F479662

General Info

Members Datasets Scaffolds Average Seq Length
762 396 750 362

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_005433|Ga0500643_005433_1326_2387
Length 353
Sequence MQPLSGLLVLDFTTLLPGPLASLMLAEAGAEVIKIERPGGEDMRHFAPAIDGESVPFAMLNRGKQVLTLDLKNQADRDKLIPLLKRADILIEQFRPGVMARLGLGYDEVRKINPKLIYCSISGYGQSGSRADEAGHDINYIGNTGVLDLQPGPLHRPVVPPVLVADIAGGSFPAVINILLALRARDQSGQGCHLDIAMTDAMFTFAWYALALGAAAKFPKSGEMWLVGSSPRYQLYPTKDGKIVACGAIEQKFWDSFVAAIGLPAEFGDDKRNPAATRDAVAKLIAAKTADEWRPLLATADCCVTIVMPLEEALRDPHFVGRGLFAHKIETASGKTIPALPVPIAPAFRRDPD

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2643221733 Bosea sp. Root381 Isolate Unclassified
4 2643221734 Bosea sp. Root670 Isolate Unclassified
5 2643221736 Bosea sp. Root483D1 Isolate Unclassified
6 2818991467 Bosea vestrisii 3192 Isolate Unclassified
7 2841760612 Bosea sp. Tri-49 Isolate Nodule
8 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
9 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
10 2844104063 Bosea sp. Tri-39 Isolate Nodule
11 2851182111 Bosea sp. Tri-44 Isolate Nodule
12 2851246043 Bosea sp. Tri-54 Isolate Nodule
13 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
246 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
247 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
382 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
386 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0.39
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0.79
Rhizoplane 5.91
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214939624 2209111006 Bacteria 6562
2 ARcpr5oldR_c000195 3300000041 Bacteria 10319
3 JGI24746J21847_1000397 3300001977 Bacteria 6455
4 JGI24739J22299_10002770 3300001989 Bacteria 6738
5 JGI24737J22298_10000960 3300001990 Bacteria 10240
6 JGI24750J21931_1000172 3300002070 Bacteria 10780
7 JGI24748J21848_1000441 3300002074 Bacteria 4612
8 JGI24738J21930_10000223 3300002075 Bacteria 15332
9 JGI24749J21850_1001027 3300002076 Bacteria 3965
10 JGI24744J21845_10004694 3300002077 Bacteria 2824
11 JGI24035J26624_1000220 3300002126 Bacteria 5227
12 JGI25151J46595_10000155 3300003187 Bacteria 89339
13 JGI25406J46586_10008160 3300003203 Bacteria 4756
14 Ga0055526_1000225 3300003771 Bacteria 47943
15 Ga0055524_1000078 3300003775 Bacteria 120745
16 Ga0065165_1000089 3300005262 Bacteria 150859
17 Ga0065712_10077159 3300005290 Bacteria 3540
18 Ga0065715_10008649 3300005293 Bacteria 4878
19 Ga0070658_10059765 3300005327 Bacteria 3104
20 Ga0070676_10000012 3300005328 Bacteria 58061
21 Ga0070676_10204003 3300005328 Bacteria 1298
22 Ga0070683_100000139 3300005329 Bacteria 46987
23 Ga0070690_100005164 3300005330 Bacteria 7309
24 Ga0070690_100195429 3300005330 Bacteria 1405
25 Ga0070670_100006855 3300005331 Bacteria 9652
26 Ga0070670_100213878 3300005331 Bacteria 1676
27 Ga0070677_10000125 3300005333 Bacteria 25491
28 Ga0068869_100000605 3300005334 Bacteria 20215
29 Ga0068869_100107020 3300005334 Bacteria 2123
30 Ga0070666_10019221 3300005335 Bacteria 4407
31 Ga0070666_10159165 3300005335 Bacteria 1578
32 Ga0070680_100000179 3300005336 Bacteria 40975
33 Ga0070680_100101322 3300005336 Bacteria 2390
34 Ga0070682_100000319 3300005337 Bacteria 33197
35 Ga0070682_100080901 3300005337 Bacteria 2102
36 Ga0068868_100001158 3300005338 Bacteria 18075
37 Ga0068868_100024252 3300005338 Bacteria 4601
38 Ga0070660_100001605 3300005339 Bacteria 15534
39 Ga0070660_100021236 3300005339 Bacteria 4785
40 Ga0070660_100047355 3300005339 Bacteria 3299
41 Ga0070660_100072922 3300005339 Bacteria 2683
42 Ga0070689_100002178 3300005340 Bacteria 12687
43 Ga0070689_100004685 3300005340 Bacteria 9267
44 Ga0070691_10001565 3300005341 Bacteria 9871
45 Ga0070691_10007128 3300005341 Bacteria 5124
46 Ga0070687_100179604 3300005343 Bacteria 1267
47 Ga0070661_100001455 3300005344 Bacteria 16432
48 Ga0070661_100021209 3300005344 Bacteria 4636
49 Ga0070692_10000434 3300005345 Bacteria 12695
50 Ga0070692_10015896 3300005345 Bacteria 3569
51 Ga0070668_100004423 3300005347 Bacteria 10433
52 Ga0070669_100000409 3300005353 Bacteria 32911
53 Ga0070669_100020734 3300005353 Bacteria 4696
54 Ga0070669_100079795 3300005353 Bacteria 2434
55 Ga0070669_100220338 3300005353 Bacteria 1500
56 Ga0070675_100000166 3300005354 Bacteria 40573
57 Ga0070675_100019299 3300005354 Bacteria 5430
58 Ga0070674_100000644 3300005356 Bacteria 17586
59 Ga0070674_100034246 3300005356 Bacteria 3390
60 Ga0070673_100000041 3300005364 Bacteria 54096
61 Ga0070688_100000180 3300005365 Bacteria 33887
62 Ga0070688_100000730 3300005365 Bacteria 16219
63 Ga0070659_100000752 3300005366 Bacteria 23551
64 Ga0070659_100056123 3300005366 Bacteria 3105
65 Ga0070667_100000365 3300005367 Bacteria 49335
66 Ga0070667_100019198 3300005367 Bacteria 5668
67 Ga0070667_100116424 3300005367 Bacteria 2321
68 Ga0070703_10000903 3300005406 Bacteria 9460
69 Ga0070709_10003137 3300005434 Bacteria 8867
70 Ga0070709_10025535 3300005434 Bacteria 3492
71 Ga0070709_10110170 3300005434 Bacteria 1849
72 Ga0070714_100009592 3300005435 Bacteria 7619
73 Ga0070714_100048797 3300005435 Bacteria 3601
74 Ga0070714_100175957 3300005435 Bacteria 1944
75 Ga0070713_100034309 3300005436 Bacteria 4075
76 Ga0070710_10024251 3300005437 Bacteria 3198
77 Ga0070710_10053343 3300005437 Bacteria 2277
78 Ga0070701_10000493 3300005438 Bacteria 13517
79 Ga0070711_100030206 3300005439 Bacteria 3585
80 Ga0070711_100048418 3300005439 Bacteria 2906
81 Ga0070705_100232913 3300005440 Bacteria 1283
82 Ga0070700_100000467 3300005441 Bacteria 20231
83 Ga0070694_100000065 3300005444 Bacteria 49515
84 Ga0070694_100240852 3300005444 Bacteria 1364
85 Ga0070663_100000473 3300005455 Bacteria 21137
86 Ga0070663_100056324 3300005455 Bacteria 2816
87 Ga0070663_100325352 3300005455 Bacteria 1237
88 Ga0070678_100000091 3300005456 Bacteria 34559
89 Ga0070662_100022629 3300005457 Bacteria 4305
90 Ga0070662_100023595 3300005457 Bacteria 4227
91 Ga0070681_10135990 3300005458 Bacteria 2388
92 Ga0068867_100001090 3300005459 Bacteria 18551
93 Ga0068867_100020555 3300005459 Bacteria 4705
94 Ga0070685_10001731 3300005466 Bacteria 11442
95 Ga0070685_10099410 3300005466 Bacteria 1774
96 Ga0070699_100356833 3300005518 Bacteria 1317
97 Ga0070679_100015891 3300005530 Bacteria 7244
98 Ga0070679_100055203 3300005530 Bacteria 3956
99 Ga0070679_100071862 3300005530 Bacteria 3452
100 Ga0070679_100079573 3300005530 Bacteria 3267
101 Ga0070679_100162727 3300005530 Bacteria 2205
102 Ga0070684_100000219 3300005535 Bacteria 39995
103 Ga0070684_100132421 3300005535 Bacteria 2249
104 Ga0070684_100198285 3300005535 Bacteria 1828
105 Ga0068853_100000600 3300005539 Bacteria 24713
106 Ga0068853_100037517 3300005539 Bacteria 4123
107 Ga0068853_100267372 3300005539 Bacteria 1574
108 Ga0070672_100000019 3300005543 Bacteria 69855
109 Ga0070686_100000318 3300005544 Bacteria 31671
110 Ga0070686_100013377 3300005544 Bacteria 4697
111 Ga0070686_100015710 3300005544 Bacteria 4391
112 Ga0070695_100000474 3300005545 Bacteria 20848
113 Ga0070695_100006777 3300005545 Bacteria 6781
114 Ga0070696_100029045 3300005546 Bacteria 3775
115 Ga0070696_100041201 3300005546 Bacteria 3190
116 Ga0070665_100010015 3300005548 Bacteria 9588
117 Ga0070704_100000252 3300005549 Bacteria 23218
118 Ga0068855_100012274 3300005563 Bacteria 10352
119 Ga0068855_100019218 3300005563 Bacteria 8212
120 Ga0068855_100259502 3300005563 Bacteria 1936
121 Ga0070664_100000819 3300005564 Bacteria 23927
122 Ga0070664_100080238 3300005564 Bacteria 2810
123 Ga0070664_100127997 3300005564 Bacteria 2229
124 Ga0068857_100000768 3300005577 Bacteria 23872
125 Ga0068857_100233957 3300005577 Bacteria 1681
126 Ga0068854_100000179 3300005578 Bacteria 43176
127 Ga0068854_100114473 3300005578 Bacteria 2039
128 Ga0068856_100002295 3300005614 Bacteria 19718
129 Ga0068856_100097861 3300005614 Bacteria 2924
130 Ga0068856_100140566 3300005614 Bacteria 2421
131 Ga0070702_100000898 3300005615 Bacteria 11591
132 Ga0068852_100001992 3300005616 Bacteria 13920
133 Ga0068852_100291384 3300005616 Bacteria 1577
134 Ga0068852_100443617 3300005616 Bacteria 1284
135 Ga0068859_100001870 3300005617 Bacteria 21434
136 Ga0068864_100000429 3300005618 Bacteria 36391
137 Ga0068864_100201999 3300005618 Bacteria 1826
138 Ga0068866_10000461 3300005718 Bacteria 18602
139 Ga0068861_100000169 3300005719 Bacteria 34559
140 Ga0068870_10000586 3300005840 Bacteria 13817
141 Ga0068863_100000381 3300005841 Bacteria 45003
142 Ga0068858_100009197 3300005842 Bacteria 9441
143 Ga0068858_100081595 3300005842 Bacteria 3006
144 Ga0068860_100001472 3300005843 Bacteria 25432
145 Ga0068860_100028934 3300005843 Bacteria 5331
146 Ga0068860_100104941 3300005843 Bacteria 2698
147 Ga0068862_100001886 3300005844 Bacteria 19006
148 Ga0068862_100003346 3300005844 Bacteria 13839
149 Ga0081455_10000036 3300005937 Bacteria 136303
150 Ga0081539_10000800 3300005985 Bacteria 61179
151 Ga0070717_10000199 3300006028 Bacteria 41940
152 Ga0075368_10007349 3300006042 Bacteria 3884
153 Ga0075432_10000873 3300006058 Bacteria 9497
154 Ga0075432_10040078 3300006058 Bacteria 1634
155 Ga0070715_10053985 3300006163 Bacteria 1739
156 Ga0070716_100015201 3300006173 Bacteria 3950
157 Ga0070716_100063466 3300006173 Bacteria 2145
158 Ga0070712_100329784 3300006175 Bacteria 1243
159 Ga0075367_10033854 3300006178 Bacteria 2948
160 Ga0075369_10063403 3300006186 Bacteria 1617
161 Ga0097621_100001234 3300006237 Bacteria 17707
162 Ga0068871_100000068 3300006358 Bacteria 57531
163 Ga0068871_100081861 3300006358 Bacteria 2675
164 Ga0075430_100004696 3300006846 Bacteria 11490
165 Ga0075431_100005522 3300006847 Bacteria 12483
166 Ga0075431_100006639 3300006847 Bacteria 11490
167 Ga0075433_10001599 3300006852 Bacteria 16784
168 Ga0075433_10013425 3300006852 Bacteria 6660
169 Ga0075434_100000576 3300006871 Bacteria 28251
170 Ga0075434_100001666 3300006871 Bacteria 18944
171 Ga0075429_100013193 3300006880 Bacteria 7170
172 Ga0068865_100015742 3300006881 Bacteria 4826
173 Ga0075436_100098484 3300006914 Bacteria 2035
174 Ga0075436_100222644 3300006914 Bacteria 1339
175 Ga0097620_100001870 3300006931 Bacteria 21434
176 Ga0075435_100002716 3300007076 Bacteria 11816
177 Ga0075435_100042109 3300007076 Bacteria 3652
178 Ga0075435_100067418 3300007076 Bacteria 2914
179 Ga0105240_10023458 3300009093 Bacteria 8157
180 Ga0111539_10000503 3300009094 Bacteria 49808
181 Ga0111539_10003417 3300009094 Bacteria 20918
182 Ga0111539_10175783 3300009094 Bacteria 2501
183 Ga0105245_10000780 3300009098 Bacteria 28901
184 Ga0105245_10078335 3300009098 Bacteria 3015
185 Ga0105247_10038234 3300009101 Bacteria 2929
186 Ga0105247_10241738 3300009101 Bacteria 1230
187 Ga0114129_10013874 3300009147 Bacteria 11481
188 Ga0114129_10023827 3300009147 Bacteria 8676
189 Ga0114129_10049593 3300009147 Bacteria 5898
190 Ga0114129_10169964 3300009147 Bacteria 2973
