F479662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 396 | 750 | 362 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_005433|Ga0500643_005433_1326_2387 |
| Length | 353 |
| Sequence | MQPLSGLLVLDFTTLLPGPLASLMLAEAGAEVIKIERPGGEDMRHFAPAIDGESVPFAMLNRGKQVLTLDLKNQADRDKLIPLLKRADILIEQFRPGVMARLGLGYDEVRKINPKLIYCSISGYGQSGSRADEAGHDINYIGNTGVLDLQPGPLHRPVVPPVLVADIAGGSFPAVINILLALRARDQSGQGCHLDIAMTDAMFTFAWYALALGAAAKFPKSGEMWLVGSSPRYQLYPTKDGKIVACGAIEQKFWDSFVAAIGLPAEFGDDKRNPAATRDAVAKLIAAKTADEWRPLLATADCCVTIVMPLEEALRDPHFVGRGLFAHKIETASGKTIPALPVPIAPAFRRDPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 4 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 5 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 6 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 7 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 8 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 9 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 10 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 11 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 12 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 13 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 14 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 232 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0.39 |
| Isolates | 1.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.72 |
| Nodule | 0.79 |
| Rhizoplane | 5.91 |
| Rhizosphere | 86.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214939624 | 2209111006 | Bacteria | 6562 |
| 2 | ARcpr5oldR_c000195 | 3300000041 | Bacteria | 10319 |
| 3 | JGI24746J21847_1000397 | 3300001977 | Bacteria | 6455 |
| 4 | JGI24739J22299_10002770 | 3300001989 | Bacteria | 6738 |
| 5 | JGI24737J22298_10000960 | 3300001990 | Bacteria | 10240 |
| 6 | JGI24750J21931_1000172 | 3300002070 | Bacteria | 10780 |
| 7 | JGI24748J21848_1000441 | 3300002074 | Bacteria | 4612 |
| 8 | JGI24738J21930_10000223 | 3300002075 | Bacteria | 15332 |
| 9 | JGI24749J21850_1001027 | 3300002076 | Bacteria | 3965 |
| 10 | JGI24744J21845_10004694 | 3300002077 | Bacteria | 2824 |
| 11 | JGI24035J26624_1000220 | 3300002126 | Bacteria | 5227 |
| 12 | JGI25151J46595_10000155 | 3300003187 | Bacteria | 89339 |
| 13 | JGI25406J46586_10008160 | 3300003203 | Bacteria | 4756 |
| 14 | Ga0055526_1000225 | 3300003771 | Bacteria | 47943 |
| 15 | Ga0055524_1000078 | 3300003775 | Bacteria | 120745 |
| 16 | Ga0065165_1000089 | 3300005262 | Bacteria | 150859 |
| 17 | Ga0065712_10077159 | 3300005290 | Bacteria | 3540 |
| 18 | Ga0065715_10008649 | 3300005293 | Bacteria | 4878 |
| 19 | Ga0070658_10059765 | 3300005327 | Bacteria | 3104 |
| 20 | Ga0070676_10000012 | 3300005328 | Bacteria | 58061 |
| 21 | Ga0070676_10204003 | 3300005328 | Bacteria | 1298 |
| 22 | Ga0070683_100000139 | 3300005329 | Bacteria | 46987 |
| 23 | Ga0070690_100005164 | 3300005330 | Bacteria | 7309 |
| 24 | Ga0070690_100195429 | 3300005330 | Bacteria | 1405 |
| 25 | Ga0070670_100006855 | 3300005331 | Bacteria | 9652 |
| 26 | Ga0070670_100213878 | 3300005331 | Bacteria | 1676 |
| 27 | Ga0070677_10000125 | 3300005333 | Bacteria | 25491 |
| 28 | Ga0068869_100000605 | 3300005334 | Bacteria | 20215 |
| 29 | Ga0068869_100107020 | 3300005334 | Bacteria | 2123 |
| 30 | Ga0070666_10019221 | 3300005335 | Bacteria | 4407 |
| 31 | Ga0070666_10159165 | 3300005335 | Bacteria | 1578 |
| 32 | Ga0070680_100000179 | 3300005336 | Bacteria | 40975 |
| 33 | Ga0070680_100101322 | 3300005336 | Bacteria | 2390 |
| 34 | Ga0070682_100000319 | 3300005337 | Bacteria | 33197 |
| 35 | Ga0070682_100080901 | 3300005337 | Bacteria | 2102 |
| 36 | Ga0068868_100001158 | 3300005338 | Bacteria | 18075 |
| 37 | Ga0068868_100024252 | 3300005338 | Bacteria | 4601 |
| 38 | Ga0070660_100001605 | 3300005339 | Bacteria | 15534 |
| 39 | Ga0070660_100021236 | 3300005339 | Bacteria | 4785 |
| 40 | Ga0070660_100047355 | 3300005339 | Bacteria | 3299 |
| 41 | Ga0070660_100072922 | 3300005339 | Bacteria | 2683 |
| 42 | Ga0070689_100002178 | 3300005340 | Bacteria | 12687 |
| 43 | Ga0070689_100004685 | 3300005340 | Bacteria | 9267 |
| 44 | Ga0070691_10001565 | 3300005341 | Bacteria | 9871 |
| 45 | Ga0070691_10007128 | 3300005341 | Bacteria | 5124 |
| 46 | Ga0070687_100179604 | 3300005343 | Bacteria | 1267 |
| 47 | Ga0070661_100001455 | 3300005344 | Bacteria | 16432 |
| 48 | Ga0070661_100021209 | 3300005344 | Bacteria | 4636 |
| 49 | Ga0070692_10000434 | 3300005345 | Bacteria | 12695 |
| 50 | Ga0070692_10015896 | 3300005345 | Bacteria | 3569 |
| 51 | Ga0070668_100004423 | 3300005347 | Bacteria | 10433 |
| 52 | Ga0070669_100000409 | 3300005353 | Bacteria | 32911 |
| 53 | Ga0070669_100020734 | 3300005353 | Bacteria | 4696 |
| 54 | Ga0070669_100079795 | 3300005353 | Bacteria | 2434 |
| 55 | Ga0070669_100220338 | 3300005353 | Bacteria | 1500 |
| 56 | Ga0070675_100000166 | 3300005354 | Bacteria | 40573 |
| 57 | Ga0070675_100019299 | 3300005354 | Bacteria | 5430 |
| 58 | Ga0070674_100000644 | 3300005356 | Bacteria | 17586 |
| 59 | Ga0070674_100034246 | 3300005356 | Bacteria | 3390 |
| 60 | Ga0070673_100000041 | 3300005364 | Bacteria | 54096 |
| 61 | Ga0070688_100000180 | 3300005365 | Bacteria | 33887 |
| 62 | Ga0070688_100000730 | 3300005365 | Bacteria | 16219 |
| 63 | Ga0070659_100000752 | 3300005366 | Bacteria | 23551 |
| 64 | Ga0070659_100056123 | 3300005366 | Bacteria | 3105 |
| 65 | Ga0070667_100000365 | 3300005367 | Bacteria | 49335 |
| 66 | Ga0070667_100019198 | 3300005367 | Bacteria | 5668 |
| 67 | Ga0070667_100116424 | 3300005367 | Bacteria | 2321 |
| 68 | Ga0070703_10000903 | 3300005406 | Bacteria | 9460 |
| 69 | Ga0070709_10003137 | 3300005434 | Bacteria | 8867 |
| 70 | Ga0070709_10025535 | 3300005434 | Bacteria | 3492 |
| 71 | Ga0070709_10110170 | 3300005434 | Bacteria | 1849 |
| 72 | Ga0070714_100009592 | 3300005435 | Bacteria | 7619 |
| 73 | Ga0070714_100048797 | 3300005435 | Bacteria | 3601 |
| 74 | Ga0070714_100175957 | 3300005435 | Bacteria | 1944 |
| 75 | Ga0070713_100034309 | 3300005436 | Bacteria | 4075 |
| 76 | Ga0070710_10024251 | 3300005437 | Bacteria | 3198 |
| 77 | Ga0070710_10053343 | 3300005437 | Bacteria | 2277 |
| 78 | Ga0070701_10000493 | 3300005438 | Bacteria | 13517 |
| 79 | Ga0070711_100030206 | 3300005439 | Bacteria | 3585 |
| 80 | Ga0070711_100048418 | 3300005439 | Bacteria | 2906 |
| 81 | Ga0070705_100232913 | 3300005440 | Bacteria | 1283 |
| 82 | Ga0070700_100000467 | 3300005441 | Bacteria | 20231 |
| 83 | Ga0070694_100000065 | 3300005444 | Bacteria | 49515 |
| 84 | Ga0070694_100240852 | 3300005444 | Bacteria | 1364 |
| 85 | Ga0070663_100000473 | 3300005455 | Bacteria | 21137 |
| 86 | Ga0070663_100056324 | 3300005455 | Bacteria | 2816 |
| 87 | Ga0070663_100325352 | 3300005455 | Bacteria | 1237 |
| 88 | Ga0070678_100000091 | 3300005456 | Bacteria | 34559 |
| 89 | Ga0070662_100022629 | 3300005457 | Bacteria | 4305 |
| 90 | Ga0070662_100023595 | 3300005457 | Bacteria | 4227 |
| 91 | Ga0070681_10135990 | 3300005458 | Bacteria | 2388 |
| 92 | Ga0068867_100001090 | 3300005459 | Bacteria | 18551 |
| 93 | Ga0068867_100020555 | 3300005459 | Bacteria | 4705 |
| 94 | Ga0070685_10001731 | 3300005466 | Bacteria | 11442 |
| 95 | Ga0070685_10099410 | 3300005466 | Bacteria | 1774 |
| 96 | Ga0070699_100356833 | 3300005518 | Bacteria | 1317 |
| 97 | Ga0070679_100015891 | 3300005530 | Bacteria | 7244 |
| 98 | Ga0070679_100055203 | 3300005530 | Bacteria | 3956 |
| 99 | Ga0070679_100071862 | 3300005530 | Bacteria | 3452 |
| 100 | Ga0070679_100079573 | 3300005530 | Bacteria | 3267 |
| 101 | Ga0070679_100162727 | 3300005530 | Bacteria | 2205 |
| 102 | Ga0070684_100000219 | 3300005535 | Bacteria | 39995 |
| 103 | Ga0070684_100132421 | 3300005535 | Bacteria | 2249 |
| 104 | Ga0070684_100198285 | 3300005535 | Bacteria | 1828 |
| 105 | Ga0068853_100000600 | 3300005539 | Bacteria | 24713 |
| 106 | Ga0068853_100037517 | 3300005539 | Bacteria | 4123 |
| 107 | Ga0068853_100267372 | 3300005539 | Bacteria | 1574 |
| 108 | Ga0070672_100000019 | 3300005543 | Bacteria | 69855 |
| 109 | Ga0070686_100000318 | 3300005544 | Bacteria | 31671 |
| 110 | Ga0070686_100013377 | 3300005544 | Bacteria | 4697 |
| 111 | Ga0070686_100015710 | 3300005544 | Bacteria | 4391 |
| 112 | Ga0070695_100000474 | 3300005545 | Bacteria | 20848 |
| 113 | Ga0070695_100006777 | 3300005545 | Bacteria | 6781 |
| 114 | Ga0070696_100029045 | 3300005546 | Bacteria | 3775 |
| 115 | Ga0070696_100041201 | 3300005546 | Bacteria | 3190 |
| 116 | Ga0070665_100010015 | 3300005548 | Bacteria | 9588 |
| 117 | Ga0070704_100000252 | 3300005549 | Bacteria | 23218 |
| 118 | Ga0068855_100012274 | 3300005563 | Bacteria | 10352 |
| 119 | Ga0068855_100019218 | 3300005563 | Bacteria | 8212 |
| 120 | Ga0068855_100259502 | 3300005563 | Bacteria | 1936 |
| 121 | Ga0070664_100000819 | 3300005564 | Bacteria | 23927 |
| 122 | Ga0070664_100080238 | 3300005564 | Bacteria | 2810 |
| 123 | Ga0070664_100127997 | 3300005564 | Bacteria | 2229 |
| 124 | Ga0068857_100000768 | 3300005577 | Bacteria | 23872 |
| 125 | Ga0068857_100233957 | 3300005577 | Bacteria | 1681 |
| 126 | Ga0068854_100000179 | 3300005578 | Bacteria | 43176 |
| 127 | Ga0068854_100114473 | 3300005578 | Bacteria | 2039 |
| 128 | Ga0068856_100002295 | 3300005614 | Bacteria | 19718 |
| 129 | Ga0068856_100097861 | 3300005614 | Bacteria | 2924 |
| 130 | Ga0068856_100140566 | 3300005614 | Bacteria | 2421 |
| 131 | Ga0070702_100000898 | 3300005615 | Bacteria | 11591 |
| 132 | Ga0068852_100001992 | 3300005616 | Bacteria | 13920 |
| 133 | Ga0068852_100291384 | 3300005616 | Bacteria | 1577 |
| 134 | Ga0068852_100443617 | 3300005616 | Bacteria | 1284 |
| 135 | Ga0068859_100001870 | 3300005617 | Bacteria | 21434 |
| 136 | Ga0068864_100000429 | 3300005618 | Bacteria | 36391 |
| 137 | Ga0068864_100201999 | 3300005618 | Bacteria | 1826 |
| 138 | Ga0068866_10000461 | 3300005718 | Bacteria | 18602 |
| 139 | Ga0068861_100000169 | 3300005719 | Bacteria | 34559 |
| 140 | Ga0068870_10000586 | 3300005840 | Bacteria | 13817 |
| 141 | Ga0068863_100000381 | 3300005841 | Bacteria | 45003 |
| 142 | Ga0068858_100009197 | 3300005842 | Bacteria | 9441 |
| 143 | Ga0068858_100081595 | 3300005842 | Bacteria | 3006 |
| 144 | Ga0068860_100001472 | 3300005843 | Bacteria | 25432 |
| 145 | Ga0068860_100028934 | 3300005843 | Bacteria | 5331 |
| 146 | Ga0068860_100104941 | 3300005843 | Bacteria | 2698 |
| 147 | Ga0068862_100001886 | 3300005844 | Bacteria | 19006 |
| 148 | Ga0068862_100003346 | 3300005844 | Bacteria | 13839 |
| 149 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 150 | Ga0081539_10000800 | 3300005985 | Bacteria | 61179 |
| 151 | Ga0070717_10000199 | 3300006028 | Bacteria | 41940 |
| 152 | Ga0075368_10007349 | 3300006042 | Bacteria | 3884 |
| 153 | Ga0075432_10000873 | 3300006058 | Bacteria | 9497 |
| 154 | Ga0075432_10040078 | 3300006058 | Bacteria | 1634 |
| 155 | Ga0070715_10053985 | 3300006163 | Bacteria | 1739 |
| 156 | Ga0070716_100015201 | 3300006173 | Bacteria | 3950 |
| 157 | Ga0070716_100063466 | 3300006173 | Bacteria | 2145 |
| 158 | Ga0070712_100329784 | 3300006175 | Bacteria | 1243 |
| 159 | Ga0075367_10033854 | 3300006178 | Bacteria | 2948 |
| 160 | Ga0075369_10063403 | 3300006186 | Bacteria | 1617 |
| 161 | Ga0097621_100001234 | 3300006237 | Bacteria | 17707 |
| 162 | Ga0068871_100000068 | 3300006358 | Bacteria | 57531 |
| 163 | Ga0068871_100081861 | 3300006358 | Bacteria | 2675 |
| 164 | Ga0075430_100004696 | 3300006846 | Bacteria | 11490 |
| 165 | Ga0075431_100005522 | 3300006847 | Bacteria | 12483 |
| 166 | Ga0075431_100006639 | 3300006847 | Bacteria | 11490 |
| 167 | Ga0075433_10001599 | 3300006852 | Bacteria | 16784 |
| 168 | Ga0075433_10013425 | 3300006852 | Bacteria | 6660 |
| 169 | Ga0075434_100000576 | 3300006871 | Bacteria | 28251 |
| 170 | Ga0075434_100001666 | 3300006871 | Bacteria | 18944 |
| 171 | Ga0075429_100013193 | 3300006880 | Bacteria | 7170 |
| 172 | Ga0068865_100015742 | 3300006881 | Bacteria | 4826 |
| 173 | Ga0075436_100098484 | 3300006914 | Bacteria | 2035 |
| 174 | Ga0075436_100222644 | 3300006914 | Bacteria | 1339 |
| 175 | Ga0097620_100001870 | 3300006931 | Bacteria | 21434 |
| 176 | Ga0075435_100002716 | 3300007076 | Bacteria | 11816 |
| 177 | Ga0075435_100042109 | 3300007076 | Bacteria | 3652 |
| 178 | Ga0075435_100067418 | 3300007076 | Bacteria | 2914 |
| 179 | Ga0105240_10023458 | 3300009093 | Bacteria | 8157 |
| 180 | Ga0111539_10000503 | 3300009094 | Bacteria | 49808 |
| 181 | Ga0111539_10003417 | 3300009094 | Bacteria | 20918 |
| 182 | Ga0111539_10175783 | 3300009094 | Bacteria | 2501 |
| 183 | Ga0105245_10000780 | 3300009098 | Bacteria | 28901 |
| 184 | Ga0105245_10078335 | 3300009098 | Bacteria | 3015 |
| 185 | Ga0105247_10038234 | 3300009101 | Bacteria | 2929 |
| 186 | Ga0105247_10241738 | 3300009101 | Bacteria | 1230 |
| 187 | Ga0114129_10013874 | 3300009147 | Bacteria | 11481 |
| 188 | Ga0114129_10023827 | 3300009147 | Bacteria | 8676 |
| 189 | Ga0114129_10049593 | 3300009147 | Bacteria | 5898 |
| 190 | Ga0114129_10169964 | 3300009147 | Bacteria | 2973 |
| 191 | Ga0105243_10001083 | 3300009148 | Bacteria | 24917 |
