F479661
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 350 | 761 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_60_c1|nmdc:mga0qj67_60_c1_72199_72969 |
| Length | 256 |
| Sequence | VPPQGRRHLQHRRLDLRLTELFPGNLAMTDAVTAAQFEFLRSIDTPTVCNLIEMVAPERRGHGYTVKHLHCPFPDLPPIVGFAKTVTFKAKDKVPLGEAGYMQKRLDYLDYVASAPQPAIMVMHDLDGEHAGFGAFWGEVQSNIHKALGALGVVTDGSIRDIPMIAPNFQMLAAMIVPSHAYVHVVDYGMEIDVAGMATRSGDLVHADRHGAVVVPVDKIDAMKAANDKLAAAEARIIAAAKSGGGVEAIKAALKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 345 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.38 |
| Nodule | 0 |
| Rhizoplane | 9.71 |
| Rhizosphere | 82.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1007582 | 3300002070 | Bacteria | 1367 |
| 2 | JGI24738J21930_10014278 | 3300002075 | Bacteria | 1706 |
| 3 | JGI24744J21845_10036505 | 3300002077 | Bacteria | 928 |
| 4 | JGI25406J46586_10022905 | 3300003203 | Bacteria | 2478 |
| 5 | JGI25153J46596_10009294 | 3300003215 | Bacteria | 4594 |
| 6 | Ga0065714_10165718 | 3300005288 | Bacteria | 1029 |
| 7 | Ga0070658_10144164 | 3300005327 | Bacteria | 1991 |
| 8 | Ga0070676_10108578 | 3300005328 | Bacteria | 1725 |
| 9 | Ga0070690_100041601 | 3300005330 | Bacteria | 2910 |
| 10 | Ga0070690_100106061 | 3300005330 | Bacteria | 1869 |
| 11 | Ga0070690_100262431 | 3300005330 | Bacteria | 1226 |
| 12 | Ga0070670_100006191 | 3300005331 | Bacteria | 10116 |
| 13 | Ga0070677_10027484 | 3300005333 | Bacteria | 2142 |
| 14 | Ga0070677_10295773 | 3300005333 | Bacteria | 821 |
| 15 | Ga0068869_100368644 | 3300005334 | Bacteria | 1174 |
| 16 | Ga0068868_100486796 | 3300005338 | Bacteria | 1078 |
| 17 | Ga0070660_100366774 | 3300005339 | Bacteria | 1187 |
| 18 | Ga0070689_100109108 | 3300005340 | Bacteria | 2199 |
| 19 | Ga0070689_100286663 | 3300005340 | Bacteria | 1367 |
| 20 | Ga0070687_100237715 | 3300005343 | Bacteria | 1124 |
| 21 | Ga0070661_100090904 | 3300005344 | Bacteria | 2261 |
| 22 | Ga0070668_100167692 | 3300005347 | Bacteria | 1786 |
| 23 | Ga0070669_100301988 | 3300005353 | Bacteria | 1288 |
| 24 | Ga0070675_100138786 | 3300005354 | Bacteria | 2076 |
| 25 | Ga0070675_100206641 | 3300005354 | Bacteria | 1706 |
| 26 | Ga0070675_100308118 | 3300005354 | Bacteria | 1396 |
| 27 | Ga0070671_100261479 | 3300005355 | Bacteria | 1471 |
| 28 | Ga0070674_100023249 | 3300005356 | Bacteria | 4009 |
| 29 | Ga0070674_100120424 | 3300005356 | Bacteria | 1942 |
| 30 | Ga0070673_100084573 | 3300005364 | Bacteria | 2580 |
| 31 | Ga0070659_100389825 | 3300005366 | Bacteria | 1174 |
| 32 | Ga0070709_10002877 | 3300005434 | Bacteria | 9289 |
| 33 | Ga0070709_10140180 | 3300005434 | Bacteria | 1660 |
| 34 | Ga0070709_10365977 | 3300005434 | Bacteria | 1069 |
| 35 | Ga0070714_100013728 | 3300005435 | Bacteria | 6495 |
| 36 | Ga0070714_100020943 | 3300005435 | Bacteria | 5346 |
| 37 | Ga0070714_100089356 | 3300005435 | Bacteria | 2697 |
| 38 | Ga0070713_100046565 | 3300005436 | Bacteria | 3559 |
| 39 | Ga0070713_100320173 | 3300005436 | Bacteria | 1432 |
| 40 | Ga0070710_10045175 | 3300005437 | Bacteria | 2447 |
| 41 | Ga0070710_10088849 | 3300005437 | Bacteria | 1819 |
| 42 | Ga0070711_100170954 | 3300005439 | Bacteria | 1656 |
| 43 | Ga0070705_100049873 | 3300005440 | Bacteria | 2432 |
| 44 | Ga0070708_100342720 | 3300005445 | Bacteria | 1408 |
| 45 | Ga0070663_100126552 | 3300005455 | Bacteria | 1936 |
| 46 | Ga0070663_100235834 | 3300005455 | Bacteria | 1442 |
| 47 | Ga0070678_100185978 | 3300005456 | Bacteria | 1704 |
| 48 | Ga0070662_100004931 | 3300005457 | Bacteria | 8482 |
| 49 | Ga0070662_100096129 | 3300005457 | Bacteria | 2234 |
| 50 | Ga0070662_100686052 | 3300005457 | Bacteria | 866 |
| 51 | Ga0070681_10052487 | 3300005458 | Bacteria | 4066 |
| 52 | Ga0070681_10064707 | 3300005458 | Bacteria | 3627 |
| 53 | Ga0070685_10104108 | 3300005466 | Bacteria | 1737 |
| 54 | Ga0070685_10132614 | 3300005466 | Bacteria | 1560 |
| 55 | Ga0070707_100769295 | 3300005468 | Bacteria | 926 |
| 56 | Ga0070679_100321383 | 3300005530 | Bacteria | 1497 |
| 57 | Ga0070684_100182942 | 3300005535 | Bacteria | 1906 |
| 58 | Ga0070697_100269173 | 3300005536 | Bacteria | 1460 |
| 59 | Ga0070672_100242451 | 3300005543 | Bacteria | 1516 |
| 60 | Ga0070686_100126861 | 3300005544 | Bacteria | 1759 |
| 61 | Ga0070695_100267543 | 3300005545 | Bacteria | 1251 |
| 62 | Ga0070695_100397478 | 3300005545 | Bacteria | 1044 |
| 63 | Ga0070696_100455035 | 3300005546 | Bacteria | 1011 |
| 64 | Ga0070665_100263592 | 3300005548 | Bacteria | 1724 |
| 65 | Ga0070704_100066309 | 3300005549 | Bacteria | 2602 |
| 66 | Ga0070704_100117978 | 3300005549 | Bacteria | 2032 |
| 67 | Ga0068855_100483814 | 3300005563 | Bacteria | 1347 |
| 68 | Ga0070664_100161867 | 3300005564 | Bacteria | 1980 |
| 69 | Ga0070664_100292745 | 3300005564 | Bacteria | 1470 |
| 70 | Ga0068854_100311689 | 3300005578 | Bacteria | 1276 |
| 71 | Ga0068856_100501721 | 3300005614 | Bacteria | 1234 |
| 72 | Ga0070702_100152804 | 3300005615 | Bacteria | 1484 |
| 73 | Ga0068852_100315603 | 3300005616 | Bacteria | 1516 |
| 74 | Ga0068852_100803244 | 3300005616 | Bacteria | 955 |
| 75 | Ga0068859_100044884 | 3300005617 | Bacteria | 4441 |
| 76 | Ga0068859_100804121 | 3300005617 | Bacteria | 1028 |
| 77 | Ga0068864_100010077 | 3300005618 | Bacteria | 7804 |
| 78 | Ga0068864_100080872 | 3300005618 | Bacteria | 2848 |
| 79 | Ga0068864_100403400 | 3300005618 | Bacteria | 1299 |
| 80 | Ga0068866_10069868 | 3300005718 | Bacteria | 1852 |
| 81 | Ga0068866_10137413 | 3300005718 | Bacteria | 1398 |
| 82 | Ga0068861_100376546 | 3300005719 | Bacteria | 1253 |
| 83 | Ga0068863_100109532 | 3300005841 | Bacteria | 2629 |
| 84 | Ga0068860_101038898 | 3300005843 | Bacteria | 838 |
| 85 | Ga0081455_10001263 | 3300005937 | Bacteria | 31603 |
| 86 | Ga0081455_10012438 | 3300005937 | Bacteria | 8493 |
| 87 | Ga0081455_10021170 | 3300005937 | Bacteria | 6107 |
| 88 | Ga0081455_10126652 | 3300005937 | Bacteria | 2003 |
| 89 | Ga0081538_10002038 | 3300005981 | Bacteria | 20187 |
| 90 | Ga0081538_10020895 | 3300005981 | Bacteria | 4802 |
| 91 | Ga0081538_10069016 | 3300005981 | Bacteria | 1961 |
| 92 | Ga0081540_1000128 | 3300005983 | Bacteria | 80512 |
| 93 | Ga0081540_1000922 | 3300005983 | Bacteria | 26453 |
| 94 | Ga0081540_1014099 | 3300005983 | Bacteria | 5145 |
| 95 | Ga0081540_1047300 | 3300005983 | Bacteria | 2164 |
| 96 | Ga0081539_10002027 | 3300005985 | Bacteria | 30522 |
| 97 | Ga0081539_10037424 | 3300005985 | Bacteria | 2891 |
| 98 | Ga0081539_10194043 | 3300005985 | Bacteria | 943 |
| 99 | Ga0070717_10016903 | 3300006028 | Bacteria | 5664 |
| 100 | Ga0070717_10036056 | 3300006028 | Bacteria | 4009 |
| 101 | Ga0070717_10240965 | 3300006028 | Bacteria | 1595 |
| 102 | Ga0070717_10483827 | 3300006028 | Bacteria | 1118 |
| 103 | Ga0075365_10007739 | 3300006038 | Bacteria | 6048 |
| 104 | Ga0075365_10017704 | 3300006038 | Bacteria | 4366 |
| 105 | Ga0075365_10113997 | 3300006038 | Bacteria | 1860 |
| 106 | Ga0075363_100002772 | 3300006048 | Bacteria | 7268 |
| 107 | Ga0075363_100072469 | 3300006048 | Bacteria | 1873 |
| 108 | Ga0075363_100161548 | 3300006048 | Bacteria | 1269 |
| 109 | Ga0075364_10444775 | 3300006051 | Bacteria | 885 |
| 110 | Ga0075432_10116034 | 3300006058 | Bacteria | 1002 |
| 111 | Ga0070715_10005149 | 3300006163 | Bacteria | 4343 |
| 112 | Ga0070715_10044669 | 3300006163 | Bacteria | 1874 |
| 113 | Ga0070716_100010344 | 3300006173 | Bacteria | 4674 |
| 114 | Ga0070716_100467196 | 3300006173 | Bacteria | 923 |
| 115 | Ga0070712_100116272 | 3300006175 | Bacteria | 2006 |
| 116 | Ga0070712_100222991 | 3300006175 | Bacteria | 1493 |
| 117 | Ga0070712_100451138 | 3300006175 | Bacteria | 1071 |
| 118 | Ga0075362_10117100 | 3300006177 | Bacteria | 1258 |
| 119 | Ga0075362_10150570 | 3300006177 | Bacteria | 1116 |
| 120 | Ga0075367_10092180 | 3300006178 | Bacteria | 1844 |
| 121 | Ga0075369_10028769 | 3300006186 | Bacteria | 2331 |
| 122 | Ga0075369_10079845 | 3300006186 | Bacteria | 1450 |
| 123 | Ga0075366_10032042 | 3300006195 | Bacteria | 3094 |
| 124 | Ga0075366_10048225 | 3300006195 | Bacteria | 2525 |
| 125 | Ga0075366_10064159 | 3300006195 | Bacteria | 2184 |
| 126 | Ga0075366_10110469 | 3300006195 | Bacteria | 1653 |
| 127 | Ga0097621_100652065 | 3300006237 | Bacteria | 966 |
| 128 | Ga0075428_100146579 | 3300006844 | Bacteria | 2565 |
| 129 | Ga0075428_100151669 | 3300006844 | Bacteria | 2518 |
| 130 | Ga0075428_100218274 | 3300006844 | Bacteria | 2060 |
| 131 | Ga0075428_100353996 | 3300006844 | Bacteria | 1576 |
| 132 | Ga0075428_100421721 | 3300006844 | Bacteria | 1430 |
| 133 | Ga0075428_100438038 | 3300006844 | Bacteria | 1400 |
| 134 | Ga0075430_100000067 | 3300006846 | Bacteria | 56477 |
| 135 | Ga0075430_100002682 | 3300006846 | Bacteria | 14859 |
| 136 | Ga0075430_100017047 | 3300006846 | Bacteria | 6188 |
| 137 | Ga0075430_100104856 | 3300006846 | Bacteria | 2360 |
| 138 | Ga0075430_100112465 | 3300006846 | Bacteria | 2270 |
| 139 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 140 | Ga0075431_100124713 | 3300006847 | Bacteria | 2657 |
| 141 | Ga0075431_100181750 | 3300006847 | Bacteria | 2158 |
| 142 | Ga0075431_100186987 | 3300006847 | Bacteria | 2124 |
| 143 | Ga0075431_100247828 | 3300006847 | Bacteria | 1810 |
| 144 | Ga0075433_10014525 | 3300006852 | Bacteria | 6438 |
| 145 | Ga0075433_10031250 | 3300006852 | Bacteria | 4551 |
| 146 | Ga0075434_100003124 | 3300006871 | Bacteria | 14755 |
| 147 | Ga0075434_100020197 | 3300006871 | Bacteria | 6455 |
| 148 | Ga0075434_100034653 | 3300006871 | Bacteria | 4987 |
| 149 | Ga0075434_100138122 | 3300006871 | Bacteria | 2457 |
| 150 | Ga0075434_100208075 | 3300006871 | Bacteria | 1977 |
| 151 | Ga0075434_100236467 | 3300006871 | Bacteria | 1847 |
| 152 | Ga0075434_100521189 | 3300006871 | Bacteria | 1209 |
| 153 | Ga0075434_101010754 | 3300006871 | Bacteria | 845 |
| 154 | Ga0075429_100000288 | 3300006880 | Bacteria | 35542 |
| 155 | Ga0075429_100045647 | 3300006880 | Bacteria | 3812 |
| 156 | Ga0075429_100250062 | 3300006880 | Bacteria | 1552 |
| 157 | Ga0075429_100267850 | 3300006880 | Bacteria | 1496 |
| 158 | Ga0068865_100062764 | 3300006881 | Bacteria | 2609 |
| 159 | Ga0068865_100074714 | 3300006881 | Bacteria | 2415 |
| 160 | Ga0075436_100010935 | 3300006914 | Bacteria | 6229 |
| 161 | Ga0075436_100109432 | 3300006914 | Bacteria | 1928 |
| 162 | Ga0097620_100044882 | 3300006931 | Bacteria | 4441 |
| 163 | Ga0097620_100804072 | 3300006931 | Bacteria | 1028 |
| 164 | Ga0075435_100187081 | 3300007076 | Bacteria | 1752 |
| 165 | Ga0075435_100190124 | 3300007076 | Bacteria | 1738 |
| 166 | Ga0075435_100385789 | 3300007076 | Bacteria | 1204 |
| 167 | Ga0099794_10018981 | 3300007265 | Bacteria | 3091 |
| 168 | Ga0099795_10030011 | 3300007788 | Bacteria | 1863 |
| 169 | Ga0099795_10078185 | 3300007788 | Bacteria | 1261 |
| 170 | Ga0111539_10000753 | 3300009094 | Bacteria | 42119 |
| 171 | Ga0111539_10008081 | 3300009094 | Bacteria | 13410 |
| 172 | Ga0111539_10205729 | 3300009094 | Bacteria | 2294 |
| 173 | Ga0111539_10217739 | 3300009094 | Bacteria | 2224 |
| 174 | Ga0111539_10438547 | 3300009094 | Bacteria | 1521 |
| 175 | Ga0105245_10180925 | 3300009098 | Bacteria | 2014 |
| 176 | Ga0105245_10396357 | 3300009098 | Bacteria | 1378 |
| 177 | Ga0114129_10000104 | 3300009147 | Bacteria | 83195 |
| 178 | Ga0114129_10009491 | 3300009147 | Bacteria | 13873 |
| 179 | Ga0114129_10012500 | 3300009147 | Bacteria | 12087 |
| 180 | Ga0114129_10034990 | 3300009147 | Bacteria | 7095 |
| 181 | Ga0114129_10339881 | 3300009147 | Bacteria | 1991 |
| 182 | Ga0114129_10355109 | 3300009147 | Bacteria | 1941 |
| 183 | Ga0114129_10719070 | 3300009147 | Bacteria | 1282 |
| 184 | Ga0114129_10800854 | 3300009147 | Bacteria | 1202 |
| 185 | Ga0105243_10124820 | 3300009148 | Bacteria | 2176 |
| 186 | Ga0105243_10301494 | 3300009148 | Bacteria | 1452 |
| 187 | Ga0105243_10425642 | 3300009148 | Bacteria | 1239 |
| 188 | Ga0105242_10261222 | 3300009176 | Bacteria | 1564 |
| 189 | Ga0105248_10011816 | 3300009177 | Bacteria | 9631 |
| 190 | Ga0105248_10273483 | 3300009177 | Bacteria | 1902 |
| 191 | Ga0105238_10079541 | 3300009551 | Bacteria | 3268 |
| 192 | Ga0105249_10422349 | 3300009553 | Bacteria | 1367 |
| 193 | Ga0105249_10700876 | 3300009553 | Bacteria | 1073 |
| 194 | Ga0099796_10008664 | 3300010159 | Bacteria | 2718 |
| 195 | Ga0099796_10011549 | 3300010159 | Bacteria | 2467 |
| 196 | Ga0105239_10125876 | 3300010375 | Bacteria | 2848 |
| 197 | Ga0105239_10619579 | 3300010375 | Bacteria | 1235 |
| 198 | Ga0105246_10107510 | 3300011119 | Bacteria | 2043 |
| 199 | Ga0105246_10184605 | 3300011119 | Bacteria | 1609 |
| 200 | Ga0105246_10306643 | 3300011119 | Bacteria | 1284 |
| 201 | Ga0157374_10193688 | 3300013296 | Bacteria | 1989 |
| 202 | Ga0157378_10228098 | 3300013297 | Bacteria | 1773 |
| 203 | Ga0157378_10433098 | 3300013297 | Bacteria | 1302 |
| 204 | Ga0157378_10831962 | 3300013297 | Bacteria | 950 |
| 205 | Ga0163162_10354808 | 3300013306 | Unclassified | 1599 |
| 206 | Ga0163162_11339820 | 3300013306 | Bacteria | 814 |