191 Ga0105243_10001083 3300009148 Bacteria 24917
192 Ga0105243_10232362 3300009148 Bacteria 1637
193 Ga0105241_10000760 3300009174 Bacteria 24503
194 Ga0105241_10129672 3300009174 Bacteria 2040
195 Ga0105242_10006332 3300009176 Bacteria 9118
196 Ga0105242_10030536 3300009176 Bacteria 4303
197 Ga0105242_10072061 3300009176 Bacteria 2868
198 Ga0105248_10011305 3300009177 Bacteria 9844
199 Ga0105248_10168883 3300009177 Bacteria 2465
200 Ga0105237_10007890 3300009545 Bacteria 11599
201 Ga0105237_10064505 3300009545 Bacteria 3659
202 Ga0105237_10173560 3300009545 Bacteria 2156
203 Ga0105238_10035142 3300009551 Bacteria 5096
204 Ga0105238_10091855 3300009551 Bacteria 3023
205 Ga0105249_10002196 3300009553 Bacteria 16907
206 Ga0105249_10017908 3300009553 Bacteria 6295
207 Ga0105249_10362518 3300009553 Bacteria 1471
208 Ga0105239_10002791 3300010375 Bacteria 21868
209 Ga0105239_10003820 3300010375 Bacteria 18300
210 Ga0105239_10419325 3300010375 Bacteria 1516
211 Ga0105246_10000061 3300011119 Bacteria 44338
212 Ga0105246_10032648 3300011119 Bacteria 3454
213 Ga0157373_10084995 3300013100 Bacteria 2230
214 Ga0157373_10110205 3300013100 Bacteria 1935
215 Ga0157371_10035739 3300013102 Bacteria 3559
216 Ga0157371_10068201 3300013102 Bacteria 2517
217 Ga0157371_10141143 3300013102 Bacteria 1716
218 Ga0157370_10102731 3300013104 Bacteria 2676
219 Ga0157370_10118954 3300013104 Bacteria 2467
220 Ga0157370_10181509 3300013104 Bacteria 1955
221 Ga0171462_1046 3300013250 Bacteria 49873
222 Ga0157374_10001691 3300013296 Bacteria 18474
223 Ga0157378_10001445 3300013297 Bacteria 21386
224 Ga0163162_10000790 3300013306 Bacteria 29412
225 Ga0163162_10018394 3300013306 Bacteria 6847
226 Ga0157372_10009037 3300013307 Bacteria 10590
227 Ga0157375_10000468 3300013308 Bacteria 36848
228 Ga0163163_10001508 3300014325 Bacteria 19688
229 Ga0163163_10184099 3300014325 Bacteria 2136
230 Ga0157380_10002913 3300014326 Bacteria 11638
231 Ga0157380_10255509 3300014326 Bacteria 1589
232 Ga0157377_10000276 3300014745 Bacteria 24762
233 Ga0157379_10002285 3300014968 Bacteria 15975
234 Ga0157379_10026464 3300014968 Bacteria 5164
235 Ga0157379_10138607 3300014968 Bacteria 2193
236 Ga0157376_10000692 3300014969 Bacteria 21811
237 Ga0157376_10043172 3300014969 Bacteria 3699
238 Ga0157376_10250041 3300014969 Bacteria 1655
239 Ga0163161_10000384 3300017792 Bacteria 37040
240 Ga0163161_10079048 3300017792 Bacteria 2418
241 Ga0206356_11266497 3300020070 Bacteria 1236
242 Ga0206353_10547365 3300020082 Bacteria 3464
243 Ga0206353_11680947 3300020082 Bacteria 3468
244 Ga0213875_10000007 3300021388 Bacteria 562717
245 Ga0207666_1000097 3300025271 Bacteria 13853
246 Ga0209130_1000087 3300025284 Bacteria 155407
247 Ga0209675_1001209 3300025291 Bacteria 15665
248 Ga0209025_1000014 3300025294 Bacteria 865448
249 Ga0209025_1003588 3300025294 Bacteria 14488
250 Ga0209564_1000017 3300025295 Bacteria 594063
251 Ga0209564_1000187 3300025295 Bacteria 146950
252 Ga0209256_1000055 3300025299 Bacteria 295530
253 Ga0209256_1000146 3300025299 Bacteria 149440
254 Ga0207426_1003682 3300025302 Bacteria 8045
255 Ga0207697_10000550 3300025315 Bacteria 21243
256 Ga0207653_10002301 3300025885 Bacteria 6096
257 Ga0207682_10000088 3300025893 Bacteria 41732
258 Ga0207682_10001441 3300025893 Bacteria 10974
259 Ga0207692_10030999 3300025898 Bacteria 2556
260 Ga0207642_10000926 3300025899 Bacteria 9202
261 Ga0207710_10024509 3300025900 Bacteria 2599
262 Ga0207710_10032633 3300025900 Bacteria 2281
263 Ga0207688_10001203 3300025901 Bacteria 13390
264 Ga0207688_10023663 3300025901 Bacteria 3366
265 Ga0207680_10013156 3300025903 Bacteria 4241
266 Ga0207680_10015527 3300025903 Bacteria 3975
267 Ga0207647_10002714 3300025904 Bacteria 13370
268 Ga0207699_10002088 3300025906 Bacteria 9440
269 Ga0207645_10000140 3300025907 Bacteria 55845
270 Ga0207645_10136971 3300025907 Bacteria 1594
271 Ga0207643_10000083 3300025908 Bacteria 62116
272 Ga0207705_10044728 3300025909 Bacteria 3182
273 Ga0207654_10063367 3300025911 Bacteria 2169
274 Ga0207707_10004967 3300025912 Bacteria 11688
275 Ga0207707_10013826 3300025912 Bacteria 7038
276 Ga0207707_10069584 3300025912 Bacteria 3067
277 Ga0207707_10196931 3300025912 Bacteria 1757
278 Ga0207695_10088621 3300025913 Bacteria 3114
279 Ga0207695_10273466 3300025913 Bacteria 1584
280 Ga0207671_10074488 3300025914 Bacteria 2537
281 Ga0207671_10090131 3300025914 Bacteria 2309
282 Ga0207693_10007583 3300025915 Bacteria 8914
283 Ga0207693_10009124 3300025915 Bacteria 8097
284 Ga0207663_10009641 3300025916 Bacteria 5109
285 Ga0207663_10171384 3300025916 Bacteria 1542
286 Ga0207660_10000073 3300025917 Bacteria 51871
287 Ga0207660_10026920 3300025917 Bacteria 3919
288 Ga0207660_10080492 3300025917 Bacteria 2392
289 Ga0207662_10000964 3300025918 Bacteria 13368
290 Ga0207662_10013126 3300025918 Bacteria 4629
291 Ga0207662_10024056 3300025918 Bacteria 3505
292 Ga0207662_10040343 3300025918 Bacteria 2743
293 Ga0207657_10005395 3300025919 Bacteria 13362
294 Ga0207657_10067345 3300025919 Bacteria 3045
295 Ga0207657_10158490 3300025919 Bacteria 1839
296 Ga0207649_10000450 3300025920 Bacteria 29604
297 Ga0207649_10049051 3300025920 Bacteria 2605
298 Ga0207652_10007770 3300025921 Bacteria 8617
299 Ga0207652_10025311 3300025921 Bacteria 4932
300 Ga0207652_10118848 3300025921 Bacteria 2350
301 Ga0207652_10130371 3300025921 Bacteria 2242
302 Ga0207681_10000097 3300025923 Bacteria 73836
303 Ga0207694_10050082 3300025924 Bacteria 3233
304 Ga0207694_10056347 3300025924 Unclassified 3052
305 Ga0207650_10041696 3300025925 Bacteria 3365
306 Ga0207659_10000092 3300025926 Bacteria 52642
307 Ga0207659_10207751 3300025926 Bacteria 1567
308 Ga0207687_10016821 3300025927 Bacteria 4808
309 Ga0207700_10066434 3300025928 Bacteria 2757
310 Ga0207664_10005574 3300025929 Bacteria 8618
311 Ga0207644_10005083 3300025931 Bacteria 8591
312 Ga0207644_10007663 3300025931 Bacteria 7040
313 Ga0207644_10148161 3300025931 Bacteria 1814
314 Ga0207690_10002606 3300025932 Bacteria 10873
315 Ga0207690_10147219 3300025932 Bacteria 1742
316 Ga0207706_10004310 3300025933 Bacteria 13370
317 Ga0207706_10008823 3300025933 Bacteria 9280
318 Ga0207706_10046615 3300025933 Bacteria 3838
319 Ga0207686_10000796 3300025934 Bacteria 19364
320 Ga0207686_10027960 3300025934 Bacteria 3309
321 Ga0207709_10000362 3300025935 Bacteria 45886
322 Ga0207709_10103109 3300025935 Bacteria 1890
323 Ga0207670_10004868 3300025936 Bacteria 7299
324 Ga0207669_10000350 3300025937 Bacteria 20966
325 Ga0207669_10040659 3300025937 Bacteria 2699
326 Ga0207704_10000479 3300025938 Bacteria 17812
327 Ga0207665_10001702 3300025939 Bacteria 14793
328 Ga0207691_10000283 3300025940 Bacteria 50040
329 Ga0207691_10008505 3300025940 Bacteria 9857
330 Ga0207691_10060889 3300025940 Bacteria 3430
331 Ga0207711_10009675 3300025941 Bacteria 8032
332 Ga0207711_10078578 3300025941 Bacteria 2879
333 Ga0207689_10000085 3300025942 Bacteria 75467
334 Ga0207661_10000464 3300025944 Bacteria 26194
335 Ga0207679_10000030 3300025945 Bacteria 169351
336 Ga0207679_10117323 3300025945 Bacteria 2112
337 Ga0207667_10012374 3300025949 Bacteria 9836
338 Ga0207667_10018715 3300025949 Bacteria 7758
339 Ga0207667_10041317 3300025949 Bacteria 4905
340 Ga0207651_10000088 3300025960 Bacteria 40879
341 Ga0207712_10010820 3300025961 Bacteria 5805
342 Ga0207668_10000114 3300025972 Bacteria 57323
343 Ga0207640_10005820 3300025981 Bacteria 6723
344 Ga0207640_10019689 3300025981 Bacteria 3992
345 Ga0207640_10041774 3300025981 Bacteria 2919
346 Ga0207640_10087152 3300025981 Bacteria 2151
347 Ga0207658_10002853 3300025986 Bacteria 12371
348 Ga0207677_10009721 3300026023 Bacteria 5417
349 Ga0207677_10242565 3300026023 Bacteria 1459
350 Ga0207703_10000983 3300026035 Bacteria 27443
351 Ga0207703_10048789 3300026035 Unclassified 3419
352 Ga0207639_10000305 3300026041 Bacteria 34869
353 Ga0207678_10000125 3300026067 Bacteria 63817
354 Ga0207678_10016358 3300026067 Bacteria 6513
355 Ga0207678_10032906 3300026067 Bacteria 4518
356 Ga0207678_10132722 3300026067 Bacteria 2125
357 Ga0207708_10000187 3300026075 Bacteria 48792
358 Ga0207702_10005437 3300026078 Bacteria 11146
359 Ga0207702_10050201 3300026078 Bacteria 3522
360 Ga0207702_10132745 3300026078 Bacteria 2242
361 Ga0207641_10002129 3300026088 Bacteria 18722
362 Ga0207641_10037602 3300026088 Bacteria 4043
363 Ga0207648_10002168 3300026089 Bacteria 21342
364 Ga0207676_10000074 3300026095 Bacteria 101208
365 Ga0207676_10042253 3300026095 Bacteria 3505
366 Ga0207676_10051115 3300026095 Bacteria 3225
367 Ga0207674_10002501 3300026116 Bacteria 23186
368 Ga0207675_100004556 3300026118 Bacteria 13370
369 Ga0207683_10000014 3300026121 Bacteria 128817
370 Ga0207683_10003999 3300026121 Bacteria 12769
371 Ga0207683_10004104 3300026121 Bacteria 12582
372 Ga0207683_10012783 3300026121 Bacteria 7164
373 Ga0207698_10001242 3300026142 Bacteria 14899
374 Ga0207698_10031704 3300026142 Bacteria 3819
375 Ga0207698_10273137 3300026142 Bacteria 1559
376 Ga0209966_1001229 3300027695 Bacteria 4561
377 Ga0209998_10000361 3300027717 Bacteria 13355
378 Ga0209998_10002431 3300027717 Bacteria 4276
379 Ga0209974_10002250 3300027876 Bacteria 7018
380 Ga0209974_10007253 3300027876 Bacteria 3825
381 Ga0207428_10000114 3300027907 Bacteria 109533
382 Ga0207428_10000467 3300027907 Bacteria 48756
383 Ga0207428_10005035 3300027907 Bacteria 12415
384 Ga0268266_10027346 3300028379 Bacteria 4850
385 Ga0268265_10001371 3300028380 Bacteria 20700
386 Ga0268265_10007749 3300028380 Bacteria 7248
387 Ga0268264_10000469 3300028381 Bacteria 54801
388 Ga0268264_10016375 3300028381 Bacteria 6070
389 Ga0265330_10049181 3300031235 Bacteria 1853
390 Ga0265320_10021699 3300031240 Bacteria 3449
391 Ga0265325_10000423 3300031241 Bacteria 30296
392 Ga0265325_10012823 3300031241 Bacteria 4783
393 Ga0265325_10018415 3300031241 Bacteria 3873
394 Ga0265325_10094477 3300031241 Bacteria 1470
395 Ga0265329_10011615 3300031242 Bacteria 3195
396 Ga0265339_10003373 3300031249 Bacteria 11182
397 Ga0265339_10045049 3300031249 Bacteria 2429
398 Ga0265316_10119807 3300031344 Bacteria 1988
399 Ga0265313_10000115 3300031595 Bacteria 81365
400 Ga0265313_10002944 3300031595 Bacteria 14219
401 Ga0265313_10011952 3300031595 Bacteria 5353
402 Ga0265313_10027921 3300031595 Bacteria 2945
403 Ga0265314_10005122 3300031711 Bacteria 11925
404 Ga0265314_10164120 3300031711 Bacteria 1348
405 Ga0265342_10004840 3300031712 Bacteria 10435
406 Ga0265342_10056748 3300031712 Bacteria 2320
407 Ga0307406_10226106 3300031901 Bacteria 1394
408 Ga0373930_0000138 3300034816 Bacteria 8159
409 Ga0373950_0000569 3300034818 Bacteria 4528
410 Ga0373950_0009212 3300034818 Bacteria 1570
411 Ga0373938_0000547 3300034957 Bacteria 6072
412 Ga0373938_0000639 3300034957 Bacteria 5630
413 Ga0373928_0003248 3300035084 Bacteria 3116
414 Ga0373929_0000455 3300035085 Bacteria 7775
415 Ga0373929_0005461 3300035085 Unclassified 2288
416 Ga0373940_0003655 3300035088 Bacteria 3164
417 Ga0373940_0016340 3300035088 Bacteria 1837
418 Ga0373949_0001506 3300035090 Bacteria 6612
419 Ga0373951_0002818 3300035091 Bacteria 4331
420 Ga0373951_0036704 3300035091 Bacteria 1170
421 Ga0373952_0000029 3300035092 Bacteria 16517
422 Ga0373952_0001129 3300035092 Bacteria 4875
423 Ga0373932_0000468 3300035112 Bacteria 12380
424 Ga0373932_0004542 3300035112 Bacteria 3276
425 Ga0373936_0013398 3300035113 Bacteria 3130
426 Ga0373939_0000339 3300035114 Bacteria 11943
427 Ga0373939_0028144 3300035114 Bacteria 1597
428 Ga0373939_0036478 3300035114 Bacteria 1454
429 Ga0373941_0001871 3300035115 Bacteria 4550
430 Ga0373941_0002209 3300035115 Bacteria 4256
431 Ga0373945_0004333 3300035116 Bacteria 4507
432 Ga0373945_0030379 3300035116 Bacteria 1904
433 Ga0373953_0016093 3300035117 Bacteria 2725
434 Ga0373953_0025007 3300035117 Bacteria 2276
435 Ga0373953_0033246 3300035117 Bacteria 2016
436 Ga0373954_0002030 3300035118 Bacteria 8412
437 Ga0373954_0033972 3300035118 Bacteria 2360
438 Ga0373956_0006309 3300035119 Bacteria 4747
439 Ga0373957_0007402 3300035120 Bacteria 3512
440 Ga0373960_0000611 3300035121 Bacteria 7314
441 Ga0373943_0031766 3300035170 Bacteria 2506
442 Ga0373946_0020116 3300035171 Bacteria 2577
443 Ga0373946_0102582 3300035171 Unclassified 1284
444 Ga0373955_0001269 3300035172 Bacteria 10731
445 Ga0373955_0001523 3300035172 Bacteria 9899
446 Ga0373955_0005294 3300035172 Bacteria 5792
447 Ga0373955_0019290 3300035172 Bacteria 3405
448 Ga0373942_0011321 3300035207 Bacteria 2114
449 Ga0373961_0013171 3300035241 Bacteria 2080
450 Ga0373962_0001530 3300035242 Bacteria 5467
451 Ga0373962_0017701 3300035242 Bacteria 1848
452 Ga0373931_0000169 3300035691 Bacteria 28308
453 Ga0373931_0151906 3300035691 Bacteria 1350
454 Ga0373935_0011709 3300035692 Bacteria 5268
455 Ga0373927_0022055 3300035695 Bacteria 4173
456 Ga0373927_0038796 3300035695 Bacteria 3092
457 Ga0373933_0001124 3300035724 Bacteria 15927
458 Ga0373933_0052936 3300035724 Bacteria 2430
459 Ga0373947_0005580 3300035725 Bacteria 7335
460 Ga0373947_0036069 3300035725 Bacteria 2930
461 Ga0373947_0048752 3300035725 Unclassified 2542
462 Ga0373937_0004918 3300036401 Bacteria 11357
463 Ga0373937_0007509 3300036401 Bacteria 9436
464 Ga0373937_0012121 3300036401 Bacteria 7568
465 Ga0373937_0111440 3300036401 Bacteria 2545
466 Ga0373937_0130016 3300036401 Bacteria 2351
467 Ga0373925_0009626 3300037068 Bacteria 7042
468 Ga0373925_0049020 3300037068 Bacteria 3147
469 Ga0436364_0309649 3300037853 Bacteria 36034
470 Ga0436365_0418355 3300039437 Bacteria 2194
471 Ga0436365_1126455 3300039437 Bacteria 19004
472 Ga0436365_1741712 3300039437 Bacteria 4479
473 Ga0466959_0137082 3300045049 Bacteria 1732
474 Ga0495592_0020065 3300046454 Bacteria 5081
475 Ga0495592_0024541 3300046454 Bacteria 4582
476 Ga0495603_0007829 3300046455 Bacteria 6441
477 Ga0495603_0012902 3300046455 Bacteria 5052
478 Ga0495591_031376 3300046458 Bacteria 1595
479 Ga0495629_0000535 3300046459 Bacteria 31312
480 Ga0495638_0003352 3300046460 Bacteria 12638
481 Ga0495641_0025043 3300046461 Bacteria 2932
482 Ga0495641_0093980 3300046461 Bacteria 1339
483 Ga0495653_0008326 3300046463 Bacteria 8500
484 Ga0495653_0038924 3300046463 Bacteria 3729
485 Ga0495653_0059893 3300046463 Bacteria 2887
486 Ga0495580_0157496 3300046472 Bacteria 1572
487 Ga0495582_0002806 3300046473 Bacteria 9740
488 Ga0495639_0039439 3300046475 Bacteria 2123
489 Ga0495662_0013876 3300046476 Bacteria 3921
490 Ga0495664_0003537 3300046477 Bacteria 8521
491 Ga0495664_0028609 3300046477 Bacteria 3254
492 Ga0495585_0016072 3300046492 Bacteria 4338
493 Ga0495594_0006201 3300046499 Bacteria 6148
494 Ga0495594_0024673 3300046499 Bacteria 3231
495 Ga0495607_0015506 3300046501 Bacteria 4938
496 Ga0495608_0001474 3300046511 Bacteria 16724
497 Ga0495608_0017824 3300046511 Bacteria 4909
498 Ga0495610_0065325 3300046512 Bacteria 1717
499 Ga0495618_0027234 3300046514 Bacteria 3558
500 Ga0495628_0001927 3300046516 Bacteria 18830
501 Ga0495628_0024184 3300046516 Bacteria 4973
502 Ga0495628_0113567 3300046516 Bacteria 2082
503 Ga0495630_0047564 3300046517 Bacteria 3209
504 Ga0495630_0059407 3300046517 Bacteria 2869
505 Ga0495630_0219305 3300046517 Bacteria 1452
506 Ga0495630_0332177 3300046517 Bacteria 1163
507 Ga0495644_0006919 3300046523 Bacteria 4391
508 Ga0495652_0015699 3300046529 Bacteria 6778
509 Ga0495652_0254817 3300046529 Bacteria 1298
510 Ga0495665_0038652 3300046531 Bacteria 2544
511 Ga0495640_0020173 3300046533 Bacteria 4909
512 Ga0495640_0132462 3300046533 Bacteria 1612
513 Ga0495640_0146655 3300046533 Bacteria 1518
514 Ga0495586_0008177 3300046535 Bacteria 5575
515 Ga0495587_0002240 3300046536 Bacteria 12923
516 Ga0495587_0042135 3300046536 Bacteria 2723
517 Ga0495645_0002539 3300046543 Bacteria 12383
518 Ga0495645_0023203 3300046543 Bacteria 4492
519 Ga0495645_0119189 3300046543 Bacteria 1860
520 Ga0495667_0001150 3300046559 Bacteria 17257
521 Ga0495667_0021829 3300046559 Bacteria 4317
522 Ga0495667_0057100 3300046559 Unclassified 2566
523 Ga0495656_0003843 3300046615 Bacteria 5108
524 Ga0495634_0121245 3300046642 Bacteria 1674
525 Ga0495635_0003881 3300046663 Bacteria 10388
526 Ga0495635_0037995 3300046663 Bacteria 3332
527 Ga0495635_0070978 3300046663 Unclassified 2387
528 Ga0495659_0001458 3300046664 Bacteria 8030
529 Ga0495588_0013595 3300046674 Bacteria 3881
530 Ga0495599_0009859 3300046678 Bacteria 5848
531 Ga0495623_0000420 3300046679 Bacteria 27960
532 Ga0495646_0003113 3300046680 Bacteria 10292
533 Ga0495646_0051463 3300046680 Bacteria 2492
534 Ga0495647_0005761 3300046681 Bacteria 4073
535 Ga0495647_0018043 3300046681 Bacteria 2505
536 Ga0495658_0002441 3300046683 Bacteria 9352
537 Ga0495613_0003655 3300046689 Bacteria 11526
538 Ga0495613_0054377 3300046689 Bacteria 2943
539 Ga0495624_0054221 3300046690 Bacteria 2528
540 Ga0495624_0101906 3300046690 Bacteria 1767
541 Ga0495670_0000291 3300046691 Bacteria 23680
542 Ga0495600_0001326 3300046809 Bacteria 13661
543 Ga0495600_0019703 3300046809 Bacteria 4311
544 Ga0495600_0060643 3300046809 Bacteria 2470
545 Ga0495581_0012599 3300047315 Bacteria 4900
546 Ga0495581_0043070 3300047315 Bacteria 2612
547 Ga0495604_0003891 3300047317 Bacteria 11887
548 Ga0495604_0017520 3300047317 Bacteria 5736
549 Ga0495604_0045926 3300047317 Bacteria 3407
550 Ga0495604_0055679 3300047317 Bacteria 3048
551 Ga0495674_0042562 3300047319 Bacteria 4049
552 Ga0495674_0047567 3300047319 Bacteria 3802
553 Ga0495674_0468458 3300047319 Bacteria 1011
554 Ga0495680_0011254 3300047322 Bacteria 7932
555 Ga0495680_0012959 3300047322 Bacteria 7301
556 Ga0495680_0044564 3300047322 Bacteria 3507
557 Ga0495675_0001544 3300047444 Bacteria 13904
558 Ga0495675_0122552 3300047444 Bacteria 1619
559 Ga0495684_0002087 3300047471 Bacteria 16070
560 Ga0495684_0023924 3300047471 Bacteria 4698
561 Ga0495593_0004626 3300047673 Bacteria 8180
562 Ga0495593_0059382 3300047673 Bacteria 2004
563 Ga0495602_0005526 3300048088 Bacteria 13262
564 Ga0495602_0057446 3300048088 Bacteria 3413
565 Ga0495602_0061017 3300048088 Bacteria 3282
566 Ga0495614_0035948 3300048089 Bacteria 2127
567 Ga0496100_0000106 3300048903 Bacteria 48123
568 Ga0496100_0002951 3300048903 Bacteria 8748
569 Ga0496100_0166587 3300048903 Bacteria 1583
570 Ga0496101_0000992 3300048904 Bacteria 16792
571 Ga0496101_0113210 3300048904 Bacteria 2044
572 Ga0496101_0271289 3300048904 Bacteria 1324
573 Ga0496102_0041646 3300048905 Bacteria 4160
574 Ga0496102_0091000 3300048905 Bacteria 2823
575 Ga0496102_0176008 3300048905 Unclassified 2014
576 Ga0496102_0329375 3300048905 Bacteria 1438
577 Ga0496103_0010395 3300048906 Bacteria 5506
578 Ga0496103_0202213 3300048906 Bacteria 1277
579 Ga0496104_0000090 3300048907 Bacteria 87877
580 Ga0496104_0244328 3300048907 Bacteria 1707
581 Ga0496104_0405626 3300048907 Bacteria 1275
582 Ga0496105_0018996 3300048908 Bacteria 5538
583 Ga0496106_0026062 3300048909 Bacteria 4350
584 Ga0496106_0066563 3300048909 Bacteria 2744
585 Ga0496107_0000223 3300048910 Bacteria 30018
586 Ga0496107_0026443 3300048910 Bacteria 4114
587 Ga0496107_0066614 3300048910 Bacteria 2611
588 Ga0496107_0066871 3300048910 Bacteria 2606
589 Ga0496107_0076992 3300048910 Archaea 2429
590 Ga0496108_0003914 3300048911 Bacteria 11960
591 Ga0496108_0059924 3300048911 Bacteria 3201
592 Ga0496108_0099688 3300048911 Bacteria 2476
593 Ga0496108_0254877 3300048911 Bacteria 1527
594 Ga0496109_0016176 3300048912 Bacteria 6519
595 Ga0496109_0025242 3300048912 Bacteria 5293
596 Ga0496109_0108971 3300048912 Bacteria 2574
597 Ga0496110_0022213 3300048913 Bacteria 5385
598 Ga0496111_0073817 3300048914 Bacteria 2484
599 Ga0496112_0056898 3300048915 Bacteria 3849
600 Ga0496112_0092411 3300048915 Bacteria 2995
601 Ga0496112_0172239 3300048915 Bacteria 2130
602 Ga0496112_0255789 3300048915 Bacteria 1701
603 Ga0496113_0019689 3300048916 Bacteria 4727
604 Ga0496113_0164949 3300048916 Bacteria 1752
605 Ga0496114_0006841 3300048917 Bacteria 8982
606 Ga0496114_0057681 3300048917 Bacteria 3241
607 Ga0496114_0302343 3300048917 Bacteria 1412
608 Ga0496115_0010308 3300048918 Bacteria 6977
609 Ga0496115_0032463 3300048918 Unclassified 4118
610 Ga0496115_0170405 3300048918 Bacteria 1801
611 Ga0496115_0253738 3300048918 Bacteria 1447
612 Ga0496117_0028863 3300048920 Bacteria 4288
613 Ga0496117_0034601 3300048920 Bacteria 3804
614 Ga0496122_0020818 3300048925 Bacteria 5904
615 Ga0496123_0070768 3300048926 Bacteria 2180
616 Ga0501032_0039937 3300049569 Bacteria 3191
617 Ga0501034_0000852 3300049571 Bacteria 45151
618 Ga0501034_0002201 3300049571 Bacteria 24114
619 Ga0501034_0031278 3300049571 Bacteria 5406
620 Ga0501034_0122326 3300049571 Bacteria 2588
621 Ga0501034_0124143 3300049571 Bacteria 2567
622 Ga0501034_0171171 3300049571 Bacteria 2139
623 Ga0501034_0214893 3300049571 Bacteria 1877
624 Ga0501036_0001075 3300049572 Bacteria 20707
625 Ga0501036_0022844 3300049572 Bacteria 5266
626 Ga0501036_0029453 3300049572 Bacteria 4636
627 Ga0501037_0019552 3300049573 Bacteria 4996
628 Ga0501037_0032411 3300049573 Bacteria 3858
629 Ga0501037_0040360 3300049573 Bacteria 3435
630 Ga0501037_0041242 3300049573 Bacteria 3394
631 Ga0501037_0054451 3300049573 Bacteria 2925
632 Ga0501038_0044334 3300049574 Bacteria 3866
633 Ga0501038_0076689 3300049574 Bacteria 2823
634 Ga0501038_0098169 3300049574 Bacteria 2442
635 Ga0501038_0232121 3300049574 Bacteria 1468
636 Ga0501039_0034413 3300049575 Bacteria 3909
637 Ga0501043_0007548 3300049579 Bacteria 8628
638 Ga0501043_0039201 3300049579 Bacteria 3724
639 Ga0501046_0044408 3300049580 Bacteria 3535
640 Ga0501046_0057378 3300049580 Bacteria 3054
641 Ga0501046_0105257 3300049580 Bacteria 2161
642 Ga0501046_0232667 3300049580 Bacteria 1361
643 Ga0501047_0000010 3300049581 Bacteria 429357
644 Ga0501047_0009616 3300049581 Bacteria 9142
645 Ga0501047_0022597 3300049581 Bacteria 6039
646 Ga0501047_0032068 3300049581 Bacteria 5070
647 Ga0501048_0000592 3300049582 Bacteria 25706
648 Ga0501068_0008615 3300049584 Bacteria 5682
649 Ga0501068_0020726 3300049584 Bacteria 3835
650 Ga0501068_0061365 3300049584 Bacteria 2284
651 Ga0501069_0012513 3300049585 Bacteria 4514
652 Ga0501069_0039276 3300049585 Bacteria 2614
653 Ga0501070_0012558 3300049586 Bacteria 7143
654 Ga0501070_0015015 3300049586 Bacteria 6516
655 Ga0501070_0024118 3300049586 Bacteria 5101
656 Ga0501070_0042658 3300049586 Bacteria 3778
657 Ga0501070_0150330 3300049586 Bacteria 1921
658 Ga0501070_0154369 3300049586 Bacteria 1893
659 Ga0501071_0017492 3300049587 Bacteria 4945
660 Ga0501072_0074887 3300049588 Bacteria 2677
661 Ga0501073_0088132 3300049589 Bacteria 2158
662 Ga0501073_0110866 3300049589 Bacteria 1903
663 Ga0501073_0270959 3300049589 Bacteria 1171
664 Ga0501074_0010211 3300049590 Bacteria 6815
665 Ga0501074_0019545 3300049590 Bacteria 4917
666 Ga0501075_0009274 3300049591 Bacteria 6885
667 Ga0501077_0083389 3300049593 Bacteria 2025
668 Ga0501080_0000314 3300049742 Bacteria 37074
669 Ga0501080_0033861 3300049742 Bacteria 4769
670 Ga0501080_0099096 3300049742 Bacteria 2704
671 Ga0501080_0149735 3300049742 Bacteria 2157
672 Ga0501080_0170292 3300049742 Bacteria 2009
673 Ga0501080_0172916 3300049742 Bacteria 1991
674 Ga0501083_0001213 3300049744 Bacteria 17449
675 Ga0501083_0013974 3300049744 Bacteria 5610
676 Ga0501083_0029708 3300049744 Bacteria 3756
677 Ga0501083_0057891 3300049744 Bacteria 2594
678 Ga0501083_0075667 3300049744 Bacteria 2236
679 Ga0501035_0001359 3300049822 Bacteria 25173
680 Ga0501035_0008723 3300049822 Bacteria 9440
681 Ga0501035_0188286 3300049822 Bacteria 1775
682 Ga0501035_0354857 3300049822 Bacteria 1226
683 Ga0501044_0003955 3300049823 Bacteria 16596
684 Ga0501044_0007386 3300049823 Bacteria 12086
685 Ga0501044_0035271 3300049823 Bacteria 5239
686 Ga0501044_0037111 3300049823 Bacteria 5095
687 Ga0501044_0043548 3300049823 Bacteria 4662
688 Ga0501044_0206170 3300049823 Bacteria 1922
689 Ga0501044_0229279 3300049823 Bacteria 1805
690 Ga0501044_0247410 3300049823 Bacteria 1725
691 nmdc:mga0k408_15093_c1 3300050493 Bacteria 4269
692 nmdc:mga06z11_16338_c1 3300050494 Bacteria 3340
693 nmdc:mga06z11_22614_c1 3300050494 Bacteria 2940
694 nmdc:mga06z11_71985_c1 3300050494 Bacteria 1832
695 nmdc:mga07m45_106529_c1 3300050496 Bacteria 1613
696 nmdc:mga05p37_435133_c1 3300050507 Bacteria 1523
697 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
698 nmdc:mga09592_976_c1 3300050508 Bacteria 22595
699 nmdc:mga0qj67_13755_c1 3300050509 Bacteria 6108
700 nmdc:mga06r32_6105_c1 3300050510 Bacteria 10821
701 nmdc:mga06r32_9642_c1 3300050510 Bacteria 8722
702 nmdc:mga08y16_10256_c1 3300050511 Bacteria 9834
703 nmdc:mga08y16_138559_c1 3300050511 Bacteria 2529
704 nmdc:mga08y16_144351_c1 3300050511 Bacteria 2474
705 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
706 nmdc:mga08y16_2396_c1 3300050511 Bacteria 19256
707 nmdc:mga0n895_138396_c1 3300050512 Bacteria 2462
708 nmdc:mga0n895_2745_c1 3300050512 Bacteria 8963
709 nmdc:mga0n895_4632_c1 3300050512 Bacteria 11339
710 nmdc:mga0rr50_13492_c1 3300050513 Bacteria 5321
711 nmdc:mga0rr50_31674_c1 3300050513 Bacteria 3759
712 nmdc:mga0rr50_8402_c1 3300050513 Bacteria 6426
713 nmdc:mga08x19_116588_c1 3300050514 Bacteria 1786
714 nmdc:mga08x19_24581_c1 3300050514 Bacteria 3746
715 nmdc:mga0a205_380_c1 3300050515 Bacteria 33747
716 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
717 nmdc:mga0sz30_53897_c1 3300050516 Bacteria 1709
718 Ga0495601_0000360 3300053077 Bacteria 23959
719 Ga0495601_0001260 3300053077 Bacteria 13862
720 Ga0495601_0012407 3300053077 Bacteria 5112
721 Ga0495601_0018263 3300053077 Bacteria 4266
722 Ga0495601_0088044 3300053077 Bacteria 1996
723 Ga0495612_0000964 3300053078 Bacteria 11832
724 Ga0495612_0001978 3300053078 Bacteria 8443
725 Ga0495612_0014718 3300053078 Bacteria 3141
726 Ga0500610_0101197 3300053079 Bacteria 1491
727 Ga0495595_0000969 3300053084 Bacteria 11036
728 Ga0495595_0009105 3300053084 Bacteria 4100
729 Ga0495595_0020214 3300053084 Bacteria 2896
730 Ga0495619_0000375 3300053085 Bacteria 30799
731 Ga0495619_0000581 3300053085 Bacteria 24290
732 Ga0495619_0001851 3300053085 Bacteria 14080
733 Ga0495619_0008740 3300053085 Bacteria 6403
734 Ga0495619_0008848 3300053085 Bacteria 6365
735 Ga0500643_005433 3300053087 Bacteria 5491
736 Ga0500644_0000331 3300053088 Bacteria 24183
737 Ga0500651_0006053 3300053093 Bacteria 6949
738 Ga0500566_0067112 3300053094 Bacteria 2020
739 Ga0500641_0009223 3300053096 Bacteria 3543
740 Ga0500595_000002 3300053119 Bacteria 1074388
741 Ga0500595_007827 3300053119 Bacteria 4402
742 Ga0500577_0030058 3300053142 Bacteria 1887
743 Ga0500616_0000002 3300053153 Bacteria 1611257
744 Ga0500616_0036227 3300053153 Bacteria 2678
745 Ga0500616_0039043 3300053153 Bacteria 2561
746 Ga0500622_0009576 3300053156 Bacteria 5356
747 Ga0500645_000471 3300053730 Bacteria 27490
748 Ga0501084_0045729 3300054114 Bacteria 3665
749 Ga0501082_0000012 3300060353 Bacteria 119898
750 Ga0501082_0010372 3300060353 Bacteria 8024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034818 Ga0373950_0009212 Ga0373950_0009212_606_1541 311
2 3300053096 Ga0500641_0009223 Ga0500641_0009223_1402_2460 313
3 3300049580 Ga0501046_0232667 Ga0501046_0232667_373_1341 319
4 3300047319 Ga0495674_0468458 Ga0495674_0468458_23_991 320
5 3300048911 Ga0496108_0254877 Ga0496108_0254877_509_1504 331
6 3300048926 Ga0496123_0070768 Ga0496123_0070768_1137_2165 331
7 3300003203 JGI25406J46586_10008160 JGI25406J46586_100081603 338
8 3300005985 Ga0081539_10000800 Ga0081539_1000080023 338
9 3300035116 Ga0373945_0004333 Ga0373945_0004333_1264_2283 339
10 3300035117 Ga0373953_0025007 Ga0373953_0025007_1240_2259 339
11 3300035691 Ga0373931_0151906 Ga0373931_0151906_256_1275 339
12 3300035692 Ga0373935_0011709 Ga0373935_0011709_389_1408 339
13 3300035695 Ga0373927_0022055 Ga0373927_0022055_1218_2237 339
14 3300035725 Ga0373947_0005580 Ga0373947_0005580_4374_5393 339
15 3300037068 Ga0373925_0009626 Ga0373925_0009626_1641_2660 339
16 3300046455 Ga0495603_0012902 Ga0495603_0012902_1075_2094 339
17 3300046459 Ga0495629_0000535 Ga0495629_0000535_9842_10861 339
18 3300046461 Ga0495641_0093980 Ga0495641_0093980_306_1325 339
19 3300046472 Ga0495580_0157496 Ga0495580_0157496_39_1058 339
20 3300046473 Ga0495582_0002806 Ga0495582_0002806_1744_2763 339
21 3300046499 Ga0495594_0006201 Ga0495594_0006201_1553_2572 339
22 3300046517 Ga0495630_0219305 Ga0495630_0219305_378_1427 339
23 3300046529 Ga0495652_0254817 Ga0495652_0254817_230_1249 339
24 3300046681 Ga0495647_0005761 Ga0495647_0005761_2917_3936 339
25 3300046683 Ga0495658_0002441 Ga0495658_0002441_7519_8538 339
26 3300046689 Ga0495613_0003655 Ga0495613_0003655_7475_8494 339
27 3300047315 Ga0495581_0012599 Ga0495581_0012599_1354_2373 339
28 3300047322 Ga0495680_0011254 Ga0495680_0011254_303_1322 339
29 3300047322 Ga0495680_0012959 Ga0495680_0012959_6270_7289 339
30 3300047673 Ga0495593_0059382 Ga0495593_0059382_822_1841 339
31 3300048903 Ga0496100_0002951 Ga0496100_0002951_7689_8708 339
32 3300048906 Ga0496103_0202213 Ga0496103_0202213_227_1246 339
33 3300048907 Ga0496104_0405626 Ga0496104_0405626_221_1240 339
34 3300048911 Ga0496108_0099688 Ga0496108_0099688_1310_2329 339
35 3300048912 Ga0496109_0016176 Ga0496109_0016176_4785_5804 339
36 3300048917 Ga0496114_0057681 Ga0496114_0057681_2194_3213 339
37 3300048918 Ga0496115_0170405 Ga0496115_0170405_21_1040 339
38 3300049822 Ga0501035_0354857 Ga0501035_0354857_193_1212 339
39 3300053085 Ga0495619_0000375 Ga0495619_0000375_16755_17774 339
40 3300045049 Ga0466959_0137082 Ga0466959_0137082_14_1048 340
41 3300005518 Ga0070699_100356833 Ga0070699_1003568331 343
42 3300048920 Ga0496117_0034601 Ga0496117_0034601_2360_3472 343
43 3300048925 Ga0496122_0020818 Ga0496122_0020818_1752_2864 343
44 3300005434 Ga0070709_10110170 Ga0070709_101101701 346
45 3300049822 Ga0501035_0001359 Ga0501035_0001359_8113_9210 346
46 3300006186 Ga0075369_10063403 Ga0075369_100634032 347
47 iso_pu_bacteria 2643221547 2643756397 349
48 3300005434 Ga0070709_10025535 Ga0070709_100255353 350
49 3300025928 Ga0207700_10066434 Ga0207700_100664343 350
50 3300014326 Ga0157380_10255509 Ga0157380_102555092 353
51 3300053087 Ga0500643_005433 Ga0500643_005433_1326_2387 353
52 3300053088 Ga0500644_0000331 Ga0500644_0000331_19551_20612 353
53 3300053093 Ga0500651_0006053 Ga0500651_0006053_564_1625 353
54 3300053119 Ga0500595_000002 Ga0500595_000002_41487_42548 353
55 3300053153 Ga0500616_0000002 Ga0500616_0000002_56312_57373 353
56 3300053153 Ga0500616_0039043 Ga0500616_0039043_1391_2452 353
57 3300053730 Ga0500645_000471 Ga0500645_000471_17691_18752 353
58 3300013104 Ga0157370_10118954 Ga0157370_101189542 355
59 3300031241 Ga0265325_10018415 Ga0265325_100184152 355
60 3300006042 Ga0075368_10007349 Ga0075368_100073493 357
61 3300005327 Ga0070658_10059765 Ga0070658_100597652 358
62 3300005339 Ga0070660_100021236 Ga0070660_1000212366 358
63 3300005435 Ga0070714_100048797 Ga0070714_1000487973 358
64 3300005530 Ga0070679_100055203 Ga0070679_1000552035 358
65 3300005563 Ga0068855_100012274 Ga0068855_1000122744 358
66 3300005614 Ga0068856_100097861 Ga0068856_1000978612 358
67 3300005616 Ga0068852_100291384 Ga0068852_1002913841 358
68 3300005616 Ga0068852_100443617 Ga0068852_1004436171 358
69 3300009551 Ga0105238_10091855 Ga0105238_100918553 358
70 3300020070 Ga0206356_11266497 Ga0206356_112664971 358
71 3300025909 Ga0207705_10044728 Ga0207705_100447282 358
72 3300025912 Ga0207707_10069584 Ga0207707_100695842 358
73 3300025913 Ga0207695_10273466 Ga0207695_102734662 358
74 3300025917 Ga0207660_10026920 Ga0207660_100269204 358
75 3300025919 Ga0207657_10158490 Ga0207657_101584902 358
76 3300025921 Ga0207652_10025311 Ga0207652_100253113 358
77 3300025921 Ga0207652_10118848 Ga0207652_101188482 358
78 3300025924 Ga0207694_10050082 Ga0207694_100500822 358
79 3300025949 Ga0207667_10012374 Ga0207667_100123743 358
80 3300026078 Ga0207702_10132745 Ga0207702_101327452 358
81 3300026142 Ga0207698_10031704 Ga0207698_100317044 358
82 3300031595 Ga0265313_10027921 Ga0265313_100279212 358
83 3300031711 Ga0265314_10005122 Ga0265314_100051229 358
84 3300031712 Ga0265342_10004840 Ga0265342_100048404 358
85 3300049571 Ga0501034_0171171 Ga0501034_0171171_602_1678 358
86 3300049581 Ga0501047_0009616 Ga0501047_0009616_2637_3713 358
87 3300049823 Ga0501044_0247410 Ga0501044_0247410_416_1492 358
88 iso_pu_bacteria 2643221733 2644729303 358
89 iso_pu_bacteria 2643221734 2644735870 358
90 iso_pu_bacteria 2643221736 2644747358 358
91 iso_pu_bacteria 2818991467 2819718201 358
92 iso_pu_bacteria 2841760612 2841761917 358
93 iso_pu_bacteria 2841911363 2841916592 358
94 iso_pu_bacteria 2841917233 2841922489 358
95 iso_pu_bacteria 2844104063 2844104942 358
96 iso_pu_bacteria 2851182111 2851184902 358
97 iso_pu_bacteria 2851246043 2851247930 358
98 iso_pu_bacteria 2917699015 2917699521 358
99 3300005339 Ga0070660_100072922 Ga0070660_1000729223 359
100 3300005458 Ga0070681_10135990 Ga0070681_101359902 359
101 3300005563 Ga0068855_100259502 Ga0068855_1002595022 359
102 3300005578 Ga0068854_100114473 Ga0068854_1001144732 359
103 3300005614 Ga0068856_100140566 Ga0068856_1001405661 359
104 3300009093 Ga0105240_10023458 Ga0105240_100234585 359
105 3300013102 Ga0157371_10141143 Ga0157371_101411431 359
106 3300013104 Ga0157370_10102731 Ga0157370_101027312 359
107 3300020082 Ga0206353_10547365 Ga0206353_105473653 359
108 3300025912 Ga0207707_10196931 Ga0207707_101969312 359
109 3300025913 Ga0207695_10088621 Ga0207695_100886212 359
110 3300025919 Ga0207657_10067345 Ga0207657_100673451 359
111 3300025921 Ga0207652_10130371 Ga0207652_101303712 359
112 3300025949 Ga0207667_10041317 Ga0207667_100413172 359
113 3300025981 Ga0207640_10087152 Ga0207640_100871522 359
114 3300046460 Ga0495638_0003352 Ga0495638_0003352_2093_3205 359
115 3300049574 Ga0501038_0232121 Ga0501038_0232121_268_1347 359
116 3300049581 Ga0501047_0022597 Ga0501047_0022597_4059_5138 359
117 3300049588 Ga0501072_0074887 Ga0501072_0074887_1555_2634 359
118 3300049589 Ga0501073_0270959 Ga0501073_0270959_44_1123 359
119 3300049744 Ga0501083_0013974 Ga0501083_0013974_4373_5452 359
120 3300060353 Ga0501082_0000012 Ga0501082_0000012_81745_82851 359
121 3300060353 Ga0501082_0010372 Ga0501082_0010372_4782_5861 359
122 3300005331 Ga0070670_100213878 Ga0070670_1002138782 360
123 3300005328 Ga0070676_10204003 Ga0070676_102040031 361
124 3300005335 Ga0070666_10159165 Ga0070666_101591652 361
125 3300005353 Ga0070669_100079795 Ga0070669_1000797953 361
126 3300005353 Ga0070669_100220338 Ga0070669_1002203382 361
127 3300005356 Ga0070674_100034246 Ga0070674_1000342463 361
128 3300005435 Ga0070714_100175957 Ga0070714_1001759572 361
129 3300005466 Ga0070685_10099410 Ga0070685_100994102 361
130 3300005530 Ga0070679_100162727 Ga0070679_1001627272 361
131 3300005564 Ga0070664_100080238 Ga0070664_1000802381 361
132 3300006173 Ga0070716_100063466 Ga0070716_1000634662 361
133 3300006847 Ga0075431_100005522 Ga0075431_1000055228 361
134 3300009101 Ga0105247_10038234 Ga0105247_100382342 361
135 3300009147 Ga0114129_10049593 Ga0114129_100495932 361
136 3300009147 Ga0114129_10169964 Ga0114129_101699643 361
137 3300011119 Ga0105246_10032648 Ga0105246_100326483 361
138 3300021388 Ga0213875_10000007 Ga0213875_10000007152 361
139 3300025893 Ga0207682_10001441 Ga0207682_1000144112 361
140 3300025900 Ga0207710_10032633 Ga0207710_100326332 361
141 3300025907 Ga0207645_10136971 Ga0207645_101369711 361
142 3300025918 Ga0207662_10040343 Ga0207662_100403432 361
143 3300025926 Ga0207659_10207751 Ga0207659_102077511 361
144 3300025937 Ga0207669_10040659 Ga0207669_100406592 361
145 3300025940 Ga0207691_10008505 Ga0207691_100085059 361
146 3300025940 Ga0207691_10060889 Ga0207691_100608892 361
147 3300025981 Ga0207640_10041774 Ga0207640_100417742 361
148 3300026023 Ga0207677_10242565 Ga0207677_102425651 361
149 3300026095 Ga0207676_10051115 Ga0207676_100511152 361
150 3300026121 Ga0207683_10012783 Ga0207683_100127836 361
151 3300031235 Ga0265330_10049181 Ga0265330_100491811 361
152 3300031240 Ga0265320_10021699 Ga0265320_100216994 361
153 3300031241 Ga0265325_10012823 Ga0265325_100128232 361
154 3300031242 Ga0265329_10011615 Ga0265329_100116155 361
155 3300031249 Ga0265339_10045049 Ga0265339_100450494 361
156 3300031595 Ga0265313_10011952 Ga0265313_100119522 361
157 3300031711 Ga0265314_10164120 Ga0265314_101641202 361
158 3300031712 Ga0265342_10056748 Ga0265342_100567482 361
159 3300037853 Ga0436364_0309649 Ga0436364_0309649_8762_9859 361
160 3300049571 Ga0501034_0000852 Ga0501034_0000852_9329_10414 361
161 3300049574 Ga0501038_0044334 Ga0501038_0044334_1089_2192 361
162 3300049579 Ga0501043_0039201 Ga0501043_0039201_698_1801 361
163 3300049591 Ga0501075_0009274 Ga0501075_0009274_1291_2400 361
164 3300049742 Ga0501080_0170292 Ga0501080_0170292_227_1330 361
165 3300049744 Ga0501083_0075667 Ga0501083_0075667_654_1784 361
166 3300049822 Ga0501035_0188286 Ga0501035_0188286_513_1616 361
167 3300049823 Ga0501044_0003955 Ga0501044_0003955_13368_14471 361
168 3300050507 nmdc:mga05p37_435133_c1 nmdc:mga05p37_435133_c1_132_1331 361
169 3300050510 nmdc:mga06r32_9642_c1 nmdc:mga06r32_9642_c1_5073_6206 361
170 3300053079 Ga0500610_0101197 Ga0500610_0101197_252_1370 361
171 3300053142 Ga0500577_0030058 Ga0500577_0030058_412_1530 361
172 3300054114 Ga0501084_0045729 Ga0501084_0045729_365_1474 361
173 2209111006 2214939624 2214002878 362
174 3300000041 ARcpr5oldR_c000195 ARcpr5oldR_0001952 362
175 3300001977 JGI24746J21847_1000397 JGI24746J21847_10003972 362
176 3300001989 JGI24739J22299_10002770 JGI24739J22299_100027705 362
177 3300001990 JGI24737J22298_10000960 JGI24737J22298_100009603 362
178 3300002070 JGI24750J21931_1000172 JGI24750J21931_10001727 362
179 3300002074 JGI24748J21848_1000441 JGI24748J21848_10004413 362
180 3300002075 JGI24738J21930_10000223 JGI24738J21930_1000022312 362
181 3300002076 JGI24749J21850_1001027 JGI24749J21850_10010273 362
182 3300002077 JGI24744J21845_10004694 JGI24744J21845_100046942 362
183 3300002126 JGI24035J26624_1000220 JGI24035J26624_10002204 362
184 3300003187 JGI25151J46595_10000155 JGI25151J46595_1000015564 362
185 3300003771 Ga0055526_1000225 Ga0055526_100022520 362
186 3300003775 Ga0055524_1000078 Ga0055524_100007823 362
187 3300005262 Ga0065165_1000089 Ga0065165_100008952 362
188 3300005290 Ga0065712_10077159 Ga0065712_100771593 362
189 3300005293 Ga0065715_10008649 Ga0065715_100086493 362
190 3300005328 Ga0070676_10000012 Ga0070676_1000001245 362
191 3300005329 Ga0070683_100000139 Ga0070683_10000013920 362
192 3300005330 Ga0070690_100005164 Ga0070690_1000051642 362
193 3300005330 Ga0070690_100195429 Ga0070690_1001954292 362
194 3300005331 Ga0070670_100006855 Ga0070670_1000068552 362
195 3300005333 Ga0070677_10000125 Ga0070677_1000012512 362
196 3300005334 Ga0068869_100000605 Ga0068869_1000006056 362
197 3300005334 Ga0068869_100107020 Ga0068869_1001070202 362
198 3300005335 Ga0070666_10019221 Ga0070666_100192213 362
199 3300005336 Ga0070680_100000179 Ga0070680_10000017917 362
200 3300005336 Ga0070680_100101322 Ga0070680_1001013222 362
201 3300005337 Ga0070682_100000319 Ga0070682_1000003193 362
202 3300005337 Ga0070682_100080901 Ga0070682_1000809011 362
203 3300005338 Ga0068868_100001158 Ga0068868_10000115812 362
204 3300005338 Ga0068868_100024252 Ga0068868_1000242522 362
205 3300005339 Ga0070660_100001605 Ga0070660_10000160511 362
206 3300005339 Ga0070660_100047355 Ga0070660_1000473551 362
207 3300005340 Ga0070689_100002178 Ga0070689_1000021788 362
208 3300005340 Ga0070689_100004685 Ga0070689_1000046853 362
209 3300005341 Ga0070691_10001565 Ga0070691_1000156511 362
210 3300005341 Ga0070691_10007128 Ga0070691_100071282 362
211 3300005343 Ga0070687_100179604 Ga0070687_1001796041 362
212 3300005344 Ga0070661_100001455 Ga0070661_1000014557 362
213 3300005344 Ga0070661_100021209 Ga0070661_1000212092 362
214 3300005345 Ga0070692_10000434 Ga0070692_100004349 362
215 3300005345 Ga0070692_10015896 Ga0070692_100158963 362
216 3300005347 Ga0070668_100004423 Ga0070668_10000442312 362
217 3300005353 Ga0070669_100000409 Ga0070669_10000040911 362
218 3300005353 Ga0070669_100020734 Ga0070669_1000207343 362
219 3300005354 Ga0070675_100000166 Ga0070675_10000016639 362
220 3300005354 Ga0070675_100019299 Ga0070675_1000192993 362
221 3300005356 Ga0070674_100000644 Ga0070674_10000064419 362
222 3300005364 Ga0070673_100000041 Ga0070673_10000004120 362
223 3300005365 Ga0070688_100000180 Ga0070688_10000018023 362
224 3300005365 Ga0070688_100000730 Ga0070688_1000007305 362
225 3300005366 Ga0070659_100000752 Ga0070659_1000007528 362
226 3300005366 Ga0070659_100056123 Ga0070659_1000561232 362
227 3300005367 Ga0070667_100000365 Ga0070667_10000036510 362
228 3300005367 Ga0070667_100019198 Ga0070667_1000191985 362
229 3300005367 Ga0070667_100116424 Ga0070667_1001164242 362
230 3300005406 Ga0070703_10000903 Ga0070703_100009036 362
231 3300005434 Ga0070709_10003137 Ga0070709_100031377 362
232 3300005435 Ga0070714_100009592 Ga0070714_1000095924 362
233 3300005436 Ga0070713_100034309 Ga0070713_1000343092 362
234 3300005437 Ga0070710_10024251 Ga0070710_100242512 362
235 3300005437 Ga0070710_10053343 Ga0070710_100533432 362
236 3300005438 Ga0070701_10000493 Ga0070701_100004937 362
237 3300005439 Ga0070711_100030206 Ga0070711_1000302062 362
238 3300005439 Ga0070711_100048418 Ga0070711_1000484182 362
239 3300005440 Ga0070705_100232913 Ga0070705_1002329131 362
240 3300005441 Ga0070700_100000467 Ga0070700_1000004679 362
241 3300005444 Ga0070694_100000065 Ga0070694_10000006541 362
242 3300005444 Ga0070694_100240852 Ga0070694_1002408521 362
243 3300005455 Ga0070663_100000473 Ga0070663_1000004737 362
244 3300005455 Ga0070663_100056324 Ga0070663_1000563242 362
245 3300005455 Ga0070663_100325352 Ga0070663_1003253521 362
246 3300005456 Ga0070678_100000091 Ga0070678_10000009111 362
247 3300005457 Ga0070662_100022629 Ga0070662_1000226292 362
248 3300005457 Ga0070662_100023595 Ga0070662_1000235953 362
249 3300005459 Ga0068867_100001090 Ga0068867_10000109012 362
250 3300005459 Ga0068867_100020555 Ga0068867_1000205553 362
251 3300005466 Ga0070685_10001731 Ga0070685_100017319 362
252 3300005530 Ga0070679_100015891 Ga0070679_1000158916 362
253 3300005530 Ga0070679_100071862 Ga0070679_1000718622 362
254 3300005530 Ga0070679_100079573 Ga0070679_1000795733 362
255 3300005535 Ga0070684_100000219 Ga0070684_10000021911 362
256 3300005535 Ga0070684_100132421 Ga0070684_1001324212 362
257 3300005535 Ga0070684_100198285 Ga0070684_1001982851 362
258 3300005539 Ga0068853_100000600 Ga0068853_10000060014 362
259 3300005539 Ga0068853_100037517 Ga0068853_1000375172 362
260 3300005539 Ga0068853_100267372 Ga0068853_1002673721 362
261 3300005543 Ga0070672_100000019 Ga0070672_10000001920 362
262 3300005544 Ga0070686_100000318 Ga0070686_10000031823 362
263 3300005544 Ga0070686_100013377 Ga0070686_1000133771 362
264 3300005544 Ga0070686_100015710 Ga0070686_1000157101 362
265 3300005545 Ga0070695_100000474 Ga0070695_1000004749 362
266 3300005545 Ga0070695_100006777 Ga0070695_1000067773 362
267 3300005546 Ga0070696_100029045 Ga0070696_1000290453 362
268 3300005546 Ga0070696_100041201 Ga0070696_1000412012 362
269 3300005548 Ga0070665_100010015 Ga0070665_1000100151 362
270 3300005549 Ga0070704_100000252 Ga0070704_10000025213 362
271 3300005563 Ga0068855_100019218 Ga0068855_1000192182 362
272 3300005564 Ga0070664_100000819 Ga0070664_10000081918 362
273 3300005564 Ga0070664_100127997 Ga0070664_1001279971 362
274 3300005577 Ga0068857_100000768 Ga0068857_10000076812 362
275 3300005577 Ga0068857_100233957 Ga0068857_1002339571 362
276 3300005578 Ga0068854_100000179 Ga0068854_1000001792 362
277 3300005614 Ga0068856_100002295 Ga0068856_10000229523 362
278 3300005615 Ga0070702_100000898 Ga0070702_10000089811 362
279 3300005616 Ga0068852_100001992 Ga0068852_1000019923 362
280 3300005617 Ga0068859_100001870 Ga0068859_1000018706 362
281 3300005618 Ga0068864_100000429 Ga0068864_10000042926 362
282 3300005618 Ga0068864_100201999 Ga0068864_1002019992 362
283 3300005718 Ga0068866_10000461 Ga0068866_100004612 362
284 3300005719 Ga0068861_100000169 Ga0068861_10000016912 362
285 3300005840 Ga0068870_10000586 Ga0068870_1000058611 362
286 3300005841 Ga0068863_100000381 Ga0068863_10000038123 362
287 3300005842 Ga0068858_100009197 Ga0068858_1000091973 362
288 3300005842 Ga0068858_100081595 Ga0068858_1000815952 362
289 3300005843 Ga0068860_100001472 Ga0068860_10000147213 362
290 3300005843 Ga0068860_100028934 Ga0068860_1000289343 362
291 3300005843 Ga0068860_100104941 Ga0068860_1001049413 362
292 3300005844 Ga0068862_100001886 Ga0068862_10000188612 362
293 3300005844 Ga0068862_100003346 Ga0068862_1000033468 362
294 3300005937 Ga0081455_10000036 Ga0081455_10000036121 362
295 3300006028 Ga0070717_10000199 Ga0070717_1000019910 362
296 3300006058 Ga0075432_10000873 Ga0075432_100008737 362
297 3300006058 Ga0075432_10040078 Ga0075432_100400782 362
298 3300006163 Ga0070715_10053985 Ga0070715_100539852 362
299 3300006173 Ga0070716_100015201 Ga0070716_1000152014 362
300 3300006175 Ga0070712_100329784 Ga0070712_1003297842 362
301 3300006178 Ga0075367_10033854 Ga0075367_100338542 362
302 3300006237 Ga0097621_100001234 Ga0097621_10000123412 362
303 3300006358 Ga0068871_100000068 Ga0068871_10000006846 362
304 3300006358 Ga0068871_100081861 Ga0068871_1000818613 362
305 3300006846 Ga0075430_100004696 Ga0075430_1000046967 362
306 3300006847 Ga0075431_100006639 Ga0075431_1000066397 362
307 3300006852 Ga0075433_10001599 Ga0075433_100015995 362
308 3300006852 Ga0075433_10013425 Ga0075433_100134253 362
309 3300006871 Ga0075434_100000576 Ga0075434_10000057624 362
310 3300006871 Ga0075434_100001666 Ga0075434_1000016664 362
311 3300006880 Ga0075429_100013193 Ga0075429_1000131933 362
312 3300006881 Ga0068865_100015742 Ga0068865_1000157422 362
313 3300006914 Ga0075436_100098484 Ga0075436_1000984842 362
314 3300006914 Ga0075436_100222644 Ga0075436_1002226441 362
315 3300006931 Ga0097620_100001870 Ga0097620_1000018706 362
316 3300007076 Ga0075435_100002716 Ga0075435_10000271611 362
317 3300007076 Ga0075435_100042109 Ga0075435_1000421093 362
318 3300007076 Ga0075435_100067418 Ga0075435_1000674183 362
319 3300009094 Ga0111539_10000503 Ga0111539_1000050327 362
320 3300009094 Ga0111539_10003417 Ga0111539_100034176 362
321 3300009094 Ga0111539_10175783 Ga0111539_101757831 362
322 3300009098 Ga0105245_10000780 Ga0105245_1000078020 362
323 3300009098 Ga0105245_10078335 Ga0105245_100783354 362
324 3300009101 Ga0105247_10241738 Ga0105247_102417381 362
325 3300009147 Ga0114129_10013874 Ga0114129_100138745 362
326 3300009147 Ga0114129_10023827 Ga0114129_100238273 362
327 3300009148 Ga0105243_10001083 Ga0105243_1000108321 362
328 3300009148 Ga0105243_10232362 Ga0105243_102323622 362
329 3300009174 Ga0105241_10000760 Ga0105241_1000076020 362
330 3300009174 Ga0105241_10129672 Ga0105241_101296723 362
331 3300009176 Ga0105242_10006332 Ga0105242_100063322 362
332 3300009176 Ga0105242_10030536 Ga0105242_100305365 362
333 3300009176 Ga0105242_10072061 Ga0105242_100720613 362
334 3300009177 Ga0105248_10011305 Ga0105248_1001130510 362
335 3300009177 Ga0105248_10168883 Ga0105248_101688832 362
336 3300009545 Ga0105237_10007890 Ga0105237_100078902 362
337 3300009545 Ga0105237_10064505 Ga0105237_100645055 362
338 3300009545 Ga0105237_10173560 Ga0105237_101735602 362
339 3300009551 Ga0105238_10035142 Ga0105238_100351423 362
340 3300009553 Ga0105249_10002196 Ga0105249_100021962 362
341 3300009553 Ga0105249_10017908 Ga0105249_100179082 362
342 3300009553 Ga0105249_10362518 Ga0105249_103625182 362
343 3300010375 Ga0105239_10002791 Ga0105239_1000279119 362
344 3300010375 Ga0105239_10003820 Ga0105239_1000382012 362
345 3300010375 Ga0105239_10419325 Ga0105239_104193252 362
346 3300011119 Ga0105246_10000061 Ga0105246_1000006138 362
347 3300013100 Ga0157373_10084995 Ga0157373_100849952 362
348 3300013100 Ga0157373_10110205 Ga0157373_101102052 362
349 3300013102 Ga0157371_10035739 Ga0157371_100357392 362
350 3300013102 Ga0157371_10068201 Ga0157371_100682012 362
351 3300013104 Ga0157370_10181509 Ga0157370_101815092 362
352 3300013250 Ga0171462_1046 Ga0171462_104613 362
353 3300013296 Ga0157374_10001691 Ga0157374_100016917 362
354 3300013297 Ga0157378_10001445 Ga0157378_100014456 362
355 3300013306 Ga0163162_10000790 Ga0163162_100007907 362
356 3300013306 Ga0163162_10018394 Ga0163162_100183947 362
357 3300013307 Ga0157372_10009037 Ga0157372_100090372 362
358 3300013308 Ga0157375_10000468 Ga0157375_1000046817 362
359 3300014325 Ga0163163_10001508 Ga0163163_100015083 362
360 3300014325 Ga0163163_10184099 Ga0163163_101840992 362
361 3300014326 Ga0157380_10002913 Ga0157380_100029133 362
362 3300014745 Ga0157377_10000276 Ga0157377_1000027621 362
363 3300014968 Ga0157379_10002285 Ga0157379_1000228516 362
364 3300014968 Ga0157379_10026464 Ga0157379_100264646 362
365 3300014968 Ga0157379_10138607 Ga0157379_101386071 362
366 3300014969 Ga0157376_10000692 Ga0157376_1000069210 362
367 3300014969 Ga0157376_10043172 Ga0157376_100431724 362
368 3300014969 Ga0157376_10250041 Ga0157376_102500412 362
369 3300017792 Ga0163161_10000384 Ga0163161_1000038420 362
370 3300017792 Ga0163161_10079048 Ga0163161_100790482 362
371 3300020082 Ga0206353_11680947 Ga0206353_116809472 362
372 3300025271 Ga0207666_1000097 Ga0207666_10000976 362
373 3300025284 Ga0209130_1000087 Ga0209130_100008755 362
374 3300025291 Ga0209675_1001209 Ga0209675_100120911 362
375 3300025294 Ga0209025_1000014 Ga0209025_1000014596 362
376 3300025294 Ga0209025_1003588 Ga0209025_10035886 362
377 3300025295 Ga0209564_1000017 Ga0209564_100001734 362
378 3300025295 Ga0209564_1000187 Ga0209564_1000187109 362
379 3300025299 Ga0209256_1000055 Ga0209256_1000055182 362
380 3300025299 Ga0209256_1000146 Ga0209256_100014672 362
381 3300025302 Ga0207426_1003682 Ga0207426_10036823 362
382 3300025315 Ga0207697_10000550 Ga0207697_100005506 362
383 3300025885 Ga0207653_10002301 Ga0207653_100023013 362
384 3300025893 Ga0207682_10000088 Ga0207682_1000008821 362
385 3300025898 Ga0207692_10030999 Ga0207692_100309992 362
386 3300025899 Ga0207642_10000926 Ga0207642_100009267 362
387 3300025900 Ga0207710_10024509 Ga0207710_100245093 362
388 3300025901 Ga0207688_10001203 Ga0207688_1000120311 362
389 3300025901 Ga0207688_10023663 Ga0207688_100236632 362
390 3300025903 Ga0207680_10013156 Ga0207680_100131562 362
391 3300025903 Ga0207680_10015527 Ga0207680_100155273 362
392 3300025904 Ga0207647_10002714 Ga0207647_1000271411 362
393 3300025906 Ga0207699_10002088 Ga0207699_100020883 362
394 3300025907 Ga0207645_10000140 Ga0207645_1000014011 362
395 3300025908 Ga0207643_10000083 Ga0207643_1000008311 362
396 3300025911 Ga0207654_10063367 Ga0207654_100633672 362
397 3300025912 Ga0207707_10004967 Ga0207707_100049672 362
398 3300025912 Ga0207707_10013826 Ga0207707_100138266 362
399 3300025914 Ga0207671_10074488 Ga0207671_100744882 362
400 3300025914 Ga0207671_10090131 Ga0207671_100901312 362
401 3300025915 Ga0207693_10007583 Ga0207693_100075835 362
402 3300025915 Ga0207693_10009124 Ga0207693_100091246 362
403 3300025916 Ga0207663_10009641 Ga0207663_100096413 362
404 3300025916 Ga0207663_10171384 Ga0207663_101713842 362
405 3300025917 Ga0207660_10000073 Ga0207660_1000007313 362
406 3300025917 Ga0207660_10080492 Ga0207660_100804922 362
407 3300025918 Ga0207662_10000964 Ga0207662_100009646 362
408 3300025918 Ga0207662_10013126 Ga0207662_100131263 362
409 3300025918 Ga0207662_10024056 Ga0207662_100240563 362
410 3300025919 Ga0207657_10005395 Ga0207657_100053956 362
411 3300025920 Ga0207649_10000450 Ga0207649_1000045012 362
412 3300025920 Ga0207649_10049051 Ga0207649_100490512 362
413 3300025921 Ga0207652_10007770 Ga0207652_100077702 362
414 3300025923 Ga0207681_10000097 Ga0207681_1000009739 362
415 3300025924 Ga0207694_10056347 Ga0207694_100563473 362
416 3300025925 Ga0207650_10041696 Ga0207650_100416962 362
417 3300025926 Ga0207659_10000092 Ga0207659_1000009239 362
418 3300025927 Ga0207687_10016821 Ga0207687_100168212 362
419 3300025929 Ga0207664_10005574 Ga0207664_1000557410 362
420 3300025931 Ga0207644_10005083 Ga0207644_100050838 362
421 3300025931 Ga0207644_10007663 Ga0207644_100076637 362
422 3300025931 Ga0207644_10148161 Ga0207644_101481612 362
423 3300025932 Ga0207690_10002606 Ga0207690_100026068 362
424 3300025932 Ga0207690_10147219 Ga0207690_101472191 362
425 3300025933 Ga0207706_10004310 Ga0207706_1000431011 362
426 3300025933 Ga0207706_10008823 Ga0207706_1000882310 362
427 3300025933 Ga0207706_10046615 Ga0207706_100466152 362
428 3300025934 Ga0207686_10000796 Ga0207686_1000079612 362
429 3300025934 Ga0207686_10027960 Ga0207686_100279602 362
430 3300025935 Ga0207709_10000362 Ga0207709_1000036223 362
431 3300025935 Ga0207709_10103109 Ga0207709_101031092 362
432 3300025936 Ga0207670_10004868 Ga0207670_100048682 362
433 3300025937 Ga0207669_10000350 Ga0207669_100003505 362
434 3300025938 Ga0207704_10000479 Ga0207704_100004793 362
435 3300025939 Ga0207665_10001702 Ga0207665_100017024 362
436 3300025940 Ga0207691_10000283 Ga0207691_1000028339 362
437 3300025941 Ga0207711_10009675 Ga0207711_100096757 362
438 3300025941 Ga0207711_10078578 Ga0207711_100785782 362
439 3300025942 Ga0207689_10000085 Ga0207689_1000008570 362
440 3300025944 Ga0207661_10000464 Ga0207661_1000046421 362
441 3300025945 Ga0207679_10000030 Ga0207679_10000030146 362
442 3300025945 Ga0207679_10117323 Ga0207679_101173232 362
443 3300025949 Ga0207667_10018715 Ga0207667_100187152 362
444 3300025960 Ga0207651_10000088 Ga0207651_100000882 362
445 3300025961 Ga0207712_10010820 Ga0207712_100108204 362
446 3300025972 Ga0207668_10000114 Ga0207668_1000011439 362
447 3300025981 Ga0207640_10005820 Ga0207640_100058204 362
448 3300025981 Ga0207640_10019689 Ga0207640_100196892 362
449 3300025986 Ga0207658_10002853 Ga0207658_100028537 362
450 3300026023 Ga0207677_10009721 Ga0207677_100097213 362
451 3300026035 Ga0207703_10000983 Ga0207703_1000098314 362
452 3300026035 Ga0207703_10048789 Ga0207703_100487892 362
453 3300026041 Ga0207639_10000305 Ga0207639_1000030512 362
454 3300026067 Ga0207678_10000125 Ga0207678_1000012546 362
455 3300026067 Ga0207678_10016358 Ga0207678_100163586 362
456 3300026067 Ga0207678_10032906 Ga0207678_100329062 362
457 3300026067 Ga0207678_10132722 Ga0207678_101327222 362
458 3300026075 Ga0207708_10000187 Ga0207708_100001876 362
459 3300026078 Ga0207702_10005437 Ga0207702_100054373 362
460 3300026078 Ga0207702_10050201 Ga0207702_100502013 362
461 3300026088 Ga0207641_10002129 Ga0207641_1000212913 362
462 3300026088 Ga0207641_10037602 Ga0207641_100376022 362
463 3300026089 Ga0207648_10002168 Ga0207648_1000216821 362
464 3300026095 Ga0207676_10000074 Ga0207676_1000007420 362
465 3300026095 Ga0207676_10042253 Ga0207676_100422533 362
466 3300026116 Ga0207674_10002501 Ga0207674_100025016 362
467 3300026118 Ga0207675_100004556 Ga0207675_1000045566 362
468 3300026121 Ga0207683_10000014 Ga0207683_1000001440 362
469 3300026121 Ga0207683_10003999 Ga0207683_1000399914 362
470 3300026121 Ga0207683_10004104 Ga0207683_100041042 362
471 3300026142 Ga0207698_10001242 Ga0207698_100012423 362
472 3300026142 Ga0207698_10273137 Ga0207698_102731372 362
473 3300027695 Ga0209966_1001229 Ga0209966_10012293 362
474 3300027717 Ga0209998_10000361 Ga0209998_100003616 362
475 3300027717 Ga0209998_10002431 Ga0209998_100024312 362
476 3300027876 Ga0209974_10002250 Ga0209974_100022507 362
477 3300027876 Ga0209974_10007253 Ga0209974_100072532 362
478 3300027907 Ga0207428_10000114 Ga0207428_1000011475 362
479 3300027907 Ga0207428_10000467 Ga0207428_1000046728 362
480 3300027907 Ga0207428_10005035 Ga0207428_100050359 362
481 3300028379 Ga0268266_10027346 Ga0268266_100273462 362
482 3300028380 Ga0268265_10001371 Ga0268265_100013718 362
483 3300028380 Ga0268265_10007749 Ga0268265_100077492 362
484 3300028381 Ga0268264_10000469 Ga0268264_1000046919 362
485 3300028381 Ga0268264_10016375 Ga0268264_100163756 362
486 3300031241 Ga0265325_10000423 Ga0265325_1000042319 362
487 3300031241 Ga0265325_10094477 Ga0265325_100944772 362
488 3300031249 Ga0265339_10003373 Ga0265339_1000337312 362
489 3300031344 Ga0265316_10119807 Ga0265316_101198072 362
490 3300031595 Ga0265313_10000115 Ga0265313_1000011552 362
491 3300031595 Ga0265313_10002944 Ga0265313_100029442 362
492 3300031901 Ga0307406_10226106 Ga0307406_102261061 362
493 3300034816 Ga0373930_0000138 Ga0373930_0000138_6492_7580 362
494 3300034818 Ga0373950_0000569 Ga0373950_0000569_2275_3363 362
495 3300034957 Ga0373938_0000547 Ga0373938_0000547_3688_4776 362
496 3300034957 Ga0373938_0000639 Ga0373938_0000639_477_1565 362
497 3300035084 Ga0373928_0003248 Ga0373928_0003248_78_1166 362
498 3300035085 Ga0373929_0000455 Ga0373929_0000455_6485_7573 362
499 3300035085 Ga0373929_0005461 Ga0373929_0005461_571_1659 362
500 3300035088 Ga0373940_0003655 Ga0373940_0003655_1198_2286 362
501 3300035088 Ga0373940_0016340 Ga0373940_0016340_549_1637 362
502 3300035090 Ga0373949_0001506 Ga0373949_0001506_3694_4782 362
503 3300035091 Ga0373951_0002818 Ga0373951_0002818_2509_3597 362
504 3300035091 Ga0373951_0036704 Ga0373951_0036704_19_1107 362
505 3300035092 Ga0373952_0000029 Ga0373952_0000029_7405_8493 362
506 3300035092 Ga0373952_0001129 Ga0373952_0001129_908_1996 362
507 3300035112 Ga0373932_0000468 Ga0373932_0000468_700_1788 362
508 3300035112 Ga0373932_0004542 Ga0373932_0004542_2160_3248 362
509 3300035113 Ga0373936_0013398 Ga0373936_0013398_582_1670 362
510 3300035114 Ga0373939_0000339 Ga0373939_0000339_6964_8052 362
511 3300035114 Ga0373939_0028144 Ga0373939_0028144_223_1311 362
512 3300035114 Ga0373939_0036478 Ga0373939_0036478_352_1440 362
513 3300035115 Ga0373941_0001871 Ga0373941_0001871_1915_3003 362
514 3300035115 Ga0373941_0002209 Ga0373941_0002209_2731_3819 362
515 3300035116 Ga0373945_0030379 Ga0373945_0030379_269_1357 362
516 3300035117 Ga0373953_0016093 Ga0373953_0016093_117_1205 362
517 3300035117 Ga0373953_0033246 Ga0373953_0033246_841_1947 362
518 3300035118 Ga0373954_0002030 Ga0373954_0002030_3335_4423 362
519 3300035118 Ga0373954_0033972 Ga0373954_0033972_853_1941 362
520 3300035119 Ga0373956_0006309 Ga0373956_0006309_31_1119 362
521 3300035120 Ga0373957_0007402 Ga0373957_0007402_1622_2710 362
522 3300035121 Ga0373960_0000611 Ga0373960_0000611_4866_5954 362
523 3300035170 Ga0373943_0031766 Ga0373943_0031766_1311_2399 362
524 3300035171 Ga0373946_0020116 Ga0373946_0020116_1399_2487 362
525 3300035171 Ga0373946_0102582 Ga0373946_0102582_180_1268 362
526 3300035172 Ga0373955_0001269 Ga0373955_0001269_1646_2734 362
527 3300035172 Ga0373955_0001523 Ga0373955_0001523_7607_8695 362
528 3300035172 Ga0373955_0005294 Ga0373955_0005294_1939_3027 362
529 3300035172 Ga0373955_0019290 Ga0373955_0019290_524_1630 362
530 3300035207 Ga0373942_0011321 Ga0373942_0011321_559_1647 362
531 3300035241 Ga0373961_0013171 Ga0373961_0013171_836_1924 362
532 3300035242 Ga0373962_0001530 Ga0373962_0001530_1737_2825 362
533 3300035242 Ga0373962_0017701 Ga0373962_0017701_664_1752 362
534 3300035691 Ga0373931_0000169 Ga0373931_0000169_13505_14593 362
535 3300035695 Ga0373927_0038796 Ga0373927_0038796_751_1845 362
536 3300035724 Ga0373933_0001124 Ga0373933_0001124_9629_10717 362
537 3300035724 Ga0373933_0052936 Ga0373933_0052936_905_1993 362
538 3300035725 Ga0373947_0036069 Ga0373947_0036069_272_1360 362
539 3300035725 Ga0373947_0048752 Ga0373947_0048752_597_1685 362
540 3300036401 Ga0373937_0004918 Ga0373937_0004918_5006_6094 362
541 3300036401 Ga0373937_0007509 Ga0373937_0007509_918_2024 362
542 3300036401 Ga0373937_0012121 Ga0373937_0012121_5251_6339 362
543 3300036401 Ga0373937_0111440 Ga0373937_0111440_446_1534 362
544 3300036401 Ga0373937_0130016 Ga0373937_0130016_850_1944 362
545 3300037068 Ga0373925_0049020 Ga0373925_0049020_972_2060 362
546 3300039437 Ga0436365_0418355 Ga0436365_0418355_598_1692 362
547 3300039437 Ga0436365_1126455 Ga0436365_1126455_874_1971 362
548 3300039437 Ga0436365_1741712 Ga0436365_1741712_1708_2844 362
549 3300046454 Ga0495592_0020065 Ga0495592_0020065_2396_3484 362
550 3300046454 Ga0495592_0024541 Ga0495592_0024541_1260_2348 362
551 3300046455 Ga0495603_0007829 Ga0495603_0007829_800_1888 362
552 3300046458 Ga0495591_031376 Ga0495591_031376_395_1483 362
553 3300046461 Ga0495641_0025043 Ga0495641_0025043_1570_2658 362
554 3300046463 Ga0495653_0008326 Ga0495653_0008326_2410_3498 362
555 3300046463 Ga0495653_0038924 Ga0495653_0038924_966_2054 362
556 3300046463 Ga0495653_0059893 Ga0495653_0059893_260_1348 362
557 3300046475 Ga0495639_0039439 Ga0495639_0039439_266_1354 362
558 3300046476 Ga0495662_0013876 Ga0495662_0013876_1683_2771 362
559 3300046477 Ga0495664_0003537 Ga0495664_0003537_2531_3619 362
560 3300046477 Ga0495664_0028609 Ga0495664_0028609_1202_2290 362
561 3300046492 Ga0495585_0016072 Ga0495585_0016072_921_2009 362
562 3300046499 Ga0495594_0024673 Ga0495594_0024673_1989_3077 362
563 3300046501 Ga0495607_0015506 Ga0495607_0015506_1786_2874 362
564 3300046511 Ga0495608_0001474 Ga0495608_0001474_5521_6609 362
565 3300046511 Ga0495608_0017824 Ga0495608_0017824_1394_2500 362
566 3300046512 Ga0495610_0065325 Ga0495610_0065325_203_1330 362
567 3300046514 Ga0495618_0027234 Ga0495618_0027234_2439_3527 362
568 3300046516 Ga0495628_0001927 Ga0495628_0001927_12319_13407 362
569 3300046516 Ga0495628_0024184 Ga0495628_0024184_554_1642 362
570 3300046516 Ga0495628_0113567 Ga0495628_0113567_30_1118 362
571 3300046517 Ga0495630_0047564 Ga0495630_0047564_815_1903 362
572 3300046517 Ga0495630_0059407 Ga0495630_0059407_1309_2397 362
573 3300046517 Ga0495630_0332177 Ga0495630_0332177_39_1133 362
574 3300046523 Ga0495644_0006919 Ga0495644_0006919_2025_3113 362
575 3300046529 Ga0495652_0015699 Ga0495652_0015699_2672_3760 362
576 3300046531 Ga0495665_0038652 Ga0495665_0038652_420_1508 362
577 3300046533 Ga0495640_0020173 Ga0495640_0020173_1140_2228 362
578 3300046533 Ga0495640_0132462 Ga0495640_0132462_97_1185 362
579 3300046533 Ga0495640_0146655 Ga0495640_0146655_361_1449 362
580 3300046535 Ga0495586_0008177 Ga0495586_0008177_1336_2424 362
581 3300046536 Ga0495587_0002240 Ga0495587_0002240_4815_5903 362
582 3300046536 Ga0495587_0042135 Ga0495587_0042135_577_1665 362
583 3300046543 Ga0495645_0002539 Ga0495645_0002539_4443_5531 362
584 3300046543 Ga0495645_0023203 Ga0495645_0023203_520_1608 362
585 3300046543 Ga0495645_0119189 Ga0495645_0119189_289_1377 362
586 3300046559 Ga0495667_0001150 Ga0495667_0001150_12178_13266 362
587 3300046559 Ga0495667_0021829 Ga0495667_0021829_1241_2329 362
588 3300046559 Ga0495667_0057100 Ga0495667_0057100_988_2076 362
589 3300046615 Ga0495656_0003843 Ga0495656_0003843_2709_3797 362
590 3300046642 Ga0495634_0121245 Ga0495634_0121245_140_1228 362
591 3300046663 Ga0495635_0003881 Ga0495635_0003881_6074_7162 362
592 3300046663 Ga0495635_0037995 Ga0495635_0037995_1312_2400 362
593 3300046663 Ga0495635_0070978 Ga0495635_0070978_553_1641 362
594 3300046664 Ga0495659_0001458 Ga0495659_0001458_1690_2778 362
595 3300046674 Ga0495588_0013595 Ga0495588_0013595_1722_2810 362
596 3300046678 Ga0495599_0009859 Ga0495599_0009859_1759_2847 362
597 3300046679 Ga0495623_0000420 Ga0495623_0000420_22042_23130 362
598 3300046680 Ga0495646_0003113 Ga0495646_0003113_1598_2686 362
599 3300046680 Ga0495646_0051463 Ga0495646_0051463_1267_2355 362
600 3300046681 Ga0495647_0018043 Ga0495647_0018043_871_1959 362
601 3300046689 Ga0495613_0054377 Ga0495613_0054377_407_1495 362
602 3300046690 Ga0495624_0054221 Ga0495624_0054221_128_1216 362
603 3300046690 Ga0495624_0101906 Ga0495624_0101906_420_1508 362
604 3300046691 Ga0495670_0000291 Ga0495670_0000291_19392_20480 362
605 3300046809 Ga0495600_0001326 Ga0495600_0001326_6010_7098 362
606 3300046809 Ga0495600_0019703 Ga0495600_0019703_2168_3256 362
607 3300046809 Ga0495600_0060643 Ga0495600_0060643_118_1206 362
608 3300047315 Ga0495581_0043070 Ga0495581_0043070_894_1982 362
609 3300047317 Ga0495604_0003891 Ga0495604_0003891_3193_4281 362
610 3300047317 Ga0495604_0017520 Ga0495604_0017520_933_2021 362
611 3300047317 Ga0495604_0045926 Ga0495604_0045926_2290_3378 362
612 3300047317 Ga0495604_0055679 Ga0495604_0055679_711_1817 362
613 3300047319 Ga0495674_0042562 Ga0495674_0042562_1684_2772 362
614 3300047319 Ga0495674_0047567 Ga0495674_0047567_2334_3422 362
615 3300047322 Ga0495680_0044564 Ga0495680_0044564_447_1535 362
616 3300047444 Ga0495675_0001544 Ga0495675_0001544_5355_6443 362
617 3300047444 Ga0495675_0122552 Ga0495675_0122552_147_1265 362
618 3300047471 Ga0495684_0002087 Ga0495684_0002087_3224_4312 362
619 3300047471 Ga0495684_0023924 Ga0495684_0023924_1357_2445 362
620 3300047673 Ga0495593_0004626 Ga0495593_0004626_227_1315 362
621 3300048088 Ga0495602_0005526 Ga0495602_0005526_5450_6538 362
622 3300048088 Ga0495602_0057446 Ga0495602_0057446_1099_2187 362
623 3300048088 Ga0495602_0061017 Ga0495602_0061017_601_1707 362
624 3300048089 Ga0495614_0035948 Ga0495614_0035948_420_1508 362