| 192 | Ga0105243_10232362 | 3300009148 | Bacteria | 1637 |
| 193 | Ga0105241_10000760 | 3300009174 | Bacteria | 24503 |
| 194 | Ga0105241_10129672 | 3300009174 | Bacteria | 2040 |
| 195 | Ga0105242_10006332 | 3300009176 | Bacteria | 9118 |
| 196 | Ga0105242_10030536 | 3300009176 | Bacteria | 4303 |
| 197 | Ga0105242_10072061 | 3300009176 | Bacteria | 2868 |
| 198 | Ga0105248_10011305 | 3300009177 | Bacteria | 9844 |
| 199 | Ga0105248_10168883 | 3300009177 | Bacteria | 2465 |
| 200 | Ga0105237_10007890 | 3300009545 | Bacteria | 11599 |
| 201 | Ga0105237_10064505 | 3300009545 | Bacteria | 3659 |
| 202 | Ga0105237_10173560 | 3300009545 | Bacteria | 2156 |
| 203 | Ga0105238_10035142 | 3300009551 | Bacteria | 5096 |
| 204 | Ga0105238_10091855 | 3300009551 | Bacteria | 3023 |
| 205 | Ga0105249_10002196 | 3300009553 | Bacteria | 16907 |
| 206 | Ga0105249_10017908 | 3300009553 | Bacteria | 6295 |
| 207 | Ga0105249_10362518 | 3300009553 | Bacteria | 1471 |
| 208 | Ga0105239_10002791 | 3300010375 | Bacteria | 21868 |
| 209 | Ga0105239_10003820 | 3300010375 | Bacteria | 18300 |
| 210 | Ga0105239_10419325 | 3300010375 | Bacteria | 1516 |
| 211 | Ga0105246_10000061 | 3300011119 | Bacteria | 44338 |
| 212 | Ga0105246_10032648 | 3300011119 | Bacteria | 3454 |
| 213 | Ga0157373_10084995 | 3300013100 | Bacteria | 2230 |
| 214 | Ga0157373_10110205 | 3300013100 | Bacteria | 1935 |
| 215 | Ga0157371_10035739 | 3300013102 | Bacteria | 3559 |
| 216 | Ga0157371_10068201 | 3300013102 | Bacteria | 2517 |
| 217 | Ga0157371_10141143 | 3300013102 | Bacteria | 1716 |
| 218 | Ga0157370_10102731 | 3300013104 | Bacteria | 2676 |
| 219 | Ga0157370_10118954 | 3300013104 | Bacteria | 2467 |
| 220 | Ga0157370_10181509 | 3300013104 | Bacteria | 1955 |
| 221 | Ga0171462_1046 | 3300013250 | Bacteria | 49873 |
| 222 | Ga0157374_10001691 | 3300013296 | Bacteria | 18474 |
| 223 | Ga0157378_10001445 | 3300013297 | Bacteria | 21386 |
| 224 | Ga0163162_10000790 | 3300013306 | Bacteria | 29412 |
| 225 | Ga0163162_10018394 | 3300013306 | Bacteria | 6847 |
| 226 | Ga0157372_10009037 | 3300013307 | Bacteria | 10590 |
| 227 | Ga0157375_10000468 | 3300013308 | Bacteria | 36848 |
| 228 | Ga0163163_10001508 | 3300014325 | Bacteria | 19688 |
| 229 | Ga0163163_10184099 | 3300014325 | Bacteria | 2136 |
| 230 | Ga0157380_10002913 | 3300014326 | Bacteria | 11638 |
| 231 | Ga0157380_10255509 | 3300014326 | Bacteria | 1589 |
| 232 | Ga0157377_10000276 | 3300014745 | Bacteria | 24762 |
| 233 | Ga0157379_10002285 | 3300014968 | Bacteria | 15975 |
| 234 | Ga0157379_10026464 | 3300014968 | Bacteria | 5164 |
| 235 | Ga0157379_10138607 | 3300014968 | Bacteria | 2193 |
| 236 | Ga0157376_10000692 | 3300014969 | Bacteria | 21811 |
| 237 | Ga0157376_10043172 | 3300014969 | Bacteria | 3699 |
| 238 | Ga0157376_10250041 | 3300014969 | Bacteria | 1655 |
| 239 | Ga0163161_10000384 | 3300017792 | Bacteria | 37040 |
| 240 | Ga0163161_10079048 | 3300017792 | Bacteria | 2418 |
| 241 | Ga0206356_11266497 | 3300020070 | Bacteria | 1236 |
| 242 | Ga0206353_10547365 | 3300020082 | Bacteria | 3464 |
| 243 | Ga0206353_11680947 | 3300020082 | Bacteria | 3468 |
| 244 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 245 | Ga0207666_1000097 | 3300025271 | Bacteria | 13853 |
| 246 | Ga0209130_1000087 | 3300025284 | Bacteria | 155407 |
| 247 | Ga0209675_1001209 | 3300025291 | Bacteria | 15665 |
| 248 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 249 | Ga0209025_1003588 | 3300025294 | Bacteria | 14488 |
| 250 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 251 | Ga0209564_1000187 | 3300025295 | Bacteria | 146950 |
| 252 | Ga0209256_1000055 | 3300025299 | Bacteria | 295530 |
| 253 | Ga0209256_1000146 | 3300025299 | Bacteria | 149440 |
| 254 | Ga0207426_1003682 | 3300025302 | Bacteria | 8045 |
| 255 | Ga0207697_10000550 | 3300025315 | Bacteria | 21243 |
| 256 | Ga0207653_10002301 | 3300025885 | Bacteria | 6096 |
| 257 | Ga0207682_10000088 | 3300025893 | Bacteria | 41732 |
| 258 | Ga0207682_10001441 | 3300025893 | Bacteria | 10974 |
| 259 | Ga0207692_10030999 | 3300025898 | Bacteria | 2556 |
| 260 | Ga0207642_10000926 | 3300025899 | Bacteria | 9202 |
| 261 | Ga0207710_10024509 | 3300025900 | Bacteria | 2599 |
| 262 | Ga0207710_10032633 | 3300025900 | Bacteria | 2281 |
| 263 | Ga0207688_10001203 | 3300025901 | Bacteria | 13390 |
| 264 | Ga0207688_10023663 | 3300025901 | Bacteria | 3366 |
| 265 | Ga0207680_10013156 | 3300025903 | Bacteria | 4241 |
| 266 | Ga0207680_10015527 | 3300025903 | Bacteria | 3975 |
| 267 | Ga0207647_10002714 | 3300025904 | Bacteria | 13370 |
| 268 | Ga0207699_10002088 | 3300025906 | Bacteria | 9440 |
| 269 | Ga0207645_10000140 | 3300025907 | Bacteria | 55845 |
| 270 | Ga0207645_10136971 | 3300025907 | Bacteria | 1594 |
| 271 | Ga0207643_10000083 | 3300025908 | Bacteria | 62116 |
| 272 | Ga0207705_10044728 | 3300025909 | Bacteria | 3182 |
| 273 | Ga0207654_10063367 | 3300025911 | Bacteria | 2169 |
| 274 | Ga0207707_10004967 | 3300025912 | Bacteria | 11688 |
| 275 | Ga0207707_10013826 | 3300025912 | Bacteria | 7038 |
| 276 | Ga0207707_10069584 | 3300025912 | Bacteria | 3067 |
| 277 | Ga0207707_10196931 | 3300025912 | Bacteria | 1757 |
| 278 | Ga0207695_10088621 | 3300025913 | Bacteria | 3114 |
| 279 | Ga0207695_10273466 | 3300025913 | Bacteria | 1584 |
| 280 | Ga0207671_10074488 | 3300025914 | Bacteria | 2537 |
| 281 | Ga0207671_10090131 | 3300025914 | Bacteria | 2309 |
| 282 | Ga0207693_10007583 | 3300025915 | Bacteria | 8914 |
| 283 | Ga0207693_10009124 | 3300025915 | Bacteria | 8097 |
| 284 | Ga0207663_10009641 | 3300025916 | Bacteria | 5109 |
| 285 | Ga0207663_10171384 | 3300025916 | Bacteria | 1542 |
| 286 | Ga0207660_10000073 | 3300025917 | Bacteria | 51871 |
| 287 | Ga0207660_10026920 | 3300025917 | Bacteria | 3919 |
| 288 | Ga0207660_10080492 | 3300025917 | Bacteria | 2392 |
| 289 | Ga0207662_10000964 | 3300025918 | Bacteria | 13368 |
| 290 | Ga0207662_10013126 | 3300025918 | Bacteria | 4629 |
| 291 | Ga0207662_10024056 | 3300025918 | Bacteria | 3505 |
| 292 | Ga0207662_10040343 | 3300025918 | Bacteria | 2743 |
| 293 | Ga0207657_10005395 | 3300025919 | Bacteria | 13362 |
| 294 | Ga0207657_10067345 | 3300025919 | Bacteria | 3045 |
| 295 | Ga0207657_10158490 | 3300025919 | Bacteria | 1839 |
| 296 | Ga0207649_10000450 | 3300025920 | Bacteria | 29604 |
| 297 | Ga0207649_10049051 | 3300025920 | Bacteria | 2605 |
| 298 | Ga0207652_10007770 | 3300025921 | Bacteria | 8617 |
| 299 | Ga0207652_10025311 | 3300025921 | Bacteria | 4932 |
| 300 | Ga0207652_10118848 | 3300025921 | Bacteria | 2350 |
| 301 | Ga0207652_10130371 | 3300025921 | Bacteria | 2242 |
| 302 | Ga0207681_10000097 | 3300025923 | Bacteria | 73836 |
| 303 | Ga0207694_10050082 | 3300025924 | Bacteria | 3233 |
| 304 | Ga0207694_10056347 | 3300025924 | Unclassified | 3052 |
| 305 | Ga0207650_10041696 | 3300025925 | Bacteria | 3365 |
| 306 | Ga0207659_10000092 | 3300025926 | Bacteria | 52642 |
| 307 | Ga0207659_10207751 | 3300025926 | Bacteria | 1567 |
| 308 | Ga0207687_10016821 | 3300025927 | Bacteria | 4808 |
| 309 | Ga0207700_10066434 | 3300025928 | Bacteria | 2757 |
| 310 | Ga0207664_10005574 | 3300025929 | Bacteria | 8618 |
| 311 | Ga0207644_10005083 | 3300025931 | Bacteria | 8591 |
| 312 | Ga0207644_10007663 | 3300025931 | Bacteria | 7040 |
| 313 | Ga0207644_10148161 | 3300025931 | Bacteria | 1814 |
| 314 | Ga0207690_10002606 | 3300025932 | Bacteria | 10873 |
| 315 | Ga0207690_10147219 | 3300025932 | Bacteria | 1742 |
| 316 | Ga0207706_10004310 | 3300025933 | Bacteria | 13370 |
| 317 | Ga0207706_10008823 | 3300025933 | Bacteria | 9280 |
| 318 | Ga0207706_10046615 | 3300025933 | Bacteria | 3838 |
| 319 | Ga0207686_10000796 | 3300025934 | Bacteria | 19364 |
| 320 | Ga0207686_10027960 | 3300025934 | Bacteria | 3309 |
| 321 | Ga0207709_10000362 | 3300025935 | Bacteria | 45886 |
| 322 | Ga0207709_10103109 | 3300025935 | Bacteria | 1890 |
| 323 | Ga0207670_10004868 | 3300025936 | Bacteria | 7299 |
| 324 | Ga0207669_10000350 | 3300025937 | Bacteria | 20966 |
| 325 | Ga0207669_10040659 | 3300025937 | Bacteria | 2699 |
| 326 | Ga0207704_10000479 | 3300025938 | Bacteria | 17812 |
| 327 | Ga0207665_10001702 | 3300025939 | Bacteria | 14793 |
| 328 | Ga0207691_10000283 | 3300025940 | Bacteria | 50040 |
| 329 | Ga0207691_10008505 | 3300025940 | Bacteria | 9857 |
| 330 | Ga0207691_10060889 | 3300025940 | Bacteria | 3430 |
| 331 | Ga0207711_10009675 | 3300025941 | Bacteria | 8032 |
| 332 | Ga0207711_10078578 | 3300025941 | Bacteria | 2879 |
| 333 | Ga0207689_10000085 | 3300025942 | Bacteria | 75467 |
| 334 | Ga0207661_10000464 | 3300025944 | Bacteria | 26194 |
| 335 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 336 | Ga0207679_10117323 | 3300025945 | Bacteria | 2112 |
| 337 | Ga0207667_10012374 | 3300025949 | Bacteria | 9836 |
| 338 | Ga0207667_10018715 | 3300025949 | Bacteria | 7758 |
| 339 | Ga0207667_10041317 | 3300025949 | Bacteria | 4905 |
| 340 | Ga0207651_10000088 | 3300025960 | Bacteria | 40879 |
| 341 | Ga0207712_10010820 | 3300025961 | Bacteria | 5805 |
| 342 | Ga0207668_10000114 | 3300025972 | Bacteria | 57323 |
| 343 | Ga0207640_10005820 | 3300025981 | Bacteria | 6723 |
| 344 | Ga0207640_10019689 | 3300025981 | Bacteria | 3992 |
| 345 | Ga0207640_10041774 | 3300025981 | Bacteria | 2919 |
| 346 | Ga0207640_10087152 | 3300025981 | Bacteria | 2151 |
| 347 | Ga0207658_10002853 | 3300025986 | Bacteria | 12371 |
| 348 | Ga0207677_10009721 | 3300026023 | Bacteria | 5417 |
| 349 | Ga0207677_10242565 | 3300026023 | Bacteria | 1459 |
| 350 | Ga0207703_10000983 | 3300026035 | Bacteria | 27443 |
| 351 | Ga0207703_10048789 | 3300026035 | Unclassified | 3419 |
| 352 | Ga0207639_10000305 | 3300026041 | Bacteria | 34869 |
| 353 | Ga0207678_10000125 | 3300026067 | Bacteria | 63817 |
| 354 | Ga0207678_10016358 | 3300026067 | Bacteria | 6513 |
| 355 | Ga0207678_10032906 | 3300026067 | Bacteria | 4518 |
| 356 | Ga0207678_10132722 | 3300026067 | Bacteria | 2125 |
| 357 | Ga0207708_10000187 | 3300026075 | Bacteria | 48792 |
| 358 | Ga0207702_10005437 | 3300026078 | Bacteria | 11146 |
| 359 | Ga0207702_10050201 | 3300026078 | Bacteria | 3522 |
| 360 | Ga0207702_10132745 | 3300026078 | Bacteria | 2242 |
| 361 | Ga0207641_10002129 | 3300026088 | Bacteria | 18722 |
| 362 | Ga0207641_10037602 | 3300026088 | Bacteria | 4043 |
| 363 | Ga0207648_10002168 | 3300026089 | Bacteria | 21342 |
| 364 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 365 | Ga0207676_10042253 | 3300026095 | Bacteria | 3505 |
| 366 | Ga0207676_10051115 | 3300026095 | Bacteria | 3225 |
| 367 | Ga0207674_10002501 | 3300026116 | Bacteria | 23186 |
| 368 | Ga0207675_100004556 | 3300026118 | Bacteria | 13370 |
| 369 | Ga0207683_10000014 | 3300026121 | Bacteria | 128817 |
| 370 | Ga0207683_10003999 | 3300026121 | Bacteria | 12769 |
| 371 | Ga0207683_10004104 | 3300026121 | Bacteria | 12582 |
| 372 | Ga0207683_10012783 | 3300026121 | Bacteria | 7164 |
| 373 | Ga0207698_10001242 | 3300026142 | Bacteria | 14899 |
| 374 | Ga0207698_10031704 | 3300026142 | Bacteria | 3819 |
| 375 | Ga0207698_10273137 | 3300026142 | Bacteria | 1559 |
| 376 | Ga0209966_1001229 | 3300027695 | Bacteria | 4561 |
| 377 | Ga0209998_10000361 | 3300027717 | Bacteria | 13355 |
| 378 | Ga0209998_10002431 | 3300027717 | Bacteria | 4276 |
| 379 | Ga0209974_10002250 | 3300027876 | Bacteria | 7018 |
| 380 | Ga0209974_10007253 | 3300027876 | Bacteria | 3825 |
| 381 | Ga0207428_10000114 | 3300027907 | Bacteria | 109533 |
| 382 | Ga0207428_10000467 | 3300027907 | Bacteria | 48756 |
| 383 | Ga0207428_10005035 | 3300027907 | Bacteria | 12415 |
| 384 | Ga0268266_10027346 | 3300028379 | Bacteria | 4850 |
| 385 | Ga0268265_10001371 | 3300028380 | Bacteria | 20700 |
| 386 | Ga0268265_10007749 | 3300028380 | Bacteria | 7248 |
| 387 | Ga0268264_10000469 | 3300028381 | Bacteria | 54801 |
| 388 | Ga0268264_10016375 | 3300028381 | Bacteria | 6070 |
| 389 | Ga0265330_10049181 | 3300031235 | Bacteria | 1853 |
| 390 | Ga0265320_10021699 | 3300031240 | Bacteria | 3449 |
| 391 | Ga0265325_10000423 | 3300031241 | Bacteria | 30296 |
| 392 | Ga0265325_10012823 | 3300031241 | Bacteria | 4783 |
| 393 | Ga0265325_10018415 | 3300031241 | Bacteria | 3873 |
| 394 | Ga0265325_10094477 | 3300031241 | Bacteria | 1470 |
| 395 | Ga0265329_10011615 | 3300031242 | Bacteria | 3195 |
| 396 | Ga0265339_10003373 | 3300031249 | Bacteria | 11182 |
| 397 | Ga0265339_10045049 | 3300031249 | Bacteria | 2429 |
| 398 | Ga0265316_10119807 | 3300031344 | Bacteria | 1988 |
| 399 | Ga0265313_10000115 | 3300031595 | Bacteria | 81365 |
| 400 | Ga0265313_10002944 | 3300031595 | Bacteria | 14219 |
| 401 | Ga0265313_10011952 | 3300031595 | Bacteria | 5353 |
| 402 | Ga0265313_10027921 | 3300031595 | Bacteria | 2945 |
| 403 | Ga0265314_10005122 | 3300031711 | Bacteria | 11925 |
| 404 | Ga0265314_10164120 | 3300031711 | Bacteria | 1348 |
| 405 | Ga0265342_10004840 | 3300031712 | Bacteria | 10435 |
| 406 | Ga0265342_10056748 | 3300031712 | Bacteria | 2320 |
| 407 | Ga0307406_10226106 | 3300031901 | Bacteria | 1394 |