| 207 | Ga0157372_10473240 | 3300013307 | Bacteria | 1460 |
| 208 | Ga0157372_10781068 | 3300013307 | Bacteria | 1110 |
| 209 | Ga0157375_10456600 | 3300013308 | Bacteria | 1443 |
| 210 | Ga0157375_10507594 | 3300013308 | Bacteria | 1370 |
| 211 | Ga0157375_10617338 | 3300013308 | Bacteria | 1242 |
| 212 | Ga0157375_11085451 | 3300013308 | Bacteria | 936 |
| 213 | Ga0163163_10240202 | 3300014325 | Bacteria | 1861 |
| 214 | Ga0157380_10332632 | 3300014326 | Bacteria | 1413 |
| 215 | Ga0157380_10420840 | 3300014326 | Bacteria | 1274 |
| 216 | Ga0157377_10047889 | 3300014745 | Bacteria | 2396 |
| 217 | Ga0157377_10269812 | 3300014745 | Bacteria | 1111 |
| 218 | Ga0157379_10108513 | 3300014968 | Bacteria | 2492 |
| 219 | Ga0157379_10288256 | 3300014968 | Bacteria | 1495 |
| 220 | Ga0157376_10224125 | 3300014969 | Bacteria | 1743 |
| 221 | Ga0157376_10920891 | 3300014969 | Bacteria | 893 |
| 222 | Ga0163161_10137134 | 3300017792 | Bacteria | 1850 |
| 223 | Ga0213876_10026242 | 3300021384 | Bacteria | 3073 |
| 224 | Ga0213875_10000040 | 3300021388 | Bacteria | 156362 |
| 225 | Ga0209233_1032547 | 3300025261 | Bacteria | 1204 |
| 226 | Ga0209758_1000772 | 3300025297 | Bacteria | 45993 |
| 227 | Ga0209758_1072316 | 3300025297 | Bacteria | 1079 |
| 228 | Ga0207656_10021259 | 3300025321 | Bacteria | 2591 |
| 229 | Ga0207653_10004559 | 3300025885 | Bacteria | 4343 |
| 230 | Ga0207682_10006602 | 3300025893 | Bacteria | 4667 |
| 231 | Ga0207692_10247175 | 3300025898 | Bacteria | 1068 |
| 232 | Ga0207692_10259191 | 3300025898 | Bacteria | 1045 |
| 233 | Ga0207642_10014594 | 3300025899 | Bacteria | 2903 |
| 234 | Ga0207710_10023264 | 3300025900 | Bacteria | 2663 |
| 235 | Ga0207688_10001688 | 3300025901 | Bacteria | 11694 |
| 236 | Ga0207647_10016309 | 3300025904 | Bacteria | 5073 |
| 237 | Ga0207647_10107971 | 3300025904 | Bacteria | 1647 |
| 238 | Ga0207685_10028604 | 3300025905 | Bacteria | 1965 |
| 239 | Ga0207685_10177582 | 3300025905 | Bacteria | 985 |
| 240 | Ga0207699_10039458 | 3300025906 | Bacteria | 2713 |
| 241 | Ga0207699_10171291 | 3300025906 | Bacteria | 1452 |
| 242 | Ga0207645_10023211 | 3300025907 | Bacteria | 4031 |
| 243 | Ga0207643_10005230 | 3300025908 | Bacteria | 6940 |
| 244 | Ga0207643_10118737 | 3300025908 | Bacteria | 1564 |
| 245 | Ga0207684_10114815 | 3300025910 | Bacteria | 2306 |
| 246 | Ga0207654_10012606 | 3300025911 | Bacteria | 4334 |
| 247 | Ga0207654_10194017 | 3300025911 | Bacteria | 1333 |
| 248 | Ga0207707_10082390 | 3300025912 | Bacteria | 2809 |
| 249 | Ga0207707_10359853 | 3300025912 | Bacteria | 1253 |
| 250 | Ga0207695_10419652 | 3300025913 | Bacteria | 1222 |
| 251 | Ga0207693_10024520 | 3300025915 | Bacteria | 4785 |
| 252 | Ga0207693_10091980 | 3300025915 | Bacteria | 2378 |
| 253 | Ga0207693_10357759 | 3300025915 | Bacteria | 1142 |
| 254 | Ga0207693_10489514 | 3300025915 | Bacteria | 960 |
| 255 | Ga0207663_10072276 | 3300025916 | Bacteria | 2229 |
| 256 | Ga0207663_10154499 | 3300025916 | Bacteria | 1613 |
| 257 | Ga0207663_10249185 | 3300025916 | Bacteria | 1306 |
| 258 | Ga0207662_10015482 | 3300025918 | Bacteria | 4291 |
| 259 | Ga0207662_10058968 | 3300025918 | Bacteria | 2299 |
| 260 | Ga0207657_10053343 | 3300025919 | Bacteria | 3503 |
| 261 | Ga0207657_10459204 | 3300025919 | Bacteria | 999 |
| 262 | Ga0207649_10196138 | 3300025920 | Bacteria | 1423 |
| 263 | Ga0207649_10510932 | 3300025920 | Bacteria | 915 |
| 264 | Ga0207652_10137924 | 3300025921 | Bacteria | 2179 |
| 265 | Ga0207681_10063327 | 3300025923 | Bacteria | 2550 |
| 266 | Ga0207681_10153997 | 3300025923 | Bacteria | 1726 |
| 267 | Ga0207681_10225105 | 3300025923 | Bacteria | 1453 |
| 268 | Ga0207694_10065655 | 3300025924 | Bacteria | 2829 |
| 269 | Ga0207694_10859542 | 3300025924 | Bacteria | 767 |
| 270 | Ga0207650_10001375 | 3300025925 | Bacteria | 17538 |
| 271 | Ga0207650_10102203 | 3300025925 | Bacteria | 2208 |
| 272 | Ga0207659_10102646 | 3300025926 | Bacteria | 2159 |
| 273 | Ga0207687_10127230 | 3300025927 | Bacteria | 1915 |
| 274 | Ga0207687_10156151 | 3300025927 | Bacteria | 1746 |
| 275 | Ga0207687_10579154 | 3300025927 | Bacteria | 944 |
| 276 | Ga0207700_10286292 | 3300025928 | Bacteria | 1419 |
| 277 | Ga0207700_10372447 | 3300025928 | Bacteria | 1247 |
| 278 | Ga0207664_10021536 | 3300025929 | Bacteria | 4796 |
| 279 | Ga0207664_10129219 | 3300025929 | Bacteria | 2125 |
| 280 | Ga0207644_10090227 | 3300025931 | Bacteria | 2283 |
| 281 | Ga0207644_10342592 | 3300025931 | Bacteria | 1212 |
| 282 | Ga0207706_10001850 | 3300025933 | Bacteria | 20737 |
| 283 | Ga0207706_10081581 | 3300025933 | Bacteria | 2842 |
| 284 | Ga0207706_10211951 | 3300025933 | Bacteria | 1698 |
| 285 | Ga0207706_10246977 | 3300025933 | Bacteria | 1559 |
| 286 | Ga0207709_10056635 | 3300025935 | Bacteria | 2427 |
| 287 | Ga0207669_10020906 | 3300025937 | Bacteria | 3442 |
| 288 | Ga0207669_10113152 | 3300025937 | Bacteria | 1824 |
| 289 | Ga0207669_10114182 | 3300025937 | Bacteria | 1817 |
| 290 | Ga0207704_10105374 | 3300025938 | Bacteria | 1891 |
| 291 | Ga0207665_10003686 | 3300025939 | Bacteria | 10230 |
| 292 | Ga0207665_10013404 | 3300025939 | Bacteria | 5390 |
| 293 | Ga0207665_10337399 | 3300025939 | Bacteria | 1135 |
| 294 | Ga0207665_10493146 | 3300025939 | Bacteria | 945 |
| 295 | Ga0207691_10001076 | 3300025940 | Bacteria | 27185 |
| 296 | Ga0207691_10071075 | 3300025940 | Bacteria | 3142 |
| 297 | Ga0207691_10139739 | 3300025940 | Bacteria | 2135 |
| 298 | Ga0207689_10020535 | 3300025942 | Bacteria | 5557 |
| 299 | Ga0207689_10342058 | 3300025942 | Bacteria | 1243 |
| 300 | Ga0207679_10228012 | 3300025945 | Bacteria | 1571 |
| 301 | Ga0207651_10120639 | 3300025960 | Bacteria | 1988 |
| 302 | Ga0207651_10273542 | 3300025960 | Bacteria | 1392 |
| 303 | Ga0207712_10555092 | 3300025961 | Bacteria | 988 |
| 304 | Ga0207712_10651372 | 3300025961 | Bacteria | 915 |
| 305 | Ga0207658_10224919 | 3300025986 | Bacteria | 1581 |
| 306 | Ga0207678_10010390 | 3300026067 | Bacteria | 8173 |
| 307 | Ga0207678_10177113 | 3300026067 | Bacteria | 1821 |
| 308 | Ga0207708_10034492 | 3300026075 | Bacteria | 3848 |
| 309 | Ga0207702_10534559 | 3300026078 | Bacteria | 1145 |
| 310 | Ga0207648_10264802 | 3300026089 | Bacteria | 1534 |
| 311 | Ga0207648_10331332 | 3300026089 | Bacteria | 1369 |
| 312 | Ga0207676_10008313 | 3300026095 | Bacteria | 7376 |
| 313 | Ga0207676_10042344 | 3300026095 | Bacteria | 3502 |
| 314 | Ga0207676_10116011 | 3300026095 | Bacteria | 2249 |
| 315 | Ga0207674_10056816 | 3300026116 | Bacteria | 3971 |
| 316 | Ga0207674_10063716 | 3300026116 | Bacteria | 3720 |
| 317 | Ga0207675_100082953 | 3300026118 | Bacteria | 3006 |
| 318 | Ga0207675_100323138 | 3300026118 | Bacteria | 1507 |
| 319 | Ga0207675_100806521 | 3300026118 | Bacteria | 952 |
| 320 | Ga0207683_10007038 | 3300026121 | Bacteria | 9645 |
| 321 | Ga0207683_10016714 | 3300026121 | Bacteria | 6244 |
| 322 | Ga0207698_10213682 | 3300026142 | Bacteria | 1737 |
| 323 | Ga0207698_10391670 | 3300026142 | Bacteria | 1325 |
| 324 | Ga0209179_1002880 | 3300027512 | Bacteria | 2400 |
| 325 | Ga0207428_10000831 | 3300027907 | Bacteria | 34817 |
| 326 | Ga0207428_10132182 | 3300027907 | Bacteria | 1909 |
| 327 | Ga0207428_10237183 | 3300027907 | Bacteria | 1363 |
| 328 | Ga0207428_10332694 | 3300027907 | Bacteria | 1120 |
| 329 | Ga0207428_10384791 | 3300027907 | Bacteria | 1029 |
| 330 | Ga0268264_10575093 | 3300028381 | Bacteria | 1108 |
| 331 | Ga0307515_10199783 | 3300028794 | Bacteria | 1879 |
| 332 | Ga0265338_10007515 | 3300028800 | Bacteria | 13487 |
| 333 | Ga0265760_10019565 | 3300031090 | Bacteria | 1951 |
| 334 | Ga0265332_10009877 | 3300031238 | Bacteria | 4253 |
| 335 | Ga0265325_10000305 | 3300031241 | Bacteria | 34555 |
| 336 | Ga0265325_10065751 | 3300031241 | Bacteria | 1830 |
| 337 | Ga0265325_10072198 | 3300031241 | Bacteria | 1730 |
| 338 | Ga0265329_10007626 | 3300031242 | Bacteria | 4168 |
| 339 | Ga0265340_10027879 | 3300031247 | Bacteria | 2844 |
| 340 | Ga0265340_10051008 | 3300031247 | Bacteria | 2005 |
| 341 | Ga0265340_10053364 | 3300031247 | Bacteria | 1952 |
| 342 | Ga0265340_10067785 | 3300031247 | Bacteria | 1696 |
| 343 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 344 | Ga0265339_10036835 | 3300031249 | Bacteria | 2735 |
| 345 | Ga0265339_10116781 | 3300031249 | Bacteria | 1375 |
| 346 | Ga0265331_10040198 | 3300031250 | Bacteria | 2276 |
| 347 | Ga0265316_10063083 | 3300031344 | Bacteria | 2875 |
| 348 | Ga0265316_10129880 | 3300031344 | Bacteria | 1898 |
| 349 | Ga0265316_10176046 | 3300031344 | Bacteria | 1594 |
| 350 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 351 | Ga0265313_10062066 | 3300031595 | Bacteria | 1746 |
| 352 | Ga0265314_10186869 | 3300031711 | Bacteria | 1236 |
| 353 | Ga0265342_10024831 | 3300031712 | Bacteria | 3778 |
| 354 | Ga0265342_10185734 | 3300031712 | Bacteria | 1136 |
| 355 | Ga0265342_10198040 | 3300031712 | Bacteria | 1093 |
| 356 | Ga0373938_0052969 | 3300034957 | Bacteria | 931 |
| 357 | Ga0373926_0159624 | 3300035083 | Bacteria | 860 |
| 358 | Ga0373929_0002536 | 3300035085 | Bacteria | 3356 |
| 359 | Ga0373951_0021480 | 3300035091 | Unclassified | 1483 |
| 360 | Ga0373952_0024649 | 3300035092 | Bacteria | 1294 |
| 361 | Ga0373952_0039412 | 3300035092 | Bacteria | 1086 |
| 362 | Ga0373945_0002025 | 3300035116 | Bacteria | 6302 |
| 363 | Ga0373945_0108418 | 3300035116 | Bacteria | 1093 |
| 364 | Ga0373953_0178149 | 3300035117 | Bacteria | 916 |
| 365 | Ga0373954_0000496 | 3300035118 | Bacteria | 14775 |
| 366 | Ga0373954_0022672 | 3300035118 | Bacteria | 2851 |
| 367 | Ga0373954_0428376 | 3300035118 | Bacteria | 655 |
| 368 | Ga0373957_0002404 | 3300035120 | Bacteria | 5333 |
| 369 | Ga0373960_0010722 | 3300035121 | Unclassified | 2245 |
| 370 | Ga0373943_0001174 | 3300035170 | Bacteria | 11694 |
| 371 | Ga0373943_0009357 | 3300035170 | Bacteria | 4392 |
| 372 | Ga0373943_0335117 | 3300035170 | Bacteria | 865 |
| 373 | Ga0373946_0000733 | 3300035171 | Bacteria | 11130 |
| 374 | Ga0373946_0051880 | 3300035171 | Unclassified | 1718 |
| 375 | Ga0373946_0131802 | 3300035171 | Bacteria | 1150 |
| 376 | Ga0373946_0196316 | 3300035171 | Bacteria | 965 |
| 377 | Ga0373955_0062369 | 3300035172 | Bacteria | 2061 |
| 378 | Ga0373961_0011313 | 3300035241 | Bacteria | 2212 |
| 379 | Ga0373962_0031845 | 3300035242 | Bacteria | 1448 |
| 380 | Ga0373962_0033586 | 3300035242 | Bacteria | 1417 |
| 381 | Ga0373924_0000869 | 3300035410 | Bacteria | 9505 |
| 382 | Ga0373931_0004738 | 3300035691 | Bacteria | 6233 |
| 383 | Ga0373931_0015862 | 3300035691 | Bacteria | 3699 |
| 384 | Ga0373931_0087615 | 3300035691 | Bacteria | 1729 |
| 385 | Ga0373931_0155316 | 3300035691 | Bacteria | 1337 |
| 386 | Ga0373935_0001176 | 3300035692 | Bacteria | 14365 |
| 387 | Ga0373935_0048628 | 3300035692 | Bacteria | 2686 |
| 388 | Ga0373935_0451215 | 3300035692 | Bacteria | 929 |
| 389 | Ga0373935_0517867 | 3300035692 | Bacteria | 867 |
| 390 | Ga0373927_0001072 | 3300035695 | Bacteria | 20927 |
| 391 | Ga0373927_0001966 | 3300035695 | Bacteria | 15156 |
| 392 | Ga0373927_0246941 | 3300035695 | Bacteria | 1173 |
| 393 | Ga0373933_0001354 | 3300035724 | Bacteria | 14445 |
| 394 | Ga0373947_0001670 | 3300035725 | Bacteria | 13583 |
| 395 | Ga0373947_0018359 | 3300035725 | Bacteria | 4025 |
| 396 | Ga0373947_0321477 | 3300035725 | Bacteria | 1035 |
| 397 | Ga0373937_0000356 | 3300036401 | Bacteria | 42503 |
| 398 | Ga0373925_0000462 | 3300037068 | Bacteria | 40936 |
| 399 | Ga0373925_0017857 | 3300037068 | Bacteria | 5148 |
| 400 | Ga0373925_0268721 | 3300037068 | Bacteria | 1371 |
| 401 | Ga0373925_0734668 | 3300037068 | Bacteria | 814 |
| 402 | Ga0395898_0079427 | 3300037466 | Bacteria | 3165 |
| 403 | Ga0395905_0324694 | 3300037471 | Bacteria | 1429 |
| 404 | Ga0436364_0576120 | 3300037853 | Bacteria | 27783 |
| 405 | Ga0436364_0650710 | 3300037853 | Unclassified | 614 |
| 406 | Ga0436364_0836051 | 3300037853 | Bacteria | 1042 |
| 407 | Ga0436364_1119204 | 3300037853 | Bacteria | 6980 |
| 408 | Ga0436365_0542567 | 3300039437 | Bacteria | 776 |
| 409 | Ga0436365_1115437 | 3300039437 | Bacteria | 905 |
| 410 | Ga0436365_1298720 | 3300039437 | Bacteria | 3626 |
| 411 | Ga0436360_0115274 | 3300039438 | Bacteria | 1214 |
| 412 | Ga0436361_0476009 | 3300039447 | Bacteria | 18870 |
| 413 | Ga0436363_0033945 | 3300039450 | Unclassified | 858 |
| 414 | Ga0436363_1086374 | 3300039450 | Unclassified | 644 |
| 415 | Ga0436363_1218092 | 3300039450 | Bacteria | 1540 |
| 416 | Ga0436362_0779349 | 3300039453 | Bacteria | 1011 |
| 417 | Ga0436362_1220292 | 3300039453 | Bacteria | 1197 |
| 418 | Ga0436362_1278674 | 3300039453 | Bacteria | 845 |
| 419 | Ga0451797_0849193 | 3300041453 | Bacteria | 850 |
| 420 | Ga0451839_0860984 | 3300041496 | Bacteria | 851 |
| 421 | Ga0451853_2233956 | 3300041512 | Bacteria | 2205 |
| 422 | Ga0439443_009503 | 3300042003 | Bacteria | 1395 |
| 423 | Ga0439460_0102492 | 3300042461 | Bacteria | 921 |
| 424 | Ga0466968_0194990 | 3300044735 | Bacteria | 947 |
| 425 | Ga0495592_0000090 | 3300046454 | Bacteria | 80171 |
