F479720
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 381 | 1528 | 419 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10000255|Ga0081538_1000025519 |
| Length | 435 |
| Sequence | VSLNRELLLRLQAEVGERRTAERQARRAQRLPDLTGEADRQHTRPIIRDVVESYSHRLFEGTGTGLTEAAQSELVKALDARLFGAGPFQHLLDNDKVEDIHCNGYDKVFVRYADGFDEQVDPICDSNEELIQILQDLASYTGLSSRPFDTSNVELDLRLPDGSRLSATQGVSPWPTVSIRRHRHPILDLAREEELGTLDPDQAGFLRAAVRAKKNIMIAGGTGAGKTTLLRALASEIEPSERLITVERTLELALHEDETAHPNCVPFEERQPNAEGEGGVSLSSLVRRSLRMSPDRVIVGEVLGDEVVTMLNAMTQGNDGSLSTIHANSALEVVPRLCAYAIQAQERLPMEATQMLVAGALDFIVFMRKVDQQQRVIDSVIEITGYDGTMATHSHLWSAPRTGERGVRTAAQVTCHDDLVAAGWEPAPVQWGVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 164 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 165 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 210 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 213 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 214 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 339 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 340 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 341 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 342 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 343 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 344 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 345 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 346 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 347 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 348 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 349 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 350 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 351 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 352 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 353 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 354 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 355 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 356 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 357 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 358 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 359 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 360 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 361 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 362 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 363 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 364 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 365 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 366 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 367 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 368 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 369 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 370 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 371 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 372 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 373 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 374 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 375 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 376 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 377 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 378 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 379 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 380 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 381 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.46 |
| Metatranscriptomes | 0.79 |
| Isolates | 5.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.05 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 87.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10000255 | 3300005981 | Bacteria | 60411 |
| 2 | JGI24752J21851_1005025 | 3300001976 | Bacteria | 1729 |
| 3 | rootH2_10017422 | 3300003320 | Bacteria | 8587 |
| 4 | JGI25407J50210_10003188 | 3300003373 | Bacteria | 3901 |
| 5 | JGI25407J50210_10009036 | 3300003373 | Bacteria | 2518 |
| 6 | JGI25404J52841_10003275 | 3300003659 | Bacteria | 3182 |
| 7 | JGI25405J52794_10001814 | 3300003911 | Bacteria | 3581 |
| 8 | Ga0070658_10051452 | 3300005327 | Bacteria | 3338 |
| 9 | Ga0070676_10035040 | 3300005328 | Bacteria | 2885 |
| 10 | Ga0070676_10108358 | 3300005328 | Bacteria | 1726 |
| 11 | Ga0070683_100001315 | 3300005329 | Bacteria | 18902 |
| 12 | Ga0070683_100106929 | 3300005329 | Bacteria | 2638 |
| 13 | Ga0070670_100015913 | 3300005331 | Bacteria | 6454 |
| 14 | Ga0070666_10058134 | 3300005335 | Bacteria | 2614 |
| 15 | Ga0070666_10084271 | 3300005335 | Bacteria | 2175 |
| 16 | Ga0070680_100021920 | 3300005336 | Bacteria | 5080 |
| 17 | Ga0070680_100172502 | 3300005336 | Bacteria | 1820 |
| 18 | Ga0070682_100132900 | 3300005337 | Bacteria | 1686 |
| 19 | Ga0070660_100085219 | 3300005339 | Bacteria | 2484 |
| 20 | Ga0070691_10002767 | 3300005341 | Bacteria | 7825 |
| 21 | Ga0070691_10031804 | 3300005341 | Bacteria | 2476 |
| 22 | Ga0070692_10003286 | 3300005345 | Bacteria | 6524 |
| 23 | Ga0070692_10082909 | 3300005345 | Bacteria | 1730 |
| 24 | Ga0070675_100072586 | 3300005354 | Bacteria | 2857 |
| 25 | Ga0070675_100146299 | 3300005354 | Bacteria | 2023 |
| 26 | Ga0070671_100021064 | 3300005355 | Bacteria | 5322 |
| 27 | Ga0070673_100061073 | 3300005364 | Bacteria | 2988 |
| 28 | Ga0070673_100266933 | 3300005364 | Bacteria | 1497 |
| 29 | Ga0070688_100012699 | 3300005365 | Bacteria | 4726 |
| 30 | Ga0070667_100040287 | 3300005367 | Bacteria | 3917 |
| 31 | Ga0070667_100210030 | 3300005367 | Bacteria | 1730 |
| 32 | Ga0070709_10000189 | 3300005434 | Bacteria | 39091 |
| 33 | Ga0070709_10000434 | 3300005434 | Bacteria | 25299 |
| 34 | Ga0070709_10001604 | 3300005434 | Bacteria | 12206 |
| 35 | Ga0070714_100001576 | 3300005435 | Bacteria | 16570 |
| 36 | Ga0070714_100004739 | 3300005435 | Bacteria | 10295 |
| 37 | Ga0070714_100014181 | 3300005435 | Bacteria | 6398 |
| 38 | Ga0070714_100036853 | 3300005435 | Bacteria | 4105 |
| 39 | Ga0070714_100293458 | 3300005435 | Bacteria | 1514 |
| 40 | Ga0070713_100009122 | 3300005436 | Bacteria | 7077 |
| 41 | Ga0070713_100037847 | 3300005436 | Bacteria | 3903 |
| 42 | Ga0070713_100134501 | 3300005436 | Bacteria | 2183 |
| 43 | Ga0070713_100184898 | 3300005436 | Bacteria | 1875 |
| 44 | Ga0070710_10000086 | 3300005437 | Bacteria | 41898 |
| 45 | Ga0070710_10000388 | 3300005437 | Bacteria | 20532 |
| 46 | Ga0070710_10029208 | 3300005437 | Bacteria | 2956 |
| 47 | Ga0070701_10070394 | 3300005438 | Bacteria | 1869 |
| 48 | Ga0070711_100000450 | 3300005439 | Bacteria | 21452 |
| 49 | Ga0070711_100004074 | 3300005439 | Bacteria | 8593 |
| 50 | Ga0070711_100012050 | 3300005439 | Bacteria | 5391 |
| 51 | Ga0070700_100019037 | 3300005441 | Bacteria | 3957 |
| 52 | Ga0070708_100037036 | 3300005445 | Bacteria | 4254 |
| 53 | Ga0070663_100043357 | 3300005455 | Bacteria | 3166 |
| 54 | Ga0070663_100054151 | 3300005455 | Bacteria | 2867 |
| 55 | Ga0070663_100157607 | 3300005455 | Bacteria | 1745 |
| 56 | Ga0070678_100011914 | 3300005456 | Bacteria | 5383 |
| 57 | Ga0070662_100058936 | 3300005457 | Bacteria | 2796 |
| 58 | Ga0070662_100066998 | 3300005457 | Bacteria | 2636 |
| 59 | Ga0070681_10016756 | 3300005458 | Bacteria | 7316 |
| 60 | Ga0070685_10057988 | 3300005466 | Bacteria | 2255 |
| 61 | Ga0070706_100004551 | 3300005467 | Bacteria | 13334 |
| 62 | Ga0070706_100006065 | 3300005467 | Bacteria | 11424 |
| 63 | Ga0070706_100008619 | 3300005467 | Bacteria | 9504 |
| 64 | Ga0070706_100014300 | 3300005467 | Bacteria | 7333 |
| 65 | Ga0070706_100077243 | 3300005467 | Bacteria | 3082 |
| 66 | Ga0070707_100001773 | 3300005468 | Bacteria | 20734 |
| 67 | Ga0070707_100006610 | 3300005468 | Bacteria | 10757 |
| 68 | Ga0070707_100012902 | 3300005468 | Bacteria | 7805 |
| 69 | Ga0070707_100044477 | 3300005468 | Bacteria | 4251 |
| 70 | Ga0070698_100000667 | 3300005471 | Bacteria | 36601 |
| 71 | Ga0070698_100002497 | 3300005471 | Bacteria | 20270 |
| 72 | Ga0070698_100003565 | 3300005471 | Bacteria | 17106 |
| 73 | Ga0070698_100004639 | 3300005471 | Bacteria | 15108 |
| 74 | Ga0070698_100044087 | 3300005471 | Bacteria | 4569 |
| 75 | Ga0070698_100063698 | 3300005471 | Bacteria | 3718 |
| 76 | Ga0070698_100088646 | 3300005471 | Bacteria | 3079 |
| 77 | Ga0070698_100095875 | 3300005471 | Bacteria | 2944 |
| 78 | Ga0070698_100105697 | 3300005471 | Bacteria | 2784 |
| 79 | Ga0070699_100004163 | 3300005518 | Bacteria | 12787 |
| 80 | Ga0070699_100068116 | 3300005518 | Bacteria | 3090 |
| 81 | Ga0070699_100213231 | 3300005518 | Bacteria | 1719 |
| 82 | Ga0070679_100020710 | 3300005530 | Bacteria | 6416 |
| 83 | Ga0070684_100154568 | 3300005535 | Bacteria | 2080 |
| 84 | Ga0070697_100028913 | 3300005536 | Bacteria | 4442 |
| 85 | Ga0070697_100073232 | 3300005536 | Bacteria | 2812 |
| 86 | Ga0070686_100062313 | 3300005544 | Bacteria | 2413 |
| 87 | Ga0070665_100014224 | 3300005548 | Bacteria | 7992 |
| 88 | Ga0070665_100051045 | 3300005548 | Bacteria | 4149 |
| 89 | Ga0068855_100006758 | 3300005563 | Bacteria | 13913 |
| 90 | Ga0068855_100107011 | 3300005563 | Bacteria | 3213 |
| 91 | Ga0070664_100003142 | 3300005564 | Bacteria | 13351 |
| 92 | Ga0070664_100063752 | 3300005564 | Bacteria | 3142 |
| 93 | Ga0068857_100070808 | 3300005577 | Bacteria | 3106 |
| 94 | Ga0068856_100026424 | 3300005614 | Bacteria | 5661 |
| 95 | Ga0070702_100002682 | 3300005615 | Bacteria | 7774 |
| 96 | Ga0068852_100013848 | 3300005616 | Bacteria | 6185 |
| 97 | Ga0068859_100014255 | 3300005617 | Bacteria | 7973 |
| 98 | Ga0068859_100192713 | 3300005617 | Bacteria | 2122 |
| 99 | Ga0068864_100051438 | 3300005618 | Bacteria | 3549 |
| 100 | Ga0068861_100141570 | 3300005719 | Bacteria | 1963 |
| 101 | Ga0068851_10002540 | 3300005834 | Bacteria | 8026 |
| 102 | Ga0068851_10049220 | 3300005834 | Bacteria | 2137 |
| 103 | Ga0068870_10005686 | 3300005840 | Bacteria | 5456 |
| 104 | Ga0068870_10029754 | 3300005840 | Bacteria | 2754 |
| 105 | Ga0068858_100033380 | 3300005842 | Bacteria | 4777 |
| 106 | Ga0068858_100098409 | 3300005842 | Bacteria | 2727 |
| 107 | Ga0068860_100278990 | 3300005843 | Bacteria | 1632 |
| 108 | Ga0081455_10000462 | 3300005937 | Bacteria | 53037 |
| 109 | Ga0081455_10001621 | 3300005937 | Bacteria | 27482 |
| 110 | Ga0081455_10006786 | 3300005937 | Bacteria | 12206 |
| 111 | Ga0081455_10171067 | 3300005937 | Bacteria | 1655 |
| 112 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 113 | Ga0081538_10001645 | 3300005981 | Bacteria | 22911 |
| 114 | Ga0081538_10021000 | 3300005981 | Bacteria | 4786 |
| 115 | Ga0081540_1000156 | 3300005983 | Bacteria | 70177 |
| 116 | Ga0081539_10016583 | 3300005985 | Bacteria | 5244 |
| 117 | Ga0081539_10059857 | 3300005985 | Bacteria | 2094 |
| 118 | Ga0070717_10002254 | 3300006028 | Bacteria | 13518 |
| 119 | Ga0070717_10016681 | 3300006028 | Bacteria | 5699 |
| 120 | Ga0070717_10022874 | 3300006028 | Bacteria | 4945 |
| 121 | Ga0070717_10035764 | 3300006028 | Bacteria | 4024 |
| 122 | Ga0070717_10068887 | 3300006028 | Bacteria | 2945 |
| 123 | Ga0070717_10079439 | 3300006028 | Bacteria | 2751 |
| 124 | Ga0070717_10127516 | 3300006028 | Bacteria | 2186 |
| 125 | Ga0075365_10006659 | 3300006038 | Bacteria | 6382 |
| 126 | Ga0075364_10005361 | 3300006051 | Bacteria | 7449 |
| 127 | Ga0070715_10002576 | 3300006163 | Bacteria | 5596 |
| 128 | Ga0070716_100000567 | 3300006173 | Bacteria | 15445 |
| 129 | Ga0070716_100000775 | 3300006173 | Bacteria | 13702 |
| 130 | Ga0070712_100001419 | 3300006175 | Bacteria | 14579 |
| 131 | Ga0070712_100001499 | 3300006175 | Bacteria | 14245 |
| 132 | Ga0070712_100034733 | 3300006175 | Bacteria | 3418 |
| 133 | Ga0070712_100062168 | 3300006175 | Bacteria | 2640 |
| 134 | Ga0070712_100130305 | 3300006175 | Bacteria | 1905 |
| 135 | Ga0097621_100056599 | 3300006237 | Bacteria | 3204 |
| 136 | Ga0068871_100012395 | 3300006358 | Bacteria | 6283 |
| 137 | Ga0075428_100001731 | 3300006844 | Bacteria | 23290 |
| 138 | Ga0075428_100002768 | 3300006844 | Bacteria | 19092 |
| 139 | Ga0075428_100002933 | 3300006844 | Bacteria | 18598 |
| 140 | Ga0075430_100003704 | 3300006846 | Bacteria | 12840 |
| 141 | Ga0075430_100050875 | 3300006846 | Bacteria | 3492 |
| 142 | Ga0075430_100064350 | 3300006846 | Bacteria | 3081 |
| 143 | Ga0075431_100000146 | 3300006847 | Bacteria | 47784 |
| 144 | Ga0075431_100001788 | 3300006847 | Bacteria | 20287 |
| 145 | Ga0075431_100008667 | 3300006847 | Bacteria | 10191 |
| 146 | Ga0075431_100022228 | 3300006847 | Bacteria | 6485 |
| 147 | Ga0075431_100023095 | 3300006847 | Bacteria | 6359 |
| 148 | Ga0075433_10003780 | 3300006852 | Bacteria | 11722 |
| 149 | Ga0075433_10018642 | 3300006852 | Bacteria | 5772 |
| 150 | Ga0075433_10033337 | 3300006852 | Bacteria | 4414 |
| 151 | Ga0075434_100028784 | 3300006871 | Bacteria | 5463 |
| 152 | Ga0075434_100080789 | 3300006871 | Bacteria | 3248 |
| 153 | Ga0075429_100000765 | 3300006880 | Bacteria | 25332 |
| 154 | Ga0075429_100004858 | 3300006880 | Bacteria | 11581 |
| 155 | Ga0075429_100006583 | 3300006880 | Bacteria | 10061 |
| 156 | Ga0075436_100005194 | 3300006914 | Bacteria | 8961 |
| 157 | Ga0097620_100014255 | 3300006931 | Bacteria | 7973 |
| 158 | Ga0097620_100192720 | 3300006931 | Bacteria | 2122 |
| 159 | Ga0075435_100004703 | 3300007076 | Bacteria | 9420 |
| 160 | Ga0075435_100009031 | 3300007076 | Bacteria | 7189 |
| 161 | Ga0105251_10022197 | 3300009011 | Bacteria | 3301 |
| 162 | Ga0105251_10029369 | 3300009011 | Bacteria | 2769 |
| 163 | Ga0105240_10017938 | 3300009093 | Bacteria | 9519 |
| 164 | Ga0105240_10072110 | 3300009093 | Bacteria | 4269 |
| 165 | Ga0105240_10131918 | 3300009093 | Bacteria | 2996 |
| 166 | Ga0111539_10043053 | 3300009094 | Bacteria | 5416 |
| 167 | Ga0111539_10050574 | 3300009094 | Bacteria | 4951 |
| 168 | Ga0111539_10077858 | 3300009094 | Bacteria | 3902 |
| 169 | Ga0105245_10067041 | 3300009098 | Bacteria | 3250 |
| 170 | Ga0105245_10256885 | 3300009098 | Bacteria | 1699 |
| 171 | Ga0105247_10032497 | 3300009101 | Bacteria | 3171 |
| 172 | Ga0114129_10001519 | 3300009147 | Bacteria | 31396 |
| 173 | Ga0114129_10002812 | 3300009147 | Bacteria | 24275 |
| 174 | Ga0114129_10004453 | 3300009147 | Bacteria | 19771 |
| 175 | Ga0114129_10316677 | 3300009147 | Bacteria | 2075 |
| 176 | Ga0105241_10006461 | 3300009174 | Bacteria | 8642 |
| 177 | Ga0105248_10015474 | 3300009177 | Bacteria | 8410 |
| 178 | Ga0105238_10008196 | 3300009551 | Bacteria | 10452 |
| 179 | Ga0105238_10119158 | 3300009551 | Bacteria | 2620 |
| 180 | Ga0105238_10168888 | 3300009551 | Bacteria | 2164 |
| 181 | Ga0105249_10262797 | 3300009553 | Bacteria | 1716 |
| 182 | Ga0105239_10013495 | 3300010375 | Bacteria | 9071 |
| 183 | Ga0105239_10118885 | 3300010375 | Bacteria | 2933 |
| 184 | Ga0105246_10008787 | 3300011119 | Bacteria | 6216 |
| 185 | Ga0157373_10032591 | 3300013100 | Bacteria | 3750 |
| 186 | Ga0157373_10050691 | 3300013100 | Bacteria | 2956 |
| 187 | Ga0157371_10060542 | 3300013102 | Bacteria | 2684 |
| 188 | Ga0157371_10064355 | 3300013102 | Bacteria | 2598 |
| 189 | Ga0157369_10018619 | 3300013105 | Bacteria | 7784 |
| 190 | Ga0157369_10077270 | 3300013105 | Bacteria | 3568 |
| 191 | Ga0157374_10027942 | 3300013296 | Bacteria | 5093 |
| 192 | Ga0157378_10126542 | 3300013297 | Bacteria | 2361 |
| 193 | Ga0157378_10129014 | 3300013297 | Bacteria | 2339 |
| 194 | Ga0157375_10034191 | 3300013308 | Bacteria | 4840 |
| 195 | Ga0157377_10002370 | 3300014745 | Bacteria | 8310 |
| 196 | Ga0157377_10039954 | 3300014745 | Bacteria | 2596 |
| 197 | Ga0157379_10018531 | 3300014968 | Bacteria | 6140 |
| 198 | Ga0157379_10204070 | 3300014968 | Bacteria | 1788 |
| 199 | Ga0157379_10288777 | 3300014968 | Bacteria | 1493 |
| 200 | Ga0157376_10220086 | 3300014969 | Bacteria | 1758 |
| 201 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 202 | Ga0206356_11454342 | 3300020070 | Bacteria | 2049 |
| 203 | Ga0206354_10548483 | 3300020081 | Bacteria | 3894 |
| 204 | Ga0206354_11463014 | 3300020081 | Bacteria | 1659 |
| 205 | Ga0206353_11781108 | 3300020082 | Bacteria | 3374 |
| 206 | Ga0213875_10001145 | 3300021388 | Bacteria | 18237 |
| 207 | Ga0213875_10001643 | 3300021388 | Bacteria | 14116 |
| 208 | Ga0213875_10006906 | 3300021388 | Bacteria | 5915 |
| 209 | Ga0213875_10008999 | 3300021388 | Bacteria | 5079 |
| 210 | Ga0213875_10024421 | 3300021388 | Bacteria | 2882 |
| 211 | Ga0213875_10074775 | 3300021388 | Bacteria | 1581 |
| 212 | Ga0224712_10000119 | 3300022467 | Bacteria | 12710 |
| 213 | Ga0224712_10043715 | 3300022467 | Bacteria | 1705 |
| 214 | Ga0207656_10016701 | 3300025321 | Bacteria | 2861 |
| 215 | Ga0207713_1062035 | 3300025735 | Bacteria | 1419 |
| 216 | Ga0207653_10016993 | 3300025885 | Bacteria | 2288 |
| 217 | Ga0207692_10000202 | 3300025898 | Bacteria | 19952 |
| 218 | Ga0207692_10000505 | 3300025898 | Bacteria | 13777 |
| 219 | Ga0207692_10021608 | 3300025898 | Bacteria | 2947 |
| 220 | Ga0207710_10017265 | 3300025900 | Bacteria | 3061 |
| 221 | Ga0207688_10001780 | 3300025901 | Bacteria | 11441 |
| 222 | Ga0207688_10004823 | 3300025901 | Bacteria | 7347 |
| 223 | Ga0207647_10010329 | 3300025904 | Bacteria | 6594 |
| 224 | Ga0207647_10102134 | 3300025904 | Bacteria | 1701 |
| 225 | Ga0207685_10001593 | 3300025905 | Bacteria | 4842 |
| 226 | Ga0207685_10008129 | 3300025905 | Bacteria | 2968 |
| 227 | Ga0207699_10000588 | 3300025906 | Bacteria | 17872 |
| 228 | Ga0207699_10000868 | 3300025906 | Bacteria | 14421 |
| 229 | Ga0207699_10003342 | 3300025906 | Bacteria | 7648 |
| 230 | Ga0207699_10046770 | 3300025906 | Bacteria | 2533 |
| 231 | Ga0207645_10029926 | 3300025907 | Bacteria | 3509 |
| 232 | Ga0207645_10045002 | 3300025907 | Bacteria | 2822 |
| 233 | Ga0207643_10000399 | 3300025908 | Bacteria | 28909 |
| 234 | Ga0207643_10010021 | 3300025908 | Bacteria | 5094 |
| 235 | Ga0207705_10012075 | 3300025909 | Bacteria | 6240 |
| 236 | Ga0207705_10073326 | 3300025909 | Bacteria | 2483 |
| 237 | Ga0207684_10002229 | 3300025910 | Bacteria | 19767 |
| 238 | Ga0207684_10002235 | 3300025910 | Bacteria | 19732 |
| 239 | Ga0207684_10015663 | 3300025910 | Bacteria | 6526 |
| 240 | Ga0207684_10023621 | 3300025910 | Bacteria | 5249 |
| 241 | Ga0207684_10033337 | 3300025910 | Bacteria | 4379 |
| 242 | Ga0207684_10072076 | 3300025910 | Bacteria | 2935 |
| 243 | Ga0207654_10011078 | 3300025911 | Bacteria | 4589 |
| 244 | Ga0207707_10001545 | 3300025912 | Bacteria | 21197 |
| 245 | Ga0207695_10000796 | 3300025913 | Bacteria | 59143 |
| 246 | Ga0207671_10000188 | 3300025914 | Bacteria | 95365 |
| 247 | Ga0207693_10001418 | 3300025915 | Bacteria | 21248 |
| 248 | Ga0207693_10106372 | 3300025915 | Bacteria | 2201 |
| 249 | Ga0207693_10184536 | 3300025915 | Bacteria | 1642 |
| 250 | Ga0207663_10004897 | 3300025916 | Bacteria | 6701 |
| 251 | Ga0207663_10006804 | 3300025916 | Bacteria | 5886 |
| 252 | Ga0207663_10006813 | 3300025916 | Bacteria | 5883 |
| 253 | Ga0207663_10115756 | 3300025916 | Bacteria | 1827 |
| 254 | Ga0207660_10174135 | 3300025917 | Bacteria | 1667 |
| 255 | Ga0207657_10007834 | 3300025919 | Bacteria | 10901 |
| 256 | Ga0207657_10048922 | 3300025919 | Bacteria | 3688 |
| 257 | Ga0207657_10059876 | 3300025919 | Bacteria | 3270 |
| 258 | Ga0207652_10032065 | 3300025921 | Bacteria | 4413 |
| 259 | Ga0207646_10000416 | 3300025922 | Bacteria | 56976 |
| 260 | Ga0207646_10005930 | 3300025922 | Bacteria | 12744 |
| 261 | Ga0207646_10016711 | 3300025922 | Bacteria | 6884 |
| 262 | Ga0207646_10191883 | 3300025922 | Bacteria | 1845 |
| 263 | Ga0207694_10000164 | 3300025924 | Bacteria | 68118 |
| 264 | Ga0207694_10074279 | 3300025924 | Bacteria | 2661 |
| 265 | Ga0207694_10109721 | 3300025924 | Bacteria | 2194 |
| 266 | Ga0207650_10006839 | 3300025925 | Bacteria | 7781 |
| 267 | Ga0207700_10000150 | 3300025928 | Bacteria | 41536 |
| 268 | Ga0207700_10000860 | 3300025928 | Bacteria | 17458 |
| 269 | Ga0207700_10001733 | 3300025928 | Bacteria | 12393 |
| 270 | Ga0207700_10003027 | 3300025928 | Bacteria | 9693 |
| 271 | Ga0207700_10010162 | 3300025928 | Bacteria | 5921 |
| 272 | Ga0207700_10011493 | 3300025928 | Bacteria | 5648 |
| 273 | Ga0207700_10181445 | 3300025928 | Bacteria | 1763 |
| 274 | Ga0207664_10000312 | 3300025929 | Bacteria | 36120 |
| 275 | Ga0207664_10000537 | 3300025929 | Bacteria | 27020 |
| 276 | Ga0207664_10004762 | 3300025929 | Bacteria | 9222 |
| 277 | Ga0207664_10007735 | 3300025929 | Bacteria | 7460 |
| 278 | Ga0207664_10010773 | 3300025929 | Bacteria | 6467 |
| 279 | Ga0207664_10018026 | 3300025929 | Bacteria | 5186 |
| 280 | Ga0207664_10034746 | 3300025929 | Bacteria | 3885 |
| 281 | Ga0207664_10050866 | 3300025929 | Bacteria | 3269 |
| 282 | Ga0207690_10094147 | 3300025932 | Bacteria | 2125 |
| 283 | Ga0207706_10007954 | 3300025933 | Bacteria | 9789 |
| 284 | Ga0207706_10080241 | 3300025933 | Bacteria | 2869 |
| 285 | Ga0207670_10167590 | 3300025936 | Bacteria | 1644 |
| 286 | Ga0207669_10022571 | 3300025937 | Bacteria | 3346 |
| 287 | Ga0207665_10002709 | 3300025939 | Bacteria | 11883 |
| 288 | Ga0207665_10005524 | 3300025939 | Bacteria | 8430 |
| 289 | Ga0207691_10019908 | 3300025940 | Bacteria | 6347 |
| 290 | Ga0207691_10036864 | 3300025940 | Bacteria | 4530 |
| 291 | Ga0207689_10004148 | 3300025942 | Bacteria | 13172 |
| 292 | Ga0207661_10007050 | 3300025944 | Bacteria | 7977 |
| 293 | Ga0207661_10008170 | 3300025944 | Bacteria | 7470 |
| 294 | Ga0207661_10178770 | 3300025944 | Bacteria | 1852 |
| 295 | Ga0207679_10001569 | 3300025945 | Bacteria | 14281 |
| 296 | Ga0207679_10009277 | 3300025945 | Bacteria | 6294 |
| 297 | Ga0207667_10078032 | 3300025949 | Bacteria | 3433 |
| 298 | Ga0207651_10045945 | 3300025960 | Bacteria | 2932 |
| 299 | Ga0207651_10191985 | 3300025960 | Bacteria | 1630 |
| 300 | Ga0207640_10103328 | 3300025981 | Bacteria | 2003 |
| 301 | Ga0207678_10002102 | 3300026067 | Bacteria | 18030 |
| 302 | Ga0207678_10008779 | 3300026067 | Bacteria | 8891 |
| 303 | Ga0207678_10054540 | 3300026067 | Bacteria | 3443 |
| 304 | Ga0207678_10060357 | 3300026067 | Bacteria | 3262 |
| 305 | Ga0207678_10089500 | 3300026067 | Bacteria | 2631 |
| 306 | Ga0207702_10005107 | 3300026078 | Bacteria | 11542 |
| 307 | Ga0207702_10059622 | 3300026078 | Bacteria | 3250 |
| 308 | Ga0207641_10043836 | 3300026088 | Bacteria | 3759 |
| 309 | Ga0207648_10070708 | 3300026089 | Bacteria | 3042 |
| 310 | Ga0207648_10099446 | 3300026089 | Bacteria | 2547 |
| 311 | Ga0207676_10007026 | 3300026095 | Bacteria | 7974 |
| 312 | Ga0207674_10021177 | 3300026116 | Bacteria | 7009 |
| 313 | Ga0207674_10028188 | 3300026116 | Bacteria | 5931 |
| 314 | Ga0207674_10038287 | 3300026116 | Bacteria | 4979 |
| 315 | Ga0207674_10192536 | 3300026116 | Bacteria | 1989 |
| 316 | Ga0207675_100087695 | 3300026118 | Bacteria | 2923 |
| 317 | Ga0207675_100228389 | 3300026118 | Bacteria | 1795 |
| 318 | Ga0207683_10000208 | 3300026121 | Bacteria | 50925 |
| 319 | Ga0207683_10001399 | 3300026121 | Bacteria | 21779 |
| 320 | Ga0207683_10067585 | 3300026121 | Bacteria | 3153 |
| 321 | Ga0207683_10216267 | 3300026121 | Bacteria | 1745 |
| 322 | Ga0207698_10009140 | 3300026142 | Bacteria | 6300 |
| 323 | Ga0207698_10021271 | 3300026142 | Bacteria | 4482 |
| 324 | Ga0207698_10051631 | 3300026142 | Bacteria | 3145 |
| 325 | Ga0207428_10001011 | 3300027907 | Bacteria | 31194 |
| 326 | Ga0207428_10022970 | 3300027907 | Bacteria | 5253 |
| 327 | Ga0265337_1001133 | 3300028556 | Bacteria | 13619 |
| 328 | Ga0265326_10005904 | 3300028558 | Bacteria | 3836 |
| 329 | Ga0265319_1003137 | 3300028563 | Bacteria | 8714 |
| 330 | Ga0265334_10003561 | 3300028573 | Bacteria | 7056 |
| 331 | Ga0265318_10007460 | 3300028577 | Bacteria | 4944 |
| 332 | Ga0265323_10019943 | 3300028653 | Bacteria | 2585 |
| 333 | Ga0265322_10021126 | 3300028654 | Bacteria | 1864 |
| 334 | Ga0265336_10002741 | 3300028666 | Bacteria | 7124 |
| 335 | Ga0265338_10000940 | 3300028800 | Bacteria | 49081 |
| 336 | Ga0265338_10001533 | 3300028800 | Bacteria | 37286 |
| 337 | Ga0265324_10002117 | 3300029957 | Bacteria | 10461 |
| 338 | Ga0307511_10109294 | 3300030521 | Bacteria | 1769 |
| 339 | Ga0307512_10003006 | 3300030522 | Bacteria | 20337 |
| 340 | Ga0307512_10032175 | 3300030522 | Bacteria | 4532 |
| 341 | Ga0316181_1228998 | 3300030744 | Bacteria | 2881 |
| 342 | Ga0265332_10002338 | 3300031238 | Bacteria | 9675 |
| 343 | Ga0265320_10002174 | 3300031240 | Bacteria | 13772 |
| 344 | Ga0265325_10029424 | 3300031241 | Bacteria | 2953 |
| 345 | Ga0265340_10000095 | 3300031247 | Bacteria | 41685 |
| 346 | Ga0265340_10003496 | 3300031247 | Bacteria | 8846 |
| 347 | Ga0265339_10012280 | 3300031249 | Bacteria | 5236 |
| 348 | Ga0265316_10036189 | 3300031344 | Bacteria | 3992 |
| 349 | Ga0307513_10000844 | 3300031456 | Bacteria | 44769 |
| 350 | Ga0307513_10009278 | 3300031456 | Bacteria | 12457 |
| 351 | Ga0307513_10141255 | 3300031456 | Bacteria | 2334 |
| 352 | Ga0307513_10148948 | 3300031456 | Bacteria | 2253 |
| 353 | Ga0307408_100186326 | 3300031548 | Bacteria | 1669 |
| 354 | Ga0265313_10010472 | 3300031595 | Bacteria | 5858 |
| 355 | Ga0307508_10015950 | 3300031616 | Bacteria | 6843 |
| 356 | Ga0307508_10075254 | 3300031616 | Bacteria | 2953 |
| 357 | Ga0307514_10019451 | 3300031649 | Bacteria | 5558 |
| 358 | Ga0265314_10015935 | 3300031711 | Bacteria | 5951 |
| 359 | Ga0265342_10001543 | 3300031712 | Bacteria | 21280 |
| 360 | Ga0307410_10207616 | 3300031852 | Bacteria | 1499 |
| 361 | Ga0307416_100155490 | 3300032002 | Bacteria | 2104 |
| 362 | Ga0307415_100002262 | 3300032126 | Bacteria | 9539 |
| 363 | Ga0307415_100015205 | 3300032126 | Bacteria | 4549 |
| 364 | Ga0307507_10001609 | 3300033179 | Bacteria | 49933 |
| 365 | Ga0373948_0005003 | 3300034817 | Bacteria | 2126 |
| 366 | Ga0373926_0017091 | 3300035083 | Bacteria | 2487 |
| 367 | Ga0373928_0014237 | 3300035084 | Bacteria | 1605 |
| 368 | Ga0373934_0015970 | 3300035086 | Bacteria | 2852 |
| 369 | Ga0373923_0019273 | 3300035111 | Bacteria | 2639 |
| 370 | Ga0373932_0014336 | 3300035112 | Bacteria | 1991 |
| 371 | Ga0373936_0000520 | 3300035113 | Bacteria | 13136 |
| 372 | Ga0373936_0009178 | 3300035113 | Bacteria | 3728 |
| 373 | Ga0373936_0011818 | 3300035113 | Bacteria | 3311 |
| 374 | Ga0373945_0015837 | 3300035116 | Bacteria | 2540 |
| 375 | Ga0373953_0007178 | 3300035117 | Bacteria | 3717 |
| 376 | Ga0373953_0012016 | 3300035117 | Bacteria | 3056 |
| 377 | Ga0373954_0014517 | 3300035118 | Bacteria | 3514 |
| 378 | Ga0373956_0008067 | 3300035119 | Bacteria | 4259 |
| 379 | Ga0373957_0007362 | 3300035120 | Bacteria | 3520 |
| 380 | Ga0373943_0002324 | 3300035170 | Bacteria | 8641 |
| 381 | Ga0373955_0018625 | 3300035172 | Bacteria | 3457 |
| 382 | Ga0373955_0133536 | 3300035172 | Bacteria | 1450 |
| 383 | Ga0373962_0009641 | 3300035242 | Bacteria | 2396 |
| 384 | Ga0373924_0012360 | 3300035410 | Bacteria | 3188 |
| 385 | Ga0373931_0015661 | 3300035691 | Bacteria | 3721 |
| 386 | Ga0373935_0010182 | 3300035692 | Bacteria | 5632 |
| 387 | Ga0373935_0019113 | 3300035692 | Bacteria | 4177 |
| 388 | Ga0373935_0088520 | 3300035692 | Bacteria | 2023 |
| 389 | Ga0373927_0001999 | 3300035695 | Bacteria | 15033 |
| 390 | Ga0373933_0001608 | 3300035724 | Bacteria | 13212 |
| 391 | Ga0373933_0048793 | 3300035724 | Bacteria | 2522 |
| 392 | Ga0373947_0042270 | 3300035725 | Bacteria | 2720 |
| 393 | Ga0373937_0010188 | 3300036401 | Bacteria | 8201 |
| 394 | Ga0373937_0018987 | 3300036401 | Bacteria | 6149 |
| 395 | Ga0373937_0022186 | 3300036401 | Bacteria | 5704 |
| 396 | Ga0373937_0065081 | 3300036401 | Bacteria | 3355 |
| 397 | Ga0373925_0000154 | 3300037068 | Bacteria | 73830 |
| 398 | Ga0373925_0008945 | 3300037068 | Bacteria | 7296 |
| 399 | Ga0373925_0010888 | 3300037068 | Bacteria | 6597 |
| 400 | Ga0373925_0012026 | 3300037068 | Bacteria | 6267 |
| 401 | Ga0373925_0039446 | 3300037068 | Bacteria | 3493 |
| 402 | Ga0373925_0065098 | 3300037068 | Bacteria | 2745 |
| 403 | Ga0395898_0171752 | 3300037466 | Bacteria | 2072 |
| 404 | Ga0436364_0316403 | 3300037853 | Bacteria | 9081 |
| 405 | Ga0436364_0338959 | 3300037853 | Bacteria | 5071 |
| 406 | Ga0436364_0780341 | 3300037853 | Bacteria | 70185 |
| 407 | Ga0436364_1011209 | 3300037853 | Bacteria | 3250 |
| 408 | Ga0436364_1307046 | 3300037853 | Bacteria | 27649 |
| 409 | Ga0436364_1420628 | 3300037853 | Bacteria | 6828 |
| 410 | Ga0439436_0001217 | 3300041404 | Bacteria | 7324 |
| 411 | Ga0451837_0043982 | 3300041494 | Bacteria | 3334 |
| 412 | Ga0451843_1130581 | 3300041509 | Bacteria | 1641 |
| 413 | Ga0451853_1800366 | 3300041512 | Bacteria | 7574 |
| 414 | Ga0439433_0002580 | 3300041999 | Bacteria | 3848 |
| 415 | Ga0439457_000525 | 3300042014 | Bacteria | 11109 |
| 416 | Ga0439464_0009754 | 3300042439 | Bacteria | 2530 |
| 417 | Ga0466969_0002286 | 3300044656 | Bacteria | 10232 |
| 418 | Ga0466969_0004931 | 3300044656 | Bacteria | 7112 |
| 419 | Ga0466966_0006745 | 3300044684 | Bacteria | 7603 |
| 420 | Ga0466966_0022325 | 3300044684 | Bacteria | 4153 |
| 421 | Ga0466961_0030362 | 3300044693 | Bacteria | 3473 |
| 422 | Ga0466961_0031507 | 3300044693 | Bacteria | 3409 |
| 423 | Ga0466961_0063725 | 3300044693 | Bacteria | 2342 |
| 424 | Ga0466961_0085572 | 3300044693 | Bacteria | 1993 |
| 425 | Ga0466963_0047434 | 3300044694 | Bacteria | 2835 |
| 426 | Ga0466963_0097168 | 3300044694 | Bacteria | 2012 |
| 427 | Ga0466964_0051359 | 3300044706 | Bacteria | 1693 |
| 428 | Ga0466971_0000019 | 3300044719 | Bacteria | 79360 |
| 429 | Ga0466970_0016007 | 3300044765 | Bacteria | 3862 |
| 430 | Ga0466970_0028809 | 3300044765 | Bacteria | 2920 |
| 431 | Ga0466970_0037144 | 3300044765 | Bacteria | 2581 |
| 432 | Ga0466970_0100239 | 3300044765 | Bacteria | 1577 |
| 433 | Ga0466960_0013082 | 3300044901 | Bacteria | 3516 |
| 434 | Ga0466959_0000305 | 3300045049 | Bacteria | 29181 |
| 435 | Ga0466959_0078763 | 3300045049 | Bacteria | 2376 |
| 436 | Ga0466959_0087210 | 3300045049 | Bacteria | 2245 |
| 437 | Ga0466958_0003920 | 3300045836 | Bacteria | 7799 |
| 438 | Ga0466958_0041157 | 3300045836 | Bacteria | 2779 |
| 439 | Ga0466958_0068146 | 3300045836 | Bacteria | 2175 |
| 440 | Ga0466958_0076120 | 3300045836 | Bacteria | 2059 |
| 441 | Ga0466958_0106997 | 3300045836 | Bacteria | 1744 |
| 442 | Ga0466967_0000260 | 3300045976 | Bacteria | 23213 |
| 443 | Ga0466967_0025597 | 3300045976 | Bacteria | 4869 |
| 444 | Ga0466967_0060605 | 3300045976 | Bacteria | 3354 |
| 445 | Ga0495592_0001763 | 3300046454 | Bacteria | 15222 |
| 446 | Ga0495592_0064064 | 3300046454 | Bacteria | 2695 |
| 447 | Ga0495592_0106724 | 3300046454 | Bacteria | 1987 |
| 448 | Ga0495603_0005306 | 3300046455 | Bacteria | 7685 |
| 449 | Ga0495603_0006554 | 3300046455 | Bacteria | 6987 |
| 450 | Ga0495629_0003377 | 3300046459 | Bacteria | 12067 |
| 451 | Ga0495629_0011342 | 3300046459 | Bacteria | 6475 |
| 452 | Ga0495629_0013094 | 3300046459 | Bacteria | 5993 |
| 453 | Ga0495629_0017484 | 3300046459 | Bacteria | 5139 |
| 454 | Ga0495641_0008210 | 3300046461 | Bacteria | 6400 |
| 455 | Ga0495641_0011169 | 3300046461 | Bacteria | 5140 |
| 456 | Ga0495641_0013810 | 3300046461 | Bacteria | 4408 |
| 457 | Ga0495641_0056116 | 3300046461 | Bacteria | 1786 |
| 458 | Ga0495641_0081757 | 3300046461 | Bacteria | 1447 |
| 459 | Ga0495651_0000980 | 3300046462 | Bacteria | 22144 |
| 460 | Ga0495651_0001034 | 3300046462 | Bacteria | 21514 |
| 461 | Ga0495651_0007914 | 3300046462 | Bacteria | 8143 |
| 462 | Ga0495651_0033988 | 3300046462 | Bacteria | 3975 |
| 463 | Ga0495651_0091743 | 3300046462 | Bacteria | 2277 |
| 464 | Ga0495653_0005729 | 3300046463 | Bacteria | 10158 |
| 465 | Ga0495653_0029724 | 3300046463 | Bacteria | 4358 |
| 466 | Ga0495653_0040624 | 3300046463 | Bacteria | 3634 |
| 467 | Ga0495582_0000633 | 3300046473 | Bacteria | 19392 |
| 468 | Ga0495582_0016998 | 3300046473 | Bacteria | 3982 |
| 469 | Ga0495639_0003477 | 3300046475 | Bacteria | 6811 |
| 470 | Ga0495639_0012376 | 3300046475 | Bacteria | 3680 |
| 471 | Ga0495639_0084617 | 3300046475 | Bacteria | 1481 |
| 472 | Ga0495662_0005078 | 3300046476 | Bacteria | 6590 |
| 473 | Ga0495662_0011149 | 3300046476 | Bacteria | 4391 |
| 474 | Ga0495662_0012615 | 3300046476 | Bacteria | 4121 |
| 475 | Ga0495664_0005724 | 3300046477 | Bacteria | 6845 |
| 476 | Ga0495585_0019998 | 3300046492 | Bacteria | 3851 |
| 477 | Ga0495594_0004183 | 3300046499 | Bacteria | 7412 |
| 478 | Ga0495608_0001601 | 3300046511 | Bacteria | 16213 |
| 479 | Ga0495608_0082673 | 3300046511 | Bacteria | 2085 |
| 480 | Ga0495618_0013662 | 3300046514 | Bacteria | 4941 |
| 481 | Ga0495618_0019422 | 3300046514 | Bacteria | 4181 |
| 482 | Ga0495618_0084334 | 3300046514 | Bacteria | 2030 |
| 483 | Ga0495628_0002433 | 3300046516 | Bacteria | 16783 |
| 484 | Ga0495628_0004920 | 3300046516 | Bacteria | 11748 |
| 485 | Ga0495628_0053693 | 3300046516 | Bacteria | 3179 |
| 486 | Ga0495628_0101793 | 3300046516 | Bacteria | 2216 |
| 487 | Ga0495628_0139333 | 3300046516 | Bacteria | 1852 |
| 488 | Ga0495630_0129748 | 3300046517 | Bacteria | 1914 |
| 489 | Ga0495648_0049416 | 3300046524 | Bacteria | 2578 |
| 490 | Ga0495652_0001157 | 3300046529 | Bacteria | 29740 |
| 491 | Ga0495652_0001386 | 3300046529 | Bacteria | 26938 |
| 492 | Ga0495652_0016682 | 3300046529 | Bacteria | 6564 |
| 493 | Ga0495652_0025742 | 3300046529 | Bacteria | 5200 |
| 494 | Ga0495652_0039344 | 3300046529 | Bacteria | 4089 |
| 495 | Ga0495652_0058632 | 3300046529 | Bacteria | 3259 |
| 496 | Ga0495665_0000862 | 3300046531 | Bacteria | 15866 |
| 497 | Ga0495665_0030663 | 3300046531 | Bacteria | 2878 |
| 498 | Ga0495640_0014827 | 3300046533 | Bacteria | 5882 |
| 499 | Ga0495640_0022956 | 3300046533 | Bacteria | 4556 |
| 500 | Ga0495640_0043895 | 3300046533 | Bacteria | 3110 |
| 501 | Ga0495586_0025359 | 3300046535 | Bacteria | 3172 |
| 502 | Ga0495587_0007428 | 3300046536 | Bacteria | 7095 |
| 503 | Ga0495587_0014467 | 3300046536 | Bacteria | 4947 |
| 504 | Ga0495587_0016460 | 3300046536 | Bacteria | 4599 |
| 505 | Ga0495587_0034953 | 3300046536 | Bacteria | 3029 |
| 506 | Ga0495645_0009361 | 3300046543 | Bacteria | 6848 |
| 507 | Ga0495645_0021651 | 3300046543 | Bacteria | 4646 |
| 508 | Ga0495622_0037712 | 3300046557 | Bacteria | 2251 |
| 509 | Ga0495667_0008796 | 3300046559 | Bacteria | 6865 |
| 510 | Ga0495667_0012714 | 3300046559 | Bacteria | 5706 |
| 511 | Ga0495667_0020457 | 3300046559 | Bacteria | 4464 |
| 512 | Ga0495667_0036915 | 3300046559 | Bacteria | 3258 |
| 513 | Ga0495667_0118656 | 3300046559 | Bacteria | 1708 |
| 514 | Ga0495634_0037081 | 3300046642 | Bacteria | 3332 |
| 515 | Ga0495634_0089118 | 3300046642 | Bacteria | 2006 |
| 516 | Ga0495625_0043201 | 3300046660 | Bacteria | 3270 |
| 517 | Ga0495635_0001716 | 3300046663 | Bacteria | 14750 |
| 518 | Ga0495635_0003578 | 3300046663 | Bacteria | 10752 |
| 519 | Ga0495635_0007480 | 3300046663 | Bacteria | 7625 |
| 520 | Ga0495635_0016986 | 3300046663 | Bacteria | 5082 |
| 521 | Ga0495635_0182393 | 3300046663 | Bacteria | 1426 |
| 522 | Ga0495588_0000842 | 3300046674 | Bacteria | 13599 |
| 523 | Ga0495588_0093072 | 3300046674 | Bacteria | 1580 |
| 524 | Ga0495657_0010651 | 3300046675 | Bacteria | 6914 |
| 525 | Ga0495657_0026716 | 3300046675 | Bacteria | 4085 |
| 526 | Ga0495657_0029473 | 3300046675 | Bacteria | 3849 |
| 527 | Ga0495657_0053189 | 3300046675 | Bacteria | 2710 |
| 528 | Ga0495599_0013517 | 3300046678 | Bacteria | 5043 |
| 529 | Ga0495599_0021693 | 3300046678 | Bacteria | 4007 |
| 530 | Ga0495599_0029737 | 3300046678 | Bacteria | 3426 |
| 531 | Ga0495623_0007474 | 3300046679 | Bacteria | 7094 |
| 532 | Ga0495623_0013683 | 3300046679 | Bacteria | 5260 |
| 533 | Ga0495623_0018975 | 3300046679 | Bacteria | 4440 |
| 534 | Ga0495646_0001496 | 3300046680 | Bacteria | 13924 |
| 535 | Ga0495646_0042111 | 3300046680 | Bacteria | 2803 |
| 536 | Ga0495646_0081948 | 3300046680 | Bacteria | 1878 |
| 537 | Ga0495658_0021906 | 3300046683 | Bacteria | 3374 |
| 538 | Ga0495658_0061234 | 3300046683 | Bacteria | 2160 |
| 539 | Ga0495658_0096349 | 3300046683 | Bacteria | 1760 |
| 540 | Ga0495613_0034997 | 3300046689 | Bacteria | 3729 |
| 541 | Ga0495613_0047175 | 3300046689 | Bacteria | 3182 |
| 542 | Ga0495624_0010481 | 3300046690 | Bacteria | 6388 |
| 543 | Ga0495624_0049674 | 3300046690 | Bacteria | 2659 |
| 544 | Ga0495600_0001701 | 3300046809 | Bacteria | 12290 |
| 545 | Ga0495600_0011006 | 3300046809 | Bacteria | 5628 |
| 546 | Ga0495600_0012624 | 3300046809 | Bacteria | 5288 |
| 547 | Ga0495600_0021676 | 3300046809 | Bacteria | 4118 |
| 548 | Ga0495600_0057696 | 3300046809 | Bacteria | 2535 |
| 549 | Ga0495600_0099415 | 3300046809 | Bacteria | 1896 |
| 550 | Ga0495581_0031110 | 3300047315 | Bacteria | 3092 |
| 551 | Ga0495604_0003545 | 3300047317 | Bacteria | 12448 |
| 552 | Ga0495604_0011923 | 3300047317 | Bacteria | 6913 |
| 553 | Ga0495604_0015320 | 3300047317 | Bacteria | 6120 |
| 554 | Ga0495604_0029308 | 3300047317 | Bacteria | 4378 |
| 555 | Ga0495604_0035818 | 3300047317 | Bacteria | 3917 |
| 556 | Ga0495604_0036815 | 3300047317 | Bacteria | 3857 |
| 557 | Ga0495636_0000251 | 3300047318 | Bacteria | 21247 |
| 558 | Ga0495636_0006534 | 3300047318 | Bacteria | 4584 |
| 559 | Ga0495636_0008206 | 3300047318 | Bacteria | 4119 |
| 560 | Ga0495674_0000343 | 3300047319 | Bacteria | 41172 |
| 561 | Ga0495674_0018522 | 3300047319 | Bacteria | 6481 |
| 562 | Ga0495674_0139392 | 3300047319 | Bacteria | 2039 |
| 563 | Ga0495676_0007636 | 3300047321 | Bacteria | 9917 |
| 564 | Ga0495676_0013313 | 3300047321 | Bacteria | 7394 |
| 565 | Ga0495676_0030599 | 3300047321 | Bacteria | 4564 |
| 566 | Ga0495676_0154949 | 3300047321 | Bacteria | 1627 |
| 567 | Ga0495680_0003357 | 3300047322 | Bacteria | 15810 |
| 568 | Ga0495680_0009875 | 3300047322 | Bacteria | 8554 |
| 569 | Ga0495687_004799 | 3300047443 | Bacteria | 8911 |
| 570 | Ga0495675_0036312 | 3300047444 | Bacteria | 3143 |
| 571 | Ga0495675_0079831 | 3300047444 | Bacteria | 2060 |
| 572 | Ga0495675_0119323 | 3300047444 | Bacteria | 1643 |
| 573 | Ga0495685_001251 | 3300047447 | Bacteria | 7772 |
| 574 | Ga0495685_024147 | 3300047447 | Bacteria | 2092 |
| 575 | Ga0495684_0014256 | 3300047471 | Bacteria | 6116 |
| 576 | Ga0495684_0021514 | 3300047471 | Bacteria | 4965 |
| 577 | Ga0495684_0038742 | 3300047471 | Bacteria | 3654 |
| 578 | Ga0495593_0007352 | 3300047673 | Bacteria | 6449 |
| 579 | Ga0495593_0012702 | 3300047673 | Bacteria | 4809 |
| 580 | Ga0495602_0002864 | 3300048088 | Bacteria | 17659 |
| 581 | Ga0495602_0018569 | 3300048088 | Bacteria | 6937 |
| 582 | Ga0495602_0030971 | 3300048088 | Bacteria | 5064 |
| 583 | Ga0495602_0053661 | 3300048088 | Bacteria | 3567 |
| 584 | Ga0495602_0097002 | 3300048088 | Bacteria | 2430 |
| 585 | Ga0496101_0026737 | 3300048904 | Bacteria | 4012 |
| 586 | Ga0496101_0064974 | 3300048904 | Bacteria | 2659 |
| 587 | Ga0496102_0018202 | 3300048905 | Bacteria | 6167 |
| 588 | Ga0496104_0003447 | 3300048907 | Bacteria | 13626 |
| 589 | Ga0496104_0004682 | 3300048907 | Bacteria | 11910 |
| 590 | Ga0496104_0005549 | 3300048907 | Bacteria | 11048 |
| 591 | Ga0496104_0033555 | 3300048907 | Bacteria | 4783 |
| 592 | Ga0496106_0006264 | 3300048909 | Bacteria | 8809 |
| 593 | Ga0496106_0100884 | 3300048909 | Bacteria | 2238 |
| 594 | Ga0496107_0008573 | 3300048910 | Bacteria | 7077 |
| 595 | Ga0496108_0002997 | 3300048911 | Bacteria | 13566 |
| 596 | Ga0496109_0017316 | 3300048912 | Bacteria | 6314 |
| 597 | Ga0496109_0077470 | 3300048912 | Bacteria | 3059 |
| 598 | Ga0496109_0084909 | 3300048912 | Bacteria | 2921 |
| 599 | Ga0496109_0319787 | 3300048912 | Bacteria | 1464 |
| 600 | Ga0496110_0029587 | 3300048913 | Bacteria | 4716 |
| 601 | Ga0496110_0115547 | 3300048913 | Bacteria | 2416 |
| 602 | Ga0496111_0151074 | 3300048914 | Bacteria | 1722 |
| 603 | Ga0496111_0182085 | 3300048914 | Bacteria | 1562 |
| 604 | Ga0496112_0009273 | 3300048915 | Bacteria | 8848 |
| 605 | Ga0496112_0142005 | 3300048915 | Bacteria | 2370 |
| 606 | Ga0496113_0023528 | 3300048916 | Bacteria | 4368 |
| 607 | Ga0496113_0108275 | 3300048916 | Bacteria | 2160 |
| 608 | Ga0496114_0081183 | 3300048917 | Bacteria | 2739 |
| 609 | Ga0496114_0119355 | 3300048917 | Bacteria | 2267 |
| 610 | Ga0496114_0123661 | 3300048917 | Bacteria | 2227 |
| 611 | Ga0496114_0182536 | 3300048917 | Bacteria | 1833 |
| 612 | Ga0496115_0003639 | 3300048918 | Bacteria | 11093 |
| 613 | Ga0496115_0071277 | 3300048918 | Bacteria | 2818 |
| 614 | Ga0496115_0147726 | 3300048918 | Bacteria | 1940 |
| 615 | Ga0496123_0035154 | 3300048926 | Bacteria | 3576 |
| 616 | Ga0496124_0015337 | 3300048927 | Bacteria | 7354 |
| 617 | Ga0496126_0029920 | 3300048929 | Bacteria | 5168 |
| 618 | Ga0501031_0016789 | 3300049568 | Bacteria | 4755 |
| 619 | Ga0501031_0034742 | 3300049568 | Bacteria | 3290 |
| 620 | Ga0501032_0014041 | 3300049569 | Bacteria | 5682 |
| 621 | Ga0501032_0048338 | 3300049569 | Bacteria | 2872 |
| 622 | Ga0501032_0130427 | 3300049569 | Bacteria | 1659 |
| 623 | Ga0501033_0012072 | 3300049570 | Bacteria | 6593 |
| 624 | Ga0501033_0073861 | 3300049570 | Bacteria | 2504 |
| 625 | Ga0501034_0009899 | 3300049571 | Bacteria | 9964 |
| 626 | Ga0501034_0010585 | 3300049571 | Bacteria | 9596 |
| 627 | Ga0501034_0015792 | 3300049571 | Bacteria | 7755 |
| 628 | Ga0501036_0006820 | 3300049572 | Bacteria | 9279 |
| 629 | Ga0501036_0017873 | 3300049572 | Bacteria | 5936 |
| 630 | Ga0501036_0021173 | 3300049572 | Bacteria | 5462 |
| 631 | Ga0501037_0018099 | 3300049573 | Bacteria | 5190 |
| 632 | Ga0501037_0051839 | 3300049573 | Bacteria | 3001 |
| 633 | Ga0501038_0001895 | 3300049574 | Bacteria | 19341 |
| 634 | Ga0501038_0003482 | 3300049574 | Bacteria | 14660 |
| 635 | Ga0501038_0021847 | 3300049574 | Bacteria | 5739 |
| 636 | Ga0501038_0022354 | 3300049574 | Bacteria | 5669 |
| 637 | Ga0501038_0038695 | 3300049574 | Bacteria | 4175 |
| 638 | Ga0501039_0020849 | 3300049575 | Bacteria | 5024 |
| 639 | Ga0501039_0036129 | 3300049575 | Bacteria | 3812 |
| 640 | Ga0501040_0003972 | 3300049576 | Bacteria | 9611 |
| 641 | Ga0501041_0015476 | 3300049577 | Bacteria | 4529 |
| 642 | Ga0501042_0000560 | 3300049578 | Bacteria | 19671 |
| 643 | Ga0501042_0018687 | 3300049578 | Bacteria | 4803 |
| 644 | Ga0501043_0000851 | 3300049579 | Bacteria | 27034 |
| 645 | Ga0501043_0044522 | 3300049579 | Bacteria | 3489 |
| 646 | Ga0501043_0105225 | 3300049579 | Bacteria | 2217 |
| 647 | Ga0501047_0000133 | 3300049581 | Bacteria | 90926 |
| 648 | Ga0501047_0006834 | 3300049581 | Bacteria | 10720 |
| 649 | Ga0501047_0029454 | 3300049581 | Bacteria | 5293 |
| 650 | Ga0501047_0054707 | 3300049581 | Bacteria | 3860 |
| 651 | Ga0501047_0161205 | 3300049581 | Bacteria | 2114 |
| 652 | Ga0501047_0188925 | 3300049581 | Bacteria | 1924 |
| 653 | Ga0501048_0016428 | 3300049582 | Bacteria | 5455 |
| 654 | Ga0501048_0041878 | 3300049582 | Bacteria | 3281 |
| 655 | Ga0501070_0023617 | 3300049586 | Bacteria | 5151 |
| 656 | Ga0501071_0007135 | 3300049587 | Bacteria | 7306 |
| 657 | Ga0501072_0029298 | 3300049588 | Bacteria | 4299 |
| 658 | Ga0501073_0033988 | 3300049589 | Bacteria | 3630 |
| 659 | Ga0501073_0056032 | 3300049589 | Bacteria | 2758 |
| 660 | Ga0501074_0029780 | 3300049590 | Bacteria | 3955 |
| 661 | Ga0501074_0130241 | 3300049590 | Bacteria | 1800 |
| 662 | Ga0501075_0008783 | 3300049591 | Bacteria | 7043 |
| 663 | Ga0501076_0087837 | 3300049592 | Bacteria | 2499 |
| 664 | Ga0501080_0054659 | 3300049742 | Bacteria | 3718 |
| 665 | Ga0501080_0155436 | 3300049742 | Bacteria | 2113 |
| 666 | Ga0501081_0016362 | 3300049743 | Bacteria | 4902 |
| 667 | Ga0501083_0149042 | 3300049744 | Bacteria | 1532 |
| 668 | Ga0501035_0002338 | 3300049822 | Bacteria | 18696 |
| 669 | Ga0501035_0025233 | 3300049822 | Bacteria | 5449 |
| 670 | Ga0501035_0032676 | 3300049822 | Bacteria | 4733 |
| 671 | Ga0501044_0028457 | 3300049823 | Bacteria | 5898 |
| 672 | Ga0501044_0062960 | 3300049823 | Bacteria | 3790 |
| 673 | Ga0501044_0135228 | 3300049823 | Bacteria | 2457 |
| 674 | Ga0501044_0187856 | 3300049823 | Bacteria | 2030 |
| 675 | Ga0501044_0229967 | 3300049823 | Bacteria | 1802 |
| 676 | Ga0501045_0078963 | 3300049824 | Bacteria | 2426 |
| 677 | nmdc:mga03n38_27920_c1 | 3300050490 | Bacteria | 2346 |
| 678 | nmdc:mga00v17_3506_c1 | 3300050491 | Bacteria | 8111 |
| 679 | nmdc:mga0yw44_225239_c1 | 3300050492 | Bacteria | 1244 |
| 680 | nmdc:mga0yw44_41214_c1 | 3300050492 | Bacteria | 2748 |
| 681 | nmdc:mga05p37_3966_c1 | 3300050507 | Bacteria | 17332 |
| 682 | nmdc:mga05p37_512_c1 | 3300050507 | Bacteria | 42901 |
| 683 | nmdc:mga05p37_7461_c1 | 3300050507 | Bacteria | 12894 |
| 684 | nmdc:mga09592_11623_c1 | 3300050508 | Bacteria | 7159 |
| 685 | nmdc:mga09592_225_c1 | 3300050508 | Bacteria | 40713 |
| 686 | nmdc:mga09592_4224_c1 | 3300050508 | Bacteria | 11601 |
| 687 | nmdc:mga0qj67_82952_c1 | 3300050509 | Bacteria | 2570 |
| 688 | nmdc:mga0qj67_8353_c1 | 3300050509 | Bacteria | 7677 |
| 689 | nmdc:mga06r32_106_c1 | 3300050510 | Bacteria | 58645 |
| 690 | nmdc:mga06r32_15566_c1 | 3300050510 | Bacteria | 6909 |
| 691 | nmdc:mga06r32_27566_c1 | 3300050510 | Bacteria | 5309 |
| 692 | nmdc:mga06r32_4348_c1 | 3300050510 | Bacteria | 12680 |
| 693 | nmdc:mga06r32_439_c1 | 3300050510 | Bacteria | 35271 |
| 694 | nmdc:mga08y16_20592_c1 | 3300050511 | Bacteria | 6962 |
| 695 | nmdc:mga08y16_5966_c1 | 3300050511 | Bacteria | 12777 |
| 696 | nmdc:mga0n895_228157_c1 | 3300050512 | Bacteria | 1890 |
| 697 | nmdc:mga0n895_258142_c1 | 3300050512 | Bacteria | 1769 |
| 698 | nmdc:mga0n895_9881_c1 | 3300050512 | Bacteria | 8392 |
| 699 | nmdc:mga0rr50_169139_c1 | 3300050513 | Bacteria | 1780 |
| 700 | nmdc:mga0rr50_45401_c1 | 3300050513 | Bacteria | 3229 |
| 701 | nmdc:mga08x19_3519_c1 | 3300050514 | Bacteria | 9321 |
| 702 | nmdc:mga0a205_1568_c1 | 3300050515 | Bacteria | 19587 |
| 703 | nmdc:mga0a205_24544_c1 | 3300050515 | Bacteria | 5735 |
| 704 | Ga0495601_0001099 | 3300053077 | Bacteria | 14838 |
| 705 | Ga0495601_0001775 | 3300053077 | Bacteria | 11951 |
| 706 | Ga0495601_0006811 | 3300053077 | Bacteria | 6694 |
| 707 | Ga0495601_0030323 | 3300053077 | Bacteria | 3357 |
| 708 | Ga0495601_0071832 | 3300053077 | Bacteria | 2210 |
| 709 | Ga0495612_0016309 | 3300053078 | Bacteria | 2977 |
| 710 | Ga0495612_0019844 | 3300053078 | Bacteria | 2693 |
| 711 | Ga0495612_0026382 | 3300053078 | Bacteria | 2335 |
| 712 | Ga0495595_0007718 | 3300053084 | Bacteria | 4407 |
| 713 | Ga0495619_0118837 | 3300053085 | Bacteria | 1811 |
| 714 | Ga0495619_0124942 | 3300053085 | Bacteria | 1765 |
| 715 | Ga0500614_001375 | 3300053123 | Bacteria | 5858 |
| 716 | Ga0500616_0000475 | 3300053153 | Bacteria | 52004 |
| 717 | Ga0501084_0038116 | 3300054114 | Bacteria | 4018 |
| 718 | Ga0466962_0000041 | 3300061719 | Bacteria | 56378 |
| 719 | Ga0466962_0006779 | 3300061719 | Bacteria | 5495 |
| 720 | Ga0530510_0003513 | 3300061734 | Bacteria | 10778 |
| 721 | 2547410104 | 2547132111 | Bacteria | 8013147 |
| 722 | 2644539157 | 2643221697 | Bacteria | 3575694 |
| 723 | 2644539529 | 2643221697 | Bacteria | 3575694 |
| 724 | 2645721258 | 2643221961 | Bacteria | 3919167 |
| 725 | 2645724728 | 2643221962 | Bacteria | 3874254 |
| 726 | 2676494244 | 2675903060 | Bacteria | 10051191 |
| 727 | 2784589587 | 2784132148 | Bacteria | 8627943 |
| 728 | 2804845684 | 2802429296 | Bacteria | 7227771 |
| 729 | 2809233270 | 2808606448 | Bacteria | 8656184 |
| 730 | 2812356861 | 2811994879 | Bacteria | 9313447 |
| 731 | 2812362821 | 2811994880 | Bacteria | 4147780 |
| 732 | 2812479565 | 2811994917 | Bacteria | 7761064 |
| 733 | 2816426167 | 2816332119 | Bacteria | 8120218 |
| 734 | 2837272097 | 2837268691 | Bacteria | 7850704 |
| 735 | 2852640473 | 2852635781 | Bacteria | 8251373 |
| 736 | 2856745234 | 2856741275 | Bacteria | 8096094 |
| 737 | 2862286992 | 2862281513 | Bacteria | 9621493 |
| 738 | 2862514427 | 2862507626 | Bacteria | 9425308 |
| 739 | 2862707809 | 2862705112 | Bacteria | 6563286 |
| 740 | 2867350124 | 2867346516 | Bacteria | 7608576 |
| 741 | 2868093047 | 2868088558 | Bacteria | 7609351 |
| 742 | 2873154803 | 2873151551 | Bacteria | 8625867 |
| 743 | 2873321964 | 2873314349 | Bacteria | 8512634 |
| 744 | 2884695107 | 2884693830 | Bacteria | 11273186 |
| 745 | 2884997987 | 2884994152 | Bacteria | 4492978 |
| 746 | 2891401659 | 2891395885 | Bacteria | 9251614 |
| 747 | 2891560440 | 2891554331 | Bacteria | 8812224 |
| 748 | 2891567144 | 2891562705 | Bacteria | 8039471 |
| 749 | 2895431517 | 2895427314 | Bacteria | 13147766 |
| 750 | 2895446209 | 2895442618 | Bacteria | 11027144 |
| 751 | 2946069009 | 2946064051 | Bacteria | 8957905 |
| 752 | 2947227920 | 2947224130 | Bacteria | 9938529 |
| 753 | 2954002998 | 2954002825 | Bacteria | 9173742 |
| 754 | 2990046632 | 2990044586 | Bacteria | 6603797 |
| 755 | 3003001438 | 3002998708 | Bacteria | 11715108 |
| 756 | 8008487329 | 8008485437 | Bacteria | 7198341 |
| 757 | 8023626377 | 8023623736 | Bacteria | 8593882 |
| 758 | 8025416752 | 8025413630 | Bacteria | 7014048 |
| 759 | 8025483913 | 8025478263 | Bacteria | 8209203 |
| 760 | 8025526521 | 8025524527 | Bacteria | 7197316 |
| 761 | 8033690035 | 8033684223 | Bacteria | 6906479 |
| 762 | 8053948903 | 8053945823 | Bacteria | 8962862 |
| 763 | 8055071414 | 8055066027 | Bacteria | 9479577 |
| 764 | 8055174969 | 8055172936 | Bacteria | 9305943 |
| 765 | Ga0081538_10000255 | |||
| 766 | JGI24752J21851_1005025 | |||
| 767 | rootH2_10017422 | |||
| 768 | JGI25407J50210_10003188 | |||
| 769 | JGI25407J50210_10009036 | |||
| 770 | JGI25404J52841_10003275 | |||
| 771 | JGI25405J52794_10001814 | |||
| 772 | Ga0070658_10051452 | |||
| 773 | Ga0070676_10035040 | |||
| 774 | Ga0070676_10108358 | |||
| 775 | Ga0070683_100001315 | |||
| 776 | Ga0070683_100106929 | |||
| 777 | Ga0070670_100015913 | |||
| 778 | Ga0070666_10058134 | |||
| 779 | Ga0070666_10084271 | |||
| 780 | Ga0070680_100021920 | |||
| 781 | Ga0070680_100172502 | |||
| 782 | Ga0070682_100132900 | |||
| 783 | Ga0070660_100085219 | |||
| 784 | Ga0070691_10002767 | |||
| 785 | Ga0070691_10031804 | |||
| 786 | Ga0070692_10003286 | |||
| 787 | Ga0070692_10082909 | |||
| 788 | Ga0070675_100072586 | |||
| 789 | Ga0070675_100146299 | |||
| 790 | Ga0070671_100021064 | |||
| 791 | Ga0070673_100061073 | |||
| 792 | Ga0070673_100266933 | |||
| 793 | Ga0070688_100012699 | |||
| 794 | Ga0070667_100040287 | |||
| 795 | Ga0070667_100210030 | |||
| 796 | Ga0070709_10000189 | |||
| 797 | Ga0070709_10000434 | |||
| 798 | Ga0070709_10001604 | |||
| 799 | Ga0070714_100001576 | |||
| 800 | Ga0070714_100004739 | |||
| 801 | Ga0070714_100014181 | |||
| 802 | Ga0070714_100036853 | |||
| 803 | Ga0070714_100293458 | |||
| 804 | Ga0070713_100009122 | |||
| 805 | Ga0070713_100037847 | |||
| 806 | Ga0070713_100134501 | |||
| 807 | Ga0070713_100184898 | |||
| 808 | Ga0070710_10000086 | |||
| 809 | Ga0070710_10000388 | |||
| 810 | Ga0070710_10029208 | |||
| 811 | Ga0070701_10070394 | |||
| 812 | Ga0070711_100000450 | |||
| 813 | Ga0070711_100004074 | |||
| 814 | Ga0070711_100012050 | |||
| 815 | Ga0070700_100019037 | |||
| 816 | Ga0070708_100037036 | |||
| 817 | Ga0070663_100043357 | |||
| 818 | Ga0070663_100054151 | |||
| 819 | Ga0070663_100157607 | |||
| 820 | Ga0070678_100011914 | |||
| 821 | Ga0070662_100058936 | |||
| 822 | Ga0070662_100066998 | |||
| 823 | Ga0070681_10016756 | |||
| 824 | Ga0070685_10057988 | |||
| 825 | Ga0070706_100004551 | |||
| 826 | Ga0070706_100006065 | |||
| 827 | Ga0070706_100008619 | |||
| 828 | Ga0070706_100014300 | |||
| 829 | Ga0070706_100077243 | |||
| 830 | Ga0070707_100001773 | |||
| 831 | Ga0070707_100006610 | |||
| 832 | Ga0070707_100012902 | |||
| 833 | Ga0070707_100044477 | |||
| 834 | Ga0070698_100000667 | |||
| 835 | Ga0070698_100002497 | |||
| 836 | Ga0070698_100003565 | |||
| 837 | Ga0070698_100004639 | |||
| 838 | Ga0070698_100044087 | |||
| 839 | Ga0070698_100063698 | |||
| 840 | Ga0070698_100088646 | |||
| 841 | Ga0070698_100095875 | |||
| 842 | Ga0070698_100105697 | |||
| 843 | Ga0070699_100004163 | |||
| 844 | Ga0070699_100068116 | |||
| 845 | Ga0070699_100213231 | |||
| 846 | Ga0070679_100020710 | |||
| 847 | Ga0070684_100154568 | |||
| 848 | Ga0070697_100028913 | |||
| 849 | Ga0070697_100073232 | |||
| 850 | Ga0070686_100062313 | |||
| 851 | Ga0070665_100014224 | |||
| 852 | Ga0070665_100051045 | |||
| 853 | Ga0068855_100006758 | |||
| 854 | Ga0068855_100107011 | |||
| 855 | Ga0070664_100003142 | |||
| 856 | Ga0070664_100063752 | |||
| 857 | Ga0068857_100070808 | |||
| 858 | Ga0068856_100026424 | |||
| 859 | Ga0070702_100002682 | |||
| 860 | Ga0068852_100013848 | |||
| 861 | Ga0068859_100014255 | |||
| 862 | Ga0068859_100192713 | |||
| 863 | Ga0068864_100051438 | |||
| 864 | Ga0068861_100141570 | |||
| 865 | Ga0068851_10002540 | |||
| 866 | Ga0068851_10049220 | |||
| 867 | Ga0068870_10005686 | |||
| 868 | Ga0068870_10029754 | |||
| 869 | Ga0068858_100033380 | |||
| 870 | Ga0068858_100098409 | |||
| 871 | Ga0068860_100278990 | |||
| 872 | Ga0081455_10000462 | |||
| 873 | Ga0081455_10001621 | |||
| 874 | Ga0081455_10006786 | |||
| 875 | Ga0081455_10171067 | |||
| 876 | Ga0081538_10000092 | |||
| 877 | Ga0081538_10001645 | |||
| 878 | Ga0081538_10021000 | |||
| 879 | Ga0081540_1000156 | |||
| 880 | Ga0081539_10016583 | |||
| 881 | Ga0081539_10059857 | |||
| 882 | Ga0070717_10002254 | |||
| 883 | Ga0070717_10016681 | |||
| 884 | Ga0070717_10022874 | |||
| 885 | Ga0070717_10035764 | |||
| 886 | Ga0070717_10068887 | |||
| 887 | Ga0070717_10079439 | |||
| 888 | Ga0070717_10127516 | |||
| 889 | Ga0075365_10006659 | |||
| 890 | Ga0075364_10005361 | |||
| 891 | Ga0070715_10002576 | |||
| 892 | Ga0070716_100000567 | |||
| 893 | Ga0070716_100000775 | |||
| 894 | Ga0070712_100001419 | |||
| 895 | Ga0070712_100001499 | |||
| 896 | Ga0070712_100034733 | |||
| 897 | Ga0070712_100062168 | |||
| 898 | Ga0070712_100130305 | |||
| 899 | Ga0097621_100056599 | |||
| 900 | Ga0068871_100012395 | |||
| 901 | Ga0075428_100001731 | |||
| 902 | Ga0075428_100002768 | |||
| 903 | Ga0075428_100002933 | |||
| 904 | Ga0075430_100003704 | |||
| 905 | Ga0075430_100050875 | |||
| 906 | Ga0075430_100064350 | |||
| 907 | Ga0075431_100000146 | |||
| 908 | Ga0075431_100001788 | |||
| 909 | Ga0075431_100008667 | |||
| 910 | Ga0075431_100022228 | |||
| 911 | Ga0075431_100023095 | |||
| 912 | Ga0075433_10003780 | |||
| 913 | Ga0075433_10018642 | |||
| 914 | Ga0075433_10033337 | |||
| 915 | Ga0075434_100028784 | |||
| 916 | Ga0075434_100080789 | |||
| 917 | Ga0075429_100000765 | |||
| 918 | Ga0075429_100004858 | |||
| 919 | Ga0075429_100006583 | |||
| 920 | Ga0075436_100005194 | |||
| 921 | Ga0097620_100014255 | |||
| 922 | Ga0097620_100192720 | |||
| 923 | Ga0075435_100004703 | |||
| 924 | Ga0075435_100009031 | |||
| 925 | Ga0105251_10022197 | |||
| 926 | Ga0105251_10029369 | |||
| 927 | Ga0105240_10017938 | |||
| 928 | Ga0105240_10072110 | |||
| 929 | Ga0105240_10131918 | |||
| 930 | Ga0111539_10043053 | |||
| 931 | Ga0111539_10050574 | |||
| 932 | Ga0111539_10077858 | |||
| 933 | Ga0105245_10067041 | |||
| 934 | Ga0105245_10256885 | |||
| 935 | Ga0105247_10032497 | |||
| 936 | Ga0114129_10001519 | |||
| 937 | Ga0114129_10002812 | |||
| 938 | Ga0114129_10004453 | |||
| 939 | Ga0114129_10316677 | |||
| 940 | Ga0105241_10006461 | |||
| 941 | Ga0105248_10015474 | |||
| 942 | Ga0105238_10008196 | |||
| 943 | Ga0105238_10119158 | |||
| 944 | Ga0105238_10168888 | |||
| 945 | Ga0105249_10262797 | |||
| 946 | Ga0105239_10013495 | |||
| 947 | Ga0105239_10118885 | |||
| 948 | Ga0105246_10008787 | |||
| 949 | Ga0157373_10032591 | |||
| 950 | Ga0157373_10050691 | |||
| 951 | Ga0157371_10060542 | |||
| 952 | Ga0157371_10064355 | |||
| 953 | Ga0157369_10018619 | |||
| 954 | Ga0157369_10077270 | |||
| 955 | Ga0157374_10027942 | |||
| 956 | Ga0157378_10126542 | |||
| 957 | Ga0157378_10129014 | |||
| 958 | Ga0157375_10034191 | |||
| 959 | Ga0157377_10002370 | |||
| 960 | Ga0157377_10039954 | |||
| 961 | Ga0157379_10018531 | |||
| 962 | Ga0157379_10204070 | |||
| 963 | Ga0157379_10288777 | |||
| 964 | Ga0157376_10220086 | |||
| 965 | Ga0183367_1002 | |||
| 966 | Ga0206356_11454342 | |||
| 967 | Ga0206354_10548483 | |||
| 968 | Ga0206354_11463014 | |||
| 969 | Ga0206353_11781108 | |||
| 970 | Ga0213875_10001145 | |||
| 971 | Ga0213875_10001643 | |||
| 972 | Ga0213875_10006906 | |||
| 973 | Ga0213875_10008999 | |||
| 974 | Ga0213875_10024421 | |||
| 975 | Ga0213875_10074775 | |||
| 976 | Ga0224712_10000119 | |||
| 977 | Ga0224712_10043715 | |||
| 978 | Ga0207656_10016701 | |||
| 979 | Ga0207713_1062035 | |||
| 980 | Ga0207653_10016993 | |||
| 981 | Ga0207692_10000202 | |||
| 982 | Ga0207692_10000505 | |||
| 983 | Ga0207692_10021608 | |||
| 984 | Ga0207710_10017265 | |||
| 985 | Ga0207688_10001780 | |||
| 986 | Ga0207688_10004823 | |||
| 987 | Ga0207647_10010329 | |||
| 988 | Ga0207647_10102134 | |||
| 989 | Ga0207685_10001593 | |||
| 990 | Ga0207685_10008129 | |||
| 991 | Ga0207699_10000588 | |||
| 992 | Ga0207699_10000868 | |||
| 993 | Ga0207699_10003342 | |||
| 994 | Ga0207699_10046770 | |||
| 995 | Ga0207645_10029926 | |||
| 996 | Ga0207645_10045002 | |||
| 997 | Ga0207643_10000399 | |||
| 998 | Ga0207643_10010021 | |||
| 999 | Ga0207705_10012075 | |||
| 1000 | Ga0207705_10073326 | |||
| 1001 | Ga0207684_10002229 | |||
| 1002 | Ga0207684_10002235 | |||
| 1003 | Ga0207684_10015663 | |||
| 1004 | Ga0207684_10023621 | |||
| 1005 | Ga0207684_10033337 | |||
| 1006 | Ga0207684_10072076 | |||
| 1007 | Ga0207654_10011078 | |||
| 1008 | Ga0207707_10001545 | |||
| 1009 | Ga0207695_10000796 | |||
| 1010 | Ga0207671_10000188 | |||
| 1011 | Ga0207693_10001418 | |||
| 1012 | Ga0207693_10106372 | |||
| 1013 | Ga0207693_10184536 | |||
| 1014 | Ga0207663_10004897 | |||
| 1015 | Ga0207663_10006804 | |||
| 1016 | Ga0207663_10006813 | |||
| 1017 | Ga0207663_10115756 | |||
| 1018 | Ga0207660_10174135 | |||
| 1019 | Ga0207657_10007834 | |||
| 1020 | Ga0207657_10048922 | |||
| 1021 | Ga0207657_10059876 | |||
| 1022 | Ga0207652_10032065 | |||
| 1023 | Ga0207646_10000416 | |||
| 1024 | Ga0207646_10005930 | |||
| 1025 | Ga0207646_10016711 | |||
| 1026 | Ga0207646_10191883 | |||
| 1027 | Ga0207694_10000164 | |||
| 1028 | Ga0207694_10074279 | |||
| 1029 | Ga0207694_10109721 | |||
| 1030 | Ga0207650_10006839 | |||
| 1031 | Ga0207700_10000150 | |||
| 1032 | Ga0207700_10000860 | |||
| 1033 | Ga0207700_10001733 | |||
| 1034 | Ga0207700_10003027 | |||
| 1035 | Ga0207700_10010162 | |||
| 1036 | Ga0207700_10011493 | |||
| 1037 | Ga0207700_10181445 | |||
| 1038 | Ga0207664_10000312 | |||
| 1039 | Ga0207664_10000537 | |||
| 1040 | Ga0207664_10004762 | |||
| 1041 | Ga0207664_10007735 | |||
| 1042 | Ga0207664_10010773 | |||
| 1043 | Ga0207664_10018026 | |||
| 1044 | Ga0207664_10034746 | |||
| 1045 | Ga0207664_10050866 | |||
| 1046 | Ga0207690_10094147 | |||
| 1047 | Ga0207706_10007954 | |||
| 1048 | Ga0207706_10080241 | |||
| 1049 | Ga0207670_10167590 | |||
| 1050 | Ga0207669_10022571 | |||
| 1051 | Ga0207665_10002709 | |||
| 1052 | Ga0207665_10005524 | |||
| 1053 | Ga0207691_10019908 | |||
| 1054 | Ga0207691_10036864 | |||
| 1055 | Ga0207689_10004148 | |||
| 1056 | Ga0207661_10007050 | |||
| 1057 | Ga0207661_10008170 | |||
| 1058 | Ga0207661_10178770 | |||
| 1059 | Ga0207679_10001569 | |||
| 1060 | Ga0207679_10009277 | |||
| 1061 | Ga0207667_10078032 | |||
| 1062 | Ga0207651_10045945 | |||
| 1063 | Ga0207651_10191985 | |||
| 1064 | Ga0207640_10103328 | |||
| 1065 | Ga0207678_10002102 | |||
| 1066 | Ga0207678_10008779 | |||
| 1067 | Ga0207678_10054540 | |||
| 1068 | Ga0207678_10060357 | |||
| 1069 | Ga0207678_10089500 | |||
| 1070 | Ga0207702_10005107 | |||
| 1071 | Ga0207702_10059622 | |||
| 1072 | Ga0207641_10043836 | |||
| 1073 | Ga0207648_10070708 | |||
| 1074 | Ga0207648_10099446 | |||
| 1075 | Ga0207676_10007026 | |||
| 1076 | Ga0207674_10021177 | |||
| 1077 | Ga0207674_10028188 | |||
| 1078 | Ga0207674_10038287 | |||
| 1079 | Ga0207674_10192536 | |||
| 1080 | Ga0207675_100087695 | |||
| 1081 | Ga0207675_100228389 | |||
| 1082 | Ga0207683_10000208 | |||
| 1083 | Ga0207683_10001399 | |||
| 1084 | Ga0207683_10067585 | |||
| 1085 | Ga0207683_10216267 | |||
| 1086 | Ga0207698_10009140 | |||
| 1087 | Ga0207698_10021271 | |||
| 1088 | Ga0207698_10051631 | |||
| 1089 | Ga0207428_10001011 | |||
| 1090 | Ga0207428_10022970 | |||
| 1091 | Ga0265337_1001133 | |||
| 1092 | Ga0265326_10005904 | |||
| 1093 | Ga0265319_1003137 | |||
| 1094 | Ga0265334_10003561 | |||
| 1095 | Ga0265318_10007460 | |||
| 1096 | Ga0265323_10019943 | |||
| 1097 | Ga0265322_10021126 | |||
| 1098 | Ga0265336_10002741 | |||
| 1099 | Ga0265338_10000940 | |||
| 1100 | Ga0265338_10001533 | |||
| 1101 | Ga0265324_10002117 | |||
| 1102 | Ga0307511_10109294 | |||
| 1103 | Ga0307512_10003006 | |||
| 1104 | Ga0307512_10032175 | |||
| 1105 | Ga0316181_1228998 | |||
| 1106 | Ga0265332_10002338 | |||
| 1107 | Ga0265320_10002174 | |||
| 1108 | Ga0265325_10029424 | |||
| 1109 | Ga0265340_10000095 | |||
| 1110 | Ga0265340_10003496 | |||
| 1111 | Ga0265339_10012280 | |||
| 1112 | Ga0265316_10036189 | |||
| 1113 | Ga0307513_10000844 | |||
| 1114 | Ga0307513_10009278 | |||
| 1115 | Ga0307513_10141255 | |||
| 1116 | Ga0307513_10148948 | |||
| 1117 | Ga0307408_100186326 | |||
| 1118 | Ga0265313_10010472 | |||
| 1119 | Ga0307508_10015950 | |||
| 1120 | Ga0307508_10075254 | |||
| 1121 | Ga0307514_10019451 | |||
| 1122 | Ga0265314_10015935 | |||
| 1123 | Ga0265342_10001543 | |||
| 1124 | Ga0307410_10207616 | |||
| 1125 | Ga0307416_100155490 | |||
| 1126 | Ga0307415_100002262 | |||
| 1127 | Ga0307415_100015205 | |||
| 1128 | Ga0307507_10001609 | |||
| 1129 | Ga0373948_0005003 | |||
| 1130 | Ga0373926_0017091 | |||
| 1131 | Ga0373928_0014237 | |||
| 1132 | Ga0373934_0015970 | |||
| 1133 | Ga0373923_0019273 | |||
| 1134 | Ga0373932_0014336 | |||
| 1135 | Ga0373936_0000520 | |||
| 1136 | Ga0373936_0009178 | |||
| 1137 | Ga0373936_0011818 | |||
| 1138 | Ga0373945_0015837 | |||
| 1139 | Ga0373953_0007178 | |||
| 1140 | Ga0373953_0012016 | |||
| 1141 | Ga0373954_0014517 | |||
| 1142 | Ga0373956_0008067 | |||
| 1143 | Ga0373957_0007362 | |||
| 1144 | Ga0373943_0002324 | |||
| 1145 | Ga0373955_0018625 | |||
| 1146 | Ga0373955_0133536 | |||
| 1147 | Ga0373962_0009641 | |||
| 1148 | Ga0373924_0012360 | |||
| 1149 | Ga0373931_0015661 | |||
| 1150 | Ga0373935_0010182 | |||
| 1151 | Ga0373935_0019113 | |||
| 1152 | Ga0373935_0088520 | |||
| 1153 | Ga0373927_0001999 | |||
| 1154 | Ga0373933_0001608 | |||
| 1155 | Ga0373933_0048793 | |||
| 1156 | Ga0373947_0042270 | |||
| 1157 | Ga0373937_0010188 | |||
| 1158 | Ga0373937_0018987 | |||
| 1159 | Ga0373937_0022186 | |||
| 1160 | Ga0373937_0065081 | |||
| 1161 | Ga0373925_0000154 | |||
| 1162 | Ga0373925_0008945 | |||
| 1163 | Ga0373925_0010888 | |||
| 1164 | Ga0373925_0012026 | |||
| 1165 | Ga0373925_0039446 | |||
| 1166 | Ga0373925_0065098 | |||
| 1167 | Ga0395898_0171752 | |||
| 1168 | Ga0436364_0316403 | |||
| 1169 | Ga0436364_0338959 | |||
| 1170 | Ga0436364_0780341 | |||
| 1171 | Ga0436364_1011209 | |||
| 1172 | Ga0436364_1307046 | |||
| 1173 | Ga0436364_1420628 | |||
| 1174 | Ga0439436_0001217 | |||
| 1175 | Ga0451837_0043982 | |||
| 1176 | Ga0451843_1130581 | |||
| 1177 | Ga0451853_1800366 | |||
| 1178 | Ga0439433_0002580 | |||
| 1179 | Ga0439457_000525 | |||
| 1180 | Ga0439464_0009754 | |||
| 1181 | Ga0466969_0002286 | |||
| 1182 | Ga0466969_0004931 | |||
| 1183 | Ga0466966_0006745 | |||
| 1184 | Ga0466966_0022325 | |||
| 1185 | Ga0466961_0030362 | |||
| 1186 | Ga0466961_0031507 | |||
| 1187 | Ga0466961_0063725 | |||
| 1188 | Ga0466961_0085572 | |||
| 1189 | Ga0466963_0047434 | |||
| 1190 | Ga0466963_0097168 | |||
| 1191 | Ga0466964_0051359 | |||
| 1192 | Ga0466971_0000019 | |||
| 1193 | Ga0466970_0016007 | |||
| 1194 | Ga0466970_0028809 | |||
| 1195 | Ga0466970_0037144 | |||
| 1196 | Ga0466970_0100239 | |||
| 1197 | Ga0466960_0013082 | |||
| 1198 | Ga0466959_0000305 | |||
| 1199 | Ga0466959_0078763 | |||
| 1200 | Ga0466959_0087210 | |||
| 1201 | Ga0466958_0003920 | |||
| 1202 | Ga0466958_0041157 | |||
| 1203 | Ga0466958_0068146 | |||
| 1204 | Ga0466958_0076120 | |||
| 1205 | Ga0466958_0106997 | |||
| 1206 | Ga0466967_0000260 | |||
| 1207 | Ga0466967_0025597 | |||
| 1208 | Ga0466967_0060605 | |||
| 1209 | Ga0495592_0001763 | |||
| 1210 | Ga0495592_0064064 | |||
| 1211 | Ga0495592_0106724 | |||
| 1212 | Ga0495603_0005306 | |||
| 1213 | Ga0495603_0006554 | |||
| 1214 | Ga0495629_0003377 | |||
| 1215 | Ga0495629_0011342 | |||
| 1216 | Ga0495629_0013094 | |||
| 1217 | Ga0495629_0017484 | |||
| 1218 | Ga0495641_0008210 | |||
| 1219 | Ga0495641_0011169 | |||
| 1220 | Ga0495641_0013810 | |||
| 1221 | Ga0495641_0056116 | |||
| 1222 | Ga0495641_0081757 | |||
| 1223 | Ga0495651_0000980 | |||
| 1224 | Ga0495651_0001034 | |||
| 1225 | Ga0495651_0007914 | |||
| 1226 | Ga0495651_0033988 | |||
| 1227 | Ga0495651_0091743 | |||
| 1228 | Ga0495653_0005729 | |||
| 1229 | Ga0495653_0029724 | |||
| 1230 | Ga0495653_0040624 | |||
| 1231 | Ga0495582_0000633 | |||
| 1232 | Ga0495582_0016998 | |||
| 1233 | Ga0495639_0003477 | |||
| 1234 | Ga0495639_0012376 | |||
| 1235 | Ga0495639_0084617 | |||
| 1236 | Ga0495662_0005078 | |||
| 1237 | Ga0495662_0011149 | |||
| 1238 | Ga0495662_0012615 | |||
| 1239 | Ga0495664_0005724 | |||
| 1240 | Ga0495585_0019998 | |||
| 1241 | Ga0495594_0004183 | |||
| 1242 | Ga0495608_0001601 | |||
| 1243 | Ga0495608_0082673 | |||
| 1244 | Ga0495618_0013662 | |||
| 1245 | Ga0495618_0019422 | |||
| 1246 | Ga0495618_0084334 | |||
| 1247 | Ga0495628_0002433 | |||
| 1248 | Ga0495628_0004920 | |||
| 1249 | Ga0495628_0053693 | |||
| 1250 | Ga0495628_0101793 | |||
| 1251 | Ga0495628_0139333 | |||
| 1252 | Ga0495630_0129748 | |||
| 1253 | Ga0495648_0049416 | |||
| 1254 | Ga0495652_0001157 | |||
| 1255 | Ga0495652_0001386 | |||
| 1256 | Ga0495652_0016682 | |||
| 1257 | Ga0495652_0025742 | |||
| 1258 | Ga0495652_0039344 | |||
| 1259 | Ga0495652_0058632 | |||
| 1260 | Ga0495665_0000862 | |||
| 1261 | Ga0495665_0030663 | |||
| 1262 | Ga0495640_0014827 | |||
| 1263 | Ga0495640_0022956 | |||
| 1264 | Ga0495640_0043895 | |||
| 1265 | Ga0495586_0025359 | |||
| 1266 | Ga0495587_0007428 | |||
| 1267 | Ga0495587_0014467 | |||
| 1268 | Ga0495587_0016460 | |||
| 1269 | Ga0495587_0034953 | |||
| 1270 | Ga0495645_0009361 | |||
| 1271 | Ga0495645_0021651 | |||
| 1272 | Ga0495622_0037712 | |||
| 1273 | Ga0495667_0008796 | |||
| 1274 | Ga0495667_0012714 | |||
| 1275 | Ga0495667_0020457 | |||
| 1276 | Ga0495667_0036915 | |||
| 1277 | Ga0495667_0118656 | |||
| 1278 | Ga0495634_0037081 | |||
| 1279 | Ga0495634_0089118 | |||
| 1280 | Ga0495625_0043201 | |||
| 1281 | Ga0495635_0001716 | |||
| 1282 | Ga0495635_0003578 | |||
| 1283 | Ga0495635_0007480 | |||
| 1284 | Ga0495635_0016986 | |||
| 1285 | Ga0495635_0182393 | |||
| 1286 | Ga0495588_0000842 | |||
| 1287 | Ga0495588_0093072 | |||
| 1288 | Ga0495657_0010651 | |||
| 1289 | Ga0495657_0026716 | |||
| 1290 | Ga0495657_0029473 | |||
| 1291 | Ga0495657_0053189 | |||
| 1292 | Ga0495599_0013517 | |||
| 1293 | Ga0495599_0021693 | |||
| 1294 | Ga0495599_0029737 | |||
| 1295 | Ga0495623_0007474 | |||
| 1296 | Ga0495623_0013683 | |||
| 1297 | Ga0495623_0018975 | |||
| 1298 | Ga0495646_0001496 | |||
| 1299 | Ga0495646_0042111 | |||
| 1300 | Ga0495646_0081948 | |||
| 1301 | Ga0495658_0021906 | |||
| 1302 | Ga0495658_0061234 | |||
| 1303 | Ga0495658_0096349 | |||
| 1304 | Ga0495613_0034997 | |||
| 1305 | Ga0495613_0047175 | |||
| 1306 | Ga0495624_0010481 | |||
| 1307 | Ga0495624_0049674 | |||
| 1308 | Ga0495600_0001701 | |||
| 1309 | Ga0495600_0011006 | |||
| 1310 | Ga0495600_0012624 | |||
| 1311 | Ga0495600_0021676 | |||
| 1312 | Ga0495600_0057696 | |||
| 1313 | Ga0495600_0099415 | |||
| 1314 | Ga0495581_0031110 | |||
| 1315 | Ga0495604_0003545 | |||
| 1316 | Ga0495604_0011923 | |||
| 1317 | Ga0495604_0015320 | |||
| 1318 | Ga0495604_0029308 | |||
| 1319 | Ga0495604_0035818 | |||
| 1320 | Ga0495604_0036815 | |||
| 1321 | Ga0495636_0000251 | |||
| 1322 | Ga0495636_0006534 | |||
| 1323 | Ga0495636_0008206 | |||
| 1324 | Ga0495674_0000343 | |||
| 1325 | Ga0495674_0018522 | |||
| 1326 | Ga0495674_0139392 | |||
| 1327 | Ga0495676_0007636 | |||
| 1328 | Ga0495676_0013313 | |||
| 1329 | Ga0495676_0030599 | |||
| 1330 | Ga0495676_0154949 | |||
| 1331 | Ga0495680_0003357 | |||
| 1332 | Ga0495680_0009875 | |||
| 1333 | Ga0495687_004799 | |||
| 1334 | Ga0495675_0036312 | |||
| 1335 | Ga0495675_0079831 | |||
| 1336 | Ga0495675_0119323 | |||
| 1337 | Ga0495685_001251 | |||
| 1338 | Ga0495685_024147 | |||
| 1339 | Ga0495684_0014256 | |||
| 1340 | Ga0495684_0021514 | |||
| 1341 | Ga0495684_0038742 | |||
| 1342 | Ga0495593_0007352 | |||
| 1343 | Ga0495593_0012702 | |||
| 1344 | Ga0495602_0002864 | |||
| 1345 | Ga0495602_0018569 | |||
| 1346 | Ga0495602_0030971 | |||
| 1347 | Ga0495602_0053661 | |||
| 1348 | Ga0495602_0097002 | |||
| 1349 | Ga0496101_0026737 | |||
| 1350 | Ga0496101_0064974 | |||
| 1351 | Ga0496102_0018202 | |||
| 1352 | Ga0496104_0003447 | |||
| 1353 | Ga0496104_0004682 | |||
| 1354 | Ga0496104_0005549 | |||
| 1355 | Ga0496104_0033555 | |||
| 1356 | Ga0496106_0006264 | |||
| 1357 | Ga0496106_0100884 | |||
| 1358 | Ga0496107_0008573 | |||
| 1359 | Ga0496108_0002997 | |||
| 1360 | Ga0496109_0017316 | |||
| 1361 | Ga0496109_0077470 | |||
| 1362 | Ga0496109_0084909 | |||
| 1363 | Ga0496109_0319787 | |||
| 1364 | Ga0496110_0029587 | |||
| 1365 | Ga0496110_0115547 | |||
| 1366 | Ga0496111_0151074 | |||
| 1367 | Ga0496111_0182085 | |||
| 1368 | Ga0496112_0009273 | |||
| 1369 | Ga0496112_0142005 | |||
| 1370 | Ga0496113_0023528 | |||
| 1371 | Ga0496113_0108275 | |||
| 1372 | Ga0496114_0081183 | |||
| 1373 | Ga0496114_0119355 | |||
| 1374 | Ga0496114_0123661 | |||
| 1375 | Ga0496114_0182536 | |||
| 1376 | Ga0496115_0003639 | |||
| 1377 | Ga0496115_0071277 | |||
| 1378 | Ga0496115_0147726 | |||
| 1379 | Ga0496123_0035154 | |||
| 1380 | Ga0496124_0015337 | |||
| 1381 | Ga0496126_0029920 | |||
| 1382 | Ga0501031_0016789 | |||
| 1383 | Ga0501031_0034742 | |||
| 1384 | Ga0501032_0014041 | |||
| 1385 | Ga0501032_0048338 | |||
| 1386 | Ga0501032_0130427 | |||
| 1387 | Ga0501033_0012072 | |||
| 1388 | Ga0501033_0073861 | |||
| 1389 | Ga0501034_0009899 | |||
| 1390 | Ga0501034_0010585 | |||
| 1391 | Ga0501034_0015792 | |||
| 1392 | Ga0501036_0006820 | |||
| 1393 | Ga0501036_0017873 | |||
| 1394 | Ga0501036_0021173 | |||
| 1395 | Ga0501037_0018099 | |||
| 1396 | Ga0501037_0051839 | |||
| 1397 | Ga0501038_0001895 | |||
| 1398 | Ga0501038_0003482 | |||
| 1399 | Ga0501038_0021847 | |||
| 1400 | Ga0501038_0022354 | |||
| 1401 | Ga0501038_0038695 | |||
| 1402 | Ga0501039_0020849 | |||
| 1403 | Ga0501039_0036129 | |||
| 1404 | Ga0501040_0003972 | |||
| 1405 | Ga0501041_0015476 | |||
| 1406 | Ga0501042_0000560 | |||
| 1407 | Ga0501042_0018687 | |||
| 1408 | Ga0501043_0000851 | |||
| 1409 | Ga0501043_0044522 | |||
| 1410 | Ga0501043_0105225 | |||
| 1411 | Ga0501047_0000133 | |||
| 1412 | Ga0501047_0006834 | |||
| 1413 | Ga0501047_0029454 | |||
| 1414 | Ga0501047_0054707 | |||
| 1415 | Ga0501047_0161205 | |||
| 1416 | Ga0501047_0188925 | |||
| 1417 | Ga0501048_0016428 | |||
| 1418 | Ga0501048_0041878 | |||
| 1419 | Ga0501070_0023617 | |||
| 1420 | Ga0501071_0007135 | |||
| 1421 | Ga0501072_0029298 | |||
| 1422 | Ga0501073_0033988 | |||
| 1423 | Ga0501073_0056032 | |||
| 1424 | Ga0501074_0029780 | |||
| 1425 | Ga0501074_0130241 | |||
| 1426 | Ga0501075_0008783 | |||
| 1427 | Ga0501076_0087837 | |||
| 1428 | Ga0501080_0054659 | |||
| 1429 | Ga0501080_0155436 | |||
| 1430 | Ga0501081_0016362 | |||
| 1431 | Ga0501083_0149042 | |||
| 1432 | Ga0501035_0002338 | |||
| 1433 | Ga0501035_0025233 | |||
| 1434 | Ga0501035_0032676 | |||
| 1435 | Ga0501044_0028457 | |||
| 1436 | Ga0501044_0062960 | |||
| 1437 | Ga0501044_0135228 | |||
| 1438 | Ga0501044_0187856 | |||
| 1439 | Ga0501044_0229967 | |||
| 1440 | Ga0501045_0078963 | |||
| 1441 | nmdc:mga03n38_27920_c1 | |||
| 1442 | nmdc:mga00v17_3506_c1 | |||
| 1443 | nmdc:mga0yw44_225239_c1 | |||
| 1444 | nmdc:mga0yw44_41214_c1 | |||
| 1445 | nmdc:mga05p37_3966_c1 | |||
| 1446 | nmdc:mga05p37_512_c1 | |||
| 1447 | nmdc:mga05p37_7461_c1 | |||
| 1448 | nmdc:mga09592_11623_c1 | |||
| 1449 | nmdc:mga09592_225_c1 | |||
| 1450 | nmdc:mga09592_4224_c1 | |||
| 1451 | nmdc:mga0qj67_82952_c1 | |||
| 1452 | nmdc:mga0qj67_8353_c1 | |||
| 1453 | nmdc:mga06r32_106_c1 | |||
| 1454 | nmdc:mga06r32_15566_c1 | |||
| 1455 | nmdc:mga06r32_27566_c1 | |||
| 1456 | nmdc:mga06r32_4348_c1 | |||
| 1457 | nmdc:mga06r32_439_c1 | |||
| 1458 | nmdc:mga08y16_20592_c1 | |||
| 1459 | nmdc:mga08y16_5966_c1 | |||
| 1460 | nmdc:mga0n895_228157_c1 | |||
| 1461 | nmdc:mga0n895_258142_c1 | |||
| 1462 | nmdc:mga0n895_9881_c1 | |||
| 1463 | nmdc:mga0rr50_169139_c1 | |||
| 1464 | nmdc:mga0rr50_45401_c1 | |||
| 1465 | nmdc:mga08x19_3519_c1 | |||
| 1466 | nmdc:mga0a205_1568_c1 | |||
| 1467 | nmdc:mga0a205_24544_c1 | |||
| 1468 | Ga0495601_0001099 | |||
| 1469 | Ga0495601_0001775 | |||
| 1470 | Ga0495601_0006811 | |||
| 1471 | Ga0495601_0030323 | |||
| 1472 | Ga0495601_0071832 | |||
| 1473 | Ga0495612_0016309 | |||
| 1474 | Ga0495612_0019844 | |||
| 1475 | Ga0495612_0026382 | |||
| 1476 | Ga0495595_0007718 | |||
| 1477 | Ga0495619_0118837 | |||
| 1478 | Ga0495619_0124942 | |||
| 1479 | Ga0500614_001375 | |||
| 1480 | Ga0500616_0000475 | |||
| 1481 | Ga0501084_0038116 | |||
| 1482 | Ga0466962_0000041 | |||
| 1483 | Ga0466962_0006779 | |||
| 1484 | Ga0530510_0003513 | |||
| 1485 | 2547410104 | |||
| 1486 | 2644539157 | |||
| 1487 | 2644539529 | |||
| 1488 | 2645721258 | |||
| 1489 | 2645724728 | |||
| 1490 | 2676494244 | |||
| 1491 | 2784589587 | |||
| 1492 | 2804845684 | |||
| 1493 | 2809233270 | |||
| 1494 | 2812356861 | |||
| 1495 | 2812362821 | |||
| 1496 | 2812479565 | |||
| 1497 | 2816426167 | |||
| 1498 | 2837272097 | |||
| 1499 | 2852640473 | |||
| 1500 | 2856745234 | |||
| 1501 | 2862286992 | |||
| 1502 | 2862514427 | |||
| 1503 | 2862707809 | |||
| 1504 | 2867350124 | |||
| 1505 | 2868093047 | |||
| 1506 | 2873154803 | |||
| 1507 | 2873321964 | |||
| 1508 | 2884695107 | |||
| 1509 | 2884997987 | |||
| 1510 | 2891401659 | |||
| 1511 | 2891560440 | |||
| 1512 | 2891567144 | |||
| 1513 | 2895431517 | |||
| 1514 | 2895446209 | |||
| 1515 | 2946069009 | |||
| 1516 | 2947227920 | |||
| 1517 | 2954002998 | |||
| 1518 | 2990046632 | |||
| 1519 | 3003001438 | |||
| 1520 | 8008487329 | |||
| 1521 | 8023626377 | |||
| 1522 | 8025416752 | |||
| 1523 | 8025483913 | |||
| 1524 | 8025526521 | |||
| 1525 | 8033690035 | |||
| 1526 | 8053948903 | |||
| 1527 | 8055071414 | |||
| 1528 | 8055174969 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bge-assembly1.cif.gz_A | helicobacter pylori atpase, hp0525, in complex with 1g2 compound | 0.7012 | 78 | 382 |
| 2oap-assembly1.cif.gz_2 | crystal structure of the archaeal secretion atpase gspe in complex with amp-pnp | 0.6978 | 14 | 430 |
| 3jvv-assembly1.cif.gz_C-2 | crystal structure of p. aeruginosa pilt with bound amp-pcp | 0.6878 | 86 | 391 |
| 3jvu-assembly1.cif.gz_C-2 | crystal structure of unliganded p. aeruginosa pilt | 0.6849 | 96 | 391 |
| 1nlz-assembly1.cif.gz_C | crystal structure of unliganded traffic atpase of the type iv secretion system of helicobacter pylori | 0.6818 | 78 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMT3_116_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8484 | 179 | 397 | 3.40.50.300 |
| 4ii7D01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8364 | 84 | 180 | 3.30.450.370 |
| af_P9WMT3_116_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8228 | 179 | 397 | 3.40.50.300 |
| 4ihqC03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8095 | 185 | 410 | 3.40.50.300 |
| af_Q8I242_11_142_1.20.120.310 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ERV/ALR sulfhydryl oxidase domain | 0.7836 | 42 | 77 | 1.20.120.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7SLZ0-F1-model_v4 | Type II/IV secretion system protein | 0.8718 | 185 | 436 |
GO:0016887
|
| AF-A0A1R4IFW8-F1-model_v4 | Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily | 0.858 | 186 | 425 |
GO:0016887
|
| AF-A0A6J7I7W1-F1-model_v4 | Unannotated protein | 0.854 | 84 | 435 |
GO:0016887
|
| AF-W7SLZ0-F1-model_v4 | Type II/IV secretion system protein | 0.8527 | 185 | 436 |
GO:0016887
|
| AF-A0A521PGK5-F1-model_v4 | CpaF family protein | 0.8516 | 186 | 411 |
GO:0016887
|