| 408 | Ga0373930_0000138 | 3300034816 | Bacteria | 8159 |
| 409 | Ga0373950_0000569 | 3300034818 | Bacteria | 4528 |
| 410 | Ga0373950_0009212 | 3300034818 | Bacteria | 1570 |
| 411 | Ga0373938_0000547 | 3300034957 | Bacteria | 6072 |
| 412 | Ga0373938_0000639 | 3300034957 | Bacteria | 5630 |
| 413 | Ga0373928_0003248 | 3300035084 | Bacteria | 3116 |
| 414 | Ga0373929_0000455 | 3300035085 | Bacteria | 7775 |
| 415 | Ga0373929_0005461 | 3300035085 | Unclassified | 2288 |
| 416 | Ga0373940_0003655 | 3300035088 | Bacteria | 3164 |
| 417 | Ga0373940_0016340 | 3300035088 | Bacteria | 1837 |
| 418 | Ga0373949_0001506 | 3300035090 | Bacteria | 6612 |
| 419 | Ga0373951_0002818 | 3300035091 | Bacteria | 4331 |
| 420 | Ga0373951_0036704 | 3300035091 | Bacteria | 1170 |
| 421 | Ga0373952_0000029 | 3300035092 | Bacteria | 16517 |
| 422 | Ga0373952_0001129 | 3300035092 | Bacteria | 4875 |
| 423 | Ga0373932_0000468 | 3300035112 | Bacteria | 12380 |
| 424 | Ga0373932_0004542 | 3300035112 | Bacteria | 3276 |
| 425 | Ga0373936_0013398 | 3300035113 | Bacteria | 3130 |
| 426 | Ga0373939_0000339 | 3300035114 | Bacteria | 11943 |
| 427 | Ga0373939_0028144 | 3300035114 | Bacteria | 1597 |
| 428 | Ga0373939_0036478 | 3300035114 | Bacteria | 1454 |
| 429 | Ga0373941_0001871 | 3300035115 | Bacteria | 4550 |
| 430 | Ga0373941_0002209 | 3300035115 | Bacteria | 4256 |
| 431 | Ga0373945_0004333 | 3300035116 | Bacteria | 4507 |
| 432 | Ga0373945_0030379 | 3300035116 | Bacteria | 1904 |
| 433 | Ga0373953_0016093 | 3300035117 | Bacteria | 2725 |
| 434 | Ga0373953_0025007 | 3300035117 | Bacteria | 2276 |
| 435 | Ga0373953_0033246 | 3300035117 | Bacteria | 2016 |
| 436 | Ga0373954_0002030 | 3300035118 | Bacteria | 8412 |
| 437 | Ga0373954_0033972 | 3300035118 | Bacteria | 2360 |
| 438 | Ga0373956_0006309 | 3300035119 | Bacteria | 4747 |
| 439 | Ga0373957_0007402 | 3300035120 | Bacteria | 3512 |
| 440 | Ga0373960_0000611 | 3300035121 | Bacteria | 7314 |
| 441 | Ga0373943_0031766 | 3300035170 | Bacteria | 2506 |
| 442 | Ga0373946_0020116 | 3300035171 | Bacteria | 2577 |
| 443 | Ga0373946_0102582 | 3300035171 | Unclassified | 1284 |
| 444 | Ga0373955_0001269 | 3300035172 | Bacteria | 10731 |
| 445 | Ga0373955_0001523 | 3300035172 | Bacteria | 9899 |
| 446 | Ga0373955_0005294 | 3300035172 | Bacteria | 5792 |
| 447 | Ga0373955_0019290 | 3300035172 | Bacteria | 3405 |
| 448 | Ga0373942_0011321 | 3300035207 | Bacteria | 2114 |
| 449 | Ga0373961_0013171 | 3300035241 | Bacteria | 2080 |
| 450 | Ga0373962_0001530 | 3300035242 | Bacteria | 5467 |
| 451 | Ga0373962_0017701 | 3300035242 | Bacteria | 1848 |
| 452 | Ga0373931_0000169 | 3300035691 | Bacteria | 28308 |
| 453 | Ga0373931_0151906 | 3300035691 | Bacteria | 1350 |
| 454 | Ga0373935_0011709 | 3300035692 | Bacteria | 5268 |
| 455 | Ga0373927_0022055 | 3300035695 | Bacteria | 4173 |
| 456 | Ga0373927_0038796 | 3300035695 | Bacteria | 3092 |
| 457 | Ga0373933_0001124 | 3300035724 | Bacteria | 15927 |
| 458 | Ga0373933_0052936 | 3300035724 | Bacteria | 2430 |
| 459 | Ga0373947_0005580 | 3300035725 | Bacteria | 7335 |
| 460 | Ga0373947_0036069 | 3300035725 | Bacteria | 2930 |
| 461 | Ga0373947_0048752 | 3300035725 | Unclassified | 2542 |
| 462 | Ga0373937_0004918 | 3300036401 | Bacteria | 11357 |
| 463 | Ga0373937_0007509 | 3300036401 | Bacteria | 9436 |
| 464 | Ga0373937_0012121 | 3300036401 | Bacteria | 7568 |
| 465 | Ga0373937_0111440 | 3300036401 | Bacteria | 2545 |
| 466 | Ga0373937_0130016 | 3300036401 | Bacteria | 2351 |
| 467 | Ga0373925_0009626 | 3300037068 | Bacteria | 7042 |
| 468 | Ga0373925_0049020 | 3300037068 | Bacteria | 3147 |
| 469 | Ga0436364_0309649 | 3300037853 | Bacteria | 36034 |
| 470 | Ga0436365_0418355 | 3300039437 | Bacteria | 2194 |
| 471 | Ga0436365_1126455 | 3300039437 | Bacteria | 19004 |
| 472 | Ga0436365_1741712 | 3300039437 | Bacteria | 4479 |
| 473 | Ga0466959_0137082 | 3300045049 | Bacteria | 1732 |
| 474 | Ga0495592_0020065 | 3300046454 | Bacteria | 5081 |
| 475 | Ga0495592_0024541 | 3300046454 | Bacteria | 4582 |
| 476 | Ga0495603_0007829 | 3300046455 | Bacteria | 6441 |
| 477 | Ga0495603_0012902 | 3300046455 | Bacteria | 5052 |
| 478 | Ga0495591_031376 | 3300046458 | Bacteria | 1595 |
| 479 | Ga0495629_0000535 | 3300046459 | Bacteria | 31312 |
| 480 | Ga0495638_0003352 | 3300046460 | Bacteria | 12638 |
| 481 | Ga0495641_0025043 | 3300046461 | Bacteria | 2932 |
| 482 | Ga0495641_0093980 | 3300046461 | Bacteria | 1339 |
| 483 | Ga0495653_0008326 | 3300046463 | Bacteria | 8500 |
| 484 | Ga0495653_0038924 | 3300046463 | Bacteria | 3729 |
| 485 | Ga0495653_0059893 | 3300046463 | Bacteria | 2887 |
| 486 | Ga0495580_0157496 | 3300046472 | Bacteria | 1572 |
| 487 | Ga0495582_0002806 | 3300046473 | Bacteria | 9740 |
| 488 | Ga0495639_0039439 | 3300046475 | Bacteria | 2123 |
| 489 | Ga0495662_0013876 | 3300046476 | Bacteria | 3921 |
| 490 | Ga0495664_0003537 | 3300046477 | Bacteria | 8521 |
| 491 | Ga0495664_0028609 | 3300046477 | Bacteria | 3254 |
| 492 | Ga0495585_0016072 | 3300046492 | Bacteria | 4338 |
| 493 | Ga0495594_0006201 | 3300046499 | Bacteria | 6148 |
| 494 | Ga0495594_0024673 | 3300046499 | Bacteria | 3231 |
| 495 | Ga0495607_0015506 | 3300046501 | Bacteria | 4938 |
| 496 | Ga0495608_0001474 | 3300046511 | Bacteria | 16724 |
| 497 | Ga0495608_0017824 | 3300046511 | Bacteria | 4909 |
| 498 | Ga0495610_0065325 | 3300046512 | Bacteria | 1717 |
| 499 | Ga0495618_0027234 | 3300046514 | Bacteria | 3558 |
| 500 | Ga0495628_0001927 | 3300046516 | Bacteria | 18830 |
| 501 | Ga0495628_0024184 | 3300046516 | Bacteria | 4973 |
| 502 | Ga0495628_0113567 | 3300046516 | Bacteria | 2082 |
| 503 | Ga0495630_0047564 | 3300046517 | Bacteria | 3209 |
| 504 | Ga0495630_0059407 | 3300046517 | Bacteria | 2869 |
| 505 | Ga0495630_0219305 | 3300046517 | Bacteria | 1452 |
| 506 | Ga0495630_0332177 | 3300046517 | Bacteria | 1163 |
| 507 | Ga0495644_0006919 | 3300046523 | Bacteria | 4391 |
| 508 | Ga0495652_0015699 | 3300046529 | Bacteria | 6778 |
| 509 | Ga0495652_0254817 | 3300046529 | Bacteria | 1298 |
| 510 | Ga0495665_0038652 | 3300046531 | Bacteria | 2544 |
| 511 | Ga0495640_0020173 | 3300046533 | Bacteria | 4909 |
| 512 | Ga0495640_0132462 | 3300046533 | Bacteria | 1612 |
| 513 | Ga0495640_0146655 | 3300046533 | Bacteria | 1518 |
| 514 | Ga0495586_0008177 | 3300046535 | Bacteria | 5575 |
| 515 | Ga0495587_0002240 | 3300046536 | Bacteria | 12923 |
| 516 | Ga0495587_0042135 | 3300046536 | Bacteria | 2723 |
| 517 | Ga0495645_0002539 | 3300046543 | Bacteria | 12383 |
| 518 | Ga0495645_0023203 | 3300046543 | Bacteria | 4492 |
| 519 | Ga0495645_0119189 | 3300046543 | Bacteria | 1860 |
| 520 | Ga0495667_0001150 | 3300046559 | Bacteria | 17257 |
| 521 | Ga0495667_0021829 | 3300046559 | Bacteria | 4317 |
| 522 | Ga0495667_0057100 | 3300046559 | Unclassified | 2566 |
| 523 | Ga0495656_0003843 | 3300046615 | Bacteria | 5108 |
| 524 | Ga0495634_0121245 | 3300046642 | Bacteria | 1674 |
| 525 | Ga0495635_0003881 | 3300046663 | Bacteria | 10388 |
| 526 | Ga0495635_0037995 | 3300046663 | Bacteria | 3332 |
| 527 | Ga0495635_0070978 | 3300046663 | Unclassified | 2387 |
| 528 | Ga0495659_0001458 | 3300046664 | Bacteria | 8030 |
| 529 | Ga0495588_0013595 | 3300046674 | Bacteria | 3881 |
| 530 | Ga0495599_0009859 | 3300046678 | Bacteria | 5848 |
| 531 | Ga0495623_0000420 | 3300046679 | Bacteria | 27960 |
| 532 | Ga0495646_0003113 | 3300046680 | Bacteria | 10292 |
| 533 | Ga0495646_0051463 | 3300046680 | Bacteria | 2492 |
| 534 | Ga0495647_0005761 | 3300046681 | Bacteria | 4073 |
| 535 | Ga0495647_0018043 | 3300046681 | Bacteria | 2505 |
| 536 | Ga0495658_0002441 | 3300046683 | Bacteria | 9352 |
| 537 | Ga0495613_0003655 | 3300046689 | Bacteria | 11526 |
| 538 | Ga0495613_0054377 | 3300046689 | Bacteria | 2943 |
| 539 | Ga0495624_0054221 | 3300046690 | Bacteria | 2528 |
| 540 | Ga0495624_0101906 | 3300046690 | Bacteria | 1767 |
| 541 | Ga0495670_0000291 | 3300046691 | Bacteria | 23680 |
| 542 | Ga0495600_0001326 | 3300046809 | Bacteria | 13661 |
| 543 | Ga0495600_0019703 | 3300046809 | Bacteria | 4311 |
| 544 | Ga0495600_0060643 | 3300046809 | Bacteria | 2470 |
| 545 | Ga0495581_0012599 | 3300047315 | Bacteria | 4900 |
| 546 | Ga0495581_0043070 | 3300047315 | Bacteria | 2612 |
| 547 | Ga0495604_0003891 | 3300047317 | Bacteria | 11887 |
| 548 | Ga0495604_0017520 | 3300047317 | Bacteria | 5736 |
| 549 | Ga0495604_0045926 | 3300047317 | Bacteria | 3407 |
| 550 | Ga0495604_0055679 | 3300047317 | Bacteria | 3048 |
| 551 | Ga0495674_0042562 | 3300047319 | Bacteria | 4049 |
| 552 | Ga0495674_0047567 | 3300047319 | Bacteria | 3802 |
| 553 | Ga0495674_0468458 | 3300047319 | Bacteria | 1011 |
| 554 | Ga0495680_0011254 | 3300047322 | Bacteria | 7932 |
| 555 | Ga0495680_0012959 | 3300047322 | Bacteria | 7301 |
| 556 | Ga0495680_0044564 | 3300047322 | Bacteria | 3507 |
| 557 | Ga0495675_0001544 | 3300047444 | Bacteria | 13904 |
| 558 | Ga0495675_0122552 | 3300047444 | Bacteria | 1619 |
| 559 | Ga0495684_0002087 | 3300047471 | Bacteria | 16070 |
| 560 | Ga0495684_0023924 | 3300047471 | Bacteria | 4698 |
| 561 | Ga0495593_0004626 | 3300047673 | Bacteria | 8180 |
| 562 | Ga0495593_0059382 | 3300047673 | Bacteria | 2004 |
| 563 | Ga0495602_0005526 | 3300048088 | Bacteria | 13262 |
| 564 | Ga0495602_0057446 | 3300048088 | Bacteria | 3413 |
| 565 | Ga0495602_0061017 | 3300048088 | Bacteria | 3282 |
| 566 | Ga0495614_0035948 | 3300048089 | Bacteria | 2127 |
| 567 | Ga0496100_0000106 | 3300048903 | Bacteria | 48123 |
| 568 | Ga0496100_0002951 | 3300048903 | Bacteria | 8748 |
| 569 | Ga0496100_0166587 | 3300048903 | Bacteria | 1583 |
| 570 | Ga0496101_0000992 | 3300048904 | Bacteria | 16792 |
| 571 | Ga0496101_0113210 | 3300048904 | Bacteria | 2044 |
| 572 | Ga0496101_0271289 | 3300048904 | Bacteria | 1324 |
| 573 | Ga0496102_0041646 | 3300048905 | Bacteria | 4160 |
| 574 | Ga0496102_0091000 | 3300048905 | Bacteria | 2823 |
| 575 | Ga0496102_0176008 | 3300048905 | Unclassified | 2014 |
| 576 | Ga0496102_0329375 | 3300048905 | Bacteria | 1438 |
| 577 | Ga0496103_0010395 | 3300048906 | Bacteria | 5506 |
| 578 | Ga0496103_0202213 | 3300048906 | Bacteria | 1277 |
| 579 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 580 | Ga0496104_0244328 | 3300048907 | Bacteria | 1707 |
| 581 | Ga0496104_0405626 | 3300048907 | Bacteria | 1275 |
| 582 | Ga0496105_0018996 | 3300048908 | Bacteria | 5538 |
| 583 | Ga0496106_0026062 | 3300048909 | Bacteria | 4350 |
| 584 | Ga0496106_0066563 | 3300048909 | Bacteria | 2744 |
| 585 | Ga0496107_0000223 | 3300048910 | Bacteria | 30018 |
| 586 | Ga0496107_0026443 | 3300048910 | Bacteria | 4114 |
| 587 | Ga0496107_0066614 | 3300048910 | Bacteria | 2611 |
| 588 | Ga0496107_0066871 | 3300048910 | Bacteria | 2606 |
| 589 | Ga0496107_0076992 | 3300048910 | Archaea | 2429 |
| 590 | Ga0496108_0003914 | 3300048911 | Bacteria | 11960 |
| 591 | Ga0496108_0059924 | 3300048911 | Bacteria | 3201 |
| 592 | Ga0496108_0099688 | 3300048911 | Bacteria | 2476 |
| 593 | Ga0496108_0254877 | 3300048911 | Bacteria | 1527 |
| 594 | Ga0496109_0016176 | 3300048912 | Bacteria | 6519 |
| 595 | Ga0496109_0025242 | 3300048912 | Bacteria | 5293 |
| 596 | Ga0496109_0108971 | 3300048912 | Bacteria | 2574 |
| 597 | Ga0496110_0022213 | 3300048913 | Bacteria | 5385 |
| 598 | Ga0496111_0073817 | 3300048914 | Bacteria | 2484 |
| 599 | Ga0496112_0056898 | 3300048915 | Bacteria | 3849 |
| 600 | Ga0496112_0092411 | 3300048915 | Bacteria | 2995 |
| 601 | Ga0496112_0172239 | 3300048915 | Bacteria | 2130 |
| 602 | Ga0496112_0255789 | 3300048915 | Bacteria | 1701 |
| 603 | Ga0496113_0019689 | 3300048916 | Bacteria | 4727 |
| 604 | Ga0496113_0164949 | 3300048916 | Bacteria | 1752 |
| 605 | Ga0496114_0006841 | 3300048917 | Bacteria | 8982 |
| 606 | Ga0496114_0057681 | 3300048917 | Bacteria | 3241 |
| 607 | Ga0496114_0302343 | 3300048917 | Bacteria | 1412 |
| 608 | Ga0496115_0010308 | 3300048918 | Bacteria | 6977 |
| 609 | Ga0496115_0032463 | 3300048918 | Unclassified | 4118 |
| 610 | Ga0496115_0170405 | 3300048918 | Bacteria | 1801 |
| 611 | Ga0496115_0253738 | 3300048918 | Bacteria | 1447 |
| 612 | Ga0496117_0028863 | 3300048920 | Bacteria | 4288 |
| 613 | Ga0496117_0034601 | 3300048920 | Bacteria | 3804 |
| 614 | Ga0496122_0020818 | 3300048925 | Bacteria | 5904 |
| 615 | Ga0496123_0070768 | 3300048926 | Bacteria | 2180 |
| 616 | Ga0501032_0039937 | 3300049569 | Bacteria | 3191 |
| 617 | Ga0501034_0000852 | 3300049571 | Bacteria | 45151 |
| 618 | Ga0501034_0002201 | 3300049571 | Bacteria | 24114 |
| 619 | Ga0501034_0031278 | 3300049571 | Bacteria | 5406 |
| 620 | Ga0501034_0122326 | 3300049571 | Bacteria | 2588 |
| 621 | Ga0501034_0124143 | 3300049571 | Bacteria | 2567 |
| 622 | Ga0501034_0171171 | 3300049571 | Bacteria | 2139 |
| 623 | Ga0501034_0214893 | 3300049571 | Bacteria | 1877 |
| 624 | Ga0501036_0001075 | 3300049572 | Bacteria | 20707 |
| 625 | Ga0501036_0022844 | 3300049572 | Bacteria | 5266 |
| 626 | Ga0501036_0029453 | 3300049572 | Bacteria | 4636 |
| 627 | Ga0501037_0019552 | 3300049573 | Bacteria | 4996 |