| 426 | Ga0495603_0117039 | 3300046455 | Bacteria | 1554 |
| 427 | Ga0495590_0159123 | 3300046457 | Bacteria | 821 |
| 428 | Ga0495591_049312 | 3300046458 | Bacteria | 1158 |
| 429 | Ga0495629_0019883 | 3300046459 | Bacteria | 4792 |
| 430 | Ga0495629_0042536 | 3300046459 | Bacteria | 3192 |
| 431 | Ga0495638_0034007 | 3300046460 | Bacteria | 3256 |
| 432 | Ga0495641_0013506 | 3300046461 | Bacteria | 4481 |
| 433 | Ga0495651_0000682 | 3300046462 | Bacteria | 26412 |
| 434 | Ga0495653_0000322 | 3300046463 | Bacteria | 38965 |
| 435 | Ga0495653_0299130 | 3300046463 | Bacteria | 1050 |
| 436 | Ga0495582_0065403 | 3300046473 | Bacteria | 2009 |
| 437 | Ga0495582_0125793 | 3300046473 | Bacteria | 1446 |
| 438 | Ga0495662_0022104 | 3300046476 | Bacteria | 3074 |
| 439 | Ga0495662_0304774 | 3300046476 | Bacteria | 783 |
| 440 | Ga0495664_0000078 | 3300046477 | Bacteria | 47377 |
| 441 | Ga0495584_0021084 | 3300046491 | Bacteria | 3309 |
| 442 | Ga0495584_0104900 | 3300046491 | Bacteria | 1429 |
| 443 | Ga0495584_0245827 | 3300046491 | Bacteria | 910 |
| 444 | Ga0495585_0214711 | 3300046492 | Bacteria | 973 |
| 445 | Ga0495594_0190880 | 3300046499 | Bacteria | 1167 |
| 446 | Ga0495596_0121100 | 3300046500 | Bacteria | 1016 |
| 447 | Ga0495608_0000022 | 3300046511 | Bacteria | 165111 |
| 448 | Ga0495616_0068741 | 3300046513 | Bacteria | 1719 |
| 449 | Ga0495618_0000229 | 3300046514 | Bacteria | 40948 |
| 450 | Ga0495618_0114975 | 3300046514 | Bacteria | 1723 |
| 451 | Ga0495618_0202453 | 3300046514 | Bacteria | 1256 |
| 452 | Ga0495628_0000035 | 3300046516 | Bacteria | 111560 |
| 453 | Ga0495628_0220125 | 3300046516 | Bacteria | 1426 |
| 454 | Ga0495630_0000377 | 3300046517 | Bacteria | 35153 |
| 455 | Ga0495630_0077980 | 3300046517 | Bacteria | 2498 |
| 456 | Ga0495644_0031325 | 3300046523 | Bacteria | 2009 |
| 457 | Ga0495663_0013480 | 3300046525 | Bacteria | 2286 |
| 458 | Ga0495666_0078784 | 3300046526 | Bacteria | 1560 |
| 459 | Ga0495652_0000062 | 3300046529 | Bacteria | 111572 |
| 460 | Ga0495652_0165067 | 3300046529 | Bacteria | 1715 |
| 461 | Ga0495665_0065518 | 3300046531 | Bacteria | 1918 |
| 462 | Ga0495640_0000021 | 3300046533 | Bacteria | 110511 |
| 463 | Ga0495640_0150748 | 3300046533 | Bacteria | 1494 |
| 464 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 465 | Ga0495598_0000955 | 3300046537 | Bacteria | 5575 |
| 466 | Ga0495598_0028650 | 3300046537 | Bacteria | 1546 |
| 467 | Ga0495621_0056375 | 3300046539 | Bacteria | 1417 |
| 468 | Ga0495645_0000174 | 3300046543 | Bacteria | 44827 |
| 469 | Ga0495667_0000161 | 3300046559 | Bacteria | 45781 |
| 470 | Ga0495667_0168868 | 3300046559 | Bacteria | 1406 |
| 471 | Ga0495656_0066295 | 3300046615 | Bacteria | 1590 |
| 472 | Ga0495634_0000350 | 3300046642 | Bacteria | 44772 |
| 473 | Ga0495634_0107379 | 3300046642 | Bacteria | 1798 |
| 474 | Ga0495634_0364182 | 3300046642 | Bacteria | 864 |
| 475 | Ga0495635_0000018 | 3300046663 | Bacteria | 193591 |
| 476 | Ga0495635_0099459 | 3300046663 | Bacteria | 1988 |
| 477 | Ga0495659_0036047 | 3300046664 | Bacteria | 1746 |
| 478 | Ga0495588_0035374 | 3300046674 | Bacteria | 2531 |
| 479 | Ga0495657_0000245 | 3300046675 | Bacteria | 49381 |
| 480 | Ga0495657_0172814 | 3300046675 | Bacteria | 1330 |
| 481 | Ga0495599_0000032 | 3300046678 | Bacteria | 108178 |
| 482 | Ga0495623_0000004 | 3300046679 | Bacteria | 142249 |
| 483 | Ga0495646_0000083 | 3300046680 | Bacteria | 45193 |
| 484 | Ga0495658_0089708 | 3300046683 | Bacteria | 1818 |
| 485 | Ga0495613_0019217 | 3300046689 | Bacteria | 5094 |
| 486 | Ga0495613_0120552 | 3300046689 | Bacteria | 1884 |
| 487 | Ga0495624_0023352 | 3300046690 | Bacteria | 4079 |
| 488 | Ga0495624_0053886 | 3300046690 | Bacteria | 2538 |
| 489 | Ga0495670_0233051 | 3300046691 | Bacteria | 979 |
| 490 | Ga0495589_0262103 | 3300046794 | Bacteria | 806 |
| 491 | Ga0495600_0000022 | 3300046809 | Bacteria | 94789 |
| 492 | Ga0495581_0009463 | 3300047315 | Bacteria | 5639 |
| 493 | Ga0495581_0106586 | 3300047315 | Bacteria | 1629 |
| 494 | Ga0495604_0000011 | 3300047317 | Bacteria | 292024 |
| 495 | Ga0495604_0185276 | 3300047317 | Bacteria | 1454 |
| 496 | Ga0495674_0000034 | 3300047319 | Bacteria | 110674 |
| 497 | Ga0495674_0126910 | 3300047319 | Bacteria | 2152 |
| 498 | Ga0495672_0180051 | 3300047320 | Bacteria | 1071 |
| 499 | Ga0495676_0066113 | 3300047321 | Bacteria | 2803 |
| 500 | Ga0495680_0000290 | 3300047322 | Bacteria | 56506 |
| 501 | Ga0495680_0058556 | 3300047322 | Bacteria | 2977 |
| 502 | Ga0495680_0130101 | 3300047322 | Bacteria | 1851 |
| 503 | Ga0495675_0000352 | 3300047444 | Bacteria | 32304 |
| 504 | Ga0495673_0130301 | 3300047469 | Bacteria | 989 |
| 505 | Ga0495684_0000012 | 3300047471 | Bacteria | 187118 |
| 506 | Ga0495593_0049677 | 3300047673 | Bacteria | 2225 |
| 507 | Ga0495602_0000064 | 3300048088 | Bacteria | 104858 |
| 508 | Ga0495602_0292304 | 3300048088 | Bacteria | 1196 |
| 509 | Ga0495626_0187001 | 3300048091 | Bacteria | 856 |
| 510 | Ga0496100_0009210 | 3300048903 | Bacteria | 5541 |
| 511 | Ga0496100_0011779 | 3300048903 | Bacteria | 4990 |
| 512 | Ga0496100_0448805 | 3300048903 | Bacteria | 988 |
| 513 | Ga0496100_0467424 | 3300048903 | Bacteria | 969 |
| 514 | Ga0496101_0039158 | 3300048904 | Bacteria | 3369 |
| 515 | Ga0496101_0040262 | 3300048904 | Bacteria | 3328 |
| 516 | Ga0496101_0401613 | 3300048904 | Bacteria | 1079 |
| 517 | Ga0496102_0199888 | 3300048905 | Bacteria | 1884 |
| 518 | Ga0496102_0258248 | 3300048905 | Bacteria | 1643 |
| 519 | Ga0496103_0122152 | 3300048906 | Bacteria | 1659 |
| 520 | Ga0496103_0143742 | 3300048906 | Bacteria | 1526 |
| 521 | Ga0496104_0002163 | 3300048907 | Bacteria | 17059 |
| 522 | Ga0496104_0002570 | 3300048907 | Bacteria | 15649 |
| 523 | Ga0496104_0013104 | 3300048907 | Bacteria | 7471 |
| 524 | Ga0496104_0024333 | 3300048907 | Bacteria | 5570 |
| 525 | Ga0496104_0061109 | 3300048907 | Bacteria | 3571 |
| 526 | Ga0496104_0101322 | 3300048907 | Bacteria | 2757 |
| 527 | Ga0496105_0000754 | 3300048908 | Bacteria | 21960 |
| 528 | Ga0496105_0007674 | 3300048908 | Bacteria | 8365 |
| 529 | Ga0496105_0023000 | 3300048908 | Bacteria | 5053 |
| 530 | Ga0496105_0298549 | 3300048908 | Bacteria | 1295 |
| 531 | Ga0496105_0581813 | 3300048908 | Bacteria | 871 |
| 532 | Ga0496106_0004480 | 3300048909 | Bacteria | 10359 |
| 533 | Ga0496106_0059449 | 3300048909 | Bacteria | 2895 |
| 534 | Ga0496106_0072715 | 3300048909 | Bacteria | 2630 |
| 535 | Ga0496106_0203212 | 3300048909 | Bacteria | 1577 |
| 536 | Ga0496106_0220224 | 3300048909 | Unclassified | 1514 |
| 537 | Ga0496106_0427406 | 3300048909 | Bacteria | 1064 |
| 538 | Ga0496107_0003453 | 3300048910 | Bacteria | 10559 |
| 539 | Ga0496107_0133240 | 3300048910 | Bacteria | 1835 |
| 540 | Ga0496107_0254466 | 3300048910 | Bacteria | 1307 |
| 541 | Ga0496107_0555209 | 3300048910 | Bacteria | 850 |
| 542 | Ga0496108_0002431 | 3300048911 | Bacteria | 14887 |
| 543 | Ga0496108_0008557 | 3300048911 | Bacteria | 8298 |
| 544 | Ga0496108_0014148 | 3300048911 | Bacteria | 6510 |
| 545 | Ga0496108_0043119 | 3300048911 | Bacteria | 3768 |
| 546 | Ga0496108_0069671 | 3300048911 | Bacteria | 2968 |
| 547 | Ga0496108_0084505 | 3300048911 | Bacteria | 2693 |
| 548 | Ga0496108_0249800 | 3300048911 | Bacteria | 1543 |
| 549 | Ga0496108_0263465 | 3300048911 | Bacteria | 1500 |
| 550 | Ga0496109_0001755 | 3300048912 | Bacteria | 18034 |
| 551 | Ga0496109_0003909 | 3300048912 | Bacteria | 12447 |
| 552 | Ga0496109_0006920 | 3300048912 | Bacteria | 9568 |
| 553 | Ga0496109_0267654 | 3300048912 | Bacteria | 1610 |
| 554 | Ga0496109_0455999 | 3300048912 | Bacteria | 1207 |
| 555 | Ga0496110_0004771 | 3300048913 | Bacteria | 10562 |
| 556 | Ga0496110_0008732 | 3300048913 | Bacteria | 8160 |
| 557 | Ga0496110_0020230 | 3300048913 | Bacteria | 5617 |
| 558 | Ga0496110_0033299 | 3300048913 | Bacteria | 4456 |
| 559 | Ga0496110_0066301 | 3300048913 | Bacteria | 3193 |
| 560 | Ga0496110_0222011 | 3300048913 | Bacteria | 1718 |
| 561 | Ga0496110_0760257 | 3300048913 | Bacteria | 872 |
| 562 | Ga0496111_0005128 | 3300048914 | Bacteria | 8346 |
| 563 | Ga0496111_0014585 | 3300048914 | Bacteria | 5373 |
| 564 | Ga0496111_0218939 | 3300048914 | Bacteria | 1414 |
| 565 | Ga0496112_0010960 | 3300048915 | Bacteria | 8255 |
| 566 | Ga0496112_0083030 | 3300048915 | Bacteria | 3168 |
| 567 | Ga0496112_0702092 | 3300048915 | Bacteria | 939 |
| 568 | Ga0496113_0006080 | 3300048916 | Bacteria | 7609 |
| 569 | Ga0496113_0009343 | 3300048916 | Bacteria | 6429 |
| 570 | Ga0496113_0053663 | 3300048916 | Bacteria | 3014 |
| 571 | Ga0496113_0153826 | 3300048916 | Bacteria | 1815 |
| 572 | Ga0496113_0168384 | 3300048916 | Bacteria | 1734 |
| 573 | Ga0496114_0010617 | 3300048917 | Bacteria | 7326 |
| 574 | Ga0496114_0071160 | 3300048917 | Bacteria | 2922 |
| 575 | Ga0496114_0124524 | 3300048917 | Unclassified | 2220 |
| 576 | Ga0496114_0287259 | 3300048917 | Bacteria | 1451 |
| 577 | Ga0496114_0440542 | 3300048917 | Bacteria | 1154 |
| 578 | Ga0496114_0856538 | 3300048917 | Bacteria | 789 |
| 579 | Ga0496115_0007503 | 3300048918 | Bacteria | 8029 |
| 580 | Ga0496115_0054889 | 3300048918 | Bacteria | 3199 |
| 581 | Ga0496115_0056335 | 3300048918 | Bacteria | 3159 |
| 582 | Ga0496115_0437813 | 3300048918 | Bacteria | 1057 |
| 583 | Ga0501031_0030376 | 3300049568 | Bacteria | 3524 |
| 584 | Ga0501032_0008464 | 3300049569 | Bacteria | 7499 |
| 585 | Ga0501032_0014720 | 3300049569 | Bacteria | 5535 |
| 586 | Ga0501032_0165386 | 3300049569 | Bacteria | 1451 |
| 587 | Ga0501032_0211099 | 3300049569 | Bacteria | 1265 |
| 588 | Ga0501033_0014185 | 3300049570 | Bacteria | 6057 |
| 589 | Ga0501033_0074493 | 3300049570 | Bacteria | 2492 |
| 590 | Ga0501033_0218418 | 3300049570 | Bacteria | 1357 |
| 591 | Ga0501034_0000979 | 3300049571 | Bacteria | 41076 |
| 592 | Ga0501034_0088424 | 3300049571 | Bacteria | 3096 |
| 593 | Ga0501034_0138450 | 3300049571 | Bacteria | 2414 |
| 594 | Ga0501034_0181312 | 3300049571 | Bacteria | 2071 |
| 595 | Ga0501034_0311500 | 3300049571 | Bacteria | 1508 |
| 596 | Ga0501034_0442377 | 3300049571 | Bacteria | 1218 |
| 597 | Ga0501036_0000602 | 3300049572 | Bacteria | 26088 |
| 598 | Ga0501036_0022070 | 3300049572 | Bacteria | 5354 |
| 599 | Ga0501036_0127546 | 3300049572 | Bacteria | 2148 |
| 600 | Ga0501036_0263856 | 3300049572 | Bacteria | 1442 |
| 601 | Ga0501036_0433618 | 3300049572 | Unclassified | 1095 |
| 602 | Ga0501036_0493998 | 3300049572 | Bacteria | 1018 |
| 603 | Ga0501036_0664760 | 3300049572 | Bacteria | 862 |
| 604 | Ga0501037_0008058 | 3300049573 | Bacteria | 7719 |
| 605 | Ga0501037_0011444 | 3300049573 | Bacteria | 6530 |
| 606 | Ga0501037_0021830 | 3300049573 | Bacteria | 4738 |
| 607 | Ga0501037_0041725 | 3300049573 | Bacteria | 3373 |
| 608 | Ga0501037_0046672 | 3300049573 | Bacteria | 3176 |
| 609 | Ga0501037_0162717 | 3300049573 | Bacteria | 1590 |
| 610 | Ga0501038_0123832 | 3300049574 | Bacteria | 2129 |
| 611 | Ga0501038_0174553 | 3300049574 | Bacteria | 1737 |
| 612 | Ga0501038_0348580 | 3300049574 | Bacteria | 1153 |
| 613 | Ga0501039_0042925 | 3300049575 | Bacteria | 3493 |
| 614 | Ga0501039_0152064 | 3300049575 | Bacteria | 1818 |
| 615 | Ga0501039_0162449 | 3300049575 | Bacteria | 1756 |
| 616 | Ga0501040_0094732 | 3300049576 | Bacteria | 2078 |
| 617 | Ga0501042_0418793 | 3300049578 | Bacteria | 971 |
| 618 | Ga0501043_0009053 | 3300049579 | Bacteria | 7834 |
| 619 | Ga0501043_0014570 | 3300049579 | Bacteria | 6156 |
| 620 | Ga0501043_0114278 | 3300049579 | Bacteria | 2119 |
| 621 | Ga0501043_0140356 | 3300049579 | Bacteria | 1892 |
| 622 | Ga0501046_0016349 | 3300049580 | Bacteria | 6217 |
| 623 | Ga0501046_0025489 | 3300049580 | Bacteria | 4839 |
| 624 | Ga0501046_0142669 | 3300049580 | Bacteria | 1811 |
| 625 | Ga0501047_0000104 | 3300049581 | Bacteria | 102971 |
| 626 | Ga0501047_0023793 | 3300049581 | Bacteria | 5881 |
| 627 | Ga0501047_0026153 | 3300049581 | Bacteria | 5614 |
| 628 | Ga0501047_0131581 | 3300049581 | Bacteria | 2382 |
| 629 | Ga0501047_0200293 | 3300049581 | Bacteria | 1858 |
| 630 | Ga0501047_0294041 | 3300049581 | Bacteria | 1467 |
| 631 | Ga0501048_0000272 | 3300049582 | Bacteria | 34674 |
| 632 | Ga0501048_0337222 | 3300049582 | Bacteria | 1075 |
| 633 | Ga0501048_0445649 | 3300049582 | Bacteria | 927 |
| 634 | Ga0501048_0509037 | 3300049582 | Bacteria | 863 |
| 635 | Ga0501067_0351798 | 3300049583 | Bacteria | 821 |
| 636 | Ga0501068_0010259 | 3300049584 | Bacteria | 5258 |
| 637 | Ga0501068_0189666 | 3300049584 | Bacteria | 1301 |
| 638 | Ga0501068_0189667 | 3300049584 | Bacteria | 1301 |
| 639 | Ga0501069_0028225 | 3300049585 | Bacteria | 3076 |
| 640 | Ga0501069_0073108 | 3300049585 | Bacteria | 1922 |
| 641 | Ga0501069_0255491 | 3300049585 | Bacteria | 1023 |
| 642 | Ga0501070_0010785 | 3300049586 | Bacteria | 7719 |
| 643 | Ga0501070_0176167 | 3300049586 | Bacteria | 1760 |
| 644 | Ga0501070_0327001 | 3300049586 | Bacteria | 1246 |
| 645 | Ga0501071_0156163 | 3300049587 | Bacteria | 1703 |
| 646 | Ga0501071_0390721 | 3300049587 | Bacteria | 1061 |
| 647 | Ga0501072_0000464 | 3300049588 | Bacteria | 29314 |
| 648 | Ga0501072_0470749 | 3300049588 | Bacteria | 995 |
| 649 | Ga0501073_0010741 | 3300049589 | Bacteria | 6705 |
| 650 | Ga0501073_0134637 | 3300049589 | Bacteria | 1712 |
| 651 | Ga0501074_0008255 | 3300049590 | Bacteria | 7549 |
| 652 | Ga0501074_0060609 | 3300049590 | Bacteria | 2726 |
| 653 | Ga0501074_0253083 | 3300049590 | Bacteria | 1252 |
| 654 | Ga0501075_0209044 | 3300049591 | Bacteria | 1489 |
| 655 | Ga0501075_0300528 | 3300049591 | Bacteria | 1223 |
| 656 | Ga0501077_0101926 | 3300049593 | Unclassified | 1819 |
| 657 | Ga0501077_0190507 | 3300049593 | Bacteria | 1303 |
| 658 | Ga0501079_0053376 | 3300049741 | Bacteria | 3118 |
| 659 | Ga0501079_0054215 | 3300049741 | Bacteria | 3092 |
| 660 | Ga0501080_0003091 | 3300049742 | Bacteria | 14701 |
| 661 | Ga0501080_0113970 | 3300049742 | Bacteria | 2506 |
| 662 | Ga0501080_0127248 | 3300049742 | Bacteria | 2359 |
| 663 | Ga0501080_0136624 | 3300049742 | Bacteria | 2268 |
| 664 | Ga0501080_0424907 | 3300049742 | Bacteria | 1193 |
| 665 | Ga0501080_0475296 | 3300049742 | Bacteria | 1119 |
| 666 | Ga0501080_0695372 | 3300049742 | Bacteria | 897 |
| 667 | Ga0501081_0067775 | 3300049743 | Bacteria | 2484 |
| 668 | Ga0501081_0131332 | 3300049743 | Bacteria | 1789 |
| 669 | Ga0501083_0000790 | 3300049744 | Bacteria | 20771 |
| 670 | Ga0501083_0100005 | 3300049744 | Bacteria | 1913 |
| 671 | Ga0501083_0125833 | 3300049744 | Bacteria | 1680 |
| 672 | Ga0501083_0177222 | 3300049744 | Bacteria | 1392 |
| 673 | Ga0501035_0071563 | 3300049822 | Bacteria | 3070 |
| 674 | Ga0501035_0186822 | 3300049822 | Bacteria | 1783 |
| 675 | Ga0501035_0192974 | 3300049822 | Bacteria | 1750 |
| 676 | Ga0501035_0448516 | 3300049822 | Bacteria | 1067 |
| 677 | Ga0501044_0027461 | 3300049823 | Bacteria | 6015 |
| 678 | Ga0501044_0097117 | 3300049823 | Bacteria | 2967 |
| 679 | Ga0501044_0099131 | 3300049823 | Bacteria | 2932 |
| 680 | Ga0501044_0134419 | 3300049823 | Bacteria | 2465 |
| 681 | Ga0501044_0136833 | 3300049823 | Bacteria | 2440 |
| 682 | Ga0501044_0264771 | 3300049823 | Bacteria | 1656 |
| 683 | Ga0501044_0783064 | 3300049823 | Bacteria | 834 |
| 684 | nmdc:mga03683_123325_c1 | 3300050489 | Bacteria | 1154 |
| 685 | nmdc:mga03683_136925_c1 | 3300050489 | Bacteria | 1099 |
| 686 | nmdc:mga03683_31263_c1 | 3300050489 | Bacteria | 2134 |
| 687 | nmdc:mga03683_34198_c1 | 3300050489 | Bacteria | 2055 |
| 688 | nmdc:mga00v17_458157_c1 | 3300050491 | Bacteria | 828 |
| 689 | nmdc:mga00v17_94127_c1 | 3300050491 | Bacteria | 1885 |
| 690 | nmdc:mga0yw44_101091_c1 | 3300050492 | Bacteria | 1837 |
| 691 | nmdc:mga0yw44_222635_c1 | 3300050492 | Bacteria | 1251 |
| 692 | nmdc:mga0yw44_8157_c1 | 3300050492 | Bacteria | 5203 |
| 693 | nmdc:mga0k408_253592_c1 | 3300050493 | Bacteria | 1050 |
| 694 | nmdc:mga0k408_29387_c1 | 3300050493 | Bacteria | 3128 |
| 695 | nmdc:mga0k408_87025_c1 | 3300050493 | Bacteria | 1835 |
| 696 | nmdc:mga06z11_144593_c1 | 3300050494 | Bacteria | 1347 |
| 697 | nmdc:mga07m45_301207_c1 | 3300050496 | Bacteria | 932 |
| 698 | nmdc:mga05p37_119443_c1 | 3300050507 | Bacteria | 3239 |
| 699 | nmdc:mga05p37_215_c1 | 3300050507 | Bacteria | 57982 |
| 700 | nmdc:mga05p37_290900_c1 | 3300050507 | Bacteria | 1945 |
| 701 | nmdc:mga05p37_36829_c1 | 3300050507 | Bacteria | 6001 |
| 702 | nmdc:mga05p37_391773_c1 | 3300050507 | Bacteria | 1624 |
| 703 | nmdc:mga05p37_806399_c1 | 3300050507 | Bacteria | 1026 |
| 704 | nmdc:mga09592_120760_c1 | 3300050508 | Bacteria | 2251 |
| 705 | nmdc:mga09592_1263_c1 | 3300050508 | Bacteria | 20295 |
| 706 | nmdc:mga09592_176532_c1 | 3300050508 | Bacteria | 1847 |
| 707 | nmdc:mga09592_24176_c1 | 3300050508 | Bacteria | 5023 |
| 708 | nmdc:mga09592_391256_c1 | 3300050508 | Bacteria | 1202 |
| 709 | nmdc:mga0qj67_105410_c1 | 3300050509 | Bacteria | 2274 |
| 710 | nmdc:mga0qj67_20772_c1 | 3300050509 | Bacteria | 5028 |
| 711 | nmdc:mga0qj67_60_c1 | 3300050509 | Bacteria | 80228 |
| 712 | nmdc:mga06r32_1551_c1 | 3300050510 | Bacteria | 20713 |
| 713 | nmdc:mga06r32_356397_c1 | 3300050510 | Bacteria | 1447 |
| 714 | nmdc:mga06r32_435952_c1 | 3300050510 | Bacteria | 1291 |
| 715 | nmdc:mga06r32_458043_c1 | 3300050510 | Bacteria | 1255 |
| 716 | nmdc:mga06r32_50889_c1 | 3300050510 | Bacteria | 3963 |
| 717 | nmdc:mga08y16_176_c1 | 3300050511 | Bacteria | 56313 |
| 718 | nmdc:mga08y16_182463_c1 | 3300050511 | Bacteria | 2179 |
| 719 | nmdc:mga08y16_184567_c1 | 3300050511 | Bacteria | 2165 |
| 720 | nmdc:mga08y16_286252_c1 | 3300050511 | Bacteria | 1699 |
| 721 | nmdc:mga08y16_80682_c1 | 3300050511 | Bacteria | 3392 |
| 722 | nmdc:mga0n895_135437_c1 | 3300050512 | Bacteria | 2490 |
| 723 | nmdc:mga0n895_154043_c1 | 3300050512 | Bacteria | 2329 |
| 724 | nmdc:mga0n895_242086_c1 | 3300050512 | Bacteria | 1831 |
| 725 | nmdc:mga0n895_3017_c1 | 3300050512 | Bacteria | 13379 |
| 726 | nmdc:mga0rr50_75345_c1 | 3300050513 | Bacteria | 2586 |
| 727 | nmdc:mga0rr50_801525_c1 | 3300050513 | Bacteria | 804 |
| 728 | nmdc:mga08x19_442937_c1 | 3300050514 | Bacteria | 914 |
| 729 | nmdc:mga08x19_56376_c1 | 3300050514 | Bacteria | 2536 |
| 730 | nmdc:mga08x19_88207_c1 | 3300050514 | Bacteria | 2044 |
| 731 | nmdc:mga0a205_160467_c1 | 3300050515 | Bacteria | 2145 |
| 732 | nmdc:mga0a205_192658_c1 | 3300050515 | Bacteria | 1930 |
| 733 | nmdc:mga0a205_487532_c1 | 3300050515 | Bacteria | 1090 |
| 734 | nmdc:mga0sz30_17764_c1 | 3300050516 | Bacteria | 2840 |
| 735 | Ga0495601_0000015 | 3300053077 | Bacteria | 213851 |
| 736 | Ga0495601_0080642 | 3300053077 | Bacteria | 2088 |
| 737 | Ga0495601_0147092 | 3300053077 | Bacteria | 1538 |
| 738 | Ga0495601_0277680 | 3300053077 | Bacteria | 1092 |
| 739 | Ga0495612_0000096 | 3300053078 | Bacteria | 38017 |
| 740 | Ga0495612_0031628 | 3300053078 | Bacteria | 2134 |
| 741 | Ga0495612_0067179 | 3300053078 | Bacteria | 1491 |
| 742 | Ga0495595_0000035 | 3300053084 | Bacteria | 79822 |
| 743 | Ga0495619_0000044 | 3300053085 | Bacteria | 108581 |
| 744 | Ga0495619_0070397 | 3300053085 | Bacteria | 2339 |
| 745 | Ga0495619_0111295 | 3300053085 | Bacteria | 1871 |
| 746 | Ga0495619_0202743 | 3300053085 | Bacteria | 1373 |
| 747 | Ga0500641_0008847 | 3300053096 | Bacteria | 3606 |
| 748 | Ga0500642_0011422 | 3300053130 | Bacteria | 3176 |
| 749 | Ga0500642_0157575 | 3300053130 | Bacteria | 1065 |
| 750 | Ga0500652_150017 | 3300053131 | Bacteria | 967 |
| 751 | Ga0500616_0054906 | 3300053153 | Bacteria | 2085 |
| 752 | Ga0500639_064076 | 3300053163 | Bacteria | 1889 |
| 753 | Ga0501084_0062669 | 3300054114 | Bacteria | 3113 |
| 754 | Ga0501084_0118190 | 3300054114 | Bacteria | 2229 |
| 755 | Ga0501084_0801470 | 3300054114 | Bacteria | 793 |
| 756 | Ga0501082_0001642 | 3300060353 | Bacteria | 19713 |
| 757 | Ga0501082_0182800 | 3300060353 | Bacteria | 1824 |
| 758 | Ga0501082_0569935 | 3300060353 | Bacteria | 990 |
| 759 | Ga0501082_0628744 | 3300060353 | Bacteria | 939 |
| 760 | Ga0530510_0064882 | 3300061734 | Bacteria | 2645 |
| 761 | Ga0530510_0246686 | 3300061734 | Bacteria | 1330 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0650710 | Ga0436364_0650710_13_582 | 183 |
| 2 | 3300039450 | Ga0436363_1086374 | Ga0436363_1086374_44_613 | 183 |
| 3 | 3300046514 | Ga0495618_0202453 | Ga0495618_0202453_658_1227 | 183 |
| 4 | 3300039437 | Ga0436365_0542567 | Ga0436365_0542567_37_612 | 190 |
| 5 | 3300037068 | Ga0373925_0734668 | Ga0373925_0734668_20_637 | 205 |
| 6 | 3300005981 | Ga0081538_10069016 | Ga0081538_100690162 | 206 |
| 7 | 3300006048 | Ga0075363_100072469 | Ga0075363_1000724693 | 206 |
| 8 | 3300006186 | Ga0075369_10028769 | Ga0075369_100287693 | 206 |
| 9 | 3300017792 | Ga0163161_10137134 | Ga0163161_101371342 | 207 |
| 10 | 3300025906 | Ga0207699_10171291 | Ga0207699_101712911 | 208 |
| 11 | 3300035118 | Ga0373954_0428376 | Ga0373954_0428376_11_640 | 209 |
| 12 | 3300005983 | Ga0081540_1000128 | Ga0081540_100012852 | 210 |
| 13 | 3300003215 | JGI25153J46596_10009294 | JGI25153J46596_100092941 | 213 |
| 14 | 3300006177 | Ga0075362_10117100 | Ga0075362_101171002 | 213 |
| 15 | 3300006195 | Ga0075366_10032042 | Ga0075366_100320422 | 213 |
| 16 | 3300025297 | Ga0209758_1000772 | Ga0209758_100077234 | 213 |
| 17 | 3300025924 | Ga0207694_10859542 | Ga0207694_108595421 | 213 |
| 18 | 3300046455 | Ga0495603_0117039 | Ga0495603_0117039_47_727 | 213 |
| 19 | 3300050493 | nmdc:mga0k408_29387_c1 | nmdc:mga0k408_29387_c1_1312_1995 | 213 |
| 20 | 3300050493 | nmdc:mga0k408_87025_c1 | nmdc:mga0k408_87025_c1_746_1459 | 213 |
| 21 | 3300053130 | Ga0500642_0011422 | Ga0500642_0011422_2188_2871 | 213 |
| 22 | 3300053131 | Ga0500652_150017 | Ga0500652_150017_219_920 | 213 |
| 23 | 3300053153 | Ga0500616_0054906 | Ga0500616_0054906_421_1104 | 213 |
| 24 | 3300060353 | Ga0501082_0628744 | Ga0501082_0628744_95_805 | 213 |
| 25 | 3300049742 | Ga0501080_0475296 | Ga0501080_0475296_133_780 | 214 |
| 26 | 3300005546 | Ga0070696_100455035 | Ga0070696_1004550352 | 215 |
| 27 | 3300061734 | Ga0530510_0064882 | Ga0530510_0064882_755_1441 | 215 |
| 28 | 3300006846 | Ga0075430_100017047 | Ga0075430_1000170472 | 216 |
| 29 | 3300006847 | Ga0075431_100124713 | Ga0075431_1001247133 | 216 |
| 30 | 3300006880 | Ga0075429_100045647 | Ga0075429_1000456473 | 216 |
| 31 | 3300031344 | Ga0265316_10063083 | Ga0265316_100630832 | 216 |
| 32 | 3300046516 | Ga0495628_0220125 | Ga0495628_0220125_493_1149 | 216 |
| 33 | 3300046615 | Ga0495656_0066295 | Ga0495656_0066295_672_1358 | 216 |
| 34 | 3300046664 | Ga0495659_0036047 | Ga0495659_0036047_203_889 | 216 |
| 35 | 3300050508 | nmdc:mga09592_120760_c1 | nmdc:mga09592_120760_c1_1468_2196 | 216 |
| 36 | 3300050509 | nmdc:mga0qj67_20772_c1 | nmdc:mga0qj67_20772_c1_3209_3895 | 216 |
| 37 | 3300050510 | nmdc:mga06r32_50889_c1 | nmdc:mga06r32_50889_c1_2111_2797 | 216 |
| 38 | 3300005937 | Ga0081455_10021170 | Ga0081455_100211705 | 218 |
| 39 | 3300048911 | Ga0496108_0249800 | Ga0496108_0249800_16_714 | 219 |
| 40 | 3300048905 | Ga0496102_0199888 | Ga0496102_0199888_921_1619 | 221 |
| 41 | 3300048907 | Ga0496104_0002570 | Ga0496104_0002570_7225_7923 | 221 |
| 42 | 3300048915 | Ga0496112_0702092 | Ga0496112_0702092_195_893 | 221 |
| 43 | 3300048918 | Ga0496115_0007503 | Ga0496115_0007503_1452_2150 | 221 |
| 44 | 3300028800 | Ga0265338_10007515 | Ga0265338_100075154 | 222 |
| 45 | 3300031249 | Ga0265339_10000016 | Ga0265339_10000016101 | 222 |
| 46 | 3300031595 | Ga0265313_10000060 | Ga0265313_1000006038 | 222 |
| 47 | 3300031712 | Ga0265342_10198040 | Ga0265342_101980402 | 222 |
| 48 | 3300049568 | Ga0501031_0030376 | Ga0501031_0030376_24_695 | 222 |
| 49 | 3300049569 | Ga0501032_0008464 | Ga0501032_0008464_5732_6403 | 222 |
| 50 | 3300049569 | Ga0501032_0014720 | Ga0501032_0014720_3032_3703 | 222 |
| 51 | 3300049569 | Ga0501032_0165386 | Ga0501032_0165386_543_1214 | 222 |
| 52 | 3300049569 | Ga0501032_0211099 | Ga0501032_0211099_459_1130 | 222 |
| 53 | 3300049570 | Ga0501033_0014185 | Ga0501033_0014185_63_734 | 222 |
| 54 | 3300049570 | Ga0501033_0218418 | Ga0501033_0218418_556_1227 | 222 |
| 55 | 3300049571 | Ga0501034_0000979 | Ga0501034_0000979_33218_33889 | 222 |
| 56 | 3300049571 | Ga0501034_0138450 | Ga0501034_0138450_234_905 | 222 |
| 57 | 3300049571 | Ga0501034_0311500 | Ga0501034_0311500_163_834 | 222 |
| 58 | 3300049571 | Ga0501034_0442377 | Ga0501034_0442377_397_1068 | 222 |
| 59 | 3300049572 | Ga0501036_0000602 | Ga0501036_0000602_7731_8402 | 222 |
| 60 | 3300049572 | Ga0501036_0022070 | Ga0501036_0022070_4309_4980 | 222 |
| 61 | 3300049572 | Ga0501036_0127546 | Ga0501036_0127546_852_1523 | 222 |
| 62 | 3300049572 | Ga0501036_0263856 | Ga0501036_0263856_238_909 | 222 |
| 63 | 3300049572 | Ga0501036_0433618 | Ga0501036_0433618_189_860 | 222 |
| 64 | 3300049572 | Ga0501036_0493998 | Ga0501036_0493998_212_883 | 222 |
| 65 | 3300049573 | Ga0501037_0008058 | Ga0501037_0008058_4653_5324 | 222 |
| 66 | 3300049573 | Ga0501037_0011444 | Ga0501037_0011444_2221_2892 | 222 |
| 67 | 3300049573 | Ga0501037_0041725 | Ga0501037_0041725_151_822 | 222 |
| 68 | 3300049573 | Ga0501037_0046672 | Ga0501037_0046672_1890_2561 | 222 |
| 69 | 3300049573 | Ga0501037_0162717 | Ga0501037_0162717_782_1453 | 222 |
| 70 | 3300049574 | Ga0501038_0174553 | Ga0501038_0174553_759_1430 | 222 |
| 71 | 3300049574 | Ga0501038_0348580 | Ga0501038_0348580_344_1015 | 222 |
| 72 | 3300049575 | Ga0501039_0042925 | Ga0501039_0042925_149_820 | 222 |
| 73 | 3300049575 | Ga0501039_0152064 | Ga0501039_0152064_454_1125 | 222 |
| 74 | 3300049575 | Ga0501039_0162449 | Ga0501039_0162449_831_1502 | 222 |
| 75 | 3300049579 | Ga0501043_0009053 | Ga0501043_0009053_4626_5297 | 222 |
| 76 | 3300049579 | Ga0501043_0014570 | Ga0501043_0014570_4152_4823 | 222 |
| 77 | 3300049579 | Ga0501043_0114278 | Ga0501043_0114278_1386_2057 | 222 |
| 78 | 3300049580 | Ga0501046_0016349 | Ga0501046_0016349_3323_3994 | 222 |
| 79 | 3300049580 | Ga0501046_0025489 | Ga0501046_0025489_4153_4824 | 222 |
| 80 | 3300049580 | Ga0501046_0142669 | Ga0501046_0142669_651_1322 | 222 |
| 81 | 3300049581 | Ga0501047_0000104 | Ga0501047_0000104_58695_59366 | 222 |
| 82 | 3300049581 | Ga0501047_0026153 | Ga0501047_0026153_4171_4842 | 222 |
| 83 | 3300049581 | Ga0501047_0294041 | Ga0501047_0294041_680_1351 | 222 |
| 84 | 3300049582 | Ga0501048_0000272 | Ga0501048_0000272_26740_27411 | 222 |
| 85 | 3300049582 | Ga0501048_0445649 | Ga0501048_0445649_179_850 | 222 |
| 86 | 3300049582 | Ga0501048_0509037 | Ga0501048_0509037_110_781 | 222 |
| 87 | 3300049584 | Ga0501068_0010259 | Ga0501068_0010259_3974_4645 | 222 |
| 88 | 3300049584 | Ga0501068_0189666 | Ga0501068_0189666_446_1117 | 222 |
| 89 | 3300049584 | Ga0501068_0189667 | Ga0501068_0189667_508_1179 | 222 |
| 90 | 3300049585 | Ga0501069_0028225 | Ga0501069_0028225_2322_2993 | 222 |
| 91 | 3300049585 | Ga0501069_0073108 | Ga0501069_0073108_414_1085 | 222 |
| 92 | 3300049586 | Ga0501070_0010785 | Ga0501070_0010785_1962_2633 | 222 |
| 93 | 3300049586 | Ga0501070_0176167 | Ga0501070_0176167_413_1084 | 222 |
| 94 | 3300049587 | Ga0501071_0156163 | Ga0501071_0156163_537_1208 | 222 |
| 95 | 3300049587 | Ga0501071_0390721 | Ga0501071_0390721_260_931 | 222 |
| 96 | 3300049589 | Ga0501073_0010741 | Ga0501073_0010741_5024_5695 | 222 |
| 97 | 3300049589 | Ga0501073_0134637 | Ga0501073_0134637_152_823 | 222 |
| 98 | 3300049590 | Ga0501074_0008255 | Ga0501074_0008255_2262_2933 | 222 |
| 99 | 3300049590 | Ga0501074_0060609 | Ga0501074_0060609_1223_1894 | 222 |
| 100 | 3300049590 | Ga0501074_0253083 | Ga0501074_0253083_49_720 | 222 |
| 101 | 3300049742 | Ga0501080_0003091 | Ga0501080_0003091_6843_7514 | 222 |
| 102 | 3300049742 | Ga0501080_0136624 | Ga0501080_0136624_1422_2093 | 222 |
| 103 | 3300049743 | Ga0501081_0131332 | Ga0501081_0131332_782_1453 | 222 |
| 104 | 3300049744 | Ga0501083_0000790 | Ga0501083_0000790_17552_18223 | 222 |
| 105 | 3300049744 | Ga0501083_0177222 | Ga0501083_0177222_679_1350 | 222 |
| 106 | 3300049822 | Ga0501035_0192974 | Ga0501035_0192974_1011_1682 | 222 |
| 107 | 3300049822 | Ga0501035_0448516 | Ga0501035_0448516_73_744 | 222 |
| 108 | 3300049823 | Ga0501044_0027461 | Ga0501044_0027461_3686_4357 | 222 |
| 109 | 3300049823 | Ga0501044_0097117 | Ga0501044_0097117_1168_1839 | 222 |
| 110 | 3300049823 | Ga0501044_0134419 | Ga0501044_0134419_671_1342 | 222 |
| 111 | 3300049823 | Ga0501044_0136833 | Ga0501044_0136833_459_1130 | 222 |
| 112 | 3300049823 | Ga0501044_0264771 | Ga0501044_0264771_509_1180 | 222 |
| 113 | 3300060353 | Ga0501082_0569935 | Ga0501082_0569935_33_704 | 222 |
| 114 | iso_pu_bacteria | 2643221547 | 2643754948 | 222 |
| 115 | 3300005985 | Ga0081539_10037424 | Ga0081539_100374243 | 223 |
| 116 | 3300006844 | Ga0075428_100146579 | Ga0075428_1001465792 | 223 |
| 117 | 3300006846 | Ga0075430_100104856 | Ga0075430_1001048563 | 223 |
| 118 | 3300006880 | Ga0075429_100250062 | Ga0075429_1002500622 | 223 |
| 119 | 3300031090 | Ga0265760_10019565 | Ga0265760_100195651 | 223 |
| 120 | 3300035691 | Ga0373931_0087615 | Ga0373931_0087615_746_1423 | 223 |
| 121 | 3300035692 | Ga0373935_0048628 | Ga0373935_0048628_731_1408 | 223 |
| 122 | 3300037853 | Ga0436364_1119204 | Ga0436364_1119204_3950_4645 | 223 |
| 123 | 3300050489 | nmdc:mga03683_34198_c1 | nmdc:mga03683_34198_c1_14_700 | 223 |
| 124 | 3300050508 | nmdc:mga09592_176532_c1 | nmdc:mga09592_176532_c1_182_868 | 223 |
| 125 | 3300050508 | nmdc:mga09592_24176_c1 | nmdc:mga09592_24176_c1_4274_4951 | 223 |
| 126 | 3300005330 | Ga0070690_100106061 | Ga0070690_1001060612 | 224 |
| 127 | 3300005343 | Ga0070687_100237715 | Ga0070687_1002377152 | 224 |
| 128 | 3300005355 | Ga0070671_100261479 | Ga0070671_1002614792 | 224 |
| 129 | 3300005455 | Ga0070663_100126552 | Ga0070663_1001265522 | 224 |
| 130 | 3300005457 | Ga0070662_100004931 | Ga0070662_1000049312 | 224 |
| 131 | 3300005457 | Ga0070662_100686052 | Ga0070662_1006860522 | 224 |
| 132 | 3300005616 | Ga0068852_100803244 | Ga0068852_1008032442 | 224 |
| 133 | 3300005618 | Ga0068864_100080872 | Ga0068864_1000808723 | 224 |
| 134 | 3300005718 | Ga0068866_10069868 | Ga0068866_100698682 | 224 |
| 135 | 3300006048 | Ga0075363_100002772 | Ga0075363_1000027727 | 224 |
| 136 | 3300006195 | Ga0075366_10064159 | Ga0075366_100641593 | 224 |
| 137 | 3300009148 | Ga0105243_10124820 | Ga0105243_101248203 | 224 |
| 138 | 3300009176 | Ga0105242_10261222 | Ga0105242_102612222 | 224 |
| 139 | 3300009177 | Ga0105248_10011816 | Ga0105248_100118168 | 224 |
| 140 | 3300011119 | Ga0105246_10306643 | Ga0105246_103066432 | 224 |
| 141 | 3300013306 | Ga0163162_11339820 | Ga0163162_113398201 | 224 |
| 142 | 3300013307 | Ga0157372_10473240 | Ga0157372_104732402 | 224 |
| 143 | 3300013308 | Ga0157375_10456600 | Ga0157375_104566002 | 224 |
| 144 | 3300014325 | Ga0163163_10240202 | Ga0163163_102402023 | 224 |
| 145 | 3300014326 | Ga0157380_10332632 | Ga0157380_103326322 | 224 |
| 146 | 3300014745 | Ga0157377_10269812 | Ga0157377_102698122 | 224 |
| 147 | 3300014968 | Ga0157379_10288256 | Ga0157379_102882562 | 224 |
| 148 | 3300025899 | Ga0207642_10014594 | Ga0207642_100145942 | 224 |
| 149 | 3300025908 | Ga0207643_10118737 | Ga0207643_101187372 | 224 |
| 150 | 3300025912 | Ga0207707_10359853 | Ga0207707_103598532 | 224 |
| 151 | 3300025920 | Ga0207649_10510932 | Ga0207649_105109321 | 224 |
| 152 | 3300025931 | Ga0207644_10090227 | Ga0207644_100902273 | 224 |
| 153 | 3300025933 | Ga0207706_10081581 | Ga0207706_100815812 | 224 |
| 154 | 3300025933 | Ga0207706_10211951 | Ga0207706_102119513 | 224 |
| 155 | 3300025935 | Ga0207709_10056635 | Ga0207709_100566352 | 224 |
| 156 | 3300025937 | Ga0207669_10020906 | Ga0207669_100209063 | 224 |
| 157 | 3300025938 | Ga0207704_10105374 | Ga0207704_101053741 | 224 |
| 158 | 3300025940 | Ga0207691_10139739 | Ga0207691_101397392 | 224 |
| 159 | 3300025960 | Ga0207651_10273542 | Ga0207651_102735422 | 224 |
| 160 | 3300025986 | Ga0207658_10224919 | Ga0207658_102249192 | 224 |
| 161 | 3300026067 | Ga0207678_10177113 | Ga0207678_101771132 | 224 |
| 162 | 3300026089 | Ga0207648_10331332 | Ga0207648_103313321 | 224 |
| 163 | 3300026095 | Ga0207676_10116011 | Ga0207676_101160113 | 224 |
| 164 | 3300026142 | Ga0207698_10391670 | Ga0207698_103916702 | 224 |
| 165 | 3300031247 | Ga0265340_10067785 | Ga0265340_100677852 | 224 |
| 166 | 3300035085 | Ga0373929_0002536 | Ga0373929_0002536_175_855 | 224 |
| 167 | 3300035092 | Ga0373952_0024649 | Ga0373952_0024649_439_1119 | 224 |
| 168 | 3300035170 | Ga0373943_0335117 | Ga0373943_0335117_11_691 | 224 |
| 169 | 3300035241 | Ga0373961_0011313 | Ga0373961_0011313_20_700 | 224 |
| 170 | 3300035242 | Ga0373962_0031845 | Ga0373962_0031845_294_974 | 224 |
| 171 | 3300035242 | Ga0373962_0033586 | Ga0373962_0033586_345_1025 | 224 |
| 172 | 3300035691 | Ga0373931_0004738 | Ga0373931_0004738_489_1169 | 224 |
| 173 | 3300035692 | Ga0373935_0451215 | Ga0373935_0451215_238_918 | 224 |
| 174 | 3300035695 | Ga0373927_0246941 | Ga0373927_0246941_247_927 | 224 |
| 175 | 3300048088 | Ga0495602_0292304 | Ga0495602_0292304_458_1138 | 224 |
| 176 | 3300048903 | Ga0496100_0009210 | Ga0496100_0009210_3618_4298 | 224 |
| 177 | 3300048904 | Ga0496101_0039158 | Ga0496101_0039158_2026_2706 | 224 |
| 178 | 3300048907 | Ga0496104_0013104 | Ga0496104_0013104_6498_7178 | 224 |
| 179 | 3300048908 | Ga0496105_0023000 | Ga0496105_0023000_243_923 | 224 |
| 180 | 3300048909 | Ga0496106_0427406 | Ga0496106_0427406_160_840 | 224 |
| 181 | 3300048910 | Ga0496107_0133240 | Ga0496107_0133240_427_1107 | 224 |
| 182 | 3300048911 | Ga0496108_0043119 | Ga0496108_0043119_866_1546 | 224 |
| 183 | 3300048911 | Ga0496108_0069671 | Ga0496108_0069671_1047_1727 | 224 |
| 184 | 3300048912 | Ga0496109_0455999 | Ga0496109_0455999_140_820 | 224 |
| 185 | 3300048913 | Ga0496110_0004771 | Ga0496110_0004771_6790_7470 | 224 |
| 186 | 3300048914 | Ga0496111_0218939 | Ga0496111_0218939_250_930 | 224 |
| 187 | 3300048915 | Ga0496112_0083030 | Ga0496112_0083030_1077_1757 | 224 |
| 188 | 3300048917 | Ga0496114_0010617 | Ga0496114_0010617_1852_2532 | 224 |
| 189 | 3300048917 | Ga0496114_0287259 | Ga0496114_0287259_292_972 | 224 |
| 190 | 3300048917 | Ga0496114_0856538 | Ga0496114_0856538_41_721 | 224 |
| 191 | 3300048918 | Ga0496115_0054889 | Ga0496115_0054889_1810_2490 | 224 |
| 192 | 3300049742 | Ga0501080_0424907 | Ga0501080_0424907_25_708 | 224 |
| 193 | 3300049742 | Ga0501080_0695372 | Ga0501080_0695372_148_834 | 224 |
| 194 | 3300050514 | nmdc:mga08x19_442937_c1 | nmdc:mga08x19_442937_c1_14_694 | 224 |
| 195 | 3300053078 | Ga0495612_0067179 | Ga0495612_0067179_326_1006 | 224 |
| 196 | 3300003203 | JGI25406J46586_10022905 | JGI25406J46586_100229052 | 225 |
| 197 | 3300005288 | Ga0065714_10165718 | Ga0065714_101657181 | 225 |
| 198 | 3300005328 | Ga0070676_10108578 | Ga0070676_101085782 | 225 |
| 199 | 3300005330 | Ga0070690_100262431 | Ga0070690_1002624313 | 225 |
| 200 | 3300005333 | Ga0070677_10027484 | Ga0070677_100274843 | 225 |
| 201 | 3300005340 | Ga0070689_100286663 | Ga0070689_1002866633 | 225 |
| 202 | 3300005354 | Ga0070675_100138786 | Ga0070675_1001387863 | 225 |
| 203 | 3300005354 | Ga0070675_100206641 | Ga0070675_1002066411 | 225 |
| 204 | 3300005356 | Ga0070674_100023249 | Ga0070674_1000232498 | 225 |
| 205 | 3300005458 | Ga0070681_10064707 | Ga0070681_100647072 | 225 |
| 206 | 3300005466 | Ga0070685_10104108 | Ga0070685_101041083 | 225 |
| 207 | 3300005466 | Ga0070685_10132614 | Ga0070685_101326142 | 225 |
| 208 | 3300005615 | Ga0070702_100152804 | Ga0070702_1001528041 | 225 |
| 209 | 3300005617 | Ga0068859_100044884 | Ga0068859_1000448845 | 225 |
| 210 | 3300005618 | Ga0068864_100010077 | Ga0068864_1000100775 | 225 |
| 211 | 3300005719 | Ga0068861_100376546 | Ga0068861_1003765462 | 225 |
| 212 | 3300005983 | Ga0081540_1047300 | Ga0081540_10473001 | 225 |
| 213 | 3300005985 | Ga0081539_10002027 | Ga0081539_1000202716 | 225 |
| 214 | 3300006051 | Ga0075364_10444775 | Ga0075364_104447752 | 225 |
| 215 | 3300006186 | Ga0075369_10079845 | Ga0075369_100798452 | 225 |
| 216 | 3300006195 | Ga0075366_10048225 | Ga0075366_100482252 | 225 |
| 217 | 3300006195 | Ga0075366_10110469 | Ga0075366_101104692 | 225 |
| 218 | 3300006237 | Ga0097621_100652065 | Ga0097621_1006520652 | 225 |
| 219 | 3300006844 | Ga0075428_100218274 | Ga0075428_1002182742 | 225 |
| 220 | 3300006871 | Ga0075434_101010754 | Ga0075434_1010107541 | 225 |
| 221 | 3300006881 | Ga0068865_100074714 | Ga0068865_1000747142 | 225 |
| 222 | 3300006931 | Ga0097620_100044882 | Ga0097620_1000448822 | 225 |
| 223 | 3300009094 | Ga0111539_10205729 | Ga0111539_102057291 | 225 |
| 224 | 3300009098 | Ga0105245_10396357 | Ga0105245_103963572 | 225 |
| 225 | 3300009147 | Ga0114129_10355109 | Ga0114129_103551091 | 225 |
| 226 | 3300009148 | Ga0105243_10425642 | Ga0105243_104256421 | 225 |
| 227 | 3300009177 | Ga0105248_10273483 | Ga0105248_102734831 | 225 |
| 228 | 3300009551 | Ga0105238_10079541 | Ga0105238_100795413 | 225 |
| 229 | 3300013297 | Ga0157378_10831962 | Ga0157378_108319622 | 225 |
| 230 | 3300013307 | Ga0157372_10781068 | Ga0157372_107810682 | 225 |
| 231 | 3300013308 | Ga0157375_10617338 | Ga0157375_106173382 | 225 |
| 232 | 3300014326 | Ga0157380_10420840 | Ga0157380_104208402 | 225 |
| 233 | 3300014969 | Ga0157376_10920891 | Ga0157376_109208911 | 225 |
| 234 | 3300025261 | Ga0209233_1032547 | Ga0209233_10325472 | 225 |
| 235 | 3300025297 | Ga0209758_1072316 | Ga0209758_10723161 | 225 |
| 236 | 3300025893 | Ga0207682_10006602 | Ga0207682_100066021 | 225 |
| 237 | 3300025900 | Ga0207710_10023264 | Ga0207710_100232642 | 225 |
| 238 | 3300025904 | Ga0207647_10107971 | Ga0207647_101079711 | 225 |
| 239 | 3300025911 | Ga0207654_10012606 | Ga0207654_100126063 | 225 |
| 240 | 3300025913 | Ga0207695_10419652 | Ga0207695_104196521 | 225 |
| 241 | 3300025918 | Ga0207662_10058968 | Ga0207662_100589684 | 225 |
| 242 | 3300025919 | Ga0207657_10459204 | Ga0207657_104592042 | 225 |
| 243 | 3300025923 | Ga0207681_10063327 | Ga0207681_100633276 | 225 |
| 244 | 3300025923 | Ga0207681_10153997 | Ga0207681_101539972 | 225 |
| 245 | 3300025924 | Ga0207694_10065655 | Ga0207694_100656553 | 225 |
| 246 | 3300025926 | Ga0207659_10102646 | Ga0207659_101026462 | 225 |
| 247 | 3300025927 | Ga0207687_10127230 | Ga0207687_101272302 | 225 |
| 248 | 3300025927 | Ga0207687_10579154 | Ga0207687_105791542 | 225 |
| 249 | 3300025933 | Ga0207706_10246977 | Ga0207706_102469772 | 225 |
| 250 | 3300025937 | Ga0207669_10113152 | Ga0207669_101131522 | 225 |
| 251 | 3300025937 | Ga0207669_10114182 | Ga0207669_101141824 | 225 |
| 252 | 3300025939 | Ga0207665_10337399 | Ga0207665_103373992 | 225 |
| 253 | 3300025940 | Ga0207691_10071075 | Ga0207691_100710754 | 225 |
| 254 | 3300025942 | Ga0207689_10342058 | Ga0207689_103420582 | 225 |
| 255 | 3300025961 | Ga0207712_10555092 | Ga0207712_105550922 | 225 |
| 256 | 3300026095 | Ga0207676_10008313 | Ga0207676_100083136 | 225 |
| 257 | 3300026116 | Ga0207674_10063716 | Ga0207674_100637163 | 225 |
| 258 | 3300026118 | Ga0207675_100323138 | Ga0207675_1003231381 | 225 |
| 259 | 3300026118 | Ga0207675_100806521 | Ga0207675_1008065211 | 225 |
| 260 | 3300026121 | Ga0207683_10007038 | Ga0207683_1000703810 | 225 |
| 261 | 3300027907 | Ga0207428_10132182 | Ga0207428_101321824 | 225 |
| 262 | 3300028381 | Ga0268264_10575093 | Ga0268264_105750931 | 225 |
| 263 | 3300028794 | Ga0307515_10199783 | Ga0307515_101997832 | 225 |
| 264 | 3300031238 | Ga0265332_10009877 | Ga0265332_100098773 | 225 |
| 265 | 3300031241 | Ga0265325_10000305 | Ga0265325_100003056 | 225 |
| 266 | 3300031241 | Ga0265325_10065751 | Ga0265325_100657512 | 225 |
| 267 | 3300031241 | Ga0265325_10072198 | Ga0265325_100721983 | 225 |
| 268 | 3300031242 | Ga0265329_10007626 | Ga0265329_100076265 | 225 |
| 269 | 3300031247 | Ga0265340_10027879 | Ga0265340_100278792 | 225 |
| 270 | 3300031247 | Ga0265340_10051008 | Ga0265340_100510082 | 225 |
| 271 | 3300031247 | Ga0265340_10053364 | Ga0265340_100533644 | 225 |
| 272 | 3300031249 | Ga0265339_10036835 | Ga0265339_100368352 | 225 |
| 273 | 3300031249 | Ga0265339_10116781 | Ga0265339_101167812 | 225 |
| 274 | 3300031250 | Ga0265331_10040198 | Ga0265331_100401982 | 225 |
| 275 | 3300031344 | Ga0265316_10129880 | Ga0265316_101298802 | 225 |
| 276 | 3300031344 | Ga0265316_10176046 | Ga0265316_101760461 | 225 |
| 277 | 3300031595 | Ga0265313_10062066 | Ga0265313_100620662 | 225 |
| 278 | 3300031711 | Ga0265314_10186869 | Ga0265314_101868692 | 225 |
| 279 | 3300031712 | Ga0265342_10024831 | Ga0265342_100248314 | 225 |
| 280 | 3300031712 | Ga0265342_10185734 | Ga0265342_101857342 | 225 |
| 281 | 3300035171 | Ga0373946_0196316 | Ga0373946_0196316_168_851 | 225 |
| 282 | 3300039438 | Ga0436360_0115274 | Ga0436360_0115274_355_1056 | 225 |
| 283 | 3300039453 | Ga0436362_0779349 | Ga0436362_0779349_56_772 | 225 |
| 284 | 3300041453 | Ga0451797_0849193 | Ga0451797_0849193_31_714 | 225 |
| 285 | 3300042003 | Ga0439443_009503 | Ga0439443_009503_595_1305 | 225 |
| 286 | 3300042461 | Ga0439460_0102492 | Ga0439460_0102492_154_864 | 225 |
| 287 | 3300046537 | Ga0495598_0028650 | Ga0495598_0028650_47_733 | 225 |
| 288 | 3300046539 | Ga0495621_0056375 | Ga0495621_0056375_585_1265 | 225 |
| 289 | 3300047469 | Ga0495673_0130301 | Ga0495673_0130301_156_932 | 225 |
| 290 | 3300048913 | Ga0496110_0760257 | Ga0496110_0760257_18_704 | 225 |
| 291 | 3300048918 | Ga0496115_0056335 | Ga0496115_0056335_2344_3027 | 225 |
| 292 | 3300049571 | Ga0501034_0181312 | Ga0501034_0181312_1013_1699 | 225 |
| 293 | 3300049573 | Ga0501037_0021830 | Ga0501037_0021830_2946_3629 | 225 |
| 294 | 3300049574 | Ga0501038_0123832 | Ga0501038_0123832_897_1580 | 225 |
| 295 | 3300049578 | Ga0501042_0418793 | Ga0501042_0418793_257_940 | 225 |
| 296 | 3300049579 | Ga0501043_0140356 | Ga0501043_0140356_151_909 | 225 |
| 297 | 3300049581 | Ga0501047_0023793 | Ga0501047_0023793_4707_5390 | 225 |
| 298 | 3300049583 | Ga0501067_0351798 | Ga0501067_0351798_73_756 | 225 |
| 299 | 3300049585 | Ga0501069_0255491 | Ga0501069_0255491_254_940 | 225 |
| 300 | 3300049586 | Ga0501070_0327001 | Ga0501070_0327001_69_752 | 225 |
| 301 | 3300049588 | Ga0501072_0000464 | Ga0501072_0000464_2263_2946 | 225 |
| 302 | 3300049593 | Ga0501077_0101926 | Ga0501077_0101926_292_975 | 225 |
| 303 | 3300049741 | Ga0501079_0054215 | Ga0501079_0054215_491_1249 | 225 |
| 304 | 3300049742 | Ga0501080_0113970 | Ga0501080_0113970_889_1572 | 225 |
| 305 | 3300049743 | Ga0501081_0067775 | Ga0501081_0067775_780_1463 | 225 |
| 306 | 3300049744 | Ga0501083_0100005 | Ga0501083_0100005_49_735 | 225 |
| 307 | 3300049822 | Ga0501035_0071563 | Ga0501035_0071563_510_1193 | 225 |
| 308 | 3300049823 | Ga0501044_0099131 | Ga0501044_0099131_1175_1858 | 225 |
| 309 | 3300050489 | nmdc:mga03683_123325_c1 | nmdc:mga03683_123325_c1_27_710 | 225 |
| 310 | 3300050489 | nmdc:mga03683_136925_c1 | nmdc:mga03683_136925_c1_129_812 | 225 |
| 311 | 3300050489 | nmdc:mga03683_31263_c1 | nmdc:mga03683_31263_c1_620_1300 | 225 |
| 312 | 3300050491 | nmdc:mga00v17_458157_c1 | nmdc:mga00v17_458157_c1_119_802 | 225 |
| 313 | 3300050491 | nmdc:mga00v17_94127_c1 | nmdc:mga00v17_94127_c1_305_988 | 225 |
| 314 | 3300050492 | nmdc:mga0yw44_101091_c1 | nmdc:mga0yw44_101091_c1_1055_1738 | 225 |
| 315 | 3300050494 | nmdc:mga06z11_144593_c1 | nmdc:mga06z11_144593_c1_242_925 | 225 |
| 316 | 3300050496 | nmdc:mga07m45_301207_c1 | nmdc:mga07m45_301207_c1_126_806 | 225 |
| 317 | 3300050507 | nmdc:mga05p37_391773_c1 | nmdc:mga05p37_391773_c1_17_700 | 225 |
| 318 | 3300050511 | nmdc:mga08y16_286252_c1 | nmdc:mga08y16_286252_c1_721_1407 | 225 |
| 319 | 3300050516 | nmdc:mga0sz30_17764_c1 | nmdc:mga0sz30_17764_c1_574_1257 | 225 |
| 320 | 3300053096 | Ga0500641_0008847 | Ga0500641_0008847_677_1360 | 225 |
| 321 | 3300054114 | Ga0501084_0062669 | Ga0501084_0062669_854_1537 | 225 |
| 322 | 3300054114 | Ga0501084_0118190 | Ga0501084_0118190_32_718 | 225 |
| 323 | 3300060353 | Ga0501082_0001642 | Ga0501082_0001642_12450_13217 | 225 |
| 324 | 3300005458 | Ga0070681_10052487 | Ga0070681_100524872 | 226 |
| 325 | 3300005530 | Ga0070679_100321383 | Ga0070679_1003213832 | 226 |
| 326 | 3300005545 | Ga0070695_100397478 | Ga0070695_1003974782 | 226 |
| 327 | 3300005981 | Ga0081538_10002038 | Ga0081538_1000203823 | 226 |
| 328 | 3300006177 | Ga0075362_10150570 | Ga0075362_101505702 | 226 |
| 329 | 3300006847 | Ga0075431_100247828 | Ga0075431_1002478282 | 226 |
| 330 | 3300006871 | Ga0075434_100034653 | Ga0075434_1000346535 | 226 |
| 331 | 3300025912 | Ga0207707_10082390 | Ga0207707_100823902 | 226 |
| 332 | 3300025921 | Ga0207652_10137924 | Ga0207652_101379242 | 226 |
| 333 | 3300025939 | Ga0207665_10493146 | Ga0207665_104931461 | 226 |
| 334 | 3300026078 | Ga0207702_10534559 | Ga0207702_105345592 | 226 |
| 335 | 3300037853 | Ga0436364_0836051 | Ga0436364_0836051_98_778 | 226 |
| 336 | 3300039453 | Ga0436362_1220292 | Ga0436362_1220292_65_784 | 226 |
| 337 | 3300041496 | Ga0451839_0860984 | Ga0451839_0860984_92_796 | 226 |
| 338 | 3300048903 | Ga0496100_0467424 | Ga0496100_0467424_236_934 | 226 |
| 339 | 3300048907 | Ga0496104_0024333 | Ga0496104_0024333_3042_3740 | 226 |
| 340 | 3300048908 | Ga0496105_0007674 | Ga0496105_0007674_3126_3824 | 226 |
| 341 | 3300048918 | Ga0496115_0437813 | Ga0496115_0437813_236_934 | 226 |
| 342 | 3300049572 | Ga0501036_0664760 | Ga0501036_0664760_76_762 | 226 |
| 343 | 3300049591 | Ga0501075_0300528 | Ga0501075_0300528_143_832 | 226 |
| 344 | 3300050510 | nmdc:mga06r32_458043_c1 | nmdc:mga06r32_458043_c1_184_873 | 226 |
| 345 | 3300054114 | Ga0501084_0801470 | Ga0501084_0801470_70_759 | 226 |
| 346 | 3300005434 | Ga0070709_10140180 | Ga0070709_101401802 | 227 |
| 347 | 3300005434 | Ga0070709_10365977 | Ga0070709_103659772 | 227 |
| 348 | 3300005435 | Ga0070714_100013728 | Ga0070714_1000137284 | 227 |
| 349 | 3300005435 | Ga0070714_100089356 | Ga0070714_1000893562 | 227 |
| 350 | 3300005436 | Ga0070713_100320173 | Ga0070713_1003201732 | 227 |
| 351 | 3300005437 | Ga0070710_10045175 | Ga0070710_100451754 | 227 |
| 352 | 3300005437 | Ga0070710_10088849 | Ga0070710_100888492 | 227 |
| 353 | 3300006028 | Ga0070717_10036056 | Ga0070717_100360563 | 227 |
| 354 | 3300006028 | Ga0070717_10483827 | Ga0070717_104838272 | 227 |
| 355 | 3300006038 | Ga0075365_10007739 | Ga0075365_100077394 | 227 |
| 356 | 3300006163 | Ga0070715_10044669 | Ga0070715_100446692 | 227 |
| 357 | 3300006173 | Ga0070716_100467196 | Ga0070716_1004671962 | 227 |
| 358 | 3300006175 | Ga0070712_100222991 | Ga0070712_1002229913 | 227 |
| 359 | 3300006175 | Ga0070712_100451138 | Ga0070712_1004511382 | 227 |
| 360 | 3300006852 | Ga0075433_10014525 | Ga0075433_100145252 | 227 |
| 361 | 3300006871 | Ga0075434_100236467 | Ga0075434_1002364672 | 227 |
| 362 | 3300006914 | Ga0075436_100010935 | Ga0075436_1000109353 | 227 |
| 363 | 3300007076 | Ga0075435_100187081 | Ga0075435_1001870812 | 227 |
| 364 | 3300007076 | Ga0075435_100190124 | Ga0075435_1001901242 | 227 |
| 365 | 3300007788 | Ga0099795_10030011 | Ga0099795_100300111 | 227 |
| 366 | 3300009094 | Ga0111539_10438547 | Ga0111539_104385472 | 227 |
| 367 | 3300010159 | Ga0099796_10008664 | Ga0099796_100086644 | 227 |
| 368 | 3300021384 | Ga0213876_10026242 | Ga0213876_100262422 | 227 |
| 369 | 3300021388 | Ga0213875_10000040 | Ga0213875_100000409 | 227 |
| 370 | 3300025898 | Ga0207692_10247175 | Ga0207692_102471752 | 227 |
| 371 | 3300025898 | Ga0207692_10259191 | Ga0207692_102591912 | 227 |
| 372 | 3300025905 | Ga0207685_10177582 | Ga0207685_101775822 | 227 |
| 373 | 3300025915 | Ga0207693_10024520 | Ga0207693_100245206 | 227 |
| 374 | 3300025915 | Ga0207693_10489514 | Ga0207693_104895141 | 227 |
| 375 | 3300025916 | Ga0207663_10154499 | Ga0207663_101544991 | 227 |
| 376 | 3300025929 | Ga0207664_10129219 | Ga0207664_101292192 | 227 |
| 377 | 3300025939 | Ga0207665_10013404 | Ga0207665_100134045 | 227 |
| 378 | 3300027512 | Ga0209179_1002880 | Ga0209179_10028803 | 227 |
| 379 | 3300027907 | Ga0207428_10332694 | Ga0207428_103326942 | 227 |
| 380 | 3300035116 | Ga0373945_0002025 | Ga0373945_0002025_908_1600 | 227 |
| 381 | 3300035117 | Ga0373953_0178149 | Ga0373953_0178149_200_892 | 227 |
| 382 | 3300035118 | Ga0373954_0000496 | Ga0373954_0000496_4573_5265 | 227 |
| 383 | 3300035118 | Ga0373954_0022672 | Ga0373954_0022672_1197_1901 | 227 |
| 384 | 3300035120 | Ga0373957_0002404 | Ga0373957_0002404_1140_1832 | 227 |
| 385 | 3300035170 | Ga0373943_0001174 | Ga0373943_0001174_2743_3435 | 227 |
| 386 | 3300035171 | Ga0373946_0000733 | Ga0373946_0000733_4892_5584 | 227 |
| 387 | 3300035172 | Ga0373955_0062369 | Ga0373955_0062369_1020_1712 | 227 |
| 388 | 3300035410 | Ga0373924_0000869 | Ga0373924_0000869_7841_8533 | 227 |
| 389 | 3300035692 | Ga0373935_0001176 | Ga0373935_0001176_11624_12316 | 227 |
| 390 | 3300035695 | Ga0373927_0001966 | Ga0373927_0001966_14454_15146 | 227 |
| 391 | 3300035724 | Ga0373933_0001354 | Ga0373933_0001354_5975_6667 | 227 |
| 392 | 3300035725 | Ga0373947_0001670 | Ga0373947_0001670_1113_1805 | 227 |
| 393 | 3300036401 | Ga0373937_0000356 | Ga0373937_0000356_24540_25232 | 227 |
| 394 | 3300037068 | Ga0373925_0000462 | Ga0373925_0000462_25460_26152 | 227 |
| 395 | 3300037853 | Ga0436364_0576120 | Ga0436364_0576120_5683_6372 | 227 |
| 396 | 3300039437 | Ga0436365_1115437 | Ga0436365_1115437_35_724 | 227 |
| 397 | 3300039437 | Ga0436365_1298720 | Ga0436365_1298720_842_1531 | 227 |
| 398 | 3300039450 | Ga0436363_0033945 | Ga0436363_0033945_82_786 | 227 |
| 399 | 3300039453 | Ga0436362_1278674 | Ga0436362_1278674_58_747 | 227 |
| 400 | 3300046454 | Ga0495592_0000090 | Ga0495592_0000090_14766_15458 | 227 |
| 401 | 3300046459 | Ga0495629_0019883 | Ga0495629_0019883_2288_2980 | 227 |
| 402 | 3300046459 | Ga0495629_0042536 | Ga0495629_0042536_1369_2073 | 227 |
| 403 | 3300046462 | Ga0495651_0000682 | Ga0495651_0000682_14778_15470 | 227 |
| 404 | 3300046463 | Ga0495653_0000322 | Ga0495653_0000322_23489_24181 | 227 |
| 405 | 3300046476 | Ga0495662_0304774 | Ga0495662_0304774_47_739 | 227 |
| 406 | 3300046477 | Ga0495664_0000078 | Ga0495664_0000078_29628_30320 | 227 |
| 407 | 3300046511 | Ga0495608_0000022 | Ga0495608_0000022_147362_148054 | 227 |
| 408 | 3300046514 | Ga0495618_0000229 | Ga0495618_0000229_25480_26172 | 227 |
| 409 | 3300046516 | Ga0495628_0000035 | Ga0495628_0000035_95186_95878 | 227 |
| 410 | 3300046517 | Ga0495630_0000377 | Ga0495630_0000377_6363_7055 | 227 |
| 411 | 3300046529 | Ga0495652_0000062 | Ga0495652_0000062_95198_95890 | 227 |
| 412 | 3300046533 | Ga0495640_0000021 | Ga0495640_0000021_17058_17750 | 227 |
| 413 | 3300046533 | Ga0495640_0150748 | Ga0495640_0150748_674_1378 | 227 |
| 414 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_95198_95890 | 227 |
| 415 | 3300046543 | Ga0495645_0000174 | Ga0495645_0000174_29351_30043 | 227 |
| 416 | 3300046559 | Ga0495667_0000161 | Ga0495667_0000161_29407_30099 | 227 |
| 417 | 3300046642 | Ga0495634_0000350 | Ga0495634_0000350_14757_15449 | 227 |
| 418 | 3300046663 | Ga0495635_0000018 | Ga0495635_0000018_178115_178807 | 227 |
| 419 | 3300046675 | Ga0495657_0000245 | Ga0495657_0000245_33915_34607 | 227 |
| 420 | 3300046675 | Ga0495657_0172814 | Ga0495657_0172814_286_990 | 227 |
| 421 | 3300046678 | Ga0495599_0000032 | Ga0495599_0000032_92798_93490 | 227 |
| 422 | 3300046679 | Ga0495623_0000004 | Ga0495623_0000004_19418_20110 | 227 |
| 423 | 3300046680 | Ga0495646_0000083 | Ga0495646_0000083_15085_15777 | 227 |
| 424 | 3300046689 | Ga0495613_0019217 | Ga0495613_0019217_3446_4138 | 227 |
| 425 | 3300046689 | Ga0495613_0120552 | Ga0495613_0120552_115_819 | 227 |
| 426 | 3300046690 | Ga0495624_0053886 | Ga0495624_0053886_92_784 | 227 |
| 427 | 3300046809 | Ga0495600_0000022 | Ga0495600_0000022_77040_77732 | 227 |
| 428 | 3300047315 | Ga0495581_0009463 | Ga0495581_0009463_2130_2822 | 227 |
| 429 | 3300047317 | Ga0495604_0000011 | Ga0495604_0000011_14785_15477 | 227 |
| 430 | 3300047319 | Ga0495674_0000034 | Ga0495674_0000034_95198_95890 | 227 |
| 431 | 3300047322 | Ga0495680_0000290 | Ga0495680_0000290_14778_15470 | 227 |
| 432 | 3300047322 | Ga0495680_0058556 | Ga0495680_0058556_1503_2207 | 227 |
| 433 | 3300047444 | Ga0495675_0000352 | Ga0495675_0000352_14559_15251 | 227 |
| 434 | 3300047471 | Ga0495684_0000012 | Ga0495684_0000012_169484_170176 | 227 |
| 435 | 3300047673 | Ga0495593_0049677 | Ga0495593_0049677_459_1163 | 227 |
| 436 | 3300048088 | Ga0495602_0000064 | Ga0495602_0000064_14785_15477 | 227 |
| 437 | 3300049570 | Ga0501033_0074493 | Ga0501033_0074493_139_828 | 227 |
| 438 | 3300050492 | nmdc:mga0yw44_8157_c1 | nmdc:mga0yw44_8157_c1_2476_3159 | 227 |
| 439 | 3300050511 | nmdc:mga08y16_184567_c1 | nmdc:mga08y16_184567_c1_1041_1733 | 227 |
| 440 | 3300050512 | nmdc:mga0n895_242086_c1 | nmdc:mga0n895_242086_c1_325_1029 | 227 |
| 441 | 3300050512 | nmdc:mga0n895_3017_c1 | nmdc:mga0n895_3017_c1_10715_11407 | 227 |
| 442 | 3300050513 | nmdc:mga0rr50_801525_c1 | nmdc:mga0rr50_801525_c1_40_744 | 227 |
| 443 | 3300050514 | nmdc:mga08x19_56376_c1 | nmdc:mga08x19_56376_c1_1338_2033 | 227 |
| 444 | 3300050515 | nmdc:mga0a205_160467_c1 | nmdc:mga0a205_160467_c1_875_1567 | 227 |
| 445 | 3300053077 | Ga0495601_0000015 | Ga0495601_0000015_14785_15477 | 227 |
| 446 | 3300053078 | Ga0495612_0000096 | Ga0495612_0000096_22541_23233 | 227 |
| 447 | 3300053084 | Ga0495595_0000035 | Ga0495595_0000035_64403_65095 | 227 |
| 448 | 3300053085 | Ga0495619_0000044 | Ga0495619_0000044_15085_15777 | 227 |
| 449 | 3300053163 | Ga0500639_064076 | Ga0500639_064076_1189_1878 | 227 |
| 450 | 3300002070 | JGI24750J21931_1007582 | JGI24750J21931_10075821 | 228 |
| 451 | 3300002075 | JGI24738J21930_10014278 | JGI24738J21930_100142781 | 228 |
| 452 | 3300002077 | JGI24744J21845_10036505 | JGI24744J21845_100365052 | 228 |
| 453 | 3300005327 | Ga0070658_10144164 | Ga0070658_101441641 | 228 |
| 454 | 3300005330 | Ga0070690_100041601 | Ga0070690_1000416013 | 228 |
| 455 | 3300005331 | Ga0070670_100006191 | Ga0070670_1000061918 | 228 |
| 456 | 3300005333 | Ga0070677_10295773 | Ga0070677_102957731 | 228 |
| 457 | 3300005334 | Ga0068869_100368644 | Ga0068869_1003686442 | 228 |
| 458 | 3300005338 | Ga0068868_100486796 | Ga0068868_1004867961 | 228 |
| 459 | 3300005339 | Ga0070660_100366774 | Ga0070660_1003667742 | 228 |
| 460 | 3300005340 | Ga0070689_100109108 | Ga0070689_1001091082 | 228 |
| 461 | 3300005344 | Ga0070661_100090904 | Ga0070661_1000909042 | 228 |
| 462 | 3300005347 | Ga0070668_100167692 | Ga0070668_1001676922 | 228 |
| 463 | 3300005353 | Ga0070669_100301988 | Ga0070669_1003019882 | 228 |
| 464 | 3300005354 | Ga0070675_100308118 | Ga0070675_1003081182 | 228 |
| 465 | 3300005356 | Ga0070674_100120424 | Ga0070674_1001204242 | 228 |
| 466 | 3300005364 | Ga0070673_100084573 | Ga0070673_1000845733 | 228 |
| 467 | 3300005366 | Ga0070659_100389825 | Ga0070659_1003898252 | 228 |
| 468 | 3300005434 | Ga0070709_10002877 | Ga0070709_100028778 | 228 |
| 469 | 3300005435 | Ga0070714_100020943 | Ga0070714_1000209433 | 228 |
| 470 | 3300005436 | Ga0070713_100046565 | Ga0070713_1000465652 | 228 |
| 471 | 3300005439 | Ga0070711_100170954 | Ga0070711_1001709542 | 228 |
| 472 | 3300005440 | Ga0070705_100049873 | Ga0070705_1000498732 | 228 |
| 473 | 3300005445 | Ga0070708_100342720 | Ga0070708_1003427202 | 228 |
| 474 | 3300005455 | Ga0070663_100235834 | Ga0070663_1002358342 | 228 |
| 475 | 3300005456 | Ga0070678_100185978 | Ga0070678_1001859782 | 228 |
| 476 | 3300005457 | Ga0070662_100096129 | Ga0070662_1000961292 | 228 |
| 477 | 3300005468 | Ga0070707_100769295 | Ga0070707_1007692951 | 228 |
| 478 | 3300005535 | Ga0070684_100182942 | Ga0070684_1001829422 | 228 |
| 479 | 3300005536 | Ga0070697_100269173 | Ga0070697_1002691732 | 228 |
| 480 | 3300005543 | Ga0070672_100242451 | Ga0070672_1002424512 | 228 |
| 481 | 3300005544 | Ga0070686_100126861 | Ga0070686_1001268612 | 228 |
| 482 | 3300005545 | Ga0070695_100267543 | Ga0070695_1002675432 | 228 |
| 483 | 3300005548 | Ga0070665_100263592 | Ga0070665_1002635922 | 228 |
| 484 | 3300005549 | Ga0070704_100066309 | Ga0070704_1000663091 | 228 |
| 485 | 3300005549 | Ga0070704_100117978 | Ga0070704_1001179782 | 228 |
| 486 | 3300005563 | Ga0068855_100483814 | Ga0068855_1004838142 | 228 |
| 487 | 3300005564 | Ga0070664_100161867 | Ga0070664_1001618672 | 228 |
| 488 | 3300005564 | Ga0070664_100292745 | Ga0070664_1002927452 | 228 |
| 489 | 3300005578 | Ga0068854_100311689 | Ga0068854_1003116892 | 228 |
| 490 | 3300005614 | Ga0068856_100501721 | Ga0068856_1005017212 | 228 |
| 491 | 3300005616 | Ga0068852_100315603 | Ga0068852_1003156032 | 228 |
| 492 | 3300005617 | Ga0068859_100804121 | Ga0068859_1008041212 | 228 |
| 493 | 3300005618 | Ga0068864_100403400 | Ga0068864_1004034002 | 228 |
| 494 | 3300005718 | Ga0068866_10137413 | Ga0068866_101374132 | 228 |
| 495 | 3300005841 | Ga0068863_100109532 | Ga0068863_1001095324 | 228 |
| 496 | 3300005843 | Ga0068860_101038898 | Ga0068860_1010388981 | 228 |
| 497 | 3300005937 | Ga0081455_10001263 | Ga0081455_1000126313 | 228 |
| 498 | 3300005937 | Ga0081455_10012438 | Ga0081455_100124387 | 228 |
| 499 | 3300005937 | Ga0081455_10126652 | Ga0081455_101266523 | 228 |
| 500 | 3300005981 | Ga0081538_10020895 | Ga0081538_100208954 | 228 |
| 501 | 3300005983 | Ga0081540_1000922 | Ga0081540_10009223 | 228 |
| 502 | 3300005983 | Ga0081540_1014099 | Ga0081540_10140994 | 228 |
| 503 | 3300005985 | Ga0081539_10194043 | Ga0081539_101940432 | 228 |
| 504 | 3300006028 | Ga0070717_10016903 | Ga0070717_100169034 | 228 |
| 505 | 3300006028 | Ga0070717_10240965 | Ga0070717_102409652 | 228 |
| 506 | 3300006038 | Ga0075365_10017704 | Ga0075365_100177042 | 228 |
| 507 | 3300006038 | Ga0075365_10113997 | Ga0075365_101139972 | 228 |
| 508 | 3300006048 | Ga0075363_100161548 | Ga0075363_1001615482 | 228 |
| 509 | 3300006058 | Ga0075432_10116034 | Ga0075432_101160342 | 228 |
| 510 | 3300006163 | Ga0070715_10005149 | Ga0070715_100051493 | 228 |
| 511 | 3300006173 | Ga0070716_100010344 | Ga0070716_1000103443 | 228 |
| 512 | 3300006175 | Ga0070712_100116272 | Ga0070712_1001162722 | 228 |
| 513 | 3300006178 | Ga0075367_10092180 | Ga0075367_100921802 | 228 |
| 514 | 3300006844 | Ga0075428_100151669 | Ga0075428_1001516692 | 228 |
| 515 | 3300006844 | Ga0075428_100353996 | Ga0075428_1003539962 | 228 |
| 516 | 3300006844 | Ga0075428_100421721 | Ga0075428_1004217212 | 228 |
| 517 | 3300006844 | Ga0075428_100438038 | Ga0075428_1004380382 | 228 |
| 518 | 3300006846 | Ga0075430_100000067 | Ga0075430_10000006734 | 228 |
| 519 | 3300006846 | Ga0075430_100002682 | Ga0075430_1000026826 | 228 |
| 520 | 3300006846 | Ga0075430_100112465 | Ga0075430_1001124652 | 228 |
| 521 | 3300006847 | Ga0075431_100000003 | Ga0075431_10000000347 | 228 |
| 522 | 3300006847 | Ga0075431_100181750 | Ga0075431_1001817502 | 228 |
| 523 | 3300006847 | Ga0075431_100186987 | Ga0075431_1001869872 | 228 |
| 524 | 3300006852 | Ga0075433_10031250 | Ga0075433_100312503 | 228 |
| 525 | 3300006871 | Ga0075434_100003124 | Ga0075434_10000312410 | 228 |
| 526 | 3300006871 | Ga0075434_100020197 | Ga0075434_1000201975 | 228 |
| 527 | 3300006871 | Ga0075434_100138122 | Ga0075434_1001381223 | 228 |
| 528 | 3300006871 | Ga0075434_100208075 | Ga0075434_1002080752 | 228 |
| 529 | 3300006871 | Ga0075434_100521189 | Ga0075434_1005211892 | 228 |
| 530 | 3300006880 | Ga0075429_100000288 | Ga0075429_10000028831 | 228 |
| 531 | 3300006880 | Ga0075429_100267850 | Ga0075429_1002678502 | 228 |
| 532 | 3300006881 | Ga0068865_100062764 | Ga0068865_1000627642 | 228 |
| 533 | 3300006914 | Ga0075436_100109432 | Ga0075436_1001094323 | 228 |
| 534 | 3300006931 | Ga0097620_100804072 | Ga0097620_1008040722 | 228 |
| 535 | 3300007076 | Ga0075435_100385789 | Ga0075435_1003857892 | 228 |
| 536 | 3300007265 | Ga0099794_10018981 | Ga0099794_100189812 | 228 |
| 537 | 3300007788 | Ga0099795_10078185 | Ga0099795_100781852 | 228 |
| 538 | 3300009094 | Ga0111539_10000753 | Ga0111539_1000075313 | 228 |
| 539 | 3300009094 | Ga0111539_10008081 | Ga0111539_100080813 | 228 |
| 540 | 3300009094 | Ga0111539_10217739 | Ga0111539_102177392 | 228 |
| 541 | 3300009098 | Ga0105245_10180925 | Ga0105245_101809252 | 228 |
| 542 | 3300009147 | Ga0114129_10000104 | Ga0114129_1000010442 | 228 |
| 543 | 3300009147 | Ga0114129_10009491 | Ga0114129_100094917 | 228 |
| 544 | 3300009147 | Ga0114129_10012500 | Ga0114129_100125007 | 228 |
| 545 | 3300009147 | Ga0114129_10034990 | Ga0114129_100349905 | 228 |
| 546 | 3300009147 | Ga0114129_10339881 | Ga0114129_103398812 | 228 |
| 547 | 3300009147 | Ga0114129_10719070 | Ga0114129_107190702 | 228 |
| 548 | 3300009147 | Ga0114129_10800854 | Ga0114129_108008542 | 228 |
| 549 | 3300009148 | Ga0105243_10301494 | Ga0105243_103014942 | 228 |
| 550 | 3300009553 | Ga0105249_10422349 | Ga0105249_104223492 | 228 |
| 551 | 3300009553 | Ga0105249_10700876 | Ga0105249_107008761 | 228 |
| 552 | 3300010159 | Ga0099796_10011549 | Ga0099796_100115492 | 228 |
| 553 | 3300010375 | Ga0105239_10125876 | Ga0105239_101258762 | 228 |
| 554 | 3300010375 | Ga0105239_10619579 | Ga0105239_106195792 | 228 |
| 555 | 3300011119 | Ga0105246_10107510 | Ga0105246_101075103 | 228 |
| 556 | 3300011119 | Ga0105246_10184605 | Ga0105246_101846051 | 228 |
| 557 | 3300013296 | Ga0157374_10193688 | Ga0157374_101936882 | 228 |
| 558 | 3300013297 | Ga0157378_10228098 | Ga0157378_102280982 | 228 |
| 559 | 3300013297 | Ga0157378_10433098 | Ga0157378_104330982 | 228 |
| 560 | 3300013306 | Ga0163162_10354808 | Ga0163162_103548082 | 228 |
| 561 | 3300013308 | Ga0157375_10507594 | Ga0157375_105075942 | 228 |
| 562 | 3300013308 | Ga0157375_11085451 | Ga0157375_110854512 | 228 |
| 563 | 3300014745 | Ga0157377_10047889 | Ga0157377_100478892 | 228 |
| 564 | 3300014968 | Ga0157379_10108513 | Ga0157379_101085133 | 228 |
| 565 | 3300014969 | Ga0157376_10224125 | Ga0157376_102241252 | 228 |
| 566 | 3300025321 | Ga0207656_10021259 | Ga0207656_100212591 | 228 |
| 567 | 3300025885 | Ga0207653_10004559 | Ga0207653_100045594 | 228 |
| 568 | 3300025901 | Ga0207688_10001688 | Ga0207688_1000168810 | 228 |
| 569 | 3300025904 | Ga0207647_10016309 | Ga0207647_100163094 | 228 |
| 570 | 3300025905 | Ga0207685_10028604 | Ga0207685_100286042 | 228 |
| 571 | 3300025906 | Ga0207699_10039458 | Ga0207699_100394583 | 228 |
| 572 | 3300025907 | Ga0207645_10023211 | Ga0207645_100232113 | 228 |
| 573 | 3300025908 | Ga0207643_10005230 | Ga0207643_100052307 | 228 |
| 574 | 3300025910 | Ga0207684_10114815 | Ga0207684_101148152 | 228 |
| 575 | 3300025911 | Ga0207654_10194017 | Ga0207654_101940171 | 228 |
| 576 | 3300025915 | Ga0207693_10091980 | Ga0207693_100919802 | 228 |
| 577 | 3300025915 | Ga0207693_10357759 | Ga0207693_103577592 | 228 |
| 578 | 3300025916 | Ga0207663_10072276 | Ga0207663_100722762 | 228 |
| 579 | 3300025916 | Ga0207663_10249185 | Ga0207663_102491852 | 228 |
| 580 | 3300025918 | Ga0207662_10015482 | Ga0207662_100154823 | 228 |
| 581 | 3300025919 | Ga0207657_10053343 | Ga0207657_100533433 | 228 |
| 582 | 3300025920 | Ga0207649_10196138 | Ga0207649_101961382 | 228 |
| 583 | 3300025923 | Ga0207681_10225105 | Ga0207681_102251052 | 228 |
| 584 | 3300025925 | Ga0207650_10001375 | Ga0207650_100013755 | 228 |
| 585 | 3300025925 | Ga0207650_10102203 | Ga0207650_101022032 | 228 |
| 586 | 3300025927 | Ga0207687_10156151 | Ga0207687_101561512 | 228 |
| 587 | 3300025928 | Ga0207700_10286292 | Ga0207700_102862922 | 228 |
| 588 | 3300025928 | Ga0207700_10372447 | Ga0207700_103724472 | 228 |
| 589 | 3300025929 | Ga0207664_10021536 | Ga0207664_100215363 | 228 |
| 590 | 3300025931 | Ga0207644_10342592 | Ga0207644_103425922 | 228 |
| 591 | 3300025933 | Ga0207706_10001850 | Ga0207706_100018503 | 228 |
| 592 | 3300025939 | Ga0207665_10003686 | Ga0207665_100036864 | 228 |
| 593 | 3300025940 | Ga0207691_10001076 | Ga0207691_100010764 | 228 |
| 594 | 3300025942 | Ga0207689_10020535 | Ga0207689_100205355 | 228 |
| 595 | 3300025945 | Ga0207679_10228012 | Ga0207679_102280122 | 228 |
| 596 | 3300025960 | Ga0207651_10120639 | Ga0207651_101206392 | 228 |
| 597 | 3300025961 | Ga0207712_10651372 | Ga0207712_106513722 | 228 |
| 598 | 3300026067 | Ga0207678_10010390 | Ga0207678_100103907 | 228 |
| 599 | 3300026075 | Ga0207708_10034492 | Ga0207708_100344923 | 228 |
| 600 | 3300026089 | Ga0207648_10264802 | Ga0207648_102648022 | 228 |
| 601 | 3300026095 | Ga0207676_10042344 | Ga0207676_100423442 | 228 |
| 602 | 3300026116 | Ga0207674_10056816 | Ga0207674_100568162 | 228 |
| 603 | 3300026118 | Ga0207675_100082953 | Ga0207675_1000829532 | 228 |
| 604 | 3300026121 | Ga0207683_10016714 | Ga0207683_100167142 | 228 |
| 605 | 3300026142 | Ga0207698_10213682 | Ga0207698_102136822 | 228 |
| 606 | 3300027907 | Ga0207428_10000831 | Ga0207428_1000083122 | 228 |
| 607 | 3300027907 | Ga0207428_10237183 | Ga0207428_102371832 | 228 |
| 608 | 3300027907 | Ga0207428_10384791 | Ga0207428_103847912 | 228 |
| 609 | 3300034957 | Ga0373938_0052969 | Ga0373938_0052969_219_905 | 228 |
| 610 | 3300035083 | Ga0373926_0159624 | Ga0373926_0159624_155_841 | 228 |
| 611 | 3300035091 | Ga0373951_0021480 | Ga0373951_0021480_288_974 | 228 |
| 612 | 3300035092 | Ga0373952_0039412 | Ga0373952_0039412_127_813 | 228 |
| 613 | 3300035116 | Ga0373945_0108418 | Ga0373945_0108418_94_780 | 228 |
| 614 | 3300035121 | Ga0373960_0010722 | Ga0373960_0010722_1006_1692 | 228 |
| 615 | 3300035170 | Ga0373943_0009357 | Ga0373943_0009357_734_1420 | 228 |
| 616 | 3300035171 | Ga0373946_0051880 | Ga0373946_0051880_155_841 | 228 |
| 617 | 3300035171 | Ga0373946_0131802 | Ga0373946_0131802_189_875 | 228 |
| 618 | 3300035691 | Ga0373931_0015862 | Ga0373931_0015862_2520_3206 | 228 |
| 619 | 3300035691 | Ga0373931_0155316 | Ga0373931_0155316_473_1159 | 228 |
| 620 | 3300035692 | Ga0373935_0517867 | Ga0373935_0517867_156_842 | 228 |
| 621 | 3300035695 | Ga0373927_0001072 | Ga0373927_0001072_19249_19935 | 228 |
| 622 | 3300035725 | Ga0373947_0018359 | Ga0373947_0018359_126_812 | 228 |
| 623 | 3300035725 | Ga0373947_0321477 | Ga0373947_0321477_52_738 | 228 |
| 624 | 3300037068 | Ga0373925_0017857 | Ga0373925_0017857_285_971 | 228 |
| 625 | 3300037068 | Ga0373925_0268721 | Ga0373925_0268721_263_949 | 228 |
| 626 | 3300037466 | Ga0395898_0079427 | Ga0395898_0079427_488_1174 | 228 |
| 627 | 3300037471 | Ga0395905_0324694 | Ga0395905_0324694_528_1214 | 228 |
| 628 | 3300039447 | Ga0436361_0476009 | Ga0436361_0476009_6759_7445 | 228 |
| 629 | 3300039450 | Ga0436363_1218092 | Ga0436363_1218092_641_1327 | 228 |
| 630 | 3300041512 | Ga0451853_2233956 | Ga0451853_2233956_206_892 | 228 |
| 631 | 3300044735 | Ga0466968_0194990 | Ga0466968_0194990_228_914 | 228 |
| 632 | 3300046457 | Ga0495590_0159123 | Ga0495590_0159123_124_810 | 228 |
| 633 | 3300046458 | Ga0495591_049312 | Ga0495591_049312_261_947 | 228 |
| 634 | 3300046460 | Ga0495638_0034007 | Ga0495638_0034007_764_1450 | 228 |
| 635 | 3300046461 | Ga0495641_0013506 | Ga0495641_0013506_1688_2374 | 228 |
| 636 | 3300046463 | Ga0495653_0299130 | Ga0495653_0299130_12_698 | 228 |
| 637 | 3300046473 | Ga0495582_0065403 | Ga0495582_0065403_899_1585 | 228 |
| 638 | 3300046473 | Ga0495582_0125793 | Ga0495582_0125793_563_1249 | 228 |
| 639 | 3300046476 | Ga0495662_0022104 | Ga0495662_0022104_131_817 | 228 |
| 640 | 3300046491 | Ga0495584_0021084 | Ga0495584_0021084_1835_2521 | 228 |
| 641 | 3300046491 | Ga0495584_0104900 | Ga0495584_0104900_671_1357 | 228 |
| 642 | 3300046491 | Ga0495584_0245827 | Ga0495584_0245827_41_727 | 228 |
| 643 | 3300046492 | Ga0495585_0214711 | Ga0495585_0214711_199_885 | 228 |
| 644 | 3300046499 | Ga0495594_0190880 | Ga0495594_0190880_314_1000 | 228 |
| 645 | 3300046500 | Ga0495596_0121100 | Ga0495596_0121100_82_768 | 228 |
| 646 | 3300046513 | Ga0495616_0068741 | Ga0495616_0068741_1013_1699 | 228 |
| 647 | 3300046514 | Ga0495618_0114975 | Ga0495618_0114975_480_1166 | 228 |
| 648 | 3300046517 | Ga0495630_0077980 | Ga0495630_0077980_750_1436 | 228 |
| 649 | 3300046523 | Ga0495644_0031325 | Ga0495644_0031325_159_845 | 228 |
| 650 | 3300046525 | Ga0495663_0013480 | Ga0495663_0013480_1299_1985 | 228 |
| 651 | 3300046526 | Ga0495666_0078784 | Ga0495666_0078784_29_715 | 228 |
| 652 | 3300046529 | Ga0495652_0165067 | Ga0495652_0165067_635_1321 | 228 |
| 653 | 3300046531 | Ga0495665_0065518 | Ga0495665_0065518_1143_1829 | 228 |
| 654 | 3300046537 | Ga0495598_0000955 | Ga0495598_0000955_4871_5557 | 228 |
| 655 | 3300046559 | Ga0495667_0168868 | Ga0495667_0168868_586_1272 | 228 |
| 656 | 3300046642 | Ga0495634_0107379 | Ga0495634_0107379_662_1348 | 228 |
| 657 | 3300046642 | Ga0495634_0364182 | Ga0495634_0364182_139_825 | 228 |
| 658 | 3300046663 | Ga0495635_0099459 | Ga0495635_0099459_1195_1881 | 228 |
| 659 | 3300046674 | Ga0495588_0035374 | Ga0495588_0035374_1339_2025 | 228 |
| 660 | 3300046683 | Ga0495658_0089708 | Ga0495658_0089708_1079_1765 | 228 |
| 661 | 3300046690 | Ga0495624_0023352 | Ga0495624_0023352_3232_3918 | 228 |
| 662 | 3300046691 | Ga0495670_0233051 | Ga0495670_0233051_182_868 | 228 |
| 663 | 3300046794 | Ga0495589_0262103 | Ga0495589_0262103_88_774 | 228 |
| 664 | 3300047315 | Ga0495581_0106586 | Ga0495581_0106586_266_952 | 228 |
| 665 | 3300047317 | Ga0495604_0185276 | Ga0495604_0185276_627_1313 | 228 |
| 666 | 3300047319 | Ga0495674_0126910 | Ga0495674_0126910_1114_1800 | 228 |
| 667 | 3300047320 | Ga0495672_0180051 | Ga0495672_0180051_216_902 | 228 |
| 668 | 3300047321 | Ga0495676_0066113 | Ga0495676_0066113_159_845 | 228 |
| 669 | 3300047322 | Ga0495680_0130101 | Ga0495680_0130101_742_1428 | 228 |
| 670 | 3300048091 | Ga0495626_0187001 | Ga0495626_0187001_88_774 | 228 |
| 671 | 3300048903 | Ga0496100_0011779 | Ga0496100_0011779_2289_2984 | 228 |
| 672 | 3300048903 | Ga0496100_0448805 | Ga0496100_0448805_130_816 | 228 |
| 673 | 3300048904 | Ga0496101_0040262 | Ga0496101_0040262_1593_2279 | 228 |
| 674 | 3300048904 | Ga0496101_0401613 | Ga0496101_0401613_148_843 | 228 |
| 675 | 3300048905 | Ga0496102_0258248 | Ga0496102_0258248_130_816 | 228 |
| 676 | 3300048906 | Ga0496103_0122152 | Ga0496103_0122152_575_1261 | 228 |
| 677 | 3300048906 | Ga0496103_0143742 | Ga0496103_0143742_610_1296 | 228 |
| 678 | 3300048907 | Ga0496104_0002163 | Ga0496104_0002163_2523_3209 | 228 |
| 679 | 3300048907 | Ga0496104_0061109 | Ga0496104_0061109_1883_2578 | 228 |
| 680 | 3300048907 | Ga0496104_0101322 | Ga0496104_0101322_401_1087 | 228 |
| 681 | 3300048908 | Ga0496105_0000754 | Ga0496105_0000754_18189_18875 | 228 |
| 682 | 3300048908 | Ga0496105_0298549 | Ga0496105_0298549_312_998 | 228 |
| 683 | 3300048908 | Ga0496105_0581813 | Ga0496105_0581813_72_767 | 228 |
| 684 | 3300048909 | Ga0496106_0004480 | Ga0496106_0004480_1421_2107 | 228 |
| 685 | 3300048909 | Ga0496106_0059449 | Ga0496106_0059449_443_1129 | 228 |
| 686 | 3300048909 | Ga0496106_0072715 | Ga0496106_0072715_970_1665 | 228 |
| 687 | 3300048909 | Ga0496106_0203212 | Ga0496106_0203212_523_1209 | 228 |
| 688 | 3300048909 | Ga0496106_0220224 | Ga0496106_0220224_269_955 | 228 |
| 689 | 3300048910 | Ga0496107_0003453 | Ga0496107_0003453_8785_9471 | 228 |
| 690 | 3300048910 | Ga0496107_0254466 | Ga0496107_0254466_11_697 | 228 |
| 691 | 3300048910 | Ga0496107_0555209 | Ga0496107_0555209_115_801 | 228 |
| 692 | 3300048911 | Ga0496108_0002431 | Ga0496108_0002431_12656_13342 | 228 |
| 693 | 3300048911 | Ga0496108_0008557 | Ga0496108_0008557_5751_6437 | 228 |
| 694 | 3300048911 | Ga0496108_0014148 | Ga0496108_0014148_2120_2806 | 228 |
| 695 | 3300048911 | Ga0496108_0084505 | Ga0496108_0084505_1470_2156 | 228 |
| 696 | 3300048911 | Ga0496108_0263465 | Ga0496108_0263465_578_1273 | 228 |
| 697 | 3300048912 | Ga0496109_0001755 | Ga0496109_0001755_11421_12107 | 228 |
| 698 | 3300048912 | Ga0496109_0003909 | Ga0496109_0003909_8891_9577 | 228 |
| 699 | 3300048912 | Ga0496109_0006920 | Ga0496109_0006920_8383_9069 | 228 |
| 700 | 3300048912 | Ga0496109_0267654 | Ga0496109_0267654_814_1512 | 228 |
| 701 | 3300048913 | Ga0496110_0008732 | Ga0496110_0008732_6924_7610 | 228 |
| 702 | 3300048913 | Ga0496110_0020230 | Ga0496110_0020230_485_1171 | 228 |
| 703 | 3300048913 | Ga0496110_0033299 | Ga0496110_0033299_2690_3376 | 228 |
| 704 | 3300048913 | Ga0496110_0066301 | Ga0496110_0066301_2257_2943 | 228 |
| 705 | 3300048913 | Ga0496110_0222011 | Ga0496110_0222011_313_999 | 228 |
| 706 | 3300048914 | Ga0496111_0005128 | Ga0496111_0005128_7308_7994 | 228 |
| 707 | 3300048914 | Ga0496111_0014585 | Ga0496111_0014585_3448_4134 | 228 |
| 708 | 3300048915 | Ga0496112_0010960 | Ga0496112_0010960_7185_7871 | 228 |
| 709 | 3300048916 | Ga0496113_0006080 | Ga0496113_0006080_3188_3874 | 228 |
| 710 | 3300048916 | Ga0496113_0009343 | Ga0496113_0009343_4698_5384 | 228 |
| 711 | 3300048916 | Ga0496113_0053663 | Ga0496113_0053663_2185_2883 | 228 |
| 712 | 3300048916 | Ga0496113_0153826 | Ga0496113_0153826_428_1114 | 228 |
| 713 | 3300048916 | Ga0496113_0168384 | Ga0496113_0168384_641_1327 | 228 |
| 714 | 3300048917 | Ga0496114_0071160 | Ga0496114_0071160_1308_2003 | 228 |
| 715 | 3300048917 | Ga0496114_0124524 | Ga0496114_0124524_1072_1758 | 228 |
| 716 | 3300048917 | Ga0496114_0440542 | Ga0496114_0440542_103_789 | 228 |
| 717 | 3300049571 | Ga0501034_0088424 | Ga0501034_0088424_635_1366 | 228 |
| 718 | 3300049576 | Ga0501040_0094732 | Ga0501040_0094732_1014_1700 | 228 |
| 719 | 3300049581 | Ga0501047_0131581 | Ga0501047_0131581_1287_1979 | 228 |
| 720 | 3300049581 | Ga0501047_0200293 | Ga0501047_0200293_141_872 | 228 |
| 721 | 3300049582 | Ga0501048_0337222 | Ga0501048_0337222_10_696 | 228 |
| 722 | 3300049588 | Ga0501072_0470749 | Ga0501072_0470749_23_709 | 228 |
| 723 | 3300049591 | Ga0501075_0209044 | Ga0501075_0209044_222_908 | 228 |
| 724 | 3300049593 | Ga0501077_0190507 | Ga0501077_0190507_536_1222 | 228 |
| 725 | 3300049741 | Ga0501079_0053376 | Ga0501079_0053376_1617_2303 | 228 |
| 726 | 3300049742 | Ga0501080_0127248 | Ga0501080_0127248_1213_1899 | 228 |
| 727 | 3300049744 | Ga0501083_0125833 | Ga0501083_0125833_599_1291 | 228 |
| 728 | 3300049822 | Ga0501035_0186822 | Ga0501035_0186822_309_1001 | 228 |
| 729 | 3300049823 | Ga0501044_0783064 | Ga0501044_0783064_96_791 | 228 |
| 730 | 3300050492 | nmdc:mga0yw44_222635_c1 | nmdc:mga0yw44_222635_c1_407_1093 | 228 |
| 731 | 3300050493 | nmdc:mga0k408_253592_c1 | nmdc:mga0k408_253592_c1_265_951 | 228 |
| 732 | 3300050507 | nmdc:mga05p37_119443_c1 | nmdc:mga05p37_119443_c1_2039_2725 | 228 |
| 733 | 3300050507 | nmdc:mga05p37_215_c1 | nmdc:mga05p37_215_c1_28794_29486 | 228 |
| 734 | 3300050507 | nmdc:mga05p37_290900_c1 | nmdc:mga05p37_290900_c1_674_1360 | 228 |
| 735 | 3300050507 | nmdc:mga05p37_36829_c1 | nmdc:mga05p37_36829_c1_2517_3206 | 228 |
| 736 | 3300050507 | nmdc:mga05p37_806399_c1 | nmdc:mga05p37_806399_c1_44_730 | 228 |
| 737 | 3300050508 | nmdc:mga09592_1263_c1 | nmdc:mga09592_1263_c1_451_1143 | 228 |
| 738 | 3300050508 | nmdc:mga09592_391256_c1 | nmdc:mga09592_391256_c1_383_1069 | 228 |
| 739 | 3300050509 | nmdc:mga0qj67_105410_c1 | nmdc:mga0qj67_105410_c1_1217_1903 | 228 |
| 740 | 3300050509 | nmdc:mga0qj67_60_c1 | nmdc:mga0qj67_60_c1_72199_72969 | 228 |
| 741 | 3300050510 | nmdc:mga06r32_1551_c1 | nmdc:mga06r32_1551_c1_996_1688 | 228 |
| 742 | 3300050510 | nmdc:mga06r32_356397_c1 | nmdc:mga06r32_356397_c1_419_1105 | 228 |
| 743 | 3300050510 | nmdc:mga06r32_435952_c1 | nmdc:mga06r32_435952_c1_569_1255 | 228 |
| 744 | 3300050511 | nmdc:mga08y16_176_c1 | nmdc:mga08y16_176_c1_30150_30842 | 228 |
| 745 | 3300050511 | nmdc:mga08y16_182463_c1 | nmdc:mga08y16_182463_c1_268_954 | 228 |
| 746 | 3300050511 | nmdc:mga08y16_80682_c1 | nmdc:mga08y16_80682_c1_1266_1952 | 228 |
| 747 | 3300050512 | nmdc:mga0n895_135437_c1 | nmdc:mga0n895_135437_c1_758_1444 | 228 |
| 748 | 3300050512 | nmdc:mga0n895_154043_c1 | nmdc:mga0n895_154043_c1_818_1504 | 228 |
| 749 | 3300050513 | nmdc:mga0rr50_75345_c1 | nmdc:mga0rr50_75345_c1_326_1012 | 228 |
| 750 | 3300050514 | nmdc:mga08x19_88207_c1 | nmdc:mga08x19_88207_c1_444_1130 | 228 |
| 751 | 3300050515 | nmdc:mga0a205_192658_c1 | nmdc:mga0a205_192658_c1_613_1299 | 228 |
| 752 | 3300050515 | nmdc:mga0a205_487532_c1 | nmdc:mga0a205_487532_c1_346_1032 | 228 |
| 753 | 3300053077 | Ga0495601_0080642 | Ga0495601_0080642_645_1331 | 228 |
| 754 | 3300053077 | Ga0495601_0147092 | Ga0495601_0147092_343_1038 | 228 |
| 755 | 3300053077 | Ga0495601_0277680 | Ga0495601_0277680_302_988 | 228 |
| 756 | 3300053078 | Ga0495612_0031628 | Ga0495612_0031628_910_1596 | 228 |
| 757 | 3300053085 | Ga0495619_0070397 | Ga0495619_0070397_1639_2325 | 228 |
| 758 | 3300053085 | Ga0495619_0111295 | Ga0495619_0111295_935_1621 | 228 |
| 759 | 3300053085 | Ga0495619_0202743 | Ga0495619_0202743_455_1150 | 228 |
| 760 | 3300053130 | Ga0500642_0157575 | Ga0500642_0157575_284_976 | 228 |
| 761 | 3300060353 | Ga0501082_0182800 | Ga0501082_0182800_1114_1800 | 228 |
| 762 | 3300061734 | Ga0530510_0246686 | Ga0530510_0246686_44_736 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ir2-assembly1.cif.gz_A | crystal structure of novel cellulases from microbes associated with the gut ecosystem | 0.8122 | 1 | 207 |
| 2yjv-assembly1.cif.gz_A | crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb | 0.7848 | 15 | 186 |
| 3k4i-assembly1.cif.gz_C | crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 | 0.7817 | 1 | 226 |
| 3noj-assembly1.cif.gz_A | the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida | 0.7803 | 1 | 218 |
| 2pcn-assembly1.cif.gz_A | crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 | 0.7719 | 15 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8151 | 24 | 188 | 3.50.30.40 |
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.806 | 24 | 188 | 3.50.30.40 |
| 5ir2A00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8047 | 1 | 207 | 3.50.30.40 |
| 3k4iB01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.7965 | 5 | 188 | 3.50.30.40 |
| 3k4iB01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.7874 | 5 | 188 | 3.50.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5FJI4-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) | 0.9844 | 3 | 227 |
GO:0046872
|
| AF-A0A537T2X2-F1-model_v4 | RraA family protein | 0.9802 | 1 | 180 |
|
| AF-A0A537R9C4-F1-model_v4 | RraA family protein | 0.9749 | 35 | 172 |
|
| AF-A0A2E6P336-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) | 0.9733 | 2 | 226 |
GO:0016740
GO:0046872 |
| AF-A0A4Q5P2E3-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) | 0.9725 | 3 | 226 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar