F479720

General Info

Members Datasets Scaffolds Average Seq Length
764 381 1528 419

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000255|Ga0081538_1000025519
Length 435
Sequence VSLNRELLLRLQAEVGERRTAERQARRAQRLPDLTGEADRQHTRPIIRDVVESYSHRLFEGTGTGLTEAAQSELVKALDARLFGAGPFQHLLDNDKVEDIHCNGYDKVFVRYADGFDEQVDPICDSNEELIQILQDLASYTGLSSRPFDTSNVELDLRLPDGSRLSATQGVSPWPTVSIRRHRHPILDLAREEELGTLDPDQAGFLRAAVRAKKNIMIAGGTGAGKTTLLRALASEIEPSERLITVERTLELALHEDETAHPNCVPFEERQPNAEGEGGVSLSSLVRRSLRMSPDRVIVGEVLGDEVVTMLNAMTQGNDGSLSTIHANSALEVVPRLCAYAIQAQERLPMEATQMLVAGALDFIVFMRKVDQQQRVIDSVIEITGYDGTMATHSHLWSAPRTGERGVRTAAQVTCHDDLVAAGWEPAPVQWGVGA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
340 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
341 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
342 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
343 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
344 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
345 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
346 2808606448 Streptomyces sp. 193411 Isolate Unclassified
347 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
348 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
349 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
350 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
351 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
352 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
353 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
354 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
355 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
356 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
357 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
358 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
359 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
360 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
361 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
362 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
363 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
364 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
365 2891562705 Microbispora tritici MT50 Isolate Unclassified
366 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
367 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
368 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
369 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
370 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
371 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
372 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
373 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
374 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
375 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
376 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
377 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
378 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
379 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
380 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
381 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 0.79
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 3.93
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10000255 3300005981 Bacteria 60411
2 JGI24752J21851_1005025 3300001976 Bacteria 1729
3 rootH2_10017422 3300003320 Bacteria 8587
4 JGI25407J50210_10003188 3300003373 Bacteria 3901
5 JGI25407J50210_10009036 3300003373 Bacteria 2518
6 JGI25404J52841_10003275 3300003659 Bacteria 3182
7 JGI25405J52794_10001814 3300003911 Bacteria 3581
8 Ga0070658_10051452 3300005327 Bacteria 3338
9 Ga0070676_10035040 3300005328 Bacteria 2885
10 Ga0070676_10108358 3300005328 Bacteria 1726
11 Ga0070683_100001315 3300005329 Bacteria 18902
12 Ga0070683_100106929 3300005329 Bacteria 2638
13 Ga0070670_100015913 3300005331 Bacteria 6454
14 Ga0070666_10058134 3300005335 Bacteria 2614
15 Ga0070666_10084271 3300005335 Bacteria 2175
16 Ga0070680_100021920 3300005336 Bacteria 5080
17 Ga0070680_100172502 3300005336 Bacteria 1820
18 Ga0070682_100132900 3300005337 Bacteria 1686
19 Ga0070660_100085219 3300005339 Bacteria 2484
20 Ga0070691_10002767 3300005341 Bacteria 7825
21 Ga0070691_10031804 3300005341 Bacteria 2476
22 Ga0070692_10003286 3300005345 Bacteria 6524
23 Ga0070692_10082909 3300005345 Bacteria 1730
24 Ga0070675_100072586 3300005354 Bacteria 2857
25 Ga0070675_100146299 3300005354 Bacteria 2023
26 Ga0070671_100021064 3300005355 Bacteria 5322
27 Ga0070673_100061073 3300005364 Bacteria 2988
28 Ga0070673_100266933 3300005364 Bacteria 1497
29 Ga0070688_100012699 3300005365 Bacteria 4726
30 Ga0070667_100040287 3300005367 Bacteria 3917
31 Ga0070667_100210030 3300005367 Bacteria 1730
32 Ga0070709_10000189 3300005434 Bacteria 39091
33 Ga0070709_10000434 3300005434 Bacteria 25299
34 Ga0070709_10001604 3300005434 Bacteria 12206
35 Ga0070714_100001576 3300005435 Bacteria 16570
36 Ga0070714_100004739 3300005435 Bacteria 10295
37 Ga0070714_100014181 3300005435 Bacteria 6398
38 Ga0070714_100036853 3300005435 Bacteria 4105
39 Ga0070714_100293458 3300005435 Bacteria 1514
40 Ga0070713_100009122 3300005436 Bacteria 7077
41 Ga0070713_100037847 3300005436 Bacteria 3903
42 Ga0070713_100134501 3300005436 Bacteria 2183
43 Ga0070713_100184898 3300005436 Bacteria 1875
44 Ga0070710_10000086 3300005437 Bacteria 41898
45 Ga0070710_10000388 3300005437 Bacteria 20532
46 Ga0070710_10029208 3300005437 Bacteria 2956
47 Ga0070701_10070394 3300005438 Bacteria 1869
48 Ga0070711_100000450 3300005439 Bacteria 21452
49 Ga0070711_100004074 3300005439 Bacteria 8593
50 Ga0070711_100012050 3300005439 Bacteria 5391
51 Ga0070700_100019037 3300005441 Bacteria 3957
52 Ga0070708_100037036 3300005445 Bacteria 4254
53 Ga0070663_100043357 3300005455 Bacteria 3166
54 Ga0070663_100054151 3300005455 Bacteria 2867
55 Ga0070663_100157607 3300005455 Bacteria 1745
56 Ga0070678_100011914 3300005456 Bacteria 5383
57 Ga0070662_100058936 3300005457 Bacteria 2796
58 Ga0070662_100066998 3300005457 Bacteria 2636
59 Ga0070681_10016756 3300005458 Bacteria 7316
60 Ga0070685_10057988 3300005466 Bacteria 2255
61 Ga0070706_100004551 3300005467 Bacteria 13334
62 Ga0070706_100006065 3300005467 Bacteria 11424
63 Ga0070706_100008619 3300005467 Bacteria 9504
64 Ga0070706_100014300 3300005467 Bacteria 7333
65 Ga0070706_100077243 3300005467 Bacteria 3082
66 Ga0070707_100001773 3300005468 Bacteria 20734
67 Ga0070707_100006610 3300005468 Bacteria 10757
68 Ga0070707_100012902 3300005468 Bacteria 7805
69 Ga0070707_100044477 3300005468 Bacteria 4251
70 Ga0070698_100000667 3300005471 Bacteria 36601
71 Ga0070698_100002497 3300005471 Bacteria 20270
72 Ga0070698_100003565 3300005471 Bacteria 17106
73 Ga0070698_100004639 3300005471 Bacteria 15108
74 Ga0070698_100044087 3300005471 Bacteria 4569
75 Ga0070698_100063698 3300005471 Bacteria 3718
76 Ga0070698_100088646 3300005471 Bacteria 3079
77 Ga0070698_100095875 3300005471 Bacteria 2944
78 Ga0070698_100105697 3300005471 Bacteria 2784
79 Ga0070699_100004163 3300005518 Bacteria 12787
80 Ga0070699_100068116 3300005518 Bacteria 3090
81 Ga0070699_100213231 3300005518 Bacteria 1719
82 Ga0070679_100020710 3300005530 Bacteria 6416
83 Ga0070684_100154568 3300005535 Bacteria 2080
84 Ga0070697_100028913 3300005536 Bacteria 4442
85 Ga0070697_100073232 3300005536 Bacteria 2812
86 Ga0070686_100062313 3300005544 Bacteria 2413
87 Ga0070665_100014224 3300005548 Bacteria 7992
88 Ga0070665_100051045 3300005548 Bacteria 4149
89 Ga0068855_100006758 3300005563 Bacteria 13913
90 Ga0068855_100107011 3300005563 Bacteria 3213
91 Ga0070664_100003142 3300005564 Bacteria 13351
92 Ga0070664_100063752 3300005564 Bacteria 3142
93 Ga0068857_100070808 3300005577 Bacteria 3106
94 Ga0068856_100026424 3300005614 Bacteria 5661
95 Ga0070702_100002682 3300005615 Bacteria 7774
96 Ga0068852_100013848 3300005616 Bacteria 6185
97 Ga0068859_100014255 3300005617 Bacteria 7973
98 Ga0068859_100192713 3300005617 Bacteria 2122
99 Ga0068864_100051438 3300005618 Bacteria 3549
100 Ga0068861_100141570 3300005719 Bacteria 1963
101 Ga0068851_10002540 3300005834 Bacteria 8026
102 Ga0068851_10049220 3300005834 Bacteria 2137
103 Ga0068870_10005686 3300005840 Bacteria 5456
104 Ga0068870_10029754 3300005840 Bacteria 2754
105 Ga0068858_100033380 3300005842 Bacteria 4777
106 Ga0068858_100098409 3300005842 Bacteria 2727
107 Ga0068860_100278990 3300005843 Bacteria 1632
108 Ga0081455_10000462 3300005937 Bacteria 53037
109 Ga0081455_10001621 3300005937 Bacteria 27482
110 Ga0081455_10006786 3300005937 Bacteria 12206
111 Ga0081455_10171067 3300005937 Bacteria 1655
112 Ga0081538_10000092 3300005981 Bacteria 87123
113 Ga0081538_10001645 3300005981 Bacteria 22911
114 Ga0081538_10021000 3300005981 Bacteria 4786
115 Ga0081540_1000156 3300005983 Bacteria 70177
116 Ga0081539_10016583 3300005985 Bacteria 5244
117 Ga0081539_10059857 3300005985 Bacteria 2094
118 Ga0070717_10002254 3300006028 Bacteria 13518
119 Ga0070717_10016681 3300006028 Bacteria 5699
120 Ga0070717_10022874 3300006028 Bacteria 4945
121 Ga0070717_10035764 3300006028 Bacteria 4024
122 Ga0070717_10068887 3300006028 Bacteria 2945
123 Ga0070717_10079439 3300006028 Bacteria 2751
124 Ga0070717_10127516 3300006028 Bacteria 2186
125 Ga0075365_10006659 3300006038 Bacteria 6382
126 Ga0075364_10005361 3300006051 Bacteria 7449
127 Ga0070715_10002576 3300006163 Bacteria 5596
128 Ga0070716_100000567 3300006173 Bacteria 15445
129 Ga0070716_100000775 3300006173 Bacteria 13702
130 Ga0070712_100001419 3300006175 Bacteria 14579
131 Ga0070712_100001499 3300006175 Bacteria 14245
132 Ga0070712_100034733 3300006175 Bacteria 3418
133 Ga0070712_100062168 3300006175 Bacteria 2640
134 Ga0070712_100130305 3300006175 Bacteria 1905
135 Ga0097621_100056599 3300006237 Bacteria 3204
136 Ga0068871_100012395 3300006358 Bacteria 6283
137 Ga0075428_100001731 3300006844 Bacteria 23290
138 Ga0075428_100002768 3300006844 Bacteria 19092
139 Ga0075428_100002933 3300006844 Bacteria 18598
140 Ga0075430_100003704 3300006846 Bacteria 12840
141 Ga0075430_100050875 3300006846 Bacteria 3492
142 Ga0075430_100064350 3300006846 Bacteria 3081
143 Ga0075431_100000146 3300006847 Bacteria 47784
144 Ga0075431_100001788 3300006847 Bacteria 20287
145 Ga0075431_100008667 3300006847 Bacteria 10191
146 Ga0075431_100022228 3300006847 Bacteria 6485
147 Ga0075431_100023095 3300006847 Bacteria 6359
148 Ga0075433_10003780 3300006852 Bacteria 11722
149 Ga0075433_10018642 3300006852 Bacteria 5772
150 Ga0075433_10033337 3300006852 Bacteria 4414
151 Ga0075434_100028784 3300006871 Bacteria 5463
152 Ga0075434_100080789 3300006871 Bacteria 3248
153 Ga0075429_100000765 3300006880 Bacteria 25332
154 Ga0075429_100004858 3300006880 Bacteria 11581
155 Ga0075429_100006583 3300006880 Bacteria 10061
156 Ga0075436_100005194 3300006914 Bacteria 8961
157 Ga0097620_100014255 3300006931 Bacteria 7973
158 Ga0097620_100192720 3300006931 Bacteria 2122
159 Ga0075435_100004703 3300007076 Bacteria 9420
160 Ga0075435_100009031 3300007076 Bacteria 7189
161 Ga0105251_10022197 3300009011 Bacteria 3301
162 Ga0105251_10029369 3300009011 Bacteria 2769
163 Ga0105240_10017938 3300009093 Bacteria 9519
164 Ga0105240_10072110 3300009093 Bacteria 4269
165 Ga0105240_10131918 3300009093 Bacteria 2996
166 Ga0111539_10043053 3300009094 Bacteria 5416
167 Ga0111539_10050574 3300009094 Bacteria 4951
168 Ga0111539_10077858 3300009094 Bacteria 3902
169 Ga0105245_10067041 3300009098 Bacteria 3250
170 Ga0105245_10256885 3300009098 Bacteria 1699
171 Ga0105247_10032497 3300009101 Bacteria 3171
172 Ga0114129_10001519 3300009147 Bacteria 31396
173 Ga0114129_10002812 3300009147 Bacteria 24275
174 Ga0114129_10004453 3300009147 Bacteria 19771
175 Ga0114129_10316677 3300009147 Bacteria 2075
176 Ga0105241_10006461 3300009174 Bacteria 8642
177 Ga0105248_10015474 3300009177 Bacteria 8410
178 Ga0105238_10008196 3300009551 Bacteria 10452
179 Ga0105238_10119158 3300009551 Bacteria 2620
180 Ga0105238_10168888 3300009551 Bacteria 2164
181 Ga0105249_10262797 3300009553 Bacteria 1716
182 Ga0105239_10013495 3300010375 Bacteria 9071
183 Ga0105239_10118885 3300010375 Bacteria 2933
184 Ga0105246_10008787 3300011119 Bacteria 6216
185 Ga0157373_10032591 3300013100 Bacteria 3750
186 Ga0157373_10050691 3300013100 Bacteria 2956
187 Ga0157371_10060542 3300013102 Bacteria 2684
188 Ga0157371_10064355 3300013102 Bacteria 2598
189 Ga0157369_10018619 3300013105 Bacteria 7784
190 Ga0157369_10077270 3300013105 Bacteria 3568
191 Ga0157374_10027942 3300013296 Bacteria 5093
192 Ga0157378_10126542 3300013297 Bacteria 2361
193 Ga0157378_10129014 3300013297 Bacteria 2339
194 Ga0157375_10034191 3300013308 Bacteria 4840
195 Ga0157377_10002370 3300014745 Bacteria 8310
196 Ga0157377_10039954 3300014745 Bacteria 2596
197 Ga0157379_10018531 3300014968 Bacteria 6140
198 Ga0157379_10204070 3300014968 Bacteria 1788
199 Ga0157379_10288777 3300014968 Bacteria 1493
200 Ga0157376_10220086 3300014969 Bacteria 1758
201 Ga0183367_1002 3300015688 Bacteria 1101531
202 Ga0206356_11454342 3300020070 Bacteria 2049
203 Ga0206354_10548483 3300020081 Bacteria 3894
204 Ga0206354_11463014 3300020081 Bacteria 1659
205 Ga0206353_11781108 3300020082 Bacteria 3374
206 Ga0213875_10001145 3300021388 Bacteria 18237
207 Ga0213875_10001643 3300021388 Bacteria 14116
208 Ga0213875_10006906 3300021388 Bacteria 5915
209 Ga0213875_10008999 3300021388 Bacteria 5079
210 Ga0213875_10024421 3300021388 Bacteria 2882
211 Ga0213875_10074775 3300021388 Bacteria 1581
212 Ga0224712_10000119 3300022467 Bacteria 12710
213 Ga0224712_10043715 3300022467 Bacteria 1705
214 Ga0207656_10016701 3300025321 Bacteria 2861
215 Ga0207713_1062035 3300025735 Bacteria 1419
216 Ga0207653_10016993 3300025885 Bacteria 2288
217 Ga0207692_10000202 3300025898 Bacteria 19952
218 Ga0207692_10000505 3300025898 Bacteria 13777
219 Ga0207692_10021608 3300025898 Bacteria 2947
220 Ga0207710_10017265 3300025900 Bacteria 3061
221 Ga0207688_10001780 3300025901 Bacteria 11441
222 Ga0207688_10004823 3300025901 Bacteria 7347
223 Ga0207647_10010329 3300025904 Bacteria 6594
224 Ga0207647_10102134 3300025904 Bacteria 1701
225 Ga0207685_10001593 3300025905 Bacteria 4842
226 Ga0207685_10008129 3300025905 Bacteria 2968
227 Ga0207699_10000588 3300025906 Bacteria 17872
228 Ga0207699_10000868 3300025906 Bacteria 14421
229 Ga0207699_10003342 3300025906 Bacteria 7648
230 Ga0207699_10046770 3300025906 Bacteria 2533
231 Ga0207645_10029926 3300025907 Bacteria 3509
232 Ga0207645_10045002 3300025907 Bacteria 2822
233 Ga0207643_10000399 3300025908 Bacteria 28909
234 Ga0207643_10010021 3300025908 Bacteria 5094
235 Ga0207705_10012075 3300025909 Bacteria 6240
236 Ga0207705_10073326 3300025909 Bacteria 2483
237 Ga0207684_10002229 3300025910 Bacteria 19767
238 Ga0207684_10002235 3300025910 Bacteria 19732
239 Ga0207684_10015663 3300025910 Bacteria 6526
240 Ga0207684_10023621 3300025910 Bacteria 5249
241 Ga0207684_10033337 3300025910 Bacteria 4379
242 Ga0207684_10072076 3300025910 Bacteria 2935
243 Ga0207654_10011078 3300025911 Bacteria 4589
244 Ga0207707_10001545 3300025912 Bacteria 21197
245 Ga0207695_10000796 3300025913 Bacteria 59143
246 Ga0207671_10000188 3300025914 Bacteria 95365
247 Ga0207693_10001418 3300025915 Bacteria 21248
248 Ga0207693_10106372 3300025915 Bacteria 2201
249 Ga0207693_10184536 3300025915 Bacteria 1642
250 Ga0207663_10004897 3300025916 Bacteria 6701
251 Ga0207663_10006804 3300025916 Bacteria 5886
252 Ga0207663_10006813 3300025916 Bacteria 5883
253 Ga0207663_10115756 3300025916 Bacteria 1827
254 Ga0207660_10174135 3300025917 Bacteria 1667
255 Ga0207657_10007834 3300025919 Bacteria 10901
256 Ga0207657_10048922 3300025919 Bacteria 3688
257 Ga0207657_10059876 3300025919 Bacteria 3270
258 Ga0207652_10032065 3300025921 Bacteria 4413
259 Ga0207646_10000416 3300025922 Bacteria 56976
260 Ga0207646_10005930 3300025922 Bacteria 12744
261 Ga0207646_10016711 3300025922 Bacteria 6884
262 Ga0207646_10191883 3300025922 Bacteria 1845
263 Ga0207694_10000164 3300025924 Bacteria 68118
264 Ga0207694_10074279 3300025924 Bacteria 2661
265 Ga0207694_10109721 3300025924 Bacteria 2194
266 Ga0207650_10006839 3300025925 Bacteria 7781
267 Ga0207700_10000150 3300025928 Bacteria 41536
268 Ga0207700_10000860 3300025928 Bacteria 17458
269 Ga0207700_10001733 3300025928 Bacteria 12393
270 Ga0207700_10003027 3300025928 Bacteria 9693
271 Ga0207700_10010162 3300025928 Bacteria 5921
272 Ga0207700_10011493 3300025928 Bacteria 5648
273 Ga0207700_10181445 3300025928 Bacteria 1763
274 Ga0207664_10000312 3300025929 Bacteria 36120
275 Ga0207664_10000537 3300025929 Bacteria 27020
276 Ga0207664_10004762 3300025929 Bacteria 9222
277 Ga0207664_10007735 3300025929 Bacteria 7460
278 Ga0207664_10010773 3300025929 Bacteria 6467
279 Ga0207664_10018026 3300025929 Bacteria 5186
280 Ga0207664_10034746 3300025929 Bacteria 3885
281 Ga0207664_10050866 3300025929 Bacteria 3269
282 Ga0207690_10094147 3300025932 Bacteria 2125
283 Ga0207706_10007954 3300025933 Bacteria 9789
284 Ga0207706_10080241 3300025933 Bacteria 2869
285 Ga0207670_10167590 3300025936 Bacteria 1644
286 Ga0207669_10022571 3300025937 Bacteria 3346
287 Ga0207665_10002709 3300025939 Bacteria 11883
288 Ga0207665_10005524 3300025939 Bacteria 8430
289 Ga0207691_10019908 3300025940 Bacteria 6347
290 Ga0207691_10036864 3300025940 Bacteria 4530
291 Ga0207689_10004148 3300025942 Bacteria 13172
292 Ga0207661_10007050 3300025944 Bacteria 7977
293 Ga0207661_10008170 3300025944 Bacteria 7470
294 Ga0207661_10178770 3300025944 Bacteria 1852
295 Ga0207679_10001569 3300025945 Bacteria 14281
296 Ga0207679_10009277 3300025945 Bacteria 6294
297 Ga0207667_10078032 3300025949 Bacteria 3433
298 Ga0207651_10045945 3300025960 Bacteria 2932
299 Ga0207651_10191985 3300025960 Bacteria 1630
300 Ga0207640_10103328 3300025981 Bacteria 2003
301 Ga0207678_10002102 3300026067 Bacteria 18030
302 Ga0207678_10008779 3300026067 Bacteria 8891
303 Ga0207678_10054540 3300026067 Bacteria 3443
304 Ga0207678_10060357 3300026067 Bacteria 3262
305 Ga0207678_10089500 3300026067 Bacteria 2631
306 Ga0207702_10005107 3300026078 Bacteria 11542
307 Ga0207702_10059622 3300026078 Bacteria 3250
308 Ga0207641_10043836 3300026088 Bacteria 3759
309 Ga0207648_10070708 3300026089 Bacteria 3042
310 Ga0207648_10099446 3300026089 Bacteria 2547
311 Ga0207676_10007026 3300026095 Bacteria 7974
312 Ga0207674_10021177 3300026116 Bacteria 7009
313 Ga0207674_10028188 3300026116 Bacteria 5931
314 Ga0207674_10038287 3300026116 Bacteria 4979
315 Ga0207674_10192536 3300026116 Bacteria 1989
316 Ga0207675_100087695 3300026118 Bacteria 2923
317 Ga0207675_100228389 3300026118 Bacteria 1795
318 Ga0207683_10000208 3300026121 Bacteria 50925
319 Ga0207683_10001399 3300026121 Bacteria 21779
320 Ga0207683_10067585 3300026121 Bacteria 3153
321 Ga0207683_10216267 3300026121 Bacteria 1745
322 Ga0207698_10009140 3300026142 Bacteria 6300
323 Ga0207698_10021271 3300026142 Bacteria 4482
324 Ga0207698_10051631 3300026142 Bacteria 3145
325 Ga0207428_10001011 3300027907 Bacteria 31194
326 Ga0207428_10022970 3300027907 Bacteria 5253
327 Ga0265337_1001133 3300028556 Bacteria 13619
328 Ga0265326_10005904 3300028558 Bacteria 3836
329 Ga0265319_1003137 3300028563 Bacteria 8714
330 Ga0265334_10003561 3300028573 Bacteria 7056
331 Ga0265318_10007460 3300028577 Bacteria 4944
332 Ga0265323_10019943 3300028653 Bacteria 2585
333 Ga0265322_10021126 3300028654 Bacteria 1864
334 Ga0265336_10002741 3300028666 Bacteria 7124
335 Ga0265338_10000940 3300028800 Bacteria 49081
336 Ga0265338_10001533 3300028800 Bacteria 37286
337 Ga0265324_10002117 3300029957 Bacteria 10461
338 Ga0307511_10109294 3300030521 Bacteria 1769
339 Ga0307512_10003006 3300030522 Bacteria 20337
340 Ga0307512_10032175 3300030522 Bacteria 4532
341 Ga0316181_1228998 3300030744 Bacteria 2881
342 Ga0265332_10002338 3300031238 Bacteria 9675
343 Ga0265320_10002174 3300031240 Bacteria 13772
344 Ga0265325_10029424 3300031241 Bacteria 2953
345 Ga0265340_10000095 3300031247 Bacteria 41685
346 Ga0265340_10003496 3300031247 Bacteria 8846
347 Ga0265339_10012280 3300031249 Bacteria 5236
348 Ga0265316_10036189 3300031344 Bacteria 3992
349 Ga0307513_10000844 3300031456 Bacteria 44769
350 Ga0307513_10009278 3300031456 Bacteria 12457
351 Ga0307513_10141255 3300031456 Bacteria 2334
352 Ga0307513_10148948 3300031456 Bacteria 2253
353 Ga0307408_100186326 3300031548 Bacteria 1669
354 Ga0265313_10010472 3300031595 Bacteria 5858
355 Ga0307508_10015950 3300031616 Bacteria 6843
356 Ga0307508_10075254 3300031616 Bacteria 2953
357 Ga0307514_10019451 3300031649 Bacteria 5558
358 Ga0265314_10015935 3300031711 Bacteria 5951
359 Ga0265342_10001543 3300031712 Bacteria 21280
360 Ga0307410_10207616 3300031852 Bacteria 1499
361 Ga0307416_100155490 3300032002 Bacteria 2104
362 Ga0307415_100002262 3300032126 Bacteria 9539
363 Ga0307415_100015205 3300032126 Bacteria 4549
364 Ga0307507_10001609 3300033179 Bacteria 49933
365 Ga0373948_0005003 3300034817 Bacteria 2126
366 Ga0373926_0017091 3300035083 Bacteria 2487
367 Ga0373928_0014237 3300035084 Bacteria 1605
368 Ga0373934_0015970 3300035086 Bacteria 2852
369 Ga0373923_0019273 3300035111 Bacteria 2639
370 Ga0373932_0014336 3300035112 Bacteria 1991
371 Ga0373936_0000520 3300035113 Bacteria 13136
372 Ga0373936_0009178 3300035113 Bacteria 3728
373 Ga0373936_0011818 3300035113 Bacteria 3311
374 Ga0373945_0015837 3300035116 Bacteria 2540
375 Ga0373953_0007178 3300035117 Bacteria 3717
376 Ga0373953_0012016 3300035117 Bacteria 3056
377 Ga0373954_0014517 3300035118 Bacteria 3514
378 Ga0373956_0008067 3300035119 Bacteria 4259
379 Ga0373957_0007362 3300035120 Bacteria 3520
380 Ga0373943_0002324 3300035170 Bacteria 8641
381 Ga0373955_0018625 3300035172 Bacteria 3457
382 Ga0373955_0133536 3300035172 Bacteria 1450
383 Ga0373962_0009641 3300035242 Bacteria 2396
384 Ga0373924_0012360 3300035410 Bacteria 3188
385 Ga0373931_0015661 3300035691 Bacteria 3721
386 Ga0373935_0010182 3300035692 Bacteria 5632
387 Ga0373935_0019113 3300035692 Bacteria 4177
388 Ga0373935_0088520 3300035692 Bacteria 2023
389 Ga0373927_0001999 3300035695 Bacteria 15033
390 Ga0373933_0001608 3300035724 Bacteria 13212
391 Ga0373933_0048793 3300035724 Bacteria 2522
392 Ga0373947_0042270 3300035725 Bacteria 2720
393 Ga0373937_0010188 3300036401 Bacteria 8201
394 Ga0373937_0018987 3300036401 Bacteria 6149
395 Ga0373937_0022186 3300036401 Bacteria 5704
396 Ga0373937_0065081 3300036401 Bacteria 3355
397 Ga0373925_0000154 3300037068 Bacteria 73830
398 Ga0373925_0008945 3300037068 Bacteria 7296
399 Ga0373925_0010888 3300037068 Bacteria 6597
400 Ga0373925_0012026 3300037068 Bacteria 6267
401 Ga0373925_0039446 3300037068 Bacteria 3493
402 Ga0373925_0065098 3300037068 Bacteria 2745
403 Ga0395898_0171752 3300037466 Bacteria 2072
404 Ga0436364_0316403 3300037853 Bacteria 9081
405 Ga0436364_0338959 3300037853 Bacteria 5071
406 Ga0436364_0780341 3300037853 Bacteria 70185
407 Ga0436364_1011209 3300037853 Bacteria 3250
408 Ga0436364_1307046 3300037853 Bacteria 27649
409 Ga0436364_1420628 3300037853 Bacteria 6828
410 Ga0439436_0001217 3300041404 Bacteria 7324
411 Ga0451837_0043982 3300041494 Bacteria 3334
412 Ga0451843_1130581 3300041509 Bacteria 1641
413 Ga0451853_1800366 3300041512 Bacteria 7574
414 Ga0439433_0002580 3300041999 Bacteria 3848
415 Ga0439457_000525 3300042014 Bacteria 11109
416 Ga0439464_0009754 3300042439 Bacteria 2530
417 Ga0466969_0002286 3300044656 Bacteria 10232
418 Ga0466969_0004931 3300044656 Bacteria 7112
419 Ga0466966_0006745 3300044684 Bacteria 7603
420 Ga0466966_0022325 3300044684 Bacteria 4153
421 Ga0466961_0030362 3300044693 Bacteria 3473
422 Ga0466961_0031507 3300044693 Bacteria 3409
423 Ga0466961_0063725 3300044693 Bacteria 2342
424 Ga0466961_0085572 3300044693 Bacteria 1993
425 Ga0466963_0047434 3300044694 Bacteria 2835
426 Ga0466963_0097168 3300044694 Bacteria 2012
427 Ga0466964_0051359 3300044706 Bacteria 1693
428 Ga0466971_0000019 3300044719 Bacteria 79360
429 Ga0466970_0016007 3300044765 Bacteria 3862
430 Ga0466970_0028809 3300044765 Bacteria 2920
431 Ga0466970_0037144 3300044765 Bacteria 2581
432 Ga0466970_0100239 3300044765 Bacteria 1577
433 Ga0466960_0013082 3300044901 Bacteria 3516
434 Ga0466959_0000305 3300045049 Bacteria 29181
435 Ga0466959_0078763 3300045049 Bacteria 2376
436 Ga0466959_0087210 3300045049 Bacteria 2245
437 Ga0466958_0003920 3300045836 Bacteria 7799
438 Ga0466958_0041157 3300045836 Bacteria 2779
439 Ga0466958_0068146 3300045836 Bacteria 2175
440 Ga0466958_0076120 3300045836 Bacteria 2059
441 Ga0466958_0106997 3300045836 Bacteria 1744
442 Ga0466967_0000260 3300045976 Bacteria 23213
443 Ga0466967_0025597 3300045976 Bacteria 4869
444 Ga0466967_0060605 3300045976 Bacteria 3354
445 Ga0495592_0001763 3300046454 Bacteria 15222
446 Ga0495592_0064064 3300046454 Bacteria 2695
447 Ga0495592_0106724 3300046454 Bacteria 1987
448 Ga0495603_0005306 3300046455 Bacteria 7685
449 Ga0495603_0006554 3300046455 Bacteria 6987
450 Ga0495629_0003377 3300046459 Bacteria 12067
451 Ga0495629_0011342 3300046459 Bacteria 6475
452 Ga0495629_0013094 3300046459 Bacteria 5993
453 Ga0495629_0017484 3300046459 Bacteria 5139
454 Ga0495641_0008210 3300046461 Bacteria 6400
455 Ga0495641_0011169 3300046461 Bacteria 5140
456 Ga0495641_0013810 3300046461 Bacteria 4408
457 Ga0495641_0056116 3300046461 Bacteria 1786
458 Ga0495641_0081757 3300046461 Bacteria 1447
459 Ga0495651_0000980 3300046462 Bacteria 22144
460 Ga0495651_0001034 3300046462 Bacteria 21514
461 Ga0495651_0007914 3300046462 Bacteria 8143
462 Ga0495651_0033988 3300046462 Bacteria 3975
463 Ga0495651_0091743 3300046462 Bacteria 2277
464 Ga0495653_0005729 3300046463 Bacteria 10158
465 Ga0495653_0029724 3300046463 Bacteria 4358
466 Ga0495653_0040624 3300046463 Bacteria 3634
467 Ga0495582_0000633 3300046473 Bacteria 19392
468 Ga0495582_0016998 3300046473 Bacteria 3982
469 Ga0495639_0003477 3300046475 Bacteria 6811
470 Ga0495639_0012376 3300046475 Bacteria 3680
471 Ga0495639_0084617 3300046475 Bacteria 1481
472 Ga0495662_0005078 3300046476 Bacteria 6590
473 Ga0495662_0011149 3300046476 Bacteria 4391
474 Ga0495662_0012615 3300046476 Bacteria 4121
475 Ga0495664_0005724 3300046477 Bacteria 6845
476 Ga0495585_0019998 3300046492 Bacteria 3851
477 Ga0495594_0004183 3300046499 Bacteria 7412
478 Ga0495608_0001601 3300046511 Bacteria 16213
479 Ga0495608_0082673 3300046511 Bacteria 2085
480 Ga0495618_0013662 3300046514 Bacteria 4941
481 Ga0495618_0019422 3300046514 Bacteria 4181
482 Ga0495618_0084334 3300046514 Bacteria 2030
483 Ga0495628_0002433 3300046516 Bacteria 16783
484 Ga0495628_0004920 3300046516 Bacteria 11748
485 Ga0495628_0053693 3300046516 Bacteria 3179
486 Ga0495628_0101793 3300046516 Bacteria 2216
487 Ga0495628_0139333 3300046516 Bacteria 1852
488 Ga0495630_0129748 3300046517 Bacteria 1914
489 Ga0495648_0049416 3300046524 Bacteria 2578
490 Ga0495652_0001157 3300046529 Bacteria 29740
491 Ga0495652_0001386 3300046529 Bacteria 26938
492 Ga0495652_0016682 3300046529 Bacteria 6564
493 Ga0495652_0025742 3300046529 Bacteria 5200
494 Ga0495652_0039344 3300046529 Bacteria 4089
495 Ga0495652_0058632 3300046529 Bacteria 3259
496 Ga0495665_0000862 3300046531 Bacteria 15866
497 Ga0495665_0030663 3300046531 Bacteria 2878
498 Ga0495640_0014827 3300046533 Bacteria 5882
499 Ga0495640_0022956 3300046533 Bacteria 4556
500 Ga0495640_0043895 3300046533 Bacteria 3110
501 Ga0495586_0025359 3300046535 Bacteria 3172
502 Ga0495587_0007428 3300046536 Bacteria 7095
503 Ga0495587_0014467 3300046536 Bacteria 4947
504 Ga0495587_0016460 3300046536 Bacteria 4599
505 Ga0495587_0034953 3300046536 Bacteria 3029
506 Ga0495645_0009361 3300046543 Bacteria 6848
507 Ga0495645_0021651 3300046543 Bacteria 4646
508 Ga0495622_0037712 3300046557 Bacteria 2251
509 Ga0495667_0008796 3300046559 Bacteria 6865
510 Ga0495667_0012714 3300046559 Bacteria 5706
511 Ga0495667_0020457 3300046559 Bacteria 4464
512 Ga0495667_0036915 3300046559 Bacteria 3258
513 Ga0495667_0118656 3300046559 Bacteria 1708
514 Ga0495634_0037081 3300046642 Bacteria 3332
515 Ga0495634_0089118 3300046642 Bacteria 2006
516 Ga0495625_0043201 3300046660 Bacteria 3270
517 Ga0495635_0001716 3300046663 Bacteria 14750
518 Ga0495635_0003578 3300046663 Bacteria 10752
519 Ga0495635_0007480 3300046663 Bacteria 7625
520 Ga0495635_0016986 3300046663 Bacteria 5082
521 Ga0495635_0182393 3300046663 Bacteria 1426
522 Ga0495588_0000842 3300046674 Bacteria 13599
523 Ga0495588_0093072 3300046674 Bacteria 1580
524 Ga0495657_0010651 3300046675 Bacteria 6914
525 Ga0495657_0026716 3300046675 Bacteria 4085
526 Ga0495657_0029473 3300046675 Bacteria 3849
527 Ga0495657_0053189 3300046675 Bacteria 2710
528 Ga0495599_0013517 3300046678 Bacteria 5043
529 Ga0495599_0021693 3300046678 Bacteria 4007
530 Ga0495599_0029737 3300046678 Bacteria 3426
531 Ga0495623_0007474 3300046679 Bacteria 7094
532 Ga0495623_0013683 3300046679 Bacteria 5260
533 Ga0495623_0018975 3300046679 Bacteria 4440
534 Ga0495646_0001496 3300046680 Bacteria 13924
535 Ga0495646_0042111 3300046680 Bacteria 2803
536 Ga0495646_0081948 3300046680 Bacteria 1878
537 Ga0495658_0021906 3300046683 Bacteria 3374
538 Ga0495658_0061234 3300046683 Bacteria 2160
539 Ga0495658_0096349 3300046683 Bacteria 1760
540 Ga0495613_0034997 3300046689 Bacteria 3729
541 Ga0495613_0047175 3300046689 Bacteria 3182
542 Ga0495624_0010481 3300046690 Bacteria 6388
543 Ga0495624_0049674 3300046690 Bacteria 2659
544 Ga0495600_0001701 3300046809 Bacteria 12290
545 Ga0495600_0011006 3300046809 Bacteria 5628
546 Ga0495600_0012624 3300046809 Bacteria 5288
547 Ga0495600_0021676 3300046809 Bacteria 4118
548 Ga0495600_0057696 3300046809 Bacteria 2535
549 Ga0495600_0099415 3300046809 Bacteria 1896
550 Ga0495581_0031110 3300047315 Bacteria 3092
551 Ga0495604_0003545 3300047317 Bacteria 12448
552 Ga0495604_0011923 3300047317 Bacteria 6913
553 Ga0495604_0015320 3300047317 Bacteria 6120
554 Ga0495604_0029308 3300047317 Bacteria 4378
555 Ga0495604_0035818 3300047317 Bacteria 3917
556 Ga0495604_0036815 3300047317 Bacteria 3857
557 Ga0495636_0000251 3300047318 Bacteria 21247
558 Ga0495636_0006534 3300047318 Bacteria 4584
559 Ga0495636_0008206 3300047318 Bacteria 4119
560 Ga0495674_0000343 3300047319 Bacteria 41172
561 Ga0495674_0018522 3300047319 Bacteria 6481
562 Ga0495674_0139392 3300047319 Bacteria 2039
563 Ga0495676_0007636 3300047321 Bacteria 9917
564 Ga0495676_0013313 3300047321 Bacteria 7394
565 Ga0495676_0030599 3300047321 Bacteria 4564
566 Ga0495676_0154949 3300047321 Bacteria 1627
567 Ga0495680_0003357 3300047322 Bacteria 15810
568 Ga0495680_0009875 3300047322 Bacteria 8554
569 Ga0495687_004799 3300047443 Bacteria 8911
570 Ga0495675_0036312 3300047444 Bacteria 3143
571 Ga0495675_0079831 3300047444 Bacteria 2060
572 Ga0495675_0119323 3300047444 Bacteria 1643
573 Ga0495685_001251 3300047447 Bacteria 7772
574 Ga0495685_024147 3300047447 Bacteria 2092
575 Ga0495684_0014256 3300047471 Bacteria 6116
576 Ga0495684_0021514 3300047471 Bacteria 4965
577 Ga0495684_0038742 3300047471 Bacteria 3654
578 Ga0495593_0007352 3300047673 Bacteria 6449
579 Ga0495593_0012702 3300047673 Bacteria 4809
580 Ga0495602_0002864 3300048088 Bacteria 17659
581 Ga0495602_0018569 3300048088 Bacteria 6937
582 Ga0495602_0030971 3300048088 Bacteria 5064
583 Ga0495602_0053661 3300048088 Bacteria 3567
584 Ga0495602_0097002 3300048088 Bacteria 2430
585 Ga0496101_0026737 3300048904 Bacteria 4012
586 Ga0496101_0064974 3300048904 Bacteria 2659
587 Ga0496102_0018202 3300048905 Bacteria 6167
588 Ga0496104_0003447 3300048907 Bacteria 13626
589 Ga0496104_0004682 3300048907 Bacteria 11910
590 Ga0496104_0005549 3300048907 Bacteria 11048
591 Ga0496104_0033555 3300048907 Bacteria 4783
592 Ga0496106_0006264 3300048909 Bacteria 8809
593 Ga0496106_0100884 3300048909 Bacteria 2238
594 Ga0496107_0008573 3300048910 Bacteria 7077
595 Ga0496108_0002997 3300048911 Bacteria 13566
596 Ga0496109_0017316 3300048912 Bacteria 6314
597 Ga0496109_0077470 3300048912 Bacteria 3059
598 Ga0496109_0084909 3300048912 Bacteria 2921
599 Ga0496109_0319787 3300048912 Bacteria 1464
600 Ga0496110_0029587 3300048913 Bacteria 4716
601 Ga0496110_0115547 3300048913 Bacteria 2416
602 Ga0496111_0151074 3300048914 Bacteria 1722
603 Ga0496111_0182085 3300048914 Bacteria 1562
604 Ga0496112_0009273 3300048915 Bacteria 8848
605 Ga0496112_0142005 3300048915 Bacteria 2370
606 Ga0496113_0023528 3300048916 Bacteria 4368
607 Ga0496113_0108275 3300048916 Bacteria 2160
608 Ga0496114_0081183 3300048917 Bacteria 2739
609 Ga0496114_0119355 3300048917 Bacteria 2267
610 Ga0496114_0123661 3300048917 Bacteria 2227
611 Ga0496114_0182536 3300048917 Bacteria 1833
612 Ga0496115_0003639 3300048918 Bacteria 11093
613 Ga0496115_0071277 3300048918 Bacteria 2818
614 Ga0496115_0147726 3300048918 Bacteria 1940
615 Ga0496123_0035154 3300048926 Bacteria 3576
616 Ga0496124_0015337 3300048927 Bacteria 7354
617 Ga0496126_0029920 3300048929 Bacteria 5168
618 Ga0501031_0016789 3300049568 Bacteria 4755
619 Ga0501031_0034742 3300049568 Bacteria 3290
620 Ga0501032_0014041 3300049569 Bacteria 5682
621 Ga0501032_0048338 3300049569 Bacteria 2872
622 Ga0501032_0130427 3300049569 Bacteria 1659
623 Ga0501033_0012072 3300049570 Bacteria 6593
624 Ga0501033_0073861 3300049570 Bacteria 2504
625 Ga0501034_0009899 3300049571 Bacteria 9964
626 Ga0501034_0010585 3300049571 Bacteria 9596
627 Ga0501034_0015792 3300049571 Bacteria 7755
628 Ga0501036_0006820 3300049572 Bacteria 9279
629 Ga0501036_0017873 3300049572 Bacteria 5936
630 Ga0501036_0021173 3300049572 Bacteria 5462
631 Ga0501037_0018099 3300049573 Bacteria 5190
632 Ga0501037_0051839 3300049573 Bacteria 3001
633 Ga0501038_0001895 3300049574 Bacteria 19341
634 Ga0501038_0003482 3300049574 Bacteria 14660
635 Ga0501038_0021847 3300049574 Bacteria 5739
636 Ga0501038_0022354 3300049574 Bacteria 5669
637 Ga0501038_0038695 3300049574 Bacteria 4175
638 Ga0501039_0020849 3300049575 Bacteria 5024
639 Ga0501039_0036129 3300049575 Bacteria 3812
640 Ga0501040_0003972 3300049576 Bacteria 9611
641 Ga0501041_0015476 3300049577 Bacteria 4529
642 Ga0501042_0000560 3300049578 Bacteria 19671
643 Ga0501042_0018687 3300049578 Bacteria 4803
644 Ga0501043_0000851 3300049579 Bacteria 27034
645 Ga0501043_0044522 3300049579 Bacteria 3489
646 Ga0501043_0105225 3300049579 Bacteria 2217
647 Ga0501047_0000133 3300049581 Bacteria 90926
648 Ga0501047_0006834 3300049581 Bacteria 10720
649 Ga0501047_0029454 3300049581 Bacteria 5293
650 Ga0501047_0054707 3300049581 Bacteria 3860
651 Ga0501047_0161205 3300049581 Bacteria 2114
652 Ga0501047_0188925 3300049581 Bacteria 1924
653 Ga0501048_0016428 3300049582 Bacteria 5455
654 Ga0501048_0041878 3300049582 Bacteria 3281
655 Ga0501070_0023617 3300049586 Bacteria 5151
656 Ga0501071_0007135 3300049587 Bacteria 7306
657 Ga0501072_0029298 3300049588 Bacteria 4299
658 Ga0501073_0033988 3300049589 Bacteria 3630
659 Ga0501073_0056032 3300049589 Bacteria 2758
660 Ga0501074_0029780 3300049590 Bacteria 3955
661 Ga0501074_0130241 3300049590 Bacteria 1800
662 Ga0501075_0008783 3300049591 Bacteria 7043
663 Ga0501076_0087837 3300049592 Bacteria 2499
664 Ga0501080_0054659 3300049742 Bacteria 3718
665 Ga0501080_0155436 3300049742 Bacteria 2113
666 Ga0501081_0016362 3300049743 Bacteria 4902
667 Ga0501083_0149042 3300049744 Bacteria 1532
668 Ga0501035_0002338 3300049822 Bacteria 18696
669 Ga0501035_0025233 3300049822 Bacteria 5449
670 Ga0501035_0032676 3300049822 Bacteria 4733
671 Ga0501044_0028457 3300049823 Bacteria 5898
672 Ga0501044_0062960 3300049823 Bacteria 3790
673 Ga0501044_0135228 3300049823 Bacteria 2457
674 Ga0501044_0187856 3300049823 Bacteria 2030
675 Ga0501044_0229967 3300049823 Bacteria 1802
676 Ga0501045_0078963 3300049824 Bacteria 2426
677 nmdc:mga03n38_27920_c1 3300050490 Bacteria 2346
678 nmdc:mga00v17_3506_c1 3300050491 Bacteria 8111
679 nmdc:mga0yw44_225239_c1 3300050492 Bacteria 1244
680 nmdc:mga0yw44_41214_c1 3300050492 Bacteria 2748
681 nmdc:mga05p37_3966_c1 3300050507 Bacteria 17332
682 nmdc:mga05p37_512_c1 3300050507 Bacteria 42901
683 nmdc:mga05p37_7461_c1 3300050507 Bacteria 12894
684 nmdc:mga09592_11623_c1 3300050508 Bacteria 7159
685 nmdc:mga09592_225_c1 3300050508 Bacteria 40713
686 nmdc:mga09592_4224_c1 3300050508 Bacteria 11601
687 nmdc:mga0qj67_82952_c1 3300050509 Bacteria 2570
688 nmdc:mga0qj67_8353_c1 3300050509 Bacteria 7677
689 nmdc:mga06r32_106_c1 3300050510 Bacteria 58645
690 nmdc:mga06r32_15566_c1 3300050510 Bacteria 6909
691 nmdc:mga06r32_27566_c1 3300050510 Bacteria 5309
692 nmdc:mga06r32_4348_c1 3300050510 Bacteria 12680
693 nmdc:mga06r32_439_c1 3300050510 Bacteria 35271
694 nmdc:mga08y16_20592_c1 3300050511 Bacteria 6962
695 nmdc:mga08y16_5966_c1 3300050511 Bacteria 12777
696 nmdc:mga0n895_228157_c1 3300050512 Bacteria 1890
697 nmdc:mga0n895_258142_c1 3300050512 Bacteria 1769
698 nmdc:mga0n895_9881_c1 3300050512 Bacteria 8392
699 nmdc:mga0rr50_169139_c1 3300050513 Bacteria 1780
700 nmdc:mga0rr50_45401_c1 3300050513 Bacteria 3229
701 nmdc:mga08x19_3519_c1 3300050514 Bacteria 9321
702 nmdc:mga0a205_1568_c1 3300050515 Bacteria 19587
703 nmdc:mga0a205_24544_c1 3300050515 Bacteria 5735
704 Ga0495601_0001099 3300053077 Bacteria 14838
705 Ga0495601_0001775 3300053077 Bacteria 11951
706 Ga0495601_0006811 3300053077 Bacteria 6694
707 Ga0495601_0030323 3300053077 Bacteria 3357
708 Ga0495601_0071832 3300053077 Bacteria 2210
709 Ga0495612_0016309 3300053078 Bacteria 2977
710 Ga0495612_0019844 3300053078 Bacteria 2693
711 Ga0495612_0026382 3300053078 Bacteria 2335
712 Ga0495595_0007718 3300053084 Bacteria 4407
713 Ga0495619_0118837 3300053085 Bacteria 1811
714 Ga0495619_0124942 3300053085 Bacteria 1765
715 Ga0500614_001375 3300053123 Bacteria 5858
716 Ga0500616_0000475 3300053153 Bacteria 52004
717 Ga0501084_0038116 3300054114 Bacteria 4018
718 Ga0466962_0000041 3300061719 Bacteria 56378
719 Ga0466962_0006779 3300061719 Bacteria 5495
720 Ga0530510_0003513 3300061734 Bacteria 10778
721 2547410104 2547132111 Bacteria 8013147
722 2644539157 2643221697 Bacteria 3575694
723 2644539529 2643221697 Bacteria 3575694
724 2645721258 2643221961 Bacteria 3919167
725 2645724728 2643221962 Bacteria 3874254
726 2676494244 2675903060 Bacteria 10051191
727 2784589587 2784132148 Bacteria 8627943
728 2804845684 2802429296 Bacteria 7227771
729 2809233270 2808606448 Bacteria 8656184
730 2812356861 2811994879 Bacteria 9313447
731 2812362821 2811994880 Bacteria 4147780
732 2812479565 2811994917 Bacteria 7761064
733 2816426167 2816332119 Bacteria 8120218
734 2837272097 2837268691 Bacteria 7850704
735 2852640473 2852635781 Bacteria 8251373
736 2856745234 2856741275 Bacteria 8096094
737 2862286992 2862281513 Bacteria 9621493
738 2862514427 2862507626 Bacteria 9425308
739 2862707809 2862705112 Bacteria 6563286
740 2867350124 2867346516 Bacteria 7608576
741 2868093047 2868088558 Bacteria 7609351
742 2873154803 2873151551 Bacteria 8625867
743 2873321964 2873314349 Bacteria 8512634
744 2884695107 2884693830 Bacteria 11273186
745 2884997987 2884994152 Bacteria 4492978
746 2891401659 2891395885 Bacteria 9251614
747 2891560440 2891554331 Bacteria 8812224
748 2891567144 2891562705 Bacteria 8039471
749 2895431517 2895427314 Bacteria 13147766
750 2895446209 2895442618 Bacteria 11027144
751 2946069009 2946064051 Bacteria 8957905
752 2947227920 2947224130 Bacteria 9938529
753 2954002998 2954002825 Bacteria 9173742
754 2990046632 2990044586 Bacteria 6603797
755 3003001438 3002998708 Bacteria 11715108
756 8008487329 8008485437 Bacteria 7198341
757 8023626377 8023623736 Bacteria 8593882
758 8025416752 8025413630 Bacteria 7014048
759 8025483913 8025478263 Bacteria 8209203
760 8025526521 8025524527 Bacteria 7197316
761 8033690035 8033684223 Bacteria 6906479
762 8053948903 8053945823 Bacteria 8962862
763 8055071414 8055066027 Bacteria 9479577
764 8055174969 8055172936 Bacteria 9305943
765 Ga0081538_10000255
766 JGI24752J21851_1005025
767 rootH2_10017422
768 JGI25407J50210_10003188
769 JGI25407J50210_10009036
770 JGI25404J52841_10003275
771 JGI25405J52794_10001814
772 Ga0070658_10051452
773 Ga0070676_10035040
774 Ga0070676_10108358
775 Ga0070683_100001315
776 Ga0070683_100106929
777 Ga0070670_100015913
778 Ga0070666_10058134
779 Ga0070666_10084271
780 Ga0070680_100021920
781 Ga0070680_100172502
782 Ga0070682_100132900
783 Ga0070660_100085219
784 Ga0070691_10002767
785 Ga0070691_10031804
786 Ga0070692_10003286
787 Ga0070692_10082909
788 Ga0070675_100072586
789 Ga0070675_100146299
790 Ga0070671_100021064
791 Ga0070673_100061073
792 Ga0070673_100266933
793 Ga0070688_100012699
794 Ga0070667_100040287
795 Ga0070667_100210030
796 Ga0070709_10000189
797 Ga0070709_10000434
798 Ga0070709_10001604
799 Ga0070714_100001576
800 Ga0070714_100004739
801 Ga0070714_100014181
802 Ga0070714_100036853
803 Ga0070714_100293458
804 Ga0070713_100009122
805 Ga0070713_100037847
806 Ga0070713_100134501
807 Ga0070713_100184898
808 Ga0070710_10000086
809 Ga0070710_10000388
810 Ga0070710_10029208
811 Ga0070701_10070394
812 Ga0070711_100000450
813 Ga0070711_100004074
814 Ga0070711_100012050
815 Ga0070700_100019037
816 Ga0070708_100037036
817 Ga0070663_100043357
818 Ga0070663_100054151
819 Ga0070663_100157607
820 Ga0070678_100011914
821 Ga0070662_100058936
822 Ga0070662_100066998
823 Ga0070681_10016756
824 Ga0070685_10057988
825 Ga0070706_100004551
826 Ga0070706_100006065
827 Ga0070706_100008619
828 Ga0070706_100014300
829 Ga0070706_100077243
830 Ga0070707_100001773
831 Ga0070707_100006610
832 Ga0070707_100012902
833 Ga0070707_100044477
834 Ga0070698_100000667
835 Ga0070698_100002497
836 Ga0070698_100003565
837 Ga0070698_100004639
838 Ga0070698_100044087
839 Ga0070698_100063698
840 Ga0070698_100088646
841 Ga0070698_100095875
842 Ga0070698_100105697
843 Ga0070699_100004163
844 Ga0070699_100068116
845 Ga0070699_100213231
846 Ga0070679_100020710
847 Ga0070684_100154568
848 Ga0070697_100028913
849 Ga0070697_100073232
850 Ga0070686_100062313
851 Ga0070665_100014224
852 Ga0070665_100051045
853 Ga0068855_100006758
854 Ga0068855_100107011
855 Ga0070664_100003142
856 Ga0070664_100063752
857 Ga0068857_100070808
858 Ga0068856_100026424
859 Ga0070702_100002682
860 Ga0068852_100013848
861 Ga0068859_100014255
862 Ga0068859_100192713
863 Ga0068864_100051438
864 Ga0068861_100141570
865 Ga0068851_10002540
866 Ga0068851_10049220
867 Ga0068870_10005686
868 Ga0068870_10029754
869 Ga0068858_100033380
870 Ga0068858_100098409
871 Ga0068860_100278990
872 Ga0081455_10000462
873 Ga0081455_10001621
874 Ga0081455_10006786
875 Ga0081455_10171067
876 Ga0081538_10000092
877 Ga0081538_10001645
878 Ga0081538_10021000
879 Ga0081540_1000156
880 Ga0081539_10016583
881 Ga0081539_10059857
882 Ga0070717_10002254
883 Ga0070717_10016681
884 Ga0070717_10022874
885 Ga0070717_10035764
886 Ga0070717_10068887
887 Ga0070717_10079439
888 Ga0070717_10127516
889 Ga0075365_10006659
890 Ga0075364_10005361
891 Ga0070715_10002576
892 Ga0070716_100000567
893 Ga0070716_100000775
894 Ga0070712_100001419
895 Ga0070712_100001499
896 Ga0070712_100034733
897 Ga0070712_100062168
898 Ga0070712_100130305
899 Ga0097621_100056599
900 Ga0068871_100012395
901 Ga0075428_100001731
902 Ga0075428_100002768
903 Ga0075428_100002933
904 Ga0075430_100003704
905 Ga0075430_100050875
906 Ga0075430_100064350
907 Ga0075431_100000146
908 Ga0075431_100001788
909 Ga0075431_100008667
910 Ga0075431_100022228
911 Ga0075431_100023095
912 Ga0075433_10003780
913 Ga0075433_10018642
914 Ga0075433_10033337
915 Ga0075434_100028784
916 Ga0075434_100080789
917 Ga0075429_100000765
918 Ga0075429_100004858
919 Ga0075429_100006583
920 Ga0075436_100005194
921 Ga0097620_100014255
922 Ga0097620_100192720
923 Ga0075435_100004703
924 Ga0075435_100009031
925 Ga0105251_10022197
926 Ga0105251_10029369
927 Ga0105240_10017938
928 Ga0105240_10072110
929 Ga0105240_10131918
930 Ga0111539_10043053
931 Ga0111539_10050574
932 Ga0111539_10077858
933 Ga0105245_10067041
934 Ga0105245_10256885
935 Ga0105247_10032497
936 Ga0114129_10001519
937 Ga0114129_10002812
938 Ga0114129_10004453
939 Ga0114129_10316677
940 Ga0105241_10006461
941 Ga0105248_10015474
942 Ga0105238_10008196
943 Ga0105238_10119158
944 Ga0105238_10168888
945 Ga0105249_10262797
946 Ga0105239_10013495
947 Ga0105239_10118885
948 Ga0105246_10008787
949 Ga0157373_10032591
950 Ga0157373_10050691
951 Ga0157371_10060542
952 Ga0157371_10064355
953 Ga0157369_10018619
954 Ga0157369_10077270
955 Ga0157374_10027942
956 Ga0157378_10126542
957 Ga0157378_10129014
958 Ga0157375_10034191
959 Ga0157377_10002370
960 Ga0157377_10039954
961 Ga0157379_10018531
962 Ga0157379_10204070
963 Ga0157379_10288777
964 Ga0157376_10220086
965 Ga0183367_1002
966 Ga0206356_11454342
967 Ga0206354_10548483
968 Ga0206354_11463014
969 Ga0206353_11781108
970 Ga0213875_10001145
971 Ga0213875_10001643
972 Ga0213875_10006906
973 Ga0213875_10008999
974 Ga0213875_10024421
975 Ga0213875_10074775
976 Ga0224712_10000119
977 Ga0224712_10043715
978 Ga0207656_10016701
979 Ga0207713_1062035
980 Ga0207653_10016993
981 Ga0207692_10000202
982 Ga0207692_10000505
983 Ga0207692_10021608
984 Ga0207710_10017265
985 Ga0207688_10001780
986 Ga0207688_10004823
987 Ga0207647_10010329
988 Ga0207647_10102134
989 Ga0207685_10001593
990 Ga0207685_10008129
991 Ga0207699_10000588
992 Ga0207699_10000868
993 Ga0207699_10003342
994 Ga0207699_10046770
995 Ga0207645_10029926
996 Ga0207645_10045002
997 Ga0207643_10000399
998 Ga0207643_10010021
999 Ga0207705_10012075
1000 Ga0207705_10073326
1001 Ga0207684_10002229
1002 Ga0207684_10002235
1003 Ga0207684_10015663
1004 Ga0207684_10023621
1005 Ga0207684_10033337
1006 Ga0207684_10072076
1007 Ga0207654_10011078
1008 Ga0207707_10001545
1009 Ga0207695_10000796
1010 Ga0207671_10000188
1011 Ga0207693_10001418
1012 Ga0207693_10106372
1013 Ga0207693_10184536
1014 Ga0207663_10004897
1015 Ga0207663_10006804
1016 Ga0207663_10006813
1017 Ga0207663_10115756
1018 Ga0207660_10174135
1019 Ga0207657_10007834
1020 Ga0207657_10048922
1021 Ga0207657_10059876
1022 Ga0207652_10032065
1023 Ga0207646_10000416
1024 Ga0207646_10005930
1025 Ga0207646_10016711
1026 Ga0207646_10191883
1027 Ga0207694_10000164
1028 Ga0207694_10074279
1029 Ga0207694_10109721
1030 Ga0207650_10006839
1031 Ga0207700_10000150
1032 Ga0207700_10000860
1033 Ga0207700_10001733
1034 Ga0207700_10003027
1035 Ga0207700_10010162
1036 Ga0207700_10011493
1037 Ga0207700_10181445
1038 Ga0207664_10000312
1039 Ga0207664_10000537
1040 Ga0207664_10004762
1041 Ga0207664_10007735
1042 Ga0207664_10010773
1043 Ga0207664_10018026
1044 Ga0207664_10034746
1045 Ga0207664_10050866
1046 Ga0207690_10094147
1047 Ga0207706_10007954
1048 Ga0207706_10080241
1049 Ga0207670_10167590
1050 Ga0207669_10022571
1051 Ga0207665_10002709
1052 Ga0207665_10005524
1053 Ga0207691_10019908
1054 Ga0207691_10036864
1055 Ga0207689_10004148
1056 Ga0207661_10007050
1057 Ga0207661_10008170
1058 Ga0207661_10178770
1059 Ga0207679_10001569
1060 Ga0207679_10009277
1061 Ga0207667_10078032
1062 Ga0207651_10045945
1063 Ga0207651_10191985
1064 Ga0207640_10103328
1065 Ga0207678_10002102
1066 Ga0207678_10008779
1067 Ga0207678_10054540
1068 Ga0207678_10060357
1069 Ga0207678_10089500
1070 Ga0207702_10005107
1071 Ga0207702_10059622
1072 Ga0207641_10043836
1073 Ga0207648_10070708
1074 Ga0207648_10099446
1075 Ga0207676_10007026
1076 Ga0207674_10021177
1077 Ga0207674_10028188
1078 Ga0207674_10038287
1079 Ga0207674_10192536
1080 Ga0207675_100087695
1081 Ga0207675_100228389
1082 Ga0207683_10000208
1083 Ga0207683_10001399
1084 Ga0207683_10067585
1085 Ga0207683_10216267
1086 Ga0207698_10009140
1087 Ga0207698_10021271
1088 Ga0207698_10051631
1089 Ga0207428_10001011
1090 Ga0207428_10022970
1091 Ga0265337_1001133
1092 Ga0265326_10005904
1093 Ga0265319_1003137
1094 Ga0265334_10003561
1095 Ga0265318_10007460
1096 Ga0265323_10019943
1097 Ga0265322_10021126
1098 Ga0265336_10002741
1099 Ga0265338_10000940
1100 Ga0265338_10001533
1101 Ga0265324_10002117
1102 Ga0307511_10109294
1103 Ga0307512_10003006
1104 Ga0307512_10032175
1105 Ga0316181_1228998
1106 Ga0265332_10002338
1107 Ga0265320_10002174
1108 Ga0265325_10029424
1109 Ga0265340_10000095
1110 Ga0265340_10003496
1111 Ga0265339_10012280
1112 Ga0265316_10036189
1113 Ga0307513_10000844
1114 Ga0307513_10009278
1115 Ga0307513_10141255
1116 Ga0307513_10148948
1117 Ga0307408_100186326
1118 Ga0265313_10010472
1119 Ga0307508_10015950
1120 Ga0307508_10075254
1121 Ga0307514_10019451
1122 Ga0265314_10015935
1123 Ga0265342_10001543
1124 Ga0307410_10207616
1125 Ga0307416_100155490
1126 Ga0307415_100002262
1127 Ga0307415_100015205
1128 Ga0307507_10001609
1129 Ga0373948_0005003
1130 Ga0373926_0017091
1131 Ga0373928_0014237
1132 Ga0373934_0015970
1133 Ga0373923_0019273
1134 Ga0373932_0014336
1135 Ga0373936_0000520
1136 Ga0373936_0009178
1137 Ga0373936_0011818
1138 Ga0373945_0015837
1139 Ga0373953_0007178
1140 Ga0373953_0012016
1141 Ga0373954_0014517
1142 Ga0373956_0008067
1143 Ga0373957_0007362
1144 Ga0373943_0002324
1145 Ga0373955_0018625
1146 Ga0373955_0133536
1147 Ga0373962_0009641
1148 Ga0373924_0012360
1149 Ga0373931_0015661
1150 Ga0373935_0010182
1151 Ga0373935_0019113
1152 Ga0373935_0088520
1153 Ga0373927_0001999
1154 Ga0373933_0001608
1155 Ga0373933_0048793
1156 Ga0373947_0042270
1157 Ga0373937_0010188
1158 Ga0373937_0018987
1159 Ga0373937_0022186
1160 Ga0373937_0065081
1161 Ga0373925_0000154
1162 Ga0373925_0008945
1163 Ga0373925_0010888
1164 Ga0373925_0012026
1165 Ga0373925_0039446
1166 Ga0373925_0065098
1167 Ga0395898_0171752
1168 Ga0436364_0316403
1169 Ga0436364_0338959
1170 Ga0436364_0780341
1171 Ga0436364_1011209
1172 Ga0436364_1307046
1173 Ga0436364_1420628
1174 Ga0439436_0001217
1175 Ga0451837_0043982
1176 Ga0451843_1130581
1177 Ga0451853_1800366
1178 Ga0439433_0002580
1179 Ga0439457_000525
1180 Ga0439464_0009754
1181 Ga0466969_0002286
1182 Ga0466969_0004931
1183 Ga0466966_0006745
1184 Ga0466966_0022325
1185 Ga0466961_0030362
1186 Ga0466961_0031507
1187 Ga0466961_0063725
1188 Ga0466961_0085572
1189 Ga0466963_0047434
1190 Ga0466963_0097168
1191 Ga0466964_0051359
1192 Ga0466971_0000019
1193 Ga0466970_0016007
1194 Ga0466970_0028809
1195 Ga0466970_0037144
1196 Ga0466970_0100239
1197 Ga0466960_0013082
1198 Ga0466959_0000305
1199 Ga0466959_0078763
1200 Ga0466959_0087210
1201 Ga0466958_0003920
1202 Ga0466958_0041157
1203 Ga0466958_0068146
1204 Ga0466958_0076120
1205 Ga0466958_0106997
1206 Ga0466967_0000260
1207 Ga0466967_0025597
1208 Ga0466967_0060605
1209 Ga0495592_0001763
1210 Ga0495592_0064064
1211 Ga0495592_0106724
1212 Ga0495603_0005306
1213 Ga0495603_0006554
1214 Ga0495629_0003377
1215 Ga0495629_0011342
1216 Ga0495629_0013094
1217 Ga0495629_0017484
1218 Ga0495641_0008210
1219 Ga0495641_0011169
1220 Ga0495641_0013810
1221 Ga0495641_0056116
1222 Ga0495641_0081757
1223 Ga0495651_0000980
1224 Ga0495651_0001034
1225 Ga0495651_0007914
1226 Ga0495651_0033988
1227 Ga0495651_0091743
1228 Ga0495653_0005729
1229 Ga0495653_0029724
1230 Ga0495653_0040624
1231 Ga0495582_0000633
1232 Ga0495582_0016998
1233 Ga0495639_0003477
1234 Ga0495639_0012376
1235 Ga0495639_0084617
1236 Ga0495662_0005078
1237 Ga0495662_0011149
1238 Ga0495662_0012615
1239 Ga0495664_0005724
1240 Ga0495585_0019998
1241 Ga0495594_0004183
1242 Ga0495608_0001601
1243 Ga0495608_0082673
1244 Ga0495618_0013662
1245 Ga0495618_0019422
1246 Ga0495618_0084334
1247 Ga0495628_0002433
1248 Ga0495628_0004920
1249 Ga0495628_0053693
1250 Ga0495628_0101793
1251 Ga0495628_0139333
1252 Ga0495630_0129748
1253 Ga0495648_0049416
1254 Ga0495652_0001157
1255 Ga0495652_0001386
1256 Ga0495652_0016682
1257 Ga0495652_0025742
1258 Ga0495652_0039344
1259 Ga0495652_0058632
1260 Ga0495665_0000862
1261 Ga0495665_0030663
1262 Ga0495640_0014827
1263 Ga0495640_0022956
1264 Ga0495640_0043895
1265 Ga0495586_0025359
1266 Ga0495587_0007428
1267 Ga0495587_0014467
1268 Ga0495587_0016460
1269 Ga0495587_0034953
1270 Ga0495645_0009361
1271 Ga0495645_0021651
1272 Ga0495622_0037712
1273 Ga0495667_0008796
1274 Ga0495667_0012714
1275 Ga0495667_0020457
1276 Ga0495667_0036915
1277 Ga0495667_0118656
1278 Ga0495634_0037081
1279 Ga0495634_0089118
1280 Ga0495625_0043201
1281 Ga0495635_0001716
1282 Ga0495635_0003578
1283 Ga0495635_0007480
1284 Ga0495635_0016986
1285 Ga0495635_0182393
1286 Ga0495588_0000842
1287 Ga0495588_0093072
1288 Ga0495657_0010651
1289 Ga0495657_0026716
1290 Ga0495657_0029473
1291 Ga0495657_0053189
1292 Ga0495599_0013517
1293 Ga0495599_0021693
1294 Ga0495599_0029737
1295 Ga0495623_0007474
1296 Ga0495623_0013683
1297 Ga0495623_0018975
1298 Ga0495646_0001496
1299 Ga0495646_0042111
1300 Ga0495646_0081948
1301 Ga0495658_0021906
1302 Ga0495658_0061234
1303 Ga0495658_0096349
1304 Ga0495613_0034997
1305 Ga0495613_0047175
1306 Ga0495624_0010481
1307 Ga0495624_0049674
1308 Ga0495600_0001701
1309 Ga0495600_0011006
1310 Ga0495600_0012624
1311 Ga0495600_0021676
1312 Ga0495600_0057696
1313 Ga0495600_0099415
1314 Ga0495581_0031110
1315 Ga0495604_0003545
1316 Ga0495604_0011923
1317 Ga0495604_0015320
1318 Ga0495604_0029308
1319 Ga0495604_0035818
1320 Ga0495604_0036815
1321 Ga0495636_0000251
1322 Ga0495636_0006534
1323 Ga0495636_0008206
1324 Ga0495674_0000343
1325 Ga0495674_0018522
1326 Ga0495674_0139392
1327 Ga0495676_0007636
1328 Ga0495676_0013313
1329 Ga0495676_0030599
1330 Ga0495676_0154949
1331 Ga0495680_0003357
1332 Ga0495680_0009875
1333 Ga0495687_004799
1334 Ga0495675_0036312
1335 Ga0495675_0079831
1336 Ga0495675_0119323
1337 Ga0495685_001251
1338 Ga0495685_024147
1339 Ga0495684_0014256
1340 Ga0495684_0021514
1341 Ga0495684_0038742
1342 Ga0495593_0007352
1343 Ga0495593_0012702
1344 Ga0495602_0002864
1345 Ga0495602_0018569
1346 Ga0495602_0030971
1347 Ga0495602_0053661
1348 Ga0495602_0097002
1349 Ga0496101_0026737
1350 Ga0496101_0064974
1351 Ga0496102_0018202
1352 Ga0496104_0003447
1353 Ga0496104_0004682
1354 Ga0496104_0005549
1355 Ga0496104_0033555
1356 Ga0496106_0006264
1357 Ga0496106_0100884
1358 Ga0496107_0008573
1359 Ga0496108_0002997
1360 Ga0496109_0017316
1361 Ga0496109_0077470
1362 Ga0496109_0084909
1363 Ga0496109_0319787
1364 Ga0496110_0029587
1365 Ga0496110_0115547
1366 Ga0496111_0151074
1367 Ga0496111_0182085
1368 Ga0496112_0009273
1369 Ga0496112_0142005
1370 Ga0496113_0023528
1371 Ga0496113_0108275
1372 Ga0496114_0081183
1373 Ga0496114_0119355
1374 Ga0496114_0123661
1375 Ga0496114_0182536
1376 Ga0496115_0003639
1377 Ga0496115_0071277
1378 Ga0496115_0147726
1379 Ga0496123_0035154
1380 Ga0496124_0015337
1381 Ga0496126_0029920
1382 Ga0501031_0016789
1383 Ga0501031_0034742
1384 Ga0501032_0014041
1385 Ga0501032_0048338
1386 Ga0501032_0130427
1387 Ga0501033_0012072
1388 Ga0501033_0073861
1389 Ga0501034_0009899
1390 Ga0501034_0010585
1391 Ga0501034_0015792
1392 Ga0501036_0006820
1393 Ga0501036_0017873
1394 Ga0501036_0021173
1395 Ga0501037_0018099
1396 Ga0501037_0051839
1397 Ga0501038_0001895
1398 Ga0501038_0003482
1399 Ga0501038_0021847
1400 Ga0501038_0022354
1401 Ga0501038_0038695
1402 Ga0501039_0020849
1403 Ga0501039_0036129
1404 Ga0501040_0003972
1405 Ga0501041_0015476
1406 Ga0501042_0000560
1407 Ga0501042_0018687
1408 Ga0501043_0000851
1409 Ga0501043_0044522
1410 Ga0501043_0105225
1411 Ga0501047_0000133
1412 Ga0501047_0006834
1413 Ga0501047_0029454
1414 Ga0501047_0054707
1415 Ga0501047_0161205
1416 Ga0501047_0188925
1417 Ga0501048_0016428
1418 Ga0501048_0041878
1419 Ga0501070_0023617
1420 Ga0501071_0007135
1421 Ga0501072_0029298
1422 Ga0501073_0033988
1423 Ga0501073_0056032
1424 Ga0501074_0029780
1425 Ga0501074_0130241
1426 Ga0501075_0008783
1427 Ga0501076_0087837
1428 Ga0501080_0054659
1429 Ga0501080_0155436
1430 Ga0501081_0016362
1431 Ga0501083_0149042
1432 Ga0501035_0002338
1433 Ga0501035_0025233
1434 Ga0501035_0032676
1435 Ga0501044_0028457
1436 Ga0501044_0062960
1437 Ga0501044_0135228
1438 Ga0501044_0187856
1439 Ga0501044_0229967
1440 Ga0501045_0078963
1441 nmdc:mga03n38_27920_c1
1442 nmdc:mga00v17_3506_c1
1443 nmdc:mga0yw44_225239_c1
1444 nmdc:mga0yw44_41214_c1
1445 nmdc:mga05p37_3966_c1
1446 nmdc:mga05p37_512_c1
1447 nmdc:mga05p37_7461_c1
1448 nmdc:mga09592_11623_c1
1449 nmdc:mga09592_225_c1
1450 nmdc:mga09592_4224_c1
1451 nmdc:mga0qj67_82952_c1
1452 nmdc:mga0qj67_8353_c1
1453 nmdc:mga06r32_106_c1
1454 nmdc:mga06r32_15566_c1
1455 nmdc:mga06r32_27566_c1
1456 nmdc:mga06r32_4348_c1
1457 nmdc:mga06r32_439_c1
1458 nmdc:mga08y16_20592_c1
1459 nmdc:mga08y16_5966_c1
1460 nmdc:mga0n895_228157_c1
1461 nmdc:mga0n895_258142_c1
1462 nmdc:mga0n895_9881_c1
1463 nmdc:mga0rr50_169139_c1
1464 nmdc:mga0rr50_45401_c1
1465 nmdc:mga08x19_3519_c1
1466 nmdc:mga0a205_1568_c1
1467 nmdc:mga0a205_24544_c1
1468 Ga0495601_0001099
1469 Ga0495601_0001775
1470 Ga0495601_0006811
1471 Ga0495601_0030323
1472 Ga0495601_0071832
1473 Ga0495612_0016309
1474 Ga0495612_0019844
1475 Ga0495612_0026382
1476 Ga0495595_0007718
1477 Ga0495619_0118837
1478 Ga0495619_0124942
1479 Ga0500614_001375
1480 Ga0500616_0000475
1481 Ga0501084_0038116
1482 Ga0466962_0000041
1483 Ga0466962_0006779
1484 Ga0530510_0003513
1485 2547410104
1486 2644539157
1487 2644539529
1488 2645721258
1489 2645724728
1490 2676494244
1491 2784589587
1492 2804845684
1493 2809233270
1494 2812356861
1495 2812362821
1496 2812479565
1497 2816426167
1498 2837272097
1499 2852640473
1500 2856745234
1501 2862286992
1502 2862514427
1503 2862707809
1504 2867350124
1505 2868093047
1506 2873154803
1507 2873321964
1508 2884695107
1509 2884997987
1510 2891401659
1511 2891560440
1512 2891567144
1513 2895431517
1514 2895446209
1515 2946069009
1516 2947227920
1517 2954002998
1518 2990046632
1519 3003001438
1520 8008487329
1521 8023626377
1522 8025416752
1523 8025483913
1524 8025526521
1525 8033690035
1526 8053948903
1527 8055071414
1528 8055174969

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

85

360

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bge-assembly1.cif.gz_A helicobacter pylori atpase, hp0525, in complex with 1g2 compound 0.7012 78 382
2oap-assembly1.cif.gz_2 crystal structure of the archaeal secretion atpase gspe in complex with amp-pnp 0.6978 14 430
3jvv-assembly1.cif.gz_C-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.6878 86 391
3jvu-assembly1.cif.gz_C-2 crystal structure of unliganded p. aeruginosa pilt 0.6849 96 391
1nlz-assembly1.cif.gz_C crystal structure of unliganded traffic atpase of the type iv secretion system of helicobacter pylori 0.6818 78 382
ID Description Score Start End Superfamily
af_P9WMT3_116_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8484 179 397 3.40.50.300
4ii7D01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8364 84 180 3.30.450.370
af_P9WMT3_116_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8228 179 397 3.40.50.300
4ihqC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8095 185 410 3.40.50.300
af_Q8I242_11_142_1.20.120.310 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ERV/ALR sulfhydryl oxidase domain 0.7836 42 77 1.20.120.310
ID Description Score Start End GO Terms
AF-W7SLZ0-F1-model_v4 Type II/IV secretion system protein 0.8718 185 436 GO:0016887
AF-A0A1R4IFW8-F1-model_v4 Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily 0.858 186 425 GO:0016887
AF-A0A6J7I7W1-F1-model_v4 Unannotated protein 0.854 84 435 GO:0016887
AF-W7SLZ0-F1-model_v4 Type II/IV secretion system protein 0.8527 185 436 GO:0016887
AF-A0A521PGK5-F1-model_v4 CpaF family protein 0.8516 186 411 GO:0016887

Map