| 628 | Ga0501037_0032411 | 3300049573 | Bacteria | 3858 |
| 629 | Ga0501037_0040360 | 3300049573 | Bacteria | 3435 |
| 630 | Ga0501037_0041242 | 3300049573 | Bacteria | 3394 |
| 631 | Ga0501037_0054451 | 3300049573 | Bacteria | 2925 |
| 632 | Ga0501038_0044334 | 3300049574 | Bacteria | 3866 |
| 633 | Ga0501038_0076689 | 3300049574 | Bacteria | 2823 |
| 634 | Ga0501038_0098169 | 3300049574 | Bacteria | 2442 |
| 635 | Ga0501038_0232121 | 3300049574 | Bacteria | 1468 |
| 636 | Ga0501039_0034413 | 3300049575 | Bacteria | 3909 |
| 637 | Ga0501043_0007548 | 3300049579 | Bacteria | 8628 |
| 638 | Ga0501043_0039201 | 3300049579 | Bacteria | 3724 |
| 639 | Ga0501046_0044408 | 3300049580 | Bacteria | 3535 |
| 640 | Ga0501046_0057378 | 3300049580 | Bacteria | 3054 |
| 641 | Ga0501046_0105257 | 3300049580 | Bacteria | 2161 |
| 642 | Ga0501046_0232667 | 3300049580 | Bacteria | 1361 |
| 643 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 644 | Ga0501047_0009616 | 3300049581 | Bacteria | 9142 |
| 645 | Ga0501047_0022597 | 3300049581 | Bacteria | 6039 |
| 646 | Ga0501047_0032068 | 3300049581 | Bacteria | 5070 |
| 647 | Ga0501048_0000592 | 3300049582 | Bacteria | 25706 |
| 648 | Ga0501068_0008615 | 3300049584 | Bacteria | 5682 |
| 649 | Ga0501068_0020726 | 3300049584 | Bacteria | 3835 |
| 650 | Ga0501068_0061365 | 3300049584 | Bacteria | 2284 |
| 651 | Ga0501069_0012513 | 3300049585 | Bacteria | 4514 |
| 652 | Ga0501069_0039276 | 3300049585 | Bacteria | 2614 |
| 653 | Ga0501070_0012558 | 3300049586 | Bacteria | 7143 |
| 654 | Ga0501070_0015015 | 3300049586 | Bacteria | 6516 |
| 655 | Ga0501070_0024118 | 3300049586 | Bacteria | 5101 |
| 656 | Ga0501070_0042658 | 3300049586 | Bacteria | 3778 |
| 657 | Ga0501070_0150330 | 3300049586 | Bacteria | 1921 |
| 658 | Ga0501070_0154369 | 3300049586 | Bacteria | 1893 |
| 659 | Ga0501071_0017492 | 3300049587 | Bacteria | 4945 |
| 660 | Ga0501072_0074887 | 3300049588 | Bacteria | 2677 |
| 661 | Ga0501073_0088132 | 3300049589 | Bacteria | 2158 |
| 662 | Ga0501073_0110866 | 3300049589 | Bacteria | 1903 |
| 663 | Ga0501073_0270959 | 3300049589 | Bacteria | 1171 |
| 664 | Ga0501074_0010211 | 3300049590 | Bacteria | 6815 |
| 665 | Ga0501074_0019545 | 3300049590 | Bacteria | 4917 |
| 666 | Ga0501075_0009274 | 3300049591 | Bacteria | 6885 |
| 667 | Ga0501077_0083389 | 3300049593 | Bacteria | 2025 |
| 668 | Ga0501080_0000314 | 3300049742 | Bacteria | 37074 |
| 669 | Ga0501080_0033861 | 3300049742 | Bacteria | 4769 |
| 670 | Ga0501080_0099096 | 3300049742 | Bacteria | 2704 |
| 671 | Ga0501080_0149735 | 3300049742 | Bacteria | 2157 |
| 672 | Ga0501080_0170292 | 3300049742 | Bacteria | 2009 |
| 673 | Ga0501080_0172916 | 3300049742 | Bacteria | 1991 |
| 674 | Ga0501083_0001213 | 3300049744 | Bacteria | 17449 |
| 675 | Ga0501083_0013974 | 3300049744 | Bacteria | 5610 |
| 676 | Ga0501083_0029708 | 3300049744 | Bacteria | 3756 |
| 677 | Ga0501083_0057891 | 3300049744 | Bacteria | 2594 |
| 678 | Ga0501083_0075667 | 3300049744 | Bacteria | 2236 |
| 679 | Ga0501035_0001359 | 3300049822 | Bacteria | 25173 |
| 680 | Ga0501035_0008723 | 3300049822 | Bacteria | 9440 |
| 681 | Ga0501035_0188286 | 3300049822 | Bacteria | 1775 |
| 682 | Ga0501035_0354857 | 3300049822 | Bacteria | 1226 |
| 683 | Ga0501044_0003955 | 3300049823 | Bacteria | 16596 |
| 684 | Ga0501044_0007386 | 3300049823 | Bacteria | 12086 |
| 685 | Ga0501044_0035271 | 3300049823 | Bacteria | 5239 |
| 686 | Ga0501044_0037111 | 3300049823 | Bacteria | 5095 |
| 687 | Ga0501044_0043548 | 3300049823 | Bacteria | 4662 |
| 688 | Ga0501044_0206170 | 3300049823 | Bacteria | 1922 |
| 689 | Ga0501044_0229279 | 3300049823 | Bacteria | 1805 |
| 690 | Ga0501044_0247410 | 3300049823 | Bacteria | 1725 |
| 691 | nmdc:mga0k408_15093_c1 | 3300050493 | Bacteria | 4269 |
| 692 | nmdc:mga06z11_16338_c1 | 3300050494 | Bacteria | 3340 |
| 693 | nmdc:mga06z11_22614_c1 | 3300050494 | Bacteria | 2940 |
| 694 | nmdc:mga06z11_71985_c1 | 3300050494 | Bacteria | 1832 |
| 695 | nmdc:mga07m45_106529_c1 | 3300050496 | Bacteria | 1613 |
| 696 | nmdc:mga05p37_435133_c1 | 3300050507 | Bacteria | 1523 |
| 697 | nmdc:mga05p37_56_c3 | 3300050507 | Bacteria | 77819 |
| 698 | nmdc:mga09592_976_c1 | 3300050508 | Bacteria | 22595 |
| 699 | nmdc:mga0qj67_13755_c1 | 3300050509 | Bacteria | 6108 |
| 700 | nmdc:mga06r32_6105_c1 | 3300050510 | Bacteria | 10821 |
| 701 | nmdc:mga06r32_9642_c1 | 3300050510 | Bacteria | 8722 |
| 702 | nmdc:mga08y16_10256_c1 | 3300050511 | Bacteria | 9834 |
| 703 | nmdc:mga08y16_138559_c1 | 3300050511 | Bacteria | 2529 |
| 704 | nmdc:mga08y16_144351_c1 | 3300050511 | Bacteria | 2474 |
| 705 | nmdc:mga08y16_206_c1 | 3300050511 | Bacteria | 46039 |
| 706 | nmdc:mga08y16_2396_c1 | 3300050511 | Bacteria | 19256 |
| 707 | nmdc:mga0n895_138396_c1 | 3300050512 | Bacteria | 2462 |
| 708 | nmdc:mga0n895_2745_c1 | 3300050512 | Bacteria | 8963 |
| 709 | nmdc:mga0n895_4632_c1 | 3300050512 | Bacteria | 11339 |
| 710 | nmdc:mga0rr50_13492_c1 | 3300050513 | Bacteria | 5321 |
| 711 | nmdc:mga0rr50_31674_c1 | 3300050513 | Bacteria | 3759 |
| 712 | nmdc:mga0rr50_8402_c1 | 3300050513 | Bacteria | 6426 |
| 713 | nmdc:mga08x19_116588_c1 | 3300050514 | Bacteria | 1786 |
| 714 | nmdc:mga08x19_24581_c1 | 3300050514 | Bacteria | 3746 |
| 715 | nmdc:mga0a205_380_c1 | 3300050515 | Bacteria | 33747 |
| 716 | nmdc:mga0a205_80_c1 | 3300050515 | Bacteria | 53083 |
| 717 | nmdc:mga0sz30_53897_c1 | 3300050516 | Bacteria | 1709 |
| 718 | Ga0495601_0000360 | 3300053077 | Bacteria | 23959 |
| 719 | Ga0495601_0001260 | 3300053077 | Bacteria | 13862 |
| 720 | Ga0495601_0012407 | 3300053077 | Bacteria | 5112 |
| 721 | Ga0495601_0018263 | 3300053077 | Bacteria | 4266 |
| 722 | Ga0495601_0088044 | 3300053077 | Bacteria | 1996 |
| 723 | Ga0495612_0000964 | 3300053078 | Bacteria | 11832 |
| 724 | Ga0495612_0001978 | 3300053078 | Bacteria | 8443 |
| 725 | Ga0495612_0014718 | 3300053078 | Bacteria | 3141 |
| 726 | Ga0500610_0101197 | 3300053079 | Bacteria | 1491 |
| 727 | Ga0495595_0000969 | 3300053084 | Bacteria | 11036 |
| 728 | Ga0495595_0009105 | 3300053084 | Bacteria | 4100 |
| 729 | Ga0495595_0020214 | 3300053084 | Bacteria | 2896 |
| 730 | Ga0495619_0000375 | 3300053085 | Bacteria | 30799 |
| 731 | Ga0495619_0000581 | 3300053085 | Bacteria | 24290 |
| 732 | Ga0495619_0001851 | 3300053085 | Bacteria | 14080 |
| 733 | Ga0495619_0008740 | 3300053085 | Bacteria | 6403 |
| 734 | Ga0495619_0008848 | 3300053085 | Bacteria | 6365 |
| 735 | Ga0500643_005433 | 3300053087 | Bacteria | 5491 |
| 736 | Ga0500644_0000331 | 3300053088 | Bacteria | 24183 |
| 737 | Ga0500651_0006053 | 3300053093 | Bacteria | 6949 |
| 738 | Ga0500566_0067112 | 3300053094 | Bacteria | 2020 |
| 739 | Ga0500641_0009223 | 3300053096 | Bacteria | 3543 |
| 740 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 741 | Ga0500595_007827 | 3300053119 | Bacteria | 4402 |
| 742 | Ga0500577_0030058 | 3300053142 | Bacteria | 1887 |
| 743 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 744 | Ga0500616_0036227 | 3300053153 | Bacteria | 2678 |
| 745 | Ga0500616_0039043 | 3300053153 | Bacteria | 2561 |
| 746 | Ga0500622_0009576 | 3300053156 | Bacteria | 5356 |
| 747 | Ga0500645_000471 | 3300053730 | Bacteria | 27490 |
| 748 | Ga0501084_0045729 | 3300054114 | Bacteria | 3665 |
| 749 | Ga0501082_0000012 | 3300060353 | Bacteria | 119898 |
| 750 | Ga0501082_0010372 | 3300060353 | Bacteria | 8024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300034818 | Ga0373950_0009212 | Ga0373950_0009212_606_1541 | 311 |
| 2 | 3300053096 | Ga0500641_0009223 | Ga0500641_0009223_1402_2460 | 313 |
| 3 | 3300049580 | Ga0501046_0232667 | Ga0501046_0232667_373_1341 | 319 |
| 4 | 3300047319 | Ga0495674_0468458 | Ga0495674_0468458_23_991 | 320 |
| 5 | 3300048911 | Ga0496108_0254877 | Ga0496108_0254877_509_1504 | 331 |
| 6 | 3300048926 | Ga0496123_0070768 | Ga0496123_0070768_1137_2165 | 331 |
| 7 | 3300003203 | JGI25406J46586_10008160 | JGI25406J46586_100081603 | 338 |
| 8 | 3300005985 | Ga0081539_10000800 | Ga0081539_1000080023 | 338 |
| 9 | 3300035116 | Ga0373945_0004333 | Ga0373945_0004333_1264_2283 | 339 |
| 10 | 3300035117 | Ga0373953_0025007 | Ga0373953_0025007_1240_2259 | 339 |
| 11 | 3300035691 | Ga0373931_0151906 | Ga0373931_0151906_256_1275 | 339 |
| 12 | 3300035692 | Ga0373935_0011709 | Ga0373935_0011709_389_1408 | 339 |
| 13 | 3300035695 | Ga0373927_0022055 | Ga0373927_0022055_1218_2237 | 339 |
| 14 | 3300035725 | Ga0373947_0005580 | Ga0373947_0005580_4374_5393 | 339 |
| 15 | 3300037068 | Ga0373925_0009626 | Ga0373925_0009626_1641_2660 | 339 |
| 16 | 3300046455 | Ga0495603_0012902 | Ga0495603_0012902_1075_2094 | 339 |
| 17 | 3300046459 | Ga0495629_0000535 | Ga0495629_0000535_9842_10861 | 339 |
| 18 | 3300046461 | Ga0495641_0093980 | Ga0495641_0093980_306_1325 | 339 |
| 19 | 3300046472 | Ga0495580_0157496 | Ga0495580_0157496_39_1058 | 339 |
| 20 | 3300046473 | Ga0495582_0002806 | Ga0495582_0002806_1744_2763 | 339 |
| 21 | 3300046499 | Ga0495594_0006201 | Ga0495594_0006201_1553_2572 | 339 |
| 22 | 3300046517 | Ga0495630_0219305 | Ga0495630_0219305_378_1427 | 339 |
| 23 | 3300046529 | Ga0495652_0254817 | Ga0495652_0254817_230_1249 | 339 |
| 24 | 3300046681 | Ga0495647_0005761 | Ga0495647_0005761_2917_3936 | 339 |
| 25 | 3300046683 | Ga0495658_0002441 | Ga0495658_0002441_7519_8538 | 339 |
| 26 | 3300046689 | Ga0495613_0003655 | Ga0495613_0003655_7475_8494 | 339 |
| 27 | 3300047315 | Ga0495581_0012599 | Ga0495581_0012599_1354_2373 | 339 |
| 28 | 3300047322 | Ga0495680_0011254 | Ga0495680_0011254_303_1322 | 339 |
| 29 | 3300047322 | Ga0495680_0012959 | Ga0495680_0012959_6270_7289 | 339 |
| 30 | 3300047673 | Ga0495593_0059382 | Ga0495593_0059382_822_1841 | 339 |
| 31 | 3300048903 | Ga0496100_0002951 | Ga0496100_0002951_7689_8708 | 339 |
| 32 | 3300048906 | Ga0496103_0202213 | Ga0496103_0202213_227_1246 | 339 |
| 33 | 3300048907 | Ga0496104_0405626 | Ga0496104_0405626_221_1240 | 339 |
| 34 | 3300048911 | Ga0496108_0099688 | Ga0496108_0099688_1310_2329 | 339 |
| 35 | 3300048912 | Ga0496109_0016176 | Ga0496109_0016176_4785_5804 | 339 |
| 36 | 3300048917 | Ga0496114_0057681 | Ga0496114_0057681_2194_3213 | 339 |
| 37 | 3300048918 | Ga0496115_0170405 | Ga0496115_0170405_21_1040 | 339 |
| 38 | 3300049822 | Ga0501035_0354857 | Ga0501035_0354857_193_1212 | 339 |
| 39 | 3300053085 | Ga0495619_0000375 | Ga0495619_0000375_16755_17774 | 339 |
| 40 | 3300045049 | Ga0466959_0137082 | Ga0466959_0137082_14_1048 | 340 |
| 41 | 3300005518 | Ga0070699_100356833 | Ga0070699_1003568331 | 343 |
| 42 | 3300048920 | Ga0496117_0034601 | Ga0496117_0034601_2360_3472 | 343 |
| 43 | 3300048925 | Ga0496122_0020818 | Ga0496122_0020818_1752_2864 | 343 |
| 44 | 3300005434 | Ga0070709_10110170 | Ga0070709_101101701 | 346 |
| 45 | 3300049822 | Ga0501035_0001359 | Ga0501035_0001359_8113_9210 | 346 |
| 46 | 3300006186 | Ga0075369_10063403 | Ga0075369_100634032 | 347 |
| 47 | iso_pu_bacteria | 2643221547 | 2643756397 | 349 |
| 48 | 3300005434 | Ga0070709_10025535 | Ga0070709_100255353 | 350 |
| 49 | 3300025928 | Ga0207700_10066434 | Ga0207700_100664343 | 350 |
| 50 | 3300014326 | Ga0157380_10255509 | Ga0157380_102555092 | 353 |
| 51 | 3300053087 | Ga0500643_005433 | Ga0500643_005433_1326_2387 | 353 |
| 52 | 3300053088 | Ga0500644_0000331 | Ga0500644_0000331_19551_20612 | 353 |
| 53 | 3300053093 | Ga0500651_0006053 | Ga0500651_0006053_564_1625 | 353 |
| 54 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_41487_42548 | 353 |
| 55 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_56312_57373 | 353 |
| 56 | 3300053153 | Ga0500616_0039043 | Ga0500616_0039043_1391_2452 | 353 |
| 57 | 3300053730 | Ga0500645_000471 | Ga0500645_000471_17691_18752 | 353 |
| 58 | 3300013104 | Ga0157370_10118954 | Ga0157370_101189542 | 355 |
| 59 | 3300031241 | Ga0265325_10018415 | Ga0265325_100184152 | 355 |
| 60 | 3300006042 | Ga0075368_10007349 | Ga0075368_100073493 | 357 |
| 61 | 3300005327 | Ga0070658_10059765 | Ga0070658_100597652 | 358 |
| 62 | 3300005339 | Ga0070660_100021236 | Ga0070660_1000212366 | 358 |
| 63 | 3300005435 | Ga0070714_100048797 | Ga0070714_1000487973 | 358 |
| 64 | 3300005530 | Ga0070679_100055203 | Ga0070679_1000552035 | 358 |
| 65 | 3300005563 | Ga0068855_100012274 | Ga0068855_1000122744 | 358 |
| 66 | 3300005614 | Ga0068856_100097861 | Ga0068856_1000978612 | 358 |
| 67 | 3300005616 | Ga0068852_100291384 | Ga0068852_1002913841 | 358 |
| 68 | 3300005616 | Ga0068852_100443617 | Ga0068852_1004436171 | 358 |
| 69 | 3300009551 | Ga0105238_10091855 | Ga0105238_100918553 | 358 |
| 70 | 3300020070 | Ga0206356_11266497 | Ga0206356_112664971 | 358 |
| 71 | 3300025909 | Ga0207705_10044728 | Ga0207705_100447282 | 358 |
| 72 | 3300025912 | Ga0207707_10069584 | Ga0207707_100695842 | 358 |
| 73 | 3300025913 | Ga0207695_10273466 | Ga0207695_102734662 | 358 |
| 74 | 3300025917 | Ga0207660_10026920 | Ga0207660_100269204 | 358 |
| 75 | 3300025919 | Ga0207657_10158490 | Ga0207657_101584902 | 358 |
| 76 | 3300025921 | Ga0207652_10025311 | Ga0207652_100253113 | 358 |
| 77 | 3300025921 | Ga0207652_10118848 | Ga0207652_101188482 | 358 |