625 3300048903 Ga0496100_0000106 Ga0496100_0000106_40245_41333 362
626 3300048903 Ga0496100_0166587 Ga0496100_0166587_59_1147 362
627 3300048904 Ga0496101_0000992 Ga0496101_0000992_13661_14749 362
628 3300048904 Ga0496101_0113210 Ga0496101_0113210_746_1834 362
629 3300048904 Ga0496101_0271289 Ga0496101_0271289_89_1177 362
630 3300048905 Ga0496102_0041646 Ga0496102_0041646_2848_3936 362
631 3300048905 Ga0496102_0091000 Ga0496102_0091000_80_1168 362
632 3300048905 Ga0496102_0176008 Ga0496102_0176008_467_1555 362
633 3300048905 Ga0496102_0329375 Ga0496102_0329375_89_1177 362
634 3300048906 Ga0496103_0010395 Ga0496103_0010395_2931_4019 362
635 3300048907 Ga0496104_0000090 Ga0496104_0000090_70181_71269 362
636 3300048907 Ga0496104_0244328 Ga0496104_0244328_131_1219 362
637 3300048908 Ga0496105_0018996 Ga0496105_0018996_2446_3534 362
638 3300048909 Ga0496106_0026062 Ga0496106_0026062_332_1420 362
639 3300048909 Ga0496106_0066563 Ga0496106_0066563_1418_2506 362
640 3300048910 Ga0496107_0000223 Ga0496107_0000223_2931_4019 362
641 3300048910 Ga0496107_0026443 Ga0496107_0026443_1495_2583 362
642 3300048910 Ga0496107_0066614 Ga0496107_0066614_257_1345 362
643 3300048910 Ga0496107_0066871 Ga0496107_0066871_513_1601 362
644 3300048910 Ga0496107_0076992 Ga0496107_0076992_59_1147 362
645 3300048911 Ga0496108_0003914 Ga0496108_0003914_6229_7317 362
646 3300048911 Ga0496108_0059924 Ga0496108_0059924_149_1237 362
647 3300048912 Ga0496109_0025242 Ga0496109_0025242_1275_2363 362
648 3300048912 Ga0496109_0108971 Ga0496109_0108971_528_1616 362
649 3300048913 Ga0496110_0022213 Ga0496110_0022213_4167_5255 362
650 3300048914 Ga0496111_0073817 Ga0496111_0073817_595_1683 362
651 3300048915 Ga0496112_0056898 Ga0496112_0056898_1447_2535 362
652 3300048915 Ga0496112_0092411 Ga0496112_0092411_1830_2918 362
653 3300048915 Ga0496112_0172239 Ga0496112_0172239_958_2046 362
654 3300048915 Ga0496112_0255789 Ga0496112_0255789_465_1553 362
655 3300048916 Ga0496113_0019689 Ga0496113_0019689_3500_4588 362
656 3300048916 Ga0496113_0164949 Ga0496113_0164949_646_1734 362
657 3300048917 Ga0496114_0006841 Ga0496114_0006841_1734_2822 362
658 3300048917 Ga0496114_0302343 Ga0496114_0302343_41_1129 362
659 3300048918 Ga0496115_0010308 Ga0496115_0010308_4978_6066 362
660 3300048918 Ga0496115_0032463 Ga0496115_0032463_59_1147 362
661 3300048918 Ga0496115_0253738 Ga0496115_0253738_211_1299 362
662 3300048920 Ga0496117_0028863 Ga0496117_0028863_2257_3378 362
663 3300049569 Ga0501032_0039937 Ga0501032_0039937_1972_3177 362
664 3300049571 Ga0501034_0002201 Ga0501034_0002201_22874_23962 362
665 3300049571 Ga0501034_0031278 Ga0501034_0031278_2337_3425 362
666 3300049571 Ga0501034_0122326 Ga0501034_0122326_863_1996 362
667 3300049571 Ga0501034_0124143 Ga0501034_0124143_493_1581 362
668 3300049571 Ga0501034_0214893 Ga0501034_0214893_685_1773 362
669 3300049572 Ga0501036_0001075 Ga0501036_0001075_1469_2557 362
670 3300049572 Ga0501036_0022844 Ga0501036_0022844_3926_5014 362
671 3300049572 Ga0501036_0029453 Ga0501036_0029453_2974_4107 362
672 3300049573 Ga0501037_0019552 Ga0501037_0019552_2073_3161 362
673 3300049573 Ga0501037_0032411 Ga0501037_0032411_117_1205 362
674 3300049573 Ga0501037_0040360 Ga0501037_0040360_33_1121 362
675 3300049573 Ga0501037_0041242 Ga0501037_0041242_1687_2775 362
676 3300049573 Ga0501037_0054451 Ga0501037_0054451_332_1420 362
677 3300049574 Ga0501038_0076689 Ga0501038_0076689_591_1724 362
678 3300049574 Ga0501038_0098169 Ga0501038_0098169_365_1453 362
679 3300049575 Ga0501039_0034413 Ga0501039_0034413_2432_3565 362
680 3300049579 Ga0501043_0007548 Ga0501043_0007548_4204_5292 362
681 3300049580 Ga0501046_0044408 Ga0501046_0044408_1870_2958 362
682 3300049580 Ga0501046_0057378 Ga0501046_0057378_654_1787 362
683 3300049580 Ga0501046_0105257 Ga0501046_0105257_798_1886 362
684 3300049581 Ga0501047_0000010 Ga0501047_0000010_76993_78081 362
685 3300049581 Ga0501047_0032068 Ga0501047_0032068_2976_4109 362
686 3300049582 Ga0501048_0000592 Ga0501048_0000592_16631_17719 362
687 3300049584 Ga0501068_0008615 Ga0501068_0008615_3068_4201 362
688 3300049584 Ga0501068_0020726 Ga0501068_0020726_2325_3413 362
689 3300049584 Ga0501068_0061365 Ga0501068_0061365_1025_2158 362
690 3300049585 Ga0501069_0012513 Ga0501069_0012513_1970_3067 362
691 3300049585 Ga0501069_0039276 Ga0501069_0039276_1098_2231 362
692 3300049586 Ga0501070_0012558 Ga0501070_0012558_116_1249 362
693 3300049586 Ga0501070_0015015 Ga0501070_0015015_151_1239 362
694 3300049586 Ga0501070_0024118 Ga0501070_0024118_2090_3178 362
695 3300049586 Ga0501070_0042658 Ga0501070_0042658_272_1369 362
696 3300049586 Ga0501070_0150330 Ga0501070_0150330_301_1389 362
697 3300049586 Ga0501070_0154369 Ga0501070_0154369_161_1249 362
698 3300049587 Ga0501071_0017492 Ga0501071_0017492_903_2036 362
699 3300049589 Ga0501073_0088132 Ga0501073_0088132_229_1317 362
700 3300049589 Ga0501073_0110866 Ga0501073_0110866_439_1572 362
701 3300049590 Ga0501074_0010211 Ga0501074_0010211_2543_3631 362
702 3300049590 Ga0501074_0019545 Ga0501074_0019545_3202_4335 362
703 3300049593 Ga0501077_0083389 Ga0501077_0083389_842_1969 362
704 3300049742 Ga0501080_0000314 Ga0501080_0000314_20352_21440 362
705 3300049742 Ga0501080_0033861 Ga0501080_0033861_3521_4609 362
706 3300049742 Ga0501080_0099096 Ga0501080_0099096_904_2037 362
707 3300049742 Ga0501080_0149735 Ga0501080_0149735_671_1804 362
708 3300049742 Ga0501080_0172916 Ga0501080_0172916_836_1969 362
709 3300049744 Ga0501083_0001213 Ga0501083_0001213_10814_11902 362
710 3300049744 Ga0501083_0029708 Ga0501083_0029708_2407_3495 362
711 3300049744 Ga0501083_0057891 Ga0501083_0057891_74_1162 362
712 3300049822 Ga0501035_0008723 Ga0501035_0008723_6454_7587 362
713 3300049823 Ga0501044_0007386 Ga0501044_0007386_7980_9068 362
714 3300049823 Ga0501044_0035271 Ga0501044_0035271_3311_4444 362
715 3300049823 Ga0501044_0037111 Ga0501044_0037111_1713_2801 362
716 3300049823 Ga0501044_0043548 Ga0501044_0043548_670_1803 362
717 3300049823 Ga0501044_0206170 Ga0501044_0206170_132_1220 362
718 3300049823 Ga0501044_0229279 Ga0501044_0229279_117_1205 362
719 3300050493 nmdc:mga0k408_15093_c1 nmdc:mga0k408_15093_c1_2943_4094 362
720 3300050494 nmdc:mga06z11_16338_c1 nmdc:mga06z11_16338_c1_2149_3237 362
721 3300050494 nmdc:mga06z11_22614_c1 nmdc:mga06z11_22614_c1_206_1306 362
722 3300050494 nmdc:mga06z11_71985_c1 nmdc:mga06z11_71985_c1_486_1586 362
723 3300050496 nmdc:mga07m45_106529_c1 nmdc:mga07m45_106529_c1_145_1245 362
724 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_39913_41001 362
725 3300050508 nmdc:mga09592_976_c1 nmdc:mga09592_976_c1_2375_3463 362
726 3300050509 nmdc:mga0qj67_13755_c1 nmdc:mga0qj67_13755_c1_2503_3591 362
727 3300050510 nmdc:mga06r32_6105_c1 nmdc:mga06r32_6105_c1_869_1957 362
728 3300050511 nmdc:mga08y16_10256_c1 nmdc:mga08y16_10256_c1_785_1873 362
729 3300050511 nmdc:mga08y16_138559_c1 nmdc:mga08y16_138559_c1_148_1236 362
730 3300050511 nmdc:mga08y16_144351_c1 nmdc:mga08y16_144351_c1_1229_2356 362
731 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_5039_6127 362
732 3300050511 nmdc:mga08y16_2396_c1 nmdc:mga08y16_2396_c1_3746_4834 362
733 3300050512 nmdc:mga0n895_138396_c1 nmdc:mga0n895_138396_c1_1216_2304 362
734 3300050512 nmdc:mga0n895_2745_c1 nmdc:mga0n895_2745_c1_3731_4864 362
735 3300050512 nmdc:mga0n895_4632_c1 nmdc:mga0n895_4632_c1_2646_3734 362
736 3300050513 nmdc:mga0rr50_13492_c1 nmdc:mga0rr50_13492_c1_1269_2357 362
737 3300050513 nmdc:mga0rr50_31674_c1 nmdc:mga0rr50_31674_c1_743_1831 362
738 3300050513 nmdc:mga0rr50_8402_c1 nmdc:mga0rr50_8402_c1_3888_4976 362
739 3300050514 nmdc:mga08x19_116588_c1 nmdc:mga08x19_116588_c1_258_1346 362
740 3300050514 nmdc:mga08x19_24581_c1 nmdc:mga08x19_24581_c1_2516_3604 362
741 3300050515 nmdc:mga0a205_380_c1 nmdc:mga0a205_380_c1_1772_2860 362
742 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_46881_47969 362
743 3300050516 nmdc:mga0sz30_53897_c1 nmdc:mga0sz30_53897_c1_22_1143 362
744 3300053077 Ga0495601_0000360 Ga0495601_0000360_10641_11729 362
745 3300053077 Ga0495601_0001260 Ga0495601_0001260_6010_7098 362
746 3300053077 Ga0495601_0012407 Ga0495601_0012407_2873_3961 362
747 3300053077 Ga0495601_0018263 Ga0495601_0018263_1571_2677 362
748 3300053077 Ga0495601_0088044 Ga0495601_0088044_548_1636 362
749 3300053078 Ga0495612_0000964 Ga0495612_0000964_5829_6917 362
750 3300053078 Ga0495612_0001978 Ga0495612_0001978_4973_6061 362
751 3300053078 Ga0495612_0014718 Ga0495612_0014718_1064_2152 362
752 3300053084 Ga0495595_0000969 Ga0495595_0000969_5547_6635 362
753 3300053084 Ga0495595_0009105 Ga0495595_0009105_1345_2451 362
754 3300053084 Ga0495595_0020214 Ga0495595_0020214_705_1793 362
755 3300053085 Ga0495619_0000581 Ga0495619_0000581_4793_5881 362
756 3300053085 Ga0495619_0001851 Ga0495619_0001851_6076_7164 362
757 3300053085 Ga0495619_0008740 Ga0495619_0008740_3712_4818 362
758 3300053085 Ga0495619_0008848 Ga0495619_0008848_3399_4487 362
759 3300053094 Ga0500566_0067112 Ga0500566_0067112_33_1121 362
760 3300053119 Ga0500595_007827 Ga0500595_007827_134_1231 362
761 3300053153 Ga0500616_0036227 Ga0500616_0036227_697_1824 362
762 3300053156 Ga0500622_0009576 Ga0500622_0009576_2850_3977 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

4

350

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd0-assembly1.cif.gz_A the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety 0.8749 1 360
2g04-assembly2.cif.gz_D crystal structure of fatty acid-coa racemase from mycobacterium tuberculosis h37rv 0.8743 1 359
2yim-assembly2.cif.gz_C the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue 0.8725 1 362
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8538 1 362
5yit-assembly1.cif.gz_A crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8503 1 362
ID Description Score Start End Superfamily
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9358 7 199 3.40.50.10540
af_Q18122_212_295_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9301 231 309 3.40.50.10540
af_Q9VIK0_212_295_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9256 229 309 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9136 24 222 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9105 1 225 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A1H1I7B9-F1-model_v4 Glycerate-2-kinase 0.9685 1 362 GO:0005737
GO:0008887
AF-V4RC96-F1-model_v4 Alpha-methylacyl-CoA racemase (EC 5.1.99.4) 0.9666 1 362 GO:0008111
AF-A0A1H1I7B9-F1-model_v4 Glycerate-2-kinase 0.9659 1 362 GO:0005737
GO:0008887
AF-V4RC96-F1-model_v4 Alpha-methylacyl-CoA racemase (EC 5.1.99.4) 0.964 1 362 GO:0008111
AF-A0A0P1GHG1-F1-model_v4 Formyl-coenzyme A transferase (EC 2.8.3.16) 0.9604 1 213 GO:0033608

Feature Viewer

pLDDT pTM Quality
92.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map