrin homology domain (yp_926556.1) from shewanella amazonensis sb2b at 1.99 a resolution 0.674 13 111
2d4q-assembly1.cif.gz_B crystal structure of the sec-ph domain of the human neurofibromatosis type 1 protein 0.6468 13 110
ID Description Score Start End Superfamily
af_O42976_194_304_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7602 13 110 2.30.29.30
af_G5EBE2_296_407_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7512 13 109 2.30.29.30
af_Q54IL5_882_987_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7442 13 109 2.30.29.30
af_Q06321_567_677_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7426 13 109 2.30.29.30
af_P43560_195_305_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7396 13 110 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A6M8G8I1-F1-model_v4 deleted 0.807 13 108
AF-A0A7W4E161-F1-model_v4 Uncharacterized protein 0.8061 13 110 GO:0016020
AF-A0A5B0CVJ2-F1-model_v4 deleted 0.7991 13 110
AF-A0A1A0TSG7-F1-model_v4 Uncharacterized protein 0.7938 1 111
AF-A0A4Z0N8N2-F1-model_v4 Uncharacterized protein 0.7882 8 109

Map