| 78 | 3300025924 | Ga0207694_10050082 | Ga0207694_100500822 | 358 |
| 79 | 3300025949 | Ga0207667_10012374 | Ga0207667_100123743 | 358 |
| 80 | 3300026078 | Ga0207702_10132745 | Ga0207702_101327452 | 358 |
| 81 | 3300026142 | Ga0207698_10031704 | Ga0207698_100317044 | 358 |
| 82 | 3300031595 | Ga0265313_10027921 | Ga0265313_100279212 | 358 |
| 83 | 3300031711 | Ga0265314_10005122 | Ga0265314_100051229 | 358 |
| 84 | 3300031712 | Ga0265342_10004840 | Ga0265342_100048404 | 358 |
| 85 | 3300049571 | Ga0501034_0171171 | Ga0501034_0171171_602_1678 | 358 |
| 86 | 3300049581 | Ga0501047_0009616 | Ga0501047_0009616_2637_3713 | 358 |
| 87 | 3300049823 | Ga0501044_0247410 | Ga0501044_0247410_416_1492 | 358 |
| 88 | iso_pu_bacteria | 2643221733 | 2644729303 | 358 |
| 89 | iso_pu_bacteria | 2643221734 | 2644735870 | 358 |
| 90 | iso_pu_bacteria | 2643221736 | 2644747358 | 358 |
| 91 | iso_pu_bacteria | 2818991467 | 2819718201 | 358 |
| 92 | iso_pu_bacteria | 2841760612 | 2841761917 | 358 |
| 93 | iso_pu_bacteria | 2841911363 | 2841916592 | 358 |
| 94 | iso_pu_bacteria | 2841917233 | 2841922489 | 358 |
| 95 | iso_pu_bacteria | 2844104063 | 2844104942 | 358 |
| 96 | iso_pu_bacteria | 2851182111 | 2851184902 | 358 |
| 97 | iso_pu_bacteria | 2851246043 | 2851247930 | 358 |
| 98 | iso_pu_bacteria | 2917699015 | 2917699521 | 358 |
| 99 | 3300005339 | Ga0070660_100072922 | Ga0070660_1000729223 | 359 |
| 100 | 3300005458 | Ga0070681_10135990 | Ga0070681_101359902 | 359 |
| 101 | 3300005563 | Ga0068855_100259502 | Ga0068855_1002595022 | 359 |
| 102 | 3300005578 | Ga0068854_100114473 | Ga0068854_1001144732 | 359 |
| 103 | 3300005614 | Ga0068856_100140566 | Ga0068856_1001405661 | 359 |
| 104 | 3300009093 | Ga0105240_10023458 | Ga0105240_100234585 | 359 |
| 105 | 3300013102 | Ga0157371_10141143 | Ga0157371_101411431 | 359 |
| 106 | 3300013104 | Ga0157370_10102731 | Ga0157370_101027312 | 359 |
| 107 | 3300020082 | Ga0206353_10547365 | Ga0206353_105473653 | 359 |
| 108 | 3300025912 | Ga0207707_10196931 | Ga0207707_101969312 | 359 |
| 109 | 3300025913 | Ga0207695_10088621 | Ga0207695_100886212 | 359 |
| 110 | 3300025919 | Ga0207657_10067345 | Ga0207657_100673451 | 359 |
| 111 | 3300025921 | Ga0207652_10130371 | Ga0207652_101303712 | 359 |
| 112 | 3300025949 | Ga0207667_10041317 | Ga0207667_100413172 | 359 |
| 113 | 3300025981 | Ga0207640_10087152 | Ga0207640_100871522 | 359 |
| 114 | 3300046460 | Ga0495638_0003352 | Ga0495638_0003352_2093_3205 | 359 |
| 115 | 3300049574 | Ga0501038_0232121 | Ga0501038_0232121_268_1347 | 359 |
| 116 | 3300049581 | Ga0501047_0022597 | Ga0501047_0022597_4059_5138 | 359 |
| 117 | 3300049588 | Ga0501072_0074887 | Ga0501072_0074887_1555_2634 | 359 |
| 118 | 3300049589 | Ga0501073_0270959 | Ga0501073_0270959_44_1123 | 359 |
| 119 | 3300049744 | Ga0501083_0013974 | Ga0501083_0013974_4373_5452 | 359 |
| 120 | 3300060353 | Ga0501082_0000012 | Ga0501082_0000012_81745_82851 | 359 |
| 121 | 3300060353 | Ga0501082_0010372 | Ga0501082_0010372_4782_5861 | 359 |
| 122 | 3300005331 | Ga0070670_100213878 | Ga0070670_1002138782 | 360 |
| 123 | 3300005328 | Ga0070676_10204003 | Ga0070676_102040031 | 361 |
| 124 | 3300005335 | Ga0070666_10159165 | Ga0070666_101591652 | 361 |
| 125 | 3300005353 | Ga0070669_100079795 | Ga0070669_1000797953 | 361 |
| 126 | 3300005353 | Ga0070669_100220338 | Ga0070669_1002203382 | 361 |
| 127 | 3300005356 | Ga0070674_100034246 | Ga0070674_1000342463 | 361 |
| 128 | 3300005435 | Ga0070714_100175957 | Ga0070714_1001759572 | 361 |
| 129 | 3300005466 | Ga0070685_10099410 | Ga0070685_100994102 | 361 |
| 130 | 3300005530 | Ga0070679_100162727 | Ga0070679_1001627272 | 361 |
| 131 | 3300005564 | Ga0070664_100080238 | Ga0070664_1000802381 | 361 |
| 132 | 3300006173 | Ga0070716_100063466 | Ga0070716_1000634662 | 361 |
| 133 | 3300006847 | Ga0075431_100005522 | Ga0075431_1000055228 | 361 |
| 134 | 3300009101 | Ga0105247_10038234 | Ga0105247_100382342 | 361 |
| 135 | 3300009147 | Ga0114129_10049593 | Ga0114129_100495932 | 361 |
| 136 | 3300009147 | Ga0114129_10169964 | Ga0114129_101699643 | 361 |
| 137 | 3300011119 | Ga0105246_10032648 | Ga0105246_100326483 | 361 |
| 138 | 3300021388 | Ga0213875_10000007 | Ga0213875_10000007152 | 361 |
| 139 | 3300025893 | Ga0207682_10001441 | Ga0207682_1000144112 | 361 |
| 140 | 3300025900 | Ga0207710_10032633 | Ga0207710_100326332 | 361 |
| 141 | 3300025907 | Ga0207645_10136971 | Ga0207645_101369711 | 361 |
| 142 | 3300025918 | Ga0207662_10040343 | Ga0207662_100403432 | 361 |
| 143 | 3300025926 | Ga0207659_10207751 | Ga0207659_102077511 | 361 |
| 144 | 3300025937 | Ga0207669_10040659 | Ga0207669_100406592 | 361 |
| 145 | 3300025940 | Ga0207691_10008505 | Ga0207691_100085059 | 361 |
| 146 | 3300025940 | Ga0207691_10060889 | Ga0207691_100608892 | 361 |
| 147 | 3300025981 | Ga0207640_10041774 | Ga0207640_100417742 | 361 |
| 148 | 3300026023 | Ga0207677_10242565 | Ga0207677_102425651 | 361 |
| 149 | 3300026095 | Ga0207676_10051115 | Ga0207676_100511152 | 361 |
| 150 | 3300026121 | Ga0207683_10012783 | Ga0207683_100127836 | 361 |
| 151 | 3300031235 | Ga0265330_10049181 | Ga0265330_100491811 | 361 |
| 152 | 3300031240 | Ga0265320_10021699 | Ga0265320_100216994 | 361 |
| 153 | 3300031241 | Ga0265325_10012823 | Ga0265325_100128232 | 361 |
| 154 | 3300031242 | Ga0265329_10011615 | Ga0265329_100116155 | 361 |
| 155 | 3300031249 | Ga0265339_10045049 | Ga0265339_100450494 | 361 |
| 156 | 3300031595 | Ga0265313_10011952 | Ga0265313_100119522 | 361 |
| 157 | 3300031711 | Ga0265314_10164120 | Ga0265314_101641202 | 361 |
| 158 | 3300031712 | Ga0265342_10056748 | Ga0265342_100567482 | 361 |
| 159 | 3300037853 | Ga0436364_0309649 | Ga0436364_0309649_8762_9859 | 361 |
| 160 | 3300049571 | Ga0501034_0000852 | Ga0501034_0000852_9329_10414 | 361 |
| 161 | 3300049574 | Ga0501038_0044334 | Ga0501038_0044334_1089_2192 | 361 |
| 162 | 3300049579 | Ga0501043_0039201 | Ga0501043_0039201_698_1801 | 361 |
| 163 | 3300049591 | Ga0501075_0009274 | Ga0501075_0009274_1291_2400 | 361 |
| 164 | 3300049742 | Ga0501080_0170292 | Ga0501080_0170292_227_1330 | 361 |
| 165 | 3300049744 | Ga0501083_0075667 | Ga0501083_0075667_654_1784 | 361 |
| 166 | 3300049822 | Ga0501035_0188286 | Ga0501035_0188286_513_1616 | 361 |
| 167 | 3300049823 | Ga0501044_0003955 | Ga0501044_0003955_13368_14471 | 361 |
| 168 | 3300050507 | nmdc:mga05p37_435133_c1 | nmdc:mga05p37_435133_c1_132_1331 | 361 |
| 169 | 3300050510 | nmdc:mga06r32_9642_c1 | nmdc:mga06r32_9642_c1_5073_6206 | 361 |
| 170 | 3300053079 | Ga0500610_0101197 | Ga0500610_0101197_252_1370 | 361 |
| 171 | 3300053142 | Ga0500577_0030058 | Ga0500577_0030058_412_1530 | 361 |
| 172 | 3300054114 | Ga0501084_0045729 | Ga0501084_0045729_365_1474 | 361 |
| 173 | 2209111006 | 2214939624 | 2214002878 | 362 |
| 174 | 3300000041 | ARcpr5oldR_c000195 | ARcpr5oldR_0001952 | 362 |
| 175 | 3300001977 | JGI24746J21847_1000397 | JGI24746J21847_10003972 | 362 |
| 176 | 3300001989 | JGI24739J22299_10002770 | JGI24739J22299_100027705 | 362 |
| 177 | 3300001990 | JGI24737J22298_10000960 | JGI24737J22298_100009603 | 362 |
| 178 | 3300002070 | JGI24750J21931_1000172 | JGI24750J21931_10001727 | 362 |
| 179 | 3300002074 | JGI24748J21848_1000441 | JGI24748J21848_10004413 | 362 |
| 180 | 3300002075 | JGI24738J21930_10000223 | JGI24738J21930_1000022312 | 362 |
| 181 | 3300002076 | JGI24749J21850_1001027 | JGI24749J21850_10010273 | 362 |
| 182 | 3300002077 | JGI24744J21845_10004694 | JGI24744J21845_100046942 | 362 |
| 183 | 3300002126 | JGI24035J26624_1000220 | JGI24035J26624_10002204 | 362 |
| 184 | 3300003187 | JGI25151J46595_10000155 | JGI25151J46595_1000015564 | 362 |
| 185 | 3300003771 | Ga0055526_1000225 | Ga0055526_100022520 | 362 |
| 186 | 3300003775 | Ga0055524_1000078 | Ga0055524_100007823 | 362 |
| 187 | 3300005262 | Ga0065165_1000089 | Ga0065165_100008952 | 362 |
| 188 | 3300005290 | Ga0065712_10077159 | Ga0065712_100771593 | 362 |
| 189 | 3300005293 | Ga0065715_10008649 | Ga0065715_100086493 | 362 |
| 190 | 3300005328 | Ga0070676_10000012 | Ga0070676_1000001245 | 362 |
| 191 | 3300005329 | Ga0070683_100000139 | Ga0070683_10000013920 | 362 |
| 192 | 3300005330 | Ga0070690_100005164 | Ga0070690_1000051642 | 362 |
| 193 | 3300005330 | Ga0070690_100195429 | Ga0070690_1001954292 | 362 |
| 194 | 3300005331 | Ga0070670_100006855 | Ga0070670_1000068552 | 362 |
| 195 | 3300005333 | Ga0070677_10000125 | Ga0070677_1000012512 | 362 |
| 196 | 3300005334 | Ga0068869_100000605 | Ga0068869_1000006056 | 362 |
| 197 | 3300005334 | Ga0068869_100107020 | Ga0068869_1001070202 | 362 |
| 198 | 3300005335 | Ga0070666_10019221 | Ga0070666_100192213 | 362 |
| 199 | 3300005336 | Ga0070680_100000179 | Ga0070680_10000017917 | 362 |
| 200 | 3300005336 | Ga0070680_100101322 | Ga0070680_1001013222 | 362 |
| 201 | 3300005337 | Ga0070682_100000319 | Ga0070682_1000003193 | 362 |
| 202 | 3300005337 | Ga0070682_100080901 | Ga0070682_1000809011 | 362 |
| 203 | 3300005338 | Ga0068868_100001158 | Ga0068868_10000115812 | 362 |
| 204 | 3300005338 | Ga0068868_100024252 | Ga0068868_1000242522 | 362 |
| 205 | 3300005339 | Ga0070660_100001605 | Ga0070660_10000160511 | 362 |
| 206 | 3300005339 | Ga0070660_100047355 | Ga0070660_1000473551 | 362 |
| 207 | 3300005340 | Ga0070689_100002178 | Ga0070689_1000021788 | 362 |
| 208 | 3300005340 | Ga0070689_100004685 | Ga0070689_1000046853 | 362 |
| 209 | 3300005341 | Ga0070691_10001565 | Ga0070691_1000156511 | 362 |
| 210 | 3300005341 | Ga0070691_10007128 | Ga0070691_100071282 | 362 |
| 211 | 3300005343 | Ga0070687_100179604 | Ga0070687_1001796041 | 362 |
| 212 | 3300005344 | Ga0070661_100001455 | Ga0070661_1000014557 | 362 |
| 213 | 3300005344 | Ga0070661_100021209 | Ga0070661_1000212092 | 362 |
| 214 | 3300005345 | Ga0070692_10000434 | Ga0070692_100004349 | 362 |
| 215 | 3300005345 | Ga0070692_10015896 | Ga0070692_100158963 | 362 |
| 216 | 3300005347 | Ga0070668_100004423 | Ga0070668_10000442312 | 362 |
| 217 | 3300005353 | Ga0070669_100000409 | Ga0070669_10000040911 | 362 |
| 218 | 3300005353 | Ga0070669_100020734 | Ga0070669_1000207343 | 362 |
| 219 | 3300005354 | Ga0070675_100000166 | Ga0070675_10000016639 | 362 |
| 220 | 3300005354 | Ga0070675_100019299 | Ga0070675_1000192993 | 362 |
| 221 | 3300005356 | Ga0070674_100000644 | Ga0070674_10000064419 | 362 |
| 222 | 3300005364 | Ga0070673_100000041 | Ga0070673_10000004120 | 362 |
| 223 | 3300005365 | Ga0070688_100000180 | Ga0070688_10000018023 | 362 |
| 224 | 3300005365 | Ga0070688_100000730 | Ga0070688_1000007305 | 362 |
| 225 | 3300005366 | Ga0070659_100000752 | Ga0070659_1000007528 | 362 |
| 226 | 3300005366 | Ga0070659_100056123 | Ga0070659_1000561232 | 362 |
| 227 | 3300005367 | Ga0070667_100000365 | Ga0070667_10000036510 | 362 |
| 228 | 3300005367 | Ga0070667_100019198 | Ga0070667_1000191985 | 362 |
| 229 | 3300005367 | Ga0070667_100116424 | Ga0070667_1001164242 | 362 |
| 230 | 3300005406 | Ga0070703_10000903 | Ga0070703_100009036 | 362 |
| 231 | 3300005434 | Ga0070709_10003137 | Ga0070709_100031377 | 362 |
| 232 | 3300005435 | Ga0070714_100009592 | Ga0070714_1000095924 | 362 |
| 233 | 3300005436 | Ga0070713_100034309 | Ga0070713_1000343092 | 362 |
| 234 | 3300005437 | Ga0070710_10024251 | Ga0070710_100242512 | 362 |
| 235 | 3300005437 | Ga0070710_10053343 | Ga0070710_100533432 | 362 |
| 236 | 3300005438 | Ga0070701_10000493 | Ga0070701_100004937 | 362 |
| 237 | 3300005439 | Ga0070711_100030206 | Ga0070711_1000302062 | 362 |
| 238 | 3300005439 | Ga0070711_100048418 | Ga0070711_1000484182 | 362 |
| 239 | 3300005440 | Ga0070705_100232913 | Ga0070705_1002329131 | 362 |
| 240 | 3300005441 | Ga0070700_100000467 | Ga0070700_1000004679 | 362 |
| 241 | 3300005444 | Ga0070694_100000065 | Ga0070694_10000006541 | 362 |
| 242 | 3300005444 | Ga0070694_100240852 | Ga0070694_1002408521 | 362 |
| 243 | 3300005455 | Ga0070663_100000473 | Ga0070663_1000004737 | 362 |
| 244 | 3300005455 | Ga0070663_100056324 | Ga0070663_1000563242 | 362 |
| 245 | 3300005455 | Ga0070663_100325352 | Ga0070663_1003253521 | 362 |
| 246 | 3300005456 | Ga0070678_100000091 | Ga0070678_10000009111 | 362 |
| 247 | 3300005457 | Ga0070662_100022629 | Ga0070662_1000226292 | 362 |
| 248 | 3300005457 | Ga0070662_100023595 | Ga0070662_1000235953 | 362 |
| 249 | 3300005459 | Ga0068867_100001090 | Ga0068867_10000109012 | 362 |
| 250 | 3300005459 | Ga0068867_100020555 | Ga0068867_1000205553 | 362 |
| 251 | 3300005466 | Ga0070685_10001731 | Ga0070685_100017319 | 362 |
| 252 | 3300005530 | Ga0070679_100015891 | Ga0070679_1000158916 | 362 |
| 253 | 3300005530 | Ga0070679_100071862 | Ga0070679_1000718622 | 362 |
| 254 | 3300005530 | Ga0070679_100079573 | Ga0070679_1000795733 | 362 |
| 255 | 3300005535 | Ga0070684_100000219 | Ga0070684_10000021911 | 362 |
| 256 | 3300005535 | Ga0070684_100132421 | Ga0070684_1001324212 | 362 |
| 257 | 3300005535 | Ga0070684_100198285 | Ga0070684_1001982851 | 362 |
| 258 | 3300005539 | Ga0068853_100000600 | Ga0068853_10000060014 | 362 |
| 259 | 3300005539 | Ga0068853_100037517 | Ga0068853_1000375172 | 362 |
| 260 | 3300005539 | Ga0068853_100267372 | Ga0068853_1002673721 | 362 |
| 261 | 3300005543 | Ga0070672_100000019 | Ga0070672_10000001920 | 362 |
| 262 | 3300005544 | Ga0070686_100000318 | Ga0070686_10000031823 | 362 |
| 263 | 3300005544 | Ga0070686_100013377 | Ga0070686_1000133771 | 362 |
| 264 | 3300005544 | Ga0070686_100015710 | Ga0070686_1000157101 | 362 |
| 265 | 3300005545 | Ga0070695_100000474 | Ga0070695_1000004749 | 362 |
| 266 | 3300005545 | Ga0070695_100006777 | Ga0070695_1000067773 | 362 |
| 267 | 3300005546 | Ga0070696_100029045 | Ga0070696_1000290453 | 362 |
| 268 | 3300005546 | Ga0070696_100041201 | Ga0070696_1000412012 | 362 |
| 269 | 3300005548 | Ga0070665_100010015 | Ga0070665_1000100151 | 362 |
| 270 | 3300005549 | Ga0070704_100000252 | Ga0070704_10000025213 | 362 |
| 271 | 3300005563 | Ga0068855_100019218 | Ga0068855_1000192182 | 362 |
| 272 | 3300005564 | Ga0070664_100000819 | Ga0070664_10000081918 | 362 |
| 273 | 3300005564 | Ga0070664_100127997 | Ga0070664_1001279971 | 362 |
| 274 | 3300005577 | Ga0068857_100000768 | Ga0068857_10000076812 | 362 |
| 275 | 3300005577 | Ga0068857_100233957 | Ga0068857_1002339571 | 362 |
| 276 | 3300005578 | Ga0068854_100000179 | Ga0068854_1000001792 | 362 |
| 277 | 3300005614 | Ga0068856_100002295 | Ga0068856_10000229523 | 362 |
| 278 | 3300005615 | Ga0070702_100000898 | Ga0070702_10000089811 | 362 |
| 279 | 3300005616 | Ga0068852_100001992 | Ga0068852_1000019923 | 362 |
| 280 | 3300005617 | Ga0068859_100001870 | Ga0068859_1000018706 | 362 |
| 281 | 3300005618 | Ga0068864_100000429 | Ga0068864_10000042926 | 362 |
| 282 | 3300005618 | Ga0068864_100201999 | Ga0068864_1002019992 | 362 |
| 283 | 3300005718 | Ga0068866_10000461 | Ga0068866_100004612 | 362 |
| 284 | 3300005719 | Ga0068861_100000169 | Ga0068861_10000016912 | 362 |
| 285 | 3300005840 | Ga0068870_10000586 | Ga0068870_1000058611 | 362 |
| 286 | 3300005841 | Ga0068863_100000381 | Ga0068863_10000038123 | 362 |
| 287 | 3300005842 | Ga0068858_100009197 | Ga0068858_1000091973 | 362 |
| 288 | 3300005842 | Ga0068858_100081595 | Ga0068858_1000815952 | 362 |
| 289 | 3300005843 | Ga0068860_100001472 | Ga0068860_10000147213 | 362 |
| 290 | 3300005843 | Ga0068860_100028934 | Ga0068860_1000289343 | 362 |
| 291 | 3300005843 | Ga0068860_100104941 | Ga0068860_1001049413 | 362 |
| 292 | 3300005844 | Ga0068862_100001886 | Ga0068862_10000188612 | 362 |
| 293 | 3300005844 | Ga0068862_100003346 | Ga0068862_1000033468 | 362 |
| 294 | 3300005937 | Ga0081455_10000036 | Ga0081455_10000036121 | 362 |
| 295 | 3300006028 | Ga0070717_10000199 | Ga0070717_1000019910 | 362 |
| 296 | 3300006058 | Ga0075432_10000873 | Ga0075432_100008737 | 362 |
| 297 | 3300006058 | Ga0075432_10040078 | Ga0075432_100400782 | 362 |
| 298 | 3300006163 | Ga0070715_10053985 | Ga0070715_100539852 | 362 |
| 299 | 3300006173 | Ga0070716_100015201 | Ga0070716_1000152014 | 362 |
| 300 | 3300006175 | Ga0070712_100329784 | Ga0070712_1003297842 | 362 |
| 301 | 3300006178 | Ga0075367_10033854 | Ga0075367_100338542 | 362 |
| 302 | 3300006237 | Ga0097621_100001234 | Ga0097621_10000123412 | 362 |
| 303 | 3300006358 | Ga0068871_100000068 | Ga0068871_10000006846 | 362 |
| 304 | 3300006358 | Ga0068871_100081861 | Ga0068871_1000818613 | 362 |
| 305 | 3300006846 | Ga0075430_100004696 | Ga0075430_1000046967 | 362 |
| 306 | 3300006847 | Ga0075431_100006639 | Ga0075431_1000066397 | 362 |
| 307 | 3300006852 | Ga0075433_10001599 | Ga0075433_100015995 | 362 |
| 308 | 3300006852 | Ga0075433_10013425 | Ga0075433_100134253 | 362 |
| 309 | 3300006871 | Ga0075434_100000576 | Ga0075434_10000057624 | 362 |
| 310 | 3300006871 | Ga0075434_100001666 | Ga0075434_1000016664 | 362 |
| 311 | 3300006880 | Ga0075429_100013193 | Ga0075429_1000131933 | 362 |
| 312 | 3300006881 | Ga0068865_100015742 | Ga0068865_1000157422 | 362 |
| 313 | 3300006914 | Ga0075436_100098484 | Ga0075436_1000984842 | 362 |
| 314 | 3300006914 | Ga0075436_100222644 | Ga0075436_1002226441 | 362 |
| 315 | 3300006931 | Ga0097620_100001870 | Ga0097620_1000018706 | 362 |
| 316 | 3300007076 | Ga0075435_100002716 | Ga0075435_10000271611 | 362 |
| 317 | 3300007076 | Ga0075435_100042109 | Ga0075435_1000421093 | 362 |
| 318 | 3300007076 | Ga0075435_100067418 | Ga0075435_1000674183 | 362 |
| 319 | 3300009094 | Ga0111539_10000503 | Ga0111539_1000050327 | 362 |
| 320 | 3300009094 | Ga0111539_10003417 | Ga0111539_100034176 | 362 |
| 321 | 3300009094 | Ga0111539_10175783 | Ga0111539_101757831 | 362 |
| 322 | 3300009098 | Ga0105245_10000780 | Ga0105245_1000078020 | 362 |
| 323 | 3300009098 | Ga0105245_10078335 | Ga0105245_100783354 | 362 |
| 324 | 3300009101 | Ga0105247_10241738 | Ga0105247_102417381 | 362 |
| 325 | 3300009147 | Ga0114129_10013874 | Ga0114129_100138745 | 362 |
| 326 | 3300009147 | Ga0114129_10023827 | Ga0114129_100238273 | 362 |
| 327 | 3300009148 | Ga0105243_10001083 | Ga0105243_1000108321 | 362 |
| 328 | 3300009148 | Ga0105243_10232362 | Ga0105243_102323622 | 362 |
| 329 | 3300009174 | Ga0105241_10000760 | Ga0105241_1000076020 | 362 |
| 330 | 3300009174 | Ga0105241_10129672 | Ga0105241_101296723 | 362 |
| 331 | 3300009176 | Ga0105242_10006332 | Ga0105242_100063322 | 362 |
| 332 | 3300009176 | Ga0105242_10030536 | Ga0105242_100305365 | 362 |
| 333 | 3300009176 | Ga0105242_10072061 | Ga0105242_100720613 | 362 |
| 334 | 3300009177 | Ga0105248_10011305 | Ga0105248_1001130510 | 362 |
| 335 | 3300009177 | Ga0105248_10168883 | Ga0105248_101688832 | 362 |
| 336 | 3300009545 | Ga0105237_10007890 | Ga0105237_100078902 | 362 |
| 337 | 3300009545 | Ga0105237_10064505 | Ga0105237_100645055 | 362 |
| 338 | 3300009545 | Ga0105237_10173560 | Ga0105237_101735602 | 362 |
| 339 | 3300009551 | Ga0105238_10035142 | Ga0105238_100351423 | 362 |
| 340 | 3300009553 | Ga0105249_10002196 | Ga0105249_100021962 | 362 |
| 341 | 3300009553 | Ga0105249_10017908 | Ga0105249_100179082 | 362 |
| 342 | 3300009553 | Ga0105249_10362518 | Ga0105249_103625182 | 362 |
| 343 | 3300010375 | Ga0105239_10002791 | Ga0105239_1000279119 | 362 |
| 344 | 3300010375 | Ga0105239_10003820 | Ga0105239_1000382012 | 362 |
| 345 | 3300010375 | Ga0105239_10419325 | Ga0105239_104193252 | 362 |
| 346 | 3300011119 | Ga0105246_10000061 | Ga0105246_1000006138 | 362 |
| 347 | 3300013100 | Ga0157373_10084995 | Ga0157373_100849952 | 362 |
| 348 | 3300013100 | Ga0157373_10110205 | Ga0157373_101102052 | 362 |
| 349 | 3300013102 | Ga0157371_10035739 | Ga0157371_100357392 | 362 |
| 350 | 3300013102 | Ga0157371_10068201 | Ga0157371_100682012 | 362 |
| 351 | 3300013104 | Ga0157370_10181509 | Ga0157370_101815092 | 362 |
| 352 | 3300013250 | Ga0171462_1046 | Ga0171462_104613 | 362 |
| 353 | 3300013296 | Ga0157374_10001691 | Ga0157374_100016917 | 362 |
| 354 | 3300013297 | Ga0157378_10001445 | Ga0157378_100014456 | 362 |
| 355 | 3300013306 | Ga0163162_10000790 | Ga0163162_100007907 | 362 |
| 356 | 3300013306 | Ga0163162_10018394 | Ga0163162_100183947 | 362 |
| 357 | 3300013307 | Ga0157372_10009037 | Ga0157372_100090372 | 362 |
| 358 | 3300013308 | Ga0157375_10000468 | Ga0157375_1000046817 | 362 |
| 359 | 3300014325 | Ga0163163_10001508 | Ga0163163_100015083 | 362 |
| 360 | 3300014325 | Ga0163163_10184099 | Ga0163163_101840992 | 362 |
| 361 | 3300014326 | Ga0157380_10002913 | Ga0157380_100029133 | 362 |
| 362 | 3300014745 | Ga0157377_10000276 | Ga0157377_1000027621 | 362 |
| 363 | 3300014968 | Ga0157379_10002285 | Ga0157379_1000228516 | 362 |
| 364 | 3300014968 | Ga0157379_10026464 | Ga0157379_100264646 | 362 |
| 365 | 3300014968 | Ga0157379_10138607 | Ga0157379_101386071 | 362 |
| 366 | 3300014969 | Ga0157376_10000692 | Ga0157376_1000069210 | 362 |
| 367 | 3300014969 | Ga0157376_10043172 | Ga0157376_100431724 | 362 |
| 368 | 3300014969 | Ga0157376_10250041 | Ga0157376_102500412 | 362 |
| 369 | 3300017792 | Ga0163161_10000384 | Ga0163161_1000038420 | 362 |
| 370 | 3300017792 | Ga0163161_10079048 | Ga0163161_100790482 | 362 |
| 371 | 3300020082 | Ga0206353_11680947 | Ga0206353_116809472 | 362 |
| 372 | 3300025271 | Ga0207666_1000097 | Ga0207666_10000976 | 362 |
| 373 | 3300025284 | Ga0209130_1000087 | Ga0209130_100008755 | 362 |
| 374 | 3300025291 | Ga0209675_1001209 | Ga0209675_100120911 | 362 |
| 375 | 3300025294 | Ga0209025_1000014 | Ga0209025_1000014596 | 362 |
| 376 | 3300025294 | Ga0209025_1003588 | Ga0209025_10035886 | 362 |
| 377 | 3300025295 | Ga0209564_1000017 | Ga0209564_100001734 | 362 |
| 378 | 3300025295 | Ga0209564_1000187 | Ga0209564_1000187109 | 362 |
| 379 | 3300025299 | Ga0209256_1000055 | Ga0209256_1000055182 | 362 |
| 380 | 3300025299 | Ga0209256_1000146 | Ga0209256_100014672 | 362 |
| 381 | 3300025302 | Ga0207426_1003682 | Ga0207426_10036823 | 362 |
| 382 | 3300025315 | Ga0207697_10000550 | Ga0207697_100005506 | 362 |
| 383 | 3300025885 | Ga0207653_10002301 | Ga0207653_100023013 | 362 |
| 384 | 3300025893 | Ga0207682_10000088 | Ga0207682_1000008821 | 362 |
| 385 | 3300025898 | Ga0207692_10030999 | Ga0207692_100309992 | 362 |
| 386 | 3300025899 | Ga0207642_10000926 | Ga0207642_100009267 | 362 |
| 387 | 3300025900 | Ga0207710_10024509 | Ga0207710_100245093 | 362 |
| 388 | 3300025901 | Ga0207688_10001203 | Ga0207688_1000120311 | 362 |
| 389 | 3300025901 | Ga0207688_10023663 | Ga0207688_100236632 | 362 |
| 390 | 3300025903 | Ga0207680_10013156 | Ga0207680_100131562 | 362 |
| 391 | 3300025903 | Ga0207680_10015527 | Ga0207680_100155273 | 362 |
| 392 | 3300025904 | Ga0207647_10002714 | Ga0207647_1000271411 | 362 |
| 393 | 3300025906 | Ga0207699_10002088 | Ga0207699_100020883 | 362 |
| 394 | 3300025907 | Ga0207645_10000140 | Ga0207645_1000014011 | 362 |
| 395 | 3300025908 | Ga0207643_10000083 | Ga0207643_1000008311 | 362 |
| 396 | 3300025911 | Ga0207654_10063367 | Ga0207654_100633672 | 362 |
| 397 | 3300025912 | Ga0207707_10004967 | Ga0207707_100049672 | 362 |
| 398 | 3300025912 | Ga0207707_10013826 | Ga0207707_100138266 | 362 |
| 399 | 3300025914 | Ga0207671_10074488 | Ga0207671_100744882 | 362 |
| 400 | 3300025914 | Ga0207671_10090131 | Ga0207671_100901312 | 362 |
| 401 | 3300025915 | Ga0207693_10007583 | Ga0207693_100075835 | 362 |
| 402 | 3300025915 | Ga0207693_10009124 | Ga0207693_100091246 | 362 |
| 403 | 3300025916 | Ga0207663_10009641 | Ga0207663_100096413 | 362 |
| 404 | 3300025916 | Ga0207663_10171384 | Ga0207663_101713842 | 362 |
| 405 | 3300025917 | Ga0207660_10000073 | Ga0207660_1000007313 | 362 |
| 406 | 3300025917 | Ga0207660_10080492 | Ga0207660_100804922 | 362 |
| 407 | 3300025918 | Ga0207662_10000964 | Ga0207662_100009646 | 362 |
| 408 | 3300025918 | Ga0207662_10013126 | Ga0207662_100131263 | 362 |
| 409 | 3300025918 | Ga0207662_10024056 | Ga0207662_100240563 | 362 |
| 410 | 3300025919 | Ga0207657_10005395 | Ga0207657_100053956 | 362 |
| 411 | 3300025920 | Ga0207649_10000450 | Ga0207649_1000045012 | 362 |
| 412 | 3300025920 | Ga0207649_10049051 | Ga0207649_100490512 | 362 |
| 413 | 3300025921 | Ga0207652_10007770 | Ga0207652_100077702 | 362 |
| 414 | 3300025923 | Ga0207681_10000097 | Ga0207681_1000009739 | 362 |
| 415 | 3300025924 | Ga0207694_10056347 | Ga0207694_100563473 | 362 |
| 416 | 3300025925 | Ga0207650_10041696 | Ga0207650_100416962 | 362 |
| 417 | 3300025926 | Ga0207659_10000092 | Ga0207659_1000009239 | 362 |
| 418 | 3300025927 | Ga0207687_10016821 | Ga0207687_100168212 | 362 |
| 419 | 3300025929 | Ga0207664_10005574 | Ga0207664_1000557410 | 362 |
| 420 | 3300025931 | Ga0207644_10005083 | Ga0207644_100050838 | 362 |
| 421 | 3300025931 | Ga0207644_10007663 | Ga0207644_100076637 | 362 |
| 422 | 3300025931 | Ga0207644_10148161 | Ga0207644_101481612 | 362 |
| 423 | 3300025932 | Ga0207690_10002606 | Ga0207690_100026068 | 362 |
| 424 | 3300025932 | Ga0207690_10147219 | Ga0207690_101472191 | 362 |
| 425 | 3300025933 | Ga0207706_10004310 | Ga0207706_1000431011 | 362 |
| 426 | 3300025933 | Ga0207706_10008823 | Ga0207706_1000882310 | 362 |
| 427 | 3300025933 | Ga0207706_10046615 | Ga0207706_100466152 | 362 |
| 428 | 3300025934 | Ga0207686_10000796 | Ga0207686_1000079612 | 362 |
| 429 | 3300025934 | Ga0207686_10027960 | Ga0207686_100279602 | 362 |
| 430 | 3300025935 | Ga0207709_10000362 | Ga0207709_1000036223 | 362 |
| 431 | 3300025935 | Ga0207709_10103109 | Ga0207709_101031092 | 362 |
| 432 | 3300025936 | Ga0207670_10004868 | Ga0207670_100048682 | 362 |
| 433 | 3300025937 | Ga0207669_10000350 | Ga0207669_100003505 | 362 |
| 434 | 3300025938 | Ga0207704_10000479 | Ga0207704_100004793 | 362 |
| 435 | 3300025939 | Ga0207665_10001702 | Ga0207665_100017024 | 362 |
| 436 | 3300025940 | Ga0207691_10000283 | Ga0207691_1000028339 | 362 |
| 437 | 3300025941 | Ga0207711_10009675 | Ga0207711_100096757 | 362 |
| 438 | 3300025941 | Ga0207711_10078578 | Ga0207711_100785782 | 362 |
| 439 | 3300025942 | Ga0207689_10000085 | Ga0207689_1000008570 | 362 |
| 440 | 3300025944 | Ga0207661_10000464 | Ga0207661_1000046421 | 362 |
| 441 | 3300025945 | Ga0207679_10000030 | Ga0207679_10000030146 | 362 |
| 442 | 3300025945 | Ga0207679_10117323 | Ga0207679_101173232 | 362 |
| 443 | 3300025949 | Ga0207667_10018715 | Ga0207667_100187152 | 362 |
| 444 | 3300025960 | Ga0207651_10000088 | Ga0207651_100000882 | 362 |
| 445 | 3300025961 | Ga0207712_10010820 | Ga0207712_100108204 | 362 |
| 446 | 3300025972 | Ga0207668_10000114 | Ga0207668_1000011439 | 362 |
| 447 | 3300025981 | Ga0207640_10005820 | Ga0207640_100058204 | 362 |
| 448 | 3300025981 | Ga0207640_10019689 | Ga0207640_100196892 | 362 |
| 449 | 3300025986 | Ga0207658_10002853 | Ga0207658_100028537 | 362 |
| 450 | 3300026023 | Ga0207677_10009721 | Ga0207677_100097213 | 362 |
| 451 | 3300026035 | Ga0207703_10000983 | Ga0207703_1000098314 | 362 |
| 452 | 3300026035 | Ga0207703_10048789 | Ga0207703_100487892 | 362 |
| 453 | 3300026041 | Ga0207639_10000305 | Ga0207639_1000030512 | 362 |
| 454 | 3300026067 | Ga0207678_10000125 | Ga0207678_1000012546 | 362 |
| 455 | 3300026067 | Ga0207678_10016358 | Ga0207678_100163586 | 362 |
| 456 | 3300026067 | Ga0207678_10032906 | Ga0207678_100329062 | 362 |
| 457 | 3300026067 | Ga0207678_10132722 | Ga0207678_101327222 | 362 |
| 458 | 3300026075 | Ga0207708_10000187 | Ga0207708_100001876 | 362 |
| 459 | 3300026078 | Ga0207702_10005437 | Ga0207702_100054373 | 362 |
| 460 | 3300026078 | Ga0207702_10050201 | Ga0207702_100502013 | 362 |
| 461 | 3300026088 | Ga0207641_10002129 | Ga0207641_1000212913 | 362 |
| 462 | 3300026088 | Ga0207641_10037602 | Ga0207641_100376022 | 362 |
| 463 | 3300026089 | Ga0207648_10002168 | Ga0207648_1000216821 | 362 |
| 464 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007420 | 362 |
| 465 | 3300026095 | Ga0207676_10042253 | Ga0207676_100422533 | 362 |
| 466 | 3300026116 | Ga0207674_10002501 | Ga0207674_100025016 | 362 |
| 467 | 3300026118 | Ga0207675_100004556 | Ga0207675_1000045566 | 362 |
| 468 | 3300026121 | Ga0207683_10000014 | Ga0207683_1000001440 | 362 |
| 469 | 3300026121 | Ga0207683_10003999 | Ga0207683_1000399914 | 362 |
| 470 | 3300026121 | Ga0207683_10004104 | Ga0207683_100041042 | 362 |
| 471 | 3300026142 | Ga0207698_10001242 | Ga0207698_100012423 | 362 |
| 472 | 3300026142 | Ga0207698_10273137 | Ga0207698_102731372 | 362 |
| 473 | 3300027695 | Ga0209966_1001229 | Ga0209966_10012293 | 362 |
| 474 | 3300027717 | Ga0209998_10000361 | Ga0209998_100003616 | 362 |
| 475 | 3300027717 | Ga0209998_10002431 | Ga0209998_100024312 | 362 |
| 476 | 3300027876 | Ga0209974_10002250 | Ga0209974_100022507 | 362 |
| 477 | 3300027876 | Ga0209974_10007253 | Ga0209974_100072532 | 362 |
| 478 | 3300027907 | Ga0207428_10000114 | Ga0207428_1000011475 | 362 |
| 479 | 3300027907 | Ga0207428_10000467 | Ga0207428_1000046728 | 362 |
| 480 | 3300027907 | Ga0207428_10005035 | Ga0207428_100050359 | 362 |
| 481 | 3300028379 | Ga0268266_10027346 | Ga0268266_100273462 | 362 |
| 482 | 3300028380 | Ga0268265_10001371 | Ga0268265_100013718 | 362 |
| 483 | 3300028380 | Ga0268265_10007749 | Ga0268265_100077492 | 362 |
| 484 | 3300028381 | Ga0268264_10000469 | Ga0268264_1000046919 | 362 |
| 485 | 3300028381 | Ga0268264_10016375 | Ga0268264_100163756 | 362 |
| 486 | 3300031241 | Ga0265325_10000423 | Ga0265325_1000042319 | 362 |
| 487 | 3300031241 | Ga0265325_10094477 | Ga0265325_100944772 | 362 |
| 488 | 3300031249 | Ga0265339_10003373 | Ga0265339_1000337312 | 362 |
| 489 | 3300031344 | Ga0265316_10119807 | Ga0265316_101198072 | 362 |
| 490 | 3300031595 | Ga0265313_10000115 | Ga0265313_1000011552 | 362 |
| 491 | 3300031595 | Ga0265313_10002944 | Ga0265313_100029442 | 362 |
| 492 | 3300031901 | Ga0307406_10226106 | Ga0307406_102261061 | 362 |
| 493 | 3300034816 | Ga0373930_0000138 | Ga0373930_0000138_6492_7580 | 362 |
| 494 | 3300034818 | Ga0373950_0000569 | Ga0373950_0000569_2275_3363 | 362 |
| 495 | 3300034957 | Ga0373938_0000547 | Ga0373938_0000547_3688_4776 | 362 |
| 496 | 3300034957 | Ga0373938_0000639 | Ga0373938_0000639_477_1565 | 362 |
| 497 | 3300035084 | Ga0373928_0003248 | Ga0373928_0003248_78_1166 | 362 |
| 498 | 3300035085 | Ga0373929_0000455 | Ga0373929_0000455_6485_7573 | 362 |
| 499 | 3300035085 | Ga0373929_0005461 | Ga0373929_0005461_571_1659 | 362 |
| 500 | 3300035088 | Ga0373940_0003655 | Ga0373940_0003655_1198_2286 | 362 |
| 501 | 3300035088 | Ga0373940_0016340 | Ga0373940_0016340_549_1637 | 362 |
| 502 | 3300035090 | Ga0373949_0001506 | Ga0373949_0001506_3694_4782 | 362 |
| 503 | 3300035091 | Ga0373951_0002818 | Ga0373951_0002818_2509_3597 | 362 |
| 504 | 3300035091 | Ga0373951_0036704 | Ga0373951_0036704_19_1107 | 362 |
| 505 | 3300035092 | Ga0373952_0000029 | Ga0373952_0000029_7405_8493 | 362 |
| 506 | 3300035092 | Ga0373952_0001129 | Ga0373952_0001129_908_1996 | 362 |
| 507 | 3300035112 | Ga0373932_0000468 | Ga0373932_0000468_700_1788 | 362 |
| 508 | 3300035112 | Ga0373932_0004542 | Ga0373932_0004542_2160_3248 | 362 |
| 509 | 3300035113 | Ga0373936_0013398 | Ga0373936_0013398_582_1670 | 362 |
| 510 | 3300035114 | Ga0373939_0000339 | Ga0373939_0000339_6964_8052 | 362 |
| 511 | 3300035114 | Ga0373939_0028144 | Ga0373939_0028144_223_1311 | 362 |
| 512 | 3300035114 | Ga0373939_0036478 | Ga0373939_0036478_352_1440 | 362 |
| 513 | 3300035115 | Ga0373941_0001871 | Ga0373941_0001871_1915_3003 | 362 |
| 514 | 3300035115 | Ga0373941_0002209 | Ga0373941_0002209_2731_3819 | 362 |
| 515 | 3300035116 | Ga0373945_0030379 | Ga0373945_0030379_269_1357 | 362 |
| 516 | 3300035117 | Ga0373953_0016093 | Ga0373953_0016093_117_1205 | 362 |
| 517 | 3300035117 | Ga0373953_0033246 | Ga0373953_0033246_841_1947 | 362 |
| 518 | 3300035118 | Ga0373954_0002030 | Ga0373954_0002030_3335_4423 | 362 |
| 519 | 3300035118 | Ga0373954_0033972 | Ga0373954_0033972_853_1941 | 362 |
| 520 | 3300035119 | Ga0373956_0006309 | Ga0373956_0006309_31_1119 | 362 |
| 521 | 3300035120 | Ga0373957_0007402 | Ga0373957_0007402_1622_2710 | 362 |
| 522 | 3300035121 | Ga0373960_0000611 | Ga0373960_0000611_4866_5954 | 362 |
| 523 | 3300035170 | Ga0373943_0031766 | Ga0373943_0031766_1311_2399 | 362 |
| 524 | 3300035171 | Ga0373946_0020116 | Ga0373946_0020116_1399_2487 | 362 |
| 525 | 3300035171 | Ga0373946_0102582 | Ga0373946_0102582_180_1268 | 362 |
| 526 | 3300035172 | Ga0373955_0001269 | Ga0373955_0001269_1646_2734 | 362 |
| 527 | 3300035172 | Ga0373955_0001523 | Ga0373955_0001523_7607_8695 | 362 |
| 528 | 3300035172 | Ga0373955_0005294 | Ga0373955_0005294_1939_3027 | 362 |
| 529 | 3300035172 | Ga0373955_0019290 | Ga0373955_0019290_524_1630 | 362 |
| 530 | 3300035207 | Ga0373942_0011321 | Ga0373942_0011321_559_1647 | 362 |
| 531 | 3300035241 | Ga0373961_0013171 | Ga0373961_0013171_836_1924 | 362 |
| 532 | 3300035242 | Ga0373962_0001530 | Ga0373962_0001530_1737_2825 | 362 |
| 533 | 3300035242 | Ga0373962_0017701 | Ga0373962_0017701_664_1752 | 362 |
| 534 | 3300035691 | Ga0373931_0000169 | Ga0373931_0000169_13505_14593 | 362 |
| 535 | 3300035695 | Ga0373927_0038796 | Ga0373927_0038796_751_1845 | 362 |
| 536 | 3300035724 | Ga0373933_0001124 | Ga0373933_0001124_9629_10717 | 362 |
| 537 | 3300035724 | Ga0373933_0052936 | Ga0373933_0052936_905_1993 | 362 |
| 538 | 3300035725 | Ga0373947_0036069 | Ga0373947_0036069_272_1360 | 362 |
| 539 | 3300035725 | Ga0373947_0048752 | Ga0373947_0048752_597_1685 | 362 |
| 540 | 3300036401 | Ga0373937_0004918 | Ga0373937_0004918_5006_6094 | 362 |
| 541 | 3300036401 | Ga0373937_0007509 | Ga0373937_0007509_918_2024 | 362 |
| 542 | 3300036401 | Ga0373937_0012121 | Ga0373937_0012121_5251_6339 | 362 |
| 543 | 3300036401 | Ga0373937_0111440 | Ga0373937_0111440_446_1534 | 362 |
| 544 | 3300036401 | Ga0373937_0130016 | Ga0373937_0130016_850_1944 | 362 |
| 545 | 3300037068 | Ga0373925_0049020 | Ga0373925_0049020_972_2060 | 362 |
| 546 | 3300039437 | Ga0436365_0418355 | Ga0436365_0418355_598_1692 | 362 |
| 547 | 3300039437 | Ga0436365_1126455 | Ga0436365_1126455_874_1971 | 362 |
| 548 | 3300039437 | Ga0436365_1741712 | Ga0436365_1741712_1708_2844 | 362 |
| 549 | 3300046454 | Ga0495592_0020065 | Ga0495592_0020065_2396_3484 | 362 |
| 550 | 3300046454 | Ga0495592_0024541 | Ga0495592_0024541_1260_2348 | 362 |
| 551 | 3300046455 | Ga0495603_0007829 | Ga0495603_0007829_800_1888 | 362 |
| 552 | 3300046458 | Ga0495591_031376 | Ga0495591_031376_395_1483 | 362 |
| 553 | 3300046461 | Ga0495641_0025043 | Ga0495641_0025043_1570_2658 | 362 |
| 554 | 3300046463 | Ga0495653_0008326 | Ga0495653_0008326_2410_3498 | 362 |
| 555 | 3300046463 | Ga0495653_0038924 | Ga0495653_0038924_966_2054 | 362 |
| 556 | 3300046463 | Ga0495653_0059893 | Ga0495653_0059893_260_1348 | 362 |
| 557 | 3300046475 | Ga0495639_0039439 | Ga0495639_0039439_266_1354 | 362 |
| 558 | 3300046476 | Ga0495662_0013876 | Ga0495662_0013876_1683_2771 | 362 |
| 559 | 3300046477 | Ga0495664_0003537 | Ga0495664_0003537_2531_3619 | 362 |
| 560 | 3300046477 | Ga0495664_0028609 | Ga0495664_0028609_1202_2290 | 362 |
| 561 | 3300046492 | Ga0495585_0016072 | Ga0495585_0016072_921_2009 | 362 |
| 562 | 3300046499 | Ga0495594_0024673 | Ga0495594_0024673_1989_3077 | 362 |
| 563 | 3300046501 | Ga0495607_0015506 | Ga0495607_0015506_1786_2874 | 362 |
| 564 | 3300046511 | Ga0495608_0001474 | Ga0495608_0001474_5521_6609 | 362 |
| 565 | 3300046511 | Ga0495608_0017824 | Ga0495608_0017824_1394_2500 | 362 |
| 566 | 3300046512 | Ga0495610_0065325 | Ga0495610_0065325_203_1330 | 362 |
| 567 | 3300046514 | Ga0495618_0027234 | Ga0495618_0027234_2439_3527 | 362 |
| 568 | 3300046516 | Ga0495628_0001927 | Ga0495628_0001927_12319_13407 | 362 |
| 569 | 3300046516 | Ga0495628_0024184 | Ga0495628_0024184_554_1642 | 362 |
| 570 | 3300046516 | Ga0495628_0113567 | Ga0495628_0113567_30_1118 | 362 |
| 571 | 3300046517 | Ga0495630_0047564 | Ga0495630_0047564_815_1903 | 362 |
| 572 | 3300046517 | Ga0495630_0059407 | Ga0495630_0059407_1309_2397 | 362 |
| 573 | 3300046517 | Ga0495630_0332177 | Ga0495630_0332177_39_1133 | 362 |
| 574 | 3300046523 | Ga0495644_0006919 | Ga0495644_0006919_2025_3113 | 362 |
| 575 | 3300046529 | Ga0495652_0015699 | Ga0495652_0015699_2672_3760 | 362 |
| 576 | 3300046531 | Ga0495665_0038652 | Ga0495665_0038652_420_1508 | 362 |
| 577 | 3300046533 | Ga0495640_0020173 | Ga0495640_0020173_1140_2228 | 362 |
| 578 | 3300046533 | Ga0495640_0132462 | Ga0495640_0132462_97_1185 | 362 |
| 579 | 3300046533 | Ga0495640_0146655 | Ga0495640_0146655_361_1449 | 362 |
| 580 | 3300046535 | Ga0495586_0008177 | Ga0495586_0008177_1336_2424 | 362 |
| 581 | 3300046536 | Ga0495587_0002240 | Ga0495587_0002240_4815_5903 | 362 |
| 582 | 3300046536 | Ga0495587_0042135 | Ga0495587_0042135_577_1665 | 362 |
| 583 | 3300046543 | Ga0495645_0002539 | Ga0495645_0002539_4443_5531 | 362 |
| 584 | 3300046543 | Ga0495645_0023203 | Ga0495645_0023203_520_1608 | 362 |
| 585 | 3300046543 | Ga0495645_0119189 | Ga0495645_0119189_289_1377 | 362 |
| 586 | 3300046559 | Ga0495667_0001150 | Ga0495667_0001150_12178_13266 | 362 |
| 587 | 3300046559 | Ga0495667_0021829 | Ga0495667_0021829_1241_2329 | 362 |
| 588 | 3300046559 | Ga0495667_0057100 | Ga0495667_0057100_988_2076 | 362 |
| 589 | 3300046615 | Ga0495656_0003843 | Ga0495656_0003843_2709_3797 | 362 |
| 590 | 3300046642 | Ga0495634_0121245 | Ga0495634_0121245_140_1228 | 362 |
| 591 | 3300046663 | Ga0495635_0003881 | Ga0495635_0003881_6074_7162 | 362 |
| 592 | 3300046663 | Ga0495635_0037995 | Ga0495635_0037995_1312_2400 | 362 |
| 593 | 3300046663 | Ga0495635_0070978 | Ga0495635_0070978_553_1641 | 362 |
| 594 | 3300046664 | Ga0495659_0001458 | Ga0495659_0001458_1690_2778 | 362 |
| 595 | 3300046674 | Ga0495588_0013595 | Ga0495588_0013595_1722_2810 | 362 |
| 596 | 3300046678 | Ga0495599_0009859 | Ga0495599_0009859_1759_2847 | 362 |
| 597 | 3300046679 | Ga0495623_0000420 | Ga0495623_0000420_22042_23130 | 362 |
| 598 | 3300046680 | Ga0495646_0003113 | Ga0495646_0003113_1598_2686 | 362 |
| 599 | 3300046680 | Ga0495646_0051463 | Ga0495646_0051463_1267_2355 | 362 |
| 600 | 3300046681 | Ga0495647_0018043 | Ga0495647_0018043_871_1959 | 362 |
| 601 | 3300046689 | Ga0495613_0054377 | Ga0495613_0054377_407_1495 | 362 |
| 602 | 3300046690 | Ga0495624_0054221 | Ga0495624_0054221_128_1216 | 362 |
| 603 | 3300046690 | Ga0495624_0101906 | Ga0495624_0101906_420_1508 | 362 |
| 604 | 3300046691 | Ga0495670_0000291 | Ga0495670_0000291_19392_20480 | 362 |
| 605 | 3300046809 | Ga0495600_0001326 | Ga0495600_0001326_6010_7098 | 362 |
| 606 | 3300046809 | Ga0495600_0019703 | Ga0495600_0019703_2168_3256 | 362 |
| 607 | 3300046809 | Ga0495600_0060643 | Ga0495600_0060643_118_1206 | 362 |
| 608 | 3300047315 | Ga0495581_0043070 | Ga0495581_0043070_894_1982 | 362 |
| 609 | 3300047317 | Ga0495604_0003891 | Ga0495604_0003891_3193_4281 | 362 |
| 610 | 3300047317 | Ga0495604_0017520 | Ga0495604_0017520_933_2021 | 362 |
| 611 | 3300047317 | Ga0495604_0045926 | Ga0495604_0045926_2290_3378 | 362 |
| 612 | 3300047317 | Ga0495604_0055679 | Ga0495604_0055679_711_1817 | 362 |
| 613 | 3300047319 | Ga0495674_0042562 | Ga0495674_0042562_1684_2772 | 362 |
| 614 | 3300047319 | Ga0495674_0047567 | Ga0495674_0047567_2334_3422 | 362 |
| 615 | 3300047322 | Ga0495680_0044564 | Ga0495680_0044564_447_1535 | 362 |
| 616 | 3300047444 | Ga0495675_0001544 | Ga0495675_0001544_5355_6443 | 362 |
| 617 | 3300047444 | Ga0495675_0122552 | Ga0495675_0122552_147_1265 | 362 |
| 618 | 3300047471 | Ga0495684_0002087 | Ga0495684_0002087_3224_4312 | 362 |
| 619 | 3300047471 | Ga0495684_0023924 | Ga0495684_0023924_1357_2445 | 362 |
| 620 | 3300047673 | Ga0495593_0004626 | Ga0495593_0004626_227_1315 | 362 |
| 621 | 3300048088 | Ga0495602_0005526 | Ga0495602_0005526_5450_6538 | 362 |
| 622 | 3300048088 | Ga0495602_0057446 | Ga0495602_0057446_1099_2187 | 362 |
| 623 | 3300048088 | Ga0495602_0061017 | Ga0495602_0061017_601_1707 | 362 |
| 624 | 3300048089 | Ga0495614_0035948 | Ga0495614_0035948_420_1508 | 362 |
| 625 | 3300048903 | Ga0496100_0000106 | Ga0496100_0000106_40245_41333 | 362 |
| 626 | 3300048903 | Ga0496100_0166587 | Ga0496100_0166587_59_1147 | 362 |
| 627 | 3300048904 | Ga0496101_0000992 | Ga0496101_0000992_13661_14749 | 362 |
| 628 | 3300048904 | Ga0496101_0113210 | Ga0496101_0113210_746_1834 | 362 |
| 629 | 3300048904 | Ga0496101_0271289 | Ga0496101_0271289_89_1177 | 362 |
| 630 | 3300048905 | Ga0496102_0041646 | Ga0496102_0041646_2848_3936 | 362 |
| 631 | 3300048905 | Ga0496102_0091000 | Ga0496102_0091000_80_1168 | 362 |
| 632 | 3300048905 | Ga0496102_0176008 | Ga0496102_0176008_467_1555 | 362 |
| 633 | 3300048905 | Ga0496102_0329375 | Ga0496102_0329375_89_1177 | 362 |
| 634 | 3300048906 | Ga0496103_0010395 | Ga0496103_0010395_2931_4019 | 362 |
| 635 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_70181_71269 | 362 |
| 636 | 3300048907 | Ga0496104_0244328 | Ga0496104_0244328_131_1219 | 362 |
| 637 | 3300048908 | Ga0496105_0018996 | Ga0496105_0018996_2446_3534 | 362 |
| 638 | 3300048909 | Ga0496106_0026062 | Ga0496106_0026062_332_1420 | 362 |
| 639 | 3300048909 | Ga0496106_0066563 | Ga0496106_0066563_1418_2506 | 362 |
| 640 | 3300048910 | Ga0496107_0000223 | Ga0496107_0000223_2931_4019 | 362 |
| 641 | 3300048910 | Ga0496107_0026443 | Ga0496107_0026443_1495_2583 | 362 |
| 642 | 3300048910 | Ga0496107_0066614 | Ga0496107_0066614_257_1345 | 362 |
| 643 | 3300048910 | Ga0496107_0066871 | Ga0496107_0066871_513_1601 | 362 |
| 644 | 3300048910 | Ga0496107_0076992 | Ga0496107_0076992_59_1147 | 362 |
| 645 | 3300048911 | Ga0496108_0003914 | Ga0496108_0003914_6229_7317 | 362 |
| 646 | 3300048911 | Ga0496108_0059924 | Ga0496108_0059924_149_1237 | 362 |
| 647 | 3300048912 | Ga0496109_0025242 | Ga0496109_0025242_1275_2363 | 362 |
| 648 | 3300048912 | Ga0496109_0108971 | Ga0496109_0108971_528_1616 | 362 |
| 649 | 3300048913 | Ga0496110_0022213 | Ga0496110_0022213_4167_5255 | 362 |
| 650 | 3300048914 | Ga0496111_0073817 | Ga0496111_0073817_595_1683 | 362 |
| 651 | 3300048915 | Ga0496112_0056898 | Ga0496112_0056898_1447_2535 | 362 |
| 652 | 3300048915 | Ga0496112_0092411 | Ga0496112_0092411_1830_2918 | 362 |
| 653 | 3300048915 | Ga0496112_0172239 | Ga0496112_0172239_958_2046 | 362 |
| 654 | 3300048915 | Ga0496112_0255789 | Ga0496112_0255789_465_1553 | 362 |
| 655 | 3300048916 | Ga0496113_0019689 | Ga0496113_0019689_3500_4588 | 362 |
| 656 | 3300048916 | Ga0496113_0164949 | Ga0496113_0164949_646_1734 | 362 |
| 657 | 3300048917 | Ga0496114_0006841 | Ga0496114_0006841_1734_2822 | 362 |
| 658 | 3300048917 | Ga0496114_0302343 | Ga0496114_0302343_41_1129 | 362 |
| 659 | 3300048918 | Ga0496115_0010308 | Ga0496115_0010308_4978_6066 | 362 |
| 660 | 3300048918 | Ga0496115_0032463 | Ga0496115_0032463_59_1147 | 362 |
| 661 | 3300048918 | Ga0496115_0253738 | Ga0496115_0253738_211_1299 | 362 |
| 662 | 3300048920 | Ga0496117_0028863 | Ga0496117_0028863_2257_3378 | 362 |
| 663 | 3300049569 | Ga0501032_0039937 | Ga0501032_0039937_1972_3177 | 362 |
| 664 | 3300049571 | Ga0501034_0002201 | Ga0501034_0002201_22874_23962 | 362 |
| 665 | 3300049571 | Ga0501034_0031278 | Ga0501034_0031278_2337_3425 | 362 |
| 666 | 3300049571 | Ga0501034_0122326 | Ga0501034_0122326_863_1996 | 362 |
| 667 | 3300049571 | Ga0501034_0124143 | Ga0501034_0124143_493_1581 | 362 |
| 668 | 3300049571 | Ga0501034_0214893 | Ga0501034_0214893_685_1773 | 362 |
| 669 | 3300049572 | Ga0501036_0001075 | Ga0501036_0001075_1469_2557 | 362 |
| 670 | 3300049572 | Ga0501036_0022844 | Ga0501036_0022844_3926_5014 | 362 |
| 671 | 3300049572 | Ga0501036_0029453 | Ga0501036_0029453_2974_4107 | 362 |
| 672 | 3300049573 | Ga0501037_0019552 | Ga0501037_0019552_2073_3161 | 362 |
| 673 | 3300049573 | Ga0501037_0032411 | Ga0501037_0032411_117_1205 | 362 |
| 674 | 3300049573 | Ga0501037_0040360 | Ga0501037_0040360_33_1121 | 362 |
| 675 | 3300049573 | Ga0501037_0041242 | Ga0501037_0041242_1687_2775 | 362 |
| 676 | 3300049573 | Ga0501037_0054451 | Ga0501037_0054451_332_1420 | 362 |
| 677 | 3300049574 | Ga0501038_0076689 | Ga0501038_0076689_591_1724 | 362 |
| 678 | 3300049574 | Ga0501038_0098169 | Ga0501038_0098169_365_1453 | 362 |
| 679 | 3300049575 | Ga0501039_0034413 | Ga0501039_0034413_2432_3565 | 362 |
| 680 | 3300049579 | Ga0501043_0007548 | Ga0501043_0007548_4204_5292 | 362 |
| 681 | 3300049580 | Ga0501046_0044408 | Ga0501046_0044408_1870_2958 | 362 |
| 682 | 3300049580 | Ga0501046_0057378 | Ga0501046_0057378_654_1787 | 362 |
| 683 | 3300049580 | Ga0501046_0105257 | Ga0501046_0105257_798_1886 | 362 |
| 684 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_76993_78081 | 362 |
| 685 | 3300049581 | Ga0501047_0032068 | Ga0501047_0032068_2976_4109 | 362 |
| 686 | 3300049582 | Ga0501048_0000592 | Ga0501048_0000592_16631_17719 | 362 |
| 687 | 3300049584 | Ga0501068_0008615 | Ga0501068_0008615_3068_4201 | 362 |
| 688 | 3300049584 | Ga0501068_0020726 | Ga0501068_0020726_2325_3413 | 362 |
| 689 | 3300049584 | Ga0501068_0061365 | Ga0501068_0061365_1025_2158 | 362 |
| 690 | 3300049585 | Ga0501069_0012513 | Ga0501069_0012513_1970_3067 | 362 |
| 691 | 3300049585 | Ga0501069_0039276 | Ga0501069_0039276_1098_2231 | 362 |
| 692 | 3300049586 | Ga0501070_0012558 | Ga0501070_0012558_116_1249 | 362 |
| 693 | 3300049586 | Ga0501070_0015015 | Ga0501070_0015015_151_1239 | 362 |
| 694 | 3300049586 | Ga0501070_0024118 | Ga0501070_0024118_2090_3178 | 362 |
| 695 | 3300049586 | Ga0501070_0042658 | Ga0501070_0042658_272_1369 | 362 |
| 696 | 3300049586 | Ga0501070_0150330 | Ga0501070_0150330_301_1389 | 362 |
| 697 | 3300049586 | Ga0501070_0154369 | Ga0501070_0154369_161_1249 | 362 |
| 698 | 3300049587 | Ga0501071_0017492 | Ga0501071_0017492_903_2036 | 362 |
| 699 | 3300049589 | Ga0501073_0088132 | Ga0501073_0088132_229_1317 | 362 |
| 700 | 3300049589 | Ga0501073_0110866 | Ga0501073_0110866_439_1572 | 362 |
| 701 | 3300049590 | Ga0501074_0010211 | Ga0501074_0010211_2543_3631 | 362 |
| 702 | 3300049590 | Ga0501074_0019545 | Ga0501074_0019545_3202_4335 | 362 |
| 703 | 3300049593 | Ga0501077_0083389 | Ga0501077_0083389_842_1969 | 362 |
| 704 | 3300049742 | Ga0501080_0000314 | Ga0501080_0000314_20352_21440 | 362 |
| 705 | 3300049742 | Ga0501080_0033861 | Ga0501080_0033861_3521_4609 | 362 |
| 706 | 3300049742 | Ga0501080_0099096 | Ga0501080_0099096_904_2037 | 362 |
| 707 | 3300049742 | Ga0501080_0149735 | Ga0501080_0149735_671_1804 | 362 |
| 708 | 3300049742 | Ga0501080_0172916 | Ga0501080_0172916_836_1969 | 362 |
| 709 | 3300049744 | Ga0501083_0001213 | Ga0501083_0001213_10814_11902 | 362 |
| 710 | 3300049744 | Ga0501083_0029708 | Ga0501083_0029708_2407_3495 | 362 |
| 711 | 3300049744 | Ga0501083_0057891 | Ga0501083_0057891_74_1162 | 362 |
| 712 | 3300049822 | Ga0501035_0008723 | Ga0501035_0008723_6454_7587 | 362 |
| 713 | 3300049823 | Ga0501044_0007386 | Ga0501044_0007386_7980_9068 | 362 |
| 714 | 3300049823 | Ga0501044_0035271 | Ga0501044_0035271_3311_4444 | 362 |
| 715 | 3300049823 | Ga0501044_0037111 | Ga0501044_0037111_1713_2801 | 362 |
| 716 | 3300049823 | Ga0501044_0043548 | Ga0501044_0043548_670_1803 | 362 |
| 717 | 3300049823 | Ga0501044_0206170 | Ga0501044_0206170_132_1220 | 362 |
| 718 | 3300049823 | Ga0501044_0229279 | Ga0501044_0229279_117_1205 | 362 |
| 719 | 3300050493 | nmdc:mga0k408_15093_c1 | nmdc:mga0k408_15093_c1_2943_4094 | 362 |
| 720 | 3300050494 | nmdc:mga06z11_16338_c1 | nmdc:mga06z11_16338_c1_2149_3237 | 362 |
| 721 | 3300050494 | nmdc:mga06z11_22614_c1 | nmdc:mga06z11_22614_c1_206_1306 | 362 |
| 722 | 3300050494 | nmdc:mga06z11_71985_c1 | nmdc:mga06z11_71985_c1_486_1586 | 362 |
| 723 | 3300050496 | nmdc:mga07m45_106529_c1 | nmdc:mga07m45_106529_c1_145_1245 | 362 |
| 724 | 3300050507 | nmdc:mga05p37_56_c3 | nmdc:mga05p37_56_c3_39913_41001 | 362 |
| 725 | 3300050508 | nmdc:mga09592_976_c1 | nmdc:mga09592_976_c1_2375_3463 | 362 |
| 726 | 3300050509 | nmdc:mga0qj67_13755_c1 | nmdc:mga0qj67_13755_c1_2503_3591 | 362 |
| 727 | 3300050510 | nmdc:mga06r32_6105_c1 | nmdc:mga06r32_6105_c1_869_1957 | 362 |
| 728 | 3300050511 | nmdc:mga08y16_10256_c1 | nmdc:mga08y16_10256_c1_785_1873 | 362 |
| 729 | 3300050511 | nmdc:mga08y16_138559_c1 | nmdc:mga08y16_138559_c1_148_1236 | 362 |
| 730 | 3300050511 | nmdc:mga08y16_144351_c1 | nmdc:mga08y16_144351_c1_1229_2356 | 362 |
| 731 | 3300050511 | nmdc:mga08y16_206_c1 | nmdc:mga08y16_206_c1_5039_6127 | 362 |
| 732 | 3300050511 | nmdc:mga08y16_2396_c1 | nmdc:mga08y16_2396_c1_3746_4834 | 362 |
| 733 | 3300050512 | nmdc:mga0n895_138396_c1 | nmdc:mga0n895_138396_c1_1216_2304 | 362 |
| 734 | 3300050512 | nmdc:mga0n895_2745_c1 | nmdc:mga0n895_2745_c1_3731_4864 | 362 |
| 735 | 3300050512 | nmdc:mga0n895_4632_c1 | nmdc:mga0n895_4632_c1_2646_3734 | 362 |
| 736 | 3300050513 | nmdc:mga0rr50_13492_c1 | nmdc:mga0rr50_13492_c1_1269_2357 | 362 |
| 737 | 3300050513 | nmdc:mga0rr50_31674_c1 | nmdc:mga0rr50_31674_c1_743_1831 | 362 |
| 738 | 3300050513 | nmdc:mga0rr50_8402_c1 | nmdc:mga0rr50_8402_c1_3888_4976 | 362 |
| 739 | 3300050514 | nmdc:mga08x19_116588_c1 | nmdc:mga08x19_116588_c1_258_1346 | 362 |
| 740 | 3300050514 | nmdc:mga08x19_24581_c1 | nmdc:mga08x19_24581_c1_2516_3604 | 362 |
| 741 | 3300050515 | nmdc:mga0a205_380_c1 | nmdc:mga0a205_380_c1_1772_2860 | 362 |
| 742 | 3300050515 | nmdc:mga0a205_80_c1 | nmdc:mga0a205_80_c1_46881_47969 | 362 |
| 743 | 3300050516 | nmdc:mga0sz30_53897_c1 | nmdc:mga0sz30_53897_c1_22_1143 | 362 |
| 744 | 3300053077 | Ga0495601_0000360 | Ga0495601_0000360_10641_11729 | 362 |
| 745 | 3300053077 | Ga0495601_0001260 | Ga0495601_0001260_6010_7098 | 362 |
| 746 | 3300053077 | Ga0495601_0012407 | Ga0495601_0012407_2873_3961 | 362 |
| 747 | 3300053077 | Ga0495601_0018263 | Ga0495601_0018263_1571_2677 | 362 |
| 748 | 3300053077 | Ga0495601_0088044 | Ga0495601_0088044_548_1636 | 362 |
| 749 | 3300053078 | Ga0495612_0000964 | Ga0495612_0000964_5829_6917 | 362 |
| 750 | 3300053078 | Ga0495612_0001978 | Ga0495612_0001978_4973_6061 | 362 |
| 751 | 3300053078 | Ga0495612_0014718 | Ga0495612_0014718_1064_2152 | 362 |
| 752 | 3300053084 | Ga0495595_0000969 | Ga0495595_0000969_5547_6635 | 362 |
| 753 | 3300053084 | Ga0495595_0009105 | Ga0495595_0009105_1345_2451 | 362 |
| 754 | 3300053084 | Ga0495595_0020214 | Ga0495595_0020214_705_1793 | 362 |
| 755 | 3300053085 | Ga0495619_0000581 | Ga0495619_0000581_4793_5881 | 362 |
| 756 | 3300053085 | Ga0495619_0001851 | Ga0495619_0001851_6076_7164 | 362 |
| 757 | 3300053085 | Ga0495619_0008740 | Ga0495619_0008740_3712_4818 | 362 |
| 758 | 3300053085 | Ga0495619_0008848 | Ga0495619_0008848_3399_4487 | 362 |
| 759 | 3300053094 | Ga0500566_0067112 | Ga0500566_0067112_33_1121 | 362 |
| 760 | 3300053119 | Ga0500595_007827 | Ga0500595_007827_134_1231 | 362 |
| 761 | 3300053153 | Ga0500616_0036227 | Ga0500616_0036227_697_1824 | 362 |
| 762 | 3300053156 | Ga0500622_0009576 | Ga0500622_0009576_2850_3977 | 362 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd0-assembly1.cif.gz_A | the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety | 0.8749 | 1 | 360 |
| 2g04-assembly2.cif.gz_D | crystal structure of fatty acid-coa racemase from mycobacterium tuberculosis h37rv | 0.8743 | 1 | 359 |
| 2yim-assembly2.cif.gz_C | the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue | 0.8725 | 1 | 362 |
| 5yx6-assembly2.cif.gz_D | crystal structure of rv3272 from m. tuberculosis orthorhombic form | 0.8538 | 1 | 362 |
| 5yit-assembly1.cif.gz_A | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.8503 | 1 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x74D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9358 | 7 | 199 | 3.40.50.10540 |
| af_Q18122_212_295_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9301 | 231 | 309 | 3.40.50.10540 |
| af_Q9VIK0_212_295_3.30.1540.10 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9256 | 229 | 309 | 3.30.1540.10 |
| af_Q4V9F2_1_227_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9136 | 24 | 222 | 3.40.50.10540 |
| 4hl6D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9105 | 1 | 225 | 3.40.50.10540 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1I7B9-F1-model_v4 | Glycerate-2-kinase | 0.9685 | 1 | 362 |
GO:0005737
GO:0008887 |
| AF-V4RC96-F1-model_v4 | Alpha-methylacyl-CoA racemase (EC 5.1.99.4) | 0.9666 | 1 | 362 |
GO:0008111
|
| AF-A0A1H1I7B9-F1-model_v4 | Glycerate-2-kinase | 0.9659 | 1 | 362 |
GO:0005737
GO:0008887 |
| AF-V4RC96-F1-model_v4 | Alpha-methylacyl-CoA racemase (EC 5.1.99.4) | 0.964 | 1 | 362 |
GO:0008111
|
| AF-A0A0P1GHG1-F1-model_v4 | Formyl-coenzyme A transferase (EC 2.8.3.16) | 0.9604 | 1 | 213 |
GO:0033608
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar