F479661

General Info

Members Datasets Scaffolds Average Seq Length
762 350 761 228

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_60_c1|nmdc:mga0qj67_60_c1_72199_72969
Length 256
Sequence VPPQGRRHLQHRRLDLRLTELFPGNLAMTDAVTAAQFEFLRSIDTPTVCNLIEMVAPERRGHGYTVKHLHCPFPDLPPIVGFAKTVTFKAKDKVPLGEAGYMQKRLDYLDYVASAPQPAIMVMHDLDGEHAGFGAFWGEVQSNIHKALGALGVVTDGSIRDIPMIAPNFQMLAAMIVPSHAYVHVVDYGMEIDVAGMATRSGDLVHADRHGAVVVPVDKIDAMKAANDKLAAAEARIIAAAKSGGGVEAIKAALKG

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
345 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.13
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 9.71
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1007582 3300002070 Bacteria 1367
2 JGI24738J21930_10014278 3300002075 Bacteria 1706
3 JGI24744J21845_10036505 3300002077 Bacteria 928
4 JGI25406J46586_10022905 3300003203 Bacteria 2478
5 JGI25153J46596_10009294 3300003215 Bacteria 4594
6 Ga0065714_10165718 3300005288 Bacteria 1029
7 Ga0070658_10144164 3300005327 Bacteria 1991
8 Ga0070676_10108578 3300005328 Bacteria 1725
9 Ga0070690_100041601 3300005330 Bacteria 2910
10 Ga0070690_100106061 3300005330 Bacteria 1869
11 Ga0070690_100262431 3300005330 Bacteria 1226
12 Ga0070670_100006191 3300005331 Bacteria 10116
13 Ga0070677_10027484 3300005333 Bacteria 2142
14 Ga0070677_10295773 3300005333 Bacteria 821
15 Ga0068869_100368644 3300005334 Bacteria 1174
16 Ga0068868_100486796 3300005338 Bacteria 1078
17 Ga0070660_100366774 3300005339 Bacteria 1187
18 Ga0070689_100109108 3300005340 Bacteria 2199
19 Ga0070689_100286663 3300005340 Bacteria 1367
20 Ga0070687_100237715 3300005343 Bacteria 1124
21 Ga0070661_100090904 3300005344 Bacteria 2261
22 Ga0070668_100167692 3300005347 Bacteria 1786
23 Ga0070669_100301988 3300005353 Bacteria 1288
24 Ga0070675_100138786 3300005354 Bacteria 2076
25 Ga0070675_100206641 3300005354 Bacteria 1706
26 Ga0070675_100308118 3300005354 Bacteria 1396
27 Ga0070671_100261479 3300005355 Bacteria 1471
28 Ga0070674_100023249 3300005356 Bacteria 4009
29 Ga0070674_100120424 3300005356 Bacteria 1942
30 Ga0070673_100084573 3300005364 Bacteria 2580
31 Ga0070659_100389825 3300005366 Bacteria 1174
32 Ga0070709_10002877 3300005434 Bacteria 9289
33 Ga0070709_10140180 3300005434 Bacteria 1660
34 Ga0070709_10365977 3300005434 Bacteria 1069
35 Ga0070714_100013728 3300005435 Bacteria 6495
36 Ga0070714_100020943 3300005435 Bacteria 5346
37 Ga0070714_100089356 3300005435 Bacteria 2697
38 Ga0070713_100046565 3300005436 Bacteria 3559
39 Ga0070713_100320173 3300005436 Bacteria 1432
40 Ga0070710_10045175 3300005437 Bacteria 2447
41 Ga0070710_10088849 3300005437 Bacteria 1819
42 Ga0070711_100170954 3300005439 Bacteria 1656
43 Ga0070705_100049873 3300005440 Bacteria 2432
44 Ga0070708_100342720 3300005445 Bacteria 1408
45 Ga0070663_100126552 3300005455 Bacteria 1936
46 Ga0070663_100235834 3300005455 Bacteria 1442
47 Ga0070678_100185978 3300005456 Bacteria 1704
48 Ga0070662_100004931 3300005457 Bacteria 8482
49 Ga0070662_100096129 3300005457 Bacteria 2234
50 Ga0070662_100686052 3300005457 Bacteria 866
51 Ga0070681_10052487 3300005458 Bacteria 4066
52 Ga0070681_10064707 3300005458 Bacteria 3627
53 Ga0070685_10104108 3300005466 Bacteria 1737
54 Ga0070685_10132614 3300005466 Bacteria 1560
55 Ga0070707_100769295 3300005468 Bacteria 926
56 Ga0070679_100321383 3300005530 Bacteria 1497
57 Ga0070684_100182942 3300005535 Bacteria 1906
58 Ga0070697_100269173 3300005536 Bacteria 1460
59 Ga0070672_100242451 3300005543 Bacteria 1516
60 Ga0070686_100126861 3300005544 Bacteria 1759
61 Ga0070695_100267543 3300005545 Bacteria 1251
62 Ga0070695_100397478 3300005545 Bacteria 1044
63 Ga0070696_100455035 3300005546 Bacteria 1011
64 Ga0070665_100263592 3300005548 Bacteria 1724
65 Ga0070704_100066309 3300005549 Bacteria 2602
66 Ga0070704_100117978 3300005549 Bacteria 2032
67 Ga0068855_100483814 3300005563 Bacteria 1347
68 Ga0070664_100161867 3300005564 Bacteria 1980
69 Ga0070664_100292745 3300005564 Bacteria 1470
70 Ga0068854_100311689 3300005578 Bacteria 1276
71 Ga0068856_100501721 3300005614 Bacteria 1234
72 Ga0070702_100152804 3300005615 Bacteria 1484
73 Ga0068852_100315603 3300005616 Bacteria 1516
74 Ga0068852_100803244 3300005616 Bacteria 955
75 Ga0068859_100044884 3300005617 Bacteria 4441
76 Ga0068859_100804121 3300005617 Bacteria 1028
77 Ga0068864_100010077 3300005618 Bacteria 7804
78 Ga0068864_100080872 3300005618 Bacteria 2848
79 Ga0068864_100403400 3300005618 Bacteria 1299
80 Ga0068866_10069868 3300005718 Bacteria 1852
81 Ga0068866_10137413 3300005718 Bacteria 1398
82 Ga0068861_100376546 3300005719 Bacteria 1253
83 Ga0068863_100109532 3300005841 Bacteria 2629
84 Ga0068860_101038898 3300005843 Bacteria 838
85 Ga0081455_10001263 3300005937 Bacteria 31603
86 Ga0081455_10012438 3300005937 Bacteria 8493
87 Ga0081455_10021170 3300005937 Bacteria 6107
88 Ga0081455_10126652 3300005937 Bacteria 2003
89 Ga0081538_10002038 3300005981 Bacteria 20187
90 Ga0081538_10020895 3300005981 Bacteria 4802
91 Ga0081538_10069016 3300005981 Bacteria 1961
92 Ga0081540_1000128 3300005983 Bacteria 80512
93 Ga0081540_1000922 3300005983 Bacteria 26453
94 Ga0081540_1014099 3300005983 Bacteria 5145
95 Ga0081540_1047300 3300005983 Bacteria 2164
96 Ga0081539_10002027 3300005985 Bacteria 30522
97 Ga0081539_10037424 3300005985 Bacteria 2891
98 Ga0081539_10194043 3300005985 Bacteria 943
99 Ga0070717_10016903 3300006028 Bacteria 5664
100 Ga0070717_10036056 3300006028 Bacteria 4009
101 Ga0070717_10240965 3300006028 Bacteria 1595
102 Ga0070717_10483827 3300006028 Bacteria 1118
103 Ga0075365_10007739 3300006038 Bacteria 6048
104 Ga0075365_10017704 3300006038 Bacteria 4366
105 Ga0075365_10113997 3300006038 Bacteria 1860
106 Ga0075363_100002772 3300006048 Bacteria 7268
107 Ga0075363_100072469 3300006048 Bacteria 1873
108 Ga0075363_100161548 3300006048 Bacteria 1269
109 Ga0075364_10444775 3300006051 Bacteria 885
110 Ga0075432_10116034 3300006058 Bacteria 1002
111 Ga0070715_10005149 3300006163 Bacteria 4343
112 Ga0070715_10044669 3300006163 Bacteria 1874
113 Ga0070716_100010344 3300006173 Bacteria 4674
114 Ga0070716_100467196 3300006173 Bacteria 923
115 Ga0070712_100116272 3300006175 Bacteria 2006
116 Ga0070712_100222991 3300006175 Bacteria 1493
117 Ga0070712_100451138 3300006175 Bacteria 1071
118 Ga0075362_10117100 3300006177 Bacteria 1258
119 Ga0075362_10150570 3300006177 Bacteria 1116
120 Ga0075367_10092180 3300006178 Bacteria 1844
121 Ga0075369_10028769 3300006186 Bacteria 2331
122 Ga0075369_10079845 3300006186 Bacteria 1450
123 Ga0075366_10032042 3300006195 Bacteria 3094
124 Ga0075366_10048225 3300006195 Bacteria 2525
125 Ga0075366_10064159 3300006195 Bacteria 2184
126 Ga0075366_10110469 3300006195 Bacteria 1653
127 Ga0097621_100652065 3300006237 Bacteria 966
128 Ga0075428_100146579 3300006844 Bacteria 2565
129 Ga0075428_100151669 3300006844 Bacteria 2518
130 Ga0075428_100218274 3300006844 Bacteria 2060
131 Ga0075428_100353996 3300006844 Bacteria 1576
132 Ga0075428_100421721 3300006844 Bacteria 1430
133 Ga0075428_100438038 3300006844 Bacteria 1400
134 Ga0075430_100000067 3300006846 Bacteria 56477
135 Ga0075430_100002682 3300006846 Bacteria 14859
136 Ga0075430_100017047 3300006846 Bacteria 6188
137 Ga0075430_100104856 3300006846 Bacteria 2360
138 Ga0075430_100112465 3300006846 Bacteria 2270
139 Ga0075431_100000003 3300006847 Bacteria 112884
140 Ga0075431_100124713 3300006847 Bacteria 2657
141 Ga0075431_100181750 3300006847 Bacteria 2158
142 Ga0075431_100186987 3300006847 Bacteria 2124
143 Ga0075431_100247828 3300006847 Bacteria 1810
144 Ga0075433_10014525 3300006852 Bacteria 6438
145 Ga0075433_10031250 3300006852 Bacteria 4551
146 Ga0075434_100003124 3300006871 Bacteria 14755
147 Ga0075434_100020197 3300006871 Bacteria 6455
148 Ga0075434_100034653 3300006871 Bacteria 4987
149 Ga0075434_100138122 3300006871 Bacteria 2457
150 Ga0075434_100208075 3300006871 Bacteria 1977
151 Ga0075434_100236467 3300006871 Bacteria 1847
152 Ga0075434_100521189 3300006871 Bacteria 1209
153 Ga0075434_101010754 3300006871 Bacteria 845
154 Ga0075429_100000288 3300006880 Bacteria 35542
155 Ga0075429_100045647 3300006880 Bacteria 3812
156 Ga0075429_100250062 3300006880 Bacteria 1552
157 Ga0075429_100267850 3300006880 Bacteria 1496
158 Ga0068865_100062764 3300006881 Bacteria 2609
159 Ga0068865_100074714 3300006881 Bacteria 2415
160 Ga0075436_100010935 3300006914 Bacteria 6229
161 Ga0075436_100109432 3300006914 Bacteria 1928
162 Ga0097620_100044882 3300006931 Bacteria 4441
163 Ga0097620_100804072 3300006931 Bacteria 1028
164 Ga0075435_100187081 3300007076 Bacteria 1752
165 Ga0075435_100190124 3300007076 Bacteria 1738
166 Ga0075435_100385789 3300007076 Bacteria 1204
167 Ga0099794_10018981 3300007265 Bacteria 3091
168 Ga0099795_10030011 3300007788 Bacteria 1863
169 Ga0099795_10078185 3300007788 Bacteria 1261
170 Ga0111539_10000753 3300009094 Bacteria 42119
171 Ga0111539_10008081 3300009094 Bacteria 13410
172 Ga0111539_10205729 3300009094 Bacteria 2294
173 Ga0111539_10217739 3300009094 Bacteria 2224
174 Ga0111539_10438547 3300009094 Bacteria 1521
175 Ga0105245_10180925 3300009098 Bacteria 2014
176 Ga0105245_10396357 3300009098 Bacteria 1378
177 Ga0114129_10000104 3300009147 Bacteria 83195
178 Ga0114129_10009491 3300009147 Bacteria 13873
179 Ga0114129_10012500 3300009147 Bacteria 12087
180 Ga0114129_10034990 3300009147 Bacteria 7095
181 Ga0114129_10339881 3300009147 Bacteria 1991
182 Ga0114129_10355109 3300009147 Bacteria 1941
183 Ga0114129_10719070 3300009147 Bacteria 1282
184 Ga0114129_10800854 3300009147 Bacteria 1202
185 Ga0105243_10124820 3300009148 Bacteria 2176
186 Ga0105243_10301494 3300009148 Bacteria 1452
187 Ga0105243_10425642 3300009148 Bacteria 1239
188 Ga0105242_10261222 3300009176 Bacteria 1564
189 Ga0105248_10011816 3300009177 Bacteria 9631
190 Ga0105248_10273483 3300009177 Bacteria 1902
191 Ga0105238_10079541 3300009551 Bacteria 3268
192 Ga0105249_10422349 3300009553 Bacteria 1367
193 Ga0105249_10700876 3300009553 Bacteria 1073
194 Ga0099796_10008664 3300010159 Bacteria 2718
195 Ga0099796_10011549 3300010159 Bacteria 2467
196 Ga0105239_10125876 3300010375 Bacteria 2848
197 Ga0105239_10619579 3300010375 Bacteria 1235
198 Ga0105246_10107510 3300011119 Bacteria 2043
199 Ga0105246_10184605 3300011119 Bacteria 1609
200 Ga0105246_10306643 3300011119 Bacteria 1284
201 Ga0157374_10193688 3300013296 Bacteria 1989
202 Ga0157378_10228098 3300013297 Bacteria 1773
203 Ga0157378_10433098 3300013297 Bacteria 1302
204 Ga0157378_10831962 3300013297 Bacteria 950
205 Ga0163162_10354808 3300013306 Unclassified 1599
206 Ga0163162_11339820 3300013306 Bacteria 814
207 Ga0157372_10473240 3300013307 Bacteria 1460
208 Ga0157372_10781068 3300013307 Bacteria 1110
209 Ga0157375_10456600 3300013308 Bacteria 1443
210 Ga0157375_10507594 3300013308 Bacteria 1370
211 Ga0157375_10617338 3300013308 Bacteria 1242
212 Ga0157375_11085451 3300013308 Bacteria 936
213 Ga0163163_10240202 3300014325 Bacteria 1861
214 Ga0157380_10332632 3300014326 Bacteria 1413
215 Ga0157380_10420840 3300014326 Bacteria 1274
216 Ga0157377_10047889 3300014745 Bacteria 2396
217 Ga0157377_10269812 3300014745 Bacteria 1111
218 Ga0157379_10108513 3300014968 Bacteria 2492
219 Ga0157379_10288256 3300014968 Bacteria 1495
220 Ga0157376_10224125 3300014969 Bacteria 1743
221 Ga0157376_10920891 3300014969 Bacteria 893
222 Ga0163161_10137134 3300017792 Bacteria 1850
223 Ga0213876_10026242 3300021384 Bacteria 3073
224 Ga0213875_10000040 3300021388 Bacteria 156362
225 Ga0209233_1032547 3300025261 Bacteria 1204
226 Ga0209758_1000772 3300025297 Bacteria 45993
227 Ga0209758_1072316 3300025297 Bacteria 1079
228 Ga0207656_10021259 3300025321 Bacteria 2591
229 Ga0207653_10004559 3300025885 Bacteria 4343
230 Ga0207682_10006602 3300025893 Bacteria 4667
231 Ga0207692_10247175 3300025898 Bacteria 1068
232 Ga0207692_10259191 3300025898 Bacteria 1045
233 Ga0207642_10014594 3300025899 Bacteria 2903
234 Ga0207710_10023264 3300025900 Bacteria 2663
235 Ga0207688_10001688 3300025901 Bacteria 11694
236 Ga0207647_10016309 3300025904 Bacteria 5073
237 Ga0207647_10107971 3300025904 Bacteria 1647
238 Ga0207685_10028604 3300025905 Bacteria 1965
239 Ga0207685_10177582 3300025905 Bacteria 985
240 Ga0207699_10039458 3300025906 Bacteria 2713
241 Ga0207699_10171291 3300025906 Bacteria 1452
242 Ga0207645_10023211 3300025907 Bacteria 4031
243 Ga0207643_10005230 3300025908 Bacteria 6940
244 Ga0207643_10118737 3300025908 Bacteria 1564
245 Ga0207684_10114815 3300025910 Bacteria 2306
246 Ga0207654_10012606 3300025911 Bacteria 4334
247 Ga0207654_10194017 3300025911 Bacteria 1333
248 Ga0207707_10082390 3300025912 Bacteria 2809
249 Ga0207707_10359853 3300025912 Bacteria 1253
250 Ga0207695_10419652 3300025913 Bacteria 1222
251 Ga0207693_10024520 3300025915 Bacteria 4785
252 Ga0207693_10091980 3300025915 Bacteria 2378
253 Ga0207693_10357759 3300025915 Bacteria 1142
254 Ga0207693_10489514 3300025915 Bacteria 960
255 Ga0207663_10072276 3300025916 Bacteria 2229
256 Ga0207663_10154499 3300025916 Bacteria 1613
257 Ga0207663_10249185 3300025916 Bacteria 1306
258 Ga0207662_10015482 3300025918 Bacteria 4291
259 Ga0207662_10058968 3300025918 Bacteria 2299
260 Ga0207657_10053343 3300025919 Bacteria 3503
261 Ga0207657_10459204 3300025919 Bacteria 999
262 Ga0207649_10196138 3300025920 Bacteria 1423
263 Ga0207649_10510932 3300025920 Bacteria 915
264 Ga0207652_10137924 3300025921 Bacteria 2179
265 Ga0207681_10063327 3300025923 Bacteria 2550
266 Ga0207681_10153997 3300025923 Bacteria 1726
267 Ga0207681_10225105 3300025923 Bacteria 1453
268 Ga0207694_10065655 3300025924 Bacteria 2829
269 Ga0207694_10859542 3300025924 Bacteria 767
270 Ga0207650_10001375 3300025925 Bacteria 17538
271 Ga0207650_10102203 3300025925 Bacteria 2208
272 Ga0207659_10102646 3300025926 Bacteria 2159
273 Ga0207687_10127230 3300025927 Bacteria 1915
274 Ga0207687_10156151 3300025927 Bacteria 1746
275 Ga0207687_10579154 3300025927 Bacteria 944
276 Ga0207700_10286292 3300025928 Bacteria 1419
277 Ga0207700_10372447 3300025928 Bacteria 1247
278 Ga0207664_10021536 3300025929 Bacteria 4796
279 Ga0207664_10129219 3300025929 Bacteria 2125
280 Ga0207644_10090227 3300025931 Bacteria 2283
281 Ga0207644_10342592 3300025931 Bacteria 1212
282 Ga0207706_10001850 3300025933 Bacteria 20737
283 Ga0207706_10081581 3300025933 Bacteria 2842
284 Ga0207706_10211951 3300025933 Bacteria 1698
285 Ga0207706_10246977 3300025933 Bacteria 1559
286 Ga0207709_10056635 3300025935 Bacteria 2427
287 Ga0207669_10020906 3300025937 Bacteria 3442
288 Ga0207669_10113152 3300025937 Bacteria 1824
289 Ga0207669_10114182 3300025937 Bacteria 1817
290 Ga0207704_10105374 3300025938 Bacteria 1891
291 Ga0207665_10003686 3300025939 Bacteria 10230
292 Ga0207665_10013404 3300025939 Bacteria 5390
293 Ga0207665_10337399 3300025939 Bacteria 1135
294 Ga0207665_10493146 3300025939 Bacteria 945
295 Ga0207691_10001076 3300025940 Bacteria 27185
296 Ga0207691_10071075 3300025940 Bacteria 3142
297 Ga0207691_10139739 3300025940 Bacteria 2135
298 Ga0207689_10020535 3300025942 Bacteria 5557
299 Ga0207689_10342058 3300025942 Bacteria 1243
300 Ga0207679_10228012 3300025945 Bacteria 1571
301 Ga0207651_10120639 3300025960 Bacteria 1988
302 Ga0207651_10273542 3300025960 Bacteria 1392
303 Ga0207712_10555092 3300025961 Bacteria 988
304 Ga0207712_10651372 3300025961 Bacteria 915
305 Ga0207658_10224919 3300025986 Bacteria 1581
306 Ga0207678_10010390 3300026067 Bacteria 8173
307 Ga0207678_10177113 3300026067 Bacteria 1821
308 Ga0207708_10034492 3300026075 Bacteria 3848
309 Ga0207702_10534559 3300026078 Bacteria 1145
310 Ga0207648_10264802 3300026089 Bacteria 1534
311 Ga0207648_10331332 3300026089 Bacteria 1369
312 Ga0207676_10008313 3300026095 Bacteria 7376
313 Ga0207676_10042344 3300026095 Bacteria 3502
314 Ga0207676_10116011 3300026095 Bacteria 2249
315 Ga0207674_10056816 3300026116 Bacteria 3971
316 Ga0207674_10063716 3300026116 Bacteria 3720
317 Ga0207675_100082953 3300026118 Bacteria 3006
318 Ga0207675_100323138 3300026118 Bacteria 1507
319 Ga0207675_100806521 3300026118 Bacteria 952
320 Ga0207683_10007038 3300026121 Bacteria 9645
321 Ga0207683_10016714 3300026121 Bacteria 6244
322 Ga0207698_10213682 3300026142 Bacteria 1737
323 Ga0207698_10391670 3300026142 Bacteria 1325
324 Ga0209179_1002880 3300027512 Bacteria 2400
325 Ga0207428_10000831 3300027907 Bacteria 34817
326 Ga0207428_10132182 3300027907 Bacteria 1909
327 Ga0207428_10237183 3300027907 Bacteria 1363
328 Ga0207428_10332694 3300027907 Bacteria 1120
329 Ga0207428_10384791 3300027907 Bacteria 1029
330 Ga0268264_10575093 3300028381 Bacteria 1108
331 Ga0307515_10199783 3300028794 Bacteria 1879
332 Ga0265338_10007515 3300028800 Bacteria 13487
333 Ga0265760_10019565 3300031090 Bacteria 1951
334 Ga0265332_10009877 3300031238 Bacteria 4253
335 Ga0265325_10000305 3300031241 Bacteria 34555
336 Ga0265325_10065751 3300031241 Bacteria 1830
337 Ga0265325_10072198 3300031241 Bacteria 1730
338 Ga0265329_10007626 3300031242 Bacteria 4168
339 Ga0265340_10027879 3300031247 Bacteria 2844
340 Ga0265340_10051008 3300031247 Bacteria 2005
341 Ga0265340_10053364 3300031247 Bacteria 1952
342 Ga0265340_10067785 3300031247 Bacteria 1696
343 Ga0265339_10000016 3300031249 Bacteria 185313
344 Ga0265339_10036835 3300031249 Bacteria 2735
345 Ga0265339_10116781 3300031249 Bacteria 1375
346 Ga0265331_10040198 3300031250 Bacteria 2276
347 Ga0265316_10063083 3300031344 Bacteria 2875
348 Ga0265316_10129880 3300031344 Bacteria 1898
349 Ga0265316_10176046 3300031344 Bacteria 1594
350 Ga0265313_10000060 3300031595 Bacteria 107224
351 Ga0265313_10062066 3300031595 Bacteria 1746
352 Ga0265314_10186869 3300031711 Bacteria 1236
353 Ga0265342_10024831 3300031712 Bacteria 3778
354 Ga0265342_10185734 3300031712 Bacteria 1136
355 Ga0265342_10198040 3300031712 Bacteria 1093
356 Ga0373938_0052969 3300034957 Bacteria 931
357 Ga0373926_0159624 3300035083 Bacteria 860
358 Ga0373929_0002536 3300035085 Bacteria 3356
359 Ga0373951_0021480 3300035091 Unclassified 1483
360 Ga0373952_0024649 3300035092 Bacteria 1294
361 Ga0373952_0039412 3300035092 Bacteria 1086
362 Ga0373945_0002025 3300035116 Bacteria 6302
363 Ga0373945_0108418 3300035116 Bacteria 1093
364 Ga0373953_0178149 3300035117 Bacteria 916
365 Ga0373954_0000496 3300035118 Bacteria 14775
366 Ga0373954_0022672 3300035118 Bacteria 2851
367 Ga0373954_0428376 3300035118 Bacteria 655
368 Ga0373957_0002404 3300035120 Bacteria 5333
369 Ga0373960_0010722 3300035121 Unclassified 2245
370 Ga0373943_0001174 3300035170 Bacteria 11694
371 Ga0373943_0009357 3300035170 Bacteria 4392
372 Ga0373943_0335117 3300035170 Bacteria 865
373 Ga0373946_0000733 3300035171 Bacteria 11130
374 Ga0373946_0051880 3300035171 Unclassified 1718
375 Ga0373946_0131802 3300035171 Bacteria 1150
376 Ga0373946_0196316 3300035171 Bacteria 965
377 Ga0373955_0062369 3300035172 Bacteria 2061
378 Ga0373961_0011313 3300035241 Bacteria 2212
379 Ga0373962_0031845 3300035242 Bacteria 1448
380 Ga0373962_0033586 3300035242 Bacteria 1417
381 Ga0373924_0000869 3300035410 Bacteria 9505
382 Ga0373931_0004738 3300035691 Bacteria 6233
383 Ga0373931_0015862 3300035691 Bacteria 3699
384 Ga0373931_0087615 3300035691 Bacteria 1729
385 Ga0373931_0155316 3300035691 Bacteria 1337
386 Ga0373935_0001176 3300035692 Bacteria 14365
387 Ga0373935_0048628 3300035692 Bacteria 2686
388 Ga0373935_0451215 3300035692 Bacteria 929
389 Ga0373935_0517867 3300035692 Bacteria 867
390 Ga0373927_0001072 3300035695 Bacteria 20927
391 Ga0373927_0001966 3300035695 Bacteria 15156
392 Ga0373927_0246941 3300035695 Bacteria 1173
393 Ga0373933_0001354 3300035724 Bacteria 14445
394 Ga0373947_0001670 3300035725 Bacteria 13583
395 Ga0373947_0018359 3300035725 Bacteria 4025
396 Ga0373947_0321477 3300035725 Bacteria 1035
397 Ga0373937_0000356 3300036401 Bacteria 42503
398 Ga0373925_0000462 3300037068 Bacteria 40936
399 Ga0373925_0017857 3300037068 Bacteria 5148
400 Ga0373925_0268721 3300037068 Bacteria 1371
401 Ga0373925_0734668 3300037068 Bacteria 814
402 Ga0395898_0079427 3300037466 Bacteria 3165
403 Ga0395905_0324694 3300037471 Bacteria 1429
404 Ga0436364_0576120 3300037853 Bacteria 27783
405 Ga0436364_0650710 3300037853 Unclassified 614
406 Ga0436364_0836051 3300037853 Bacteria 1042
407 Ga0436364_1119204 3300037853 Bacteria 6980
408 Ga0436365_0542567 3300039437 Bacteria 776
409 Ga0436365_1115437 3300039437 Bacteria 905
410 Ga0436365_1298720 3300039437 Bacteria 3626
411 Ga0436360_0115274 3300039438 Bacteria 1214
412 Ga0436361_0476009 3300039447 Bacteria 18870
413 Ga0436363_0033945 3300039450 Unclassified 858
414 Ga0436363_1086374 3300039450 Unclassified 644
415 Ga0436363_1218092 3300039450 Bacteria 1540
416 Ga0436362_0779349 3300039453 Bacteria 1011
417 Ga0436362_1220292 3300039453 Bacteria 1197
418 Ga0436362_1278674 3300039453 Bacteria 845
419 Ga0451797_0849193 3300041453 Bacteria 850
420 Ga0451839_0860984 3300041496 Bacteria 851
421 Ga0451853_2233956 3300041512 Bacteria 2205
422 Ga0439443_009503 3300042003 Bacteria 1395
423 Ga0439460_0102492 3300042461 Bacteria 921
424 Ga0466968_0194990 3300044735 Bacteria 947
425 Ga0495592_0000090 3300046454 Bacteria 80171
426 Ga0495603_0117039 3300046455 Bacteria 1554
427 Ga0495590_0159123 3300046457 Bacteria 821
428 Ga0495591_049312 3300046458 Bacteria 1158
429 Ga0495629_0019883 3300046459 Bacteria 4792
430 Ga0495629_0042536 3300046459 Bacteria 3192
431 Ga0495638_0034007 3300046460 Bacteria 3256
432 Ga0495641_0013506 3300046461 Bacteria 4481
433 Ga0495651_0000682 3300046462 Bacteria 26412
434 Ga0495653_0000322 3300046463 Bacteria 38965
435 Ga0495653_0299130 3300046463 Bacteria 1050
436 Ga0495582_0065403 3300046473 Bacteria 2009
437 Ga0495582_0125793 3300046473 Bacteria 1446
438 Ga0495662_0022104 3300046476 Bacteria 3074
439 Ga0495662_0304774 3300046476 Bacteria 783
440 Ga0495664_0000078 3300046477 Bacteria 47377
441 Ga0495584_0021084 3300046491 Bacteria 3309
442 Ga0495584_0104900 3300046491 Bacteria 1429
443 Ga0495584_0245827 3300046491 Bacteria 910
444 Ga0495585_0214711 3300046492 Bacteria 973
445 Ga0495594_0190880 3300046499 Bacteria 1167
446 Ga0495596_0121100 3300046500 Bacteria 1016
447 Ga0495608_0000022 3300046511 Bacteria 165111
448 Ga0495616_0068741 3300046513 Bacteria 1719
449 Ga0495618_0000229 3300046514 Bacteria 40948
450 Ga0495618_0114975 3300046514 Bacteria 1723
451 Ga0495618_0202453 3300046514 Bacteria 1256
452 Ga0495628_0000035 3300046516 Bacteria 111560
453 Ga0495628_0220125 3300046516 Bacteria 1426
454 Ga0495630_0000377 3300046517 Bacteria 35153
455 Ga0495630_0077980 3300046517 Bacteria 2498
456 Ga0495644_0031325 3300046523 Bacteria 2009
457 Ga0495663_0013480 3300046525 Bacteria 2286
458 Ga0495666_0078784 3300046526 Bacteria 1560
459 Ga0495652_0000062 3300046529 Bacteria 111572
460 Ga0495652_0165067 3300046529 Bacteria 1715
461 Ga0495665_0065518 3300046531 Bacteria 1918
462 Ga0495640_0000021 3300046533 Bacteria 110511
463 Ga0495640_0150748 3300046533 Bacteria 1494
464 Ga0495587_0000006 3300046536 Bacteria 310070
465 Ga0495598_0000955 3300046537 Bacteria 5575
466 Ga0495598_0028650 3300046537 Bacteria 1546
467 Ga0495621_0056375 3300046539 Bacteria 1417
468 Ga0495645_0000174 3300046543 Bacteria 44827
469 Ga0495667_0000161 3300046559 Bacteria 45781
470 Ga0495667_0168868 3300046559 Bacteria 1406
471 Ga0495656_0066295 3300046615 Bacteria 1590
472 Ga0495634_0000350 3300046642 Bacteria 44772
473 Ga0495634_0107379 3300046642 Bacteria 1798
474 Ga0495634_0364182 3300046642 Bacteria 864
475 Ga0495635_0000018 3300046663 Bacteria 193591
476 Ga0495635_0099459 3300046663 Bacteria 1988
477 Ga0495659_0036047 3300046664 Bacteria 1746
478 Ga0495588_0035374 3300046674 Bacteria 2531
479 Ga0495657_0000245 3300046675 Bacteria 49381
480 Ga0495657_0172814 3300046675 Bacteria 1330
481 Ga0495599_0000032 3300046678 Bacteria 108178
482 Ga0495623_0000004 3300046679 Bacteria 142249
483 Ga0495646_0000083 3300046680 Bacteria 45193
484 Ga0495658_0089708 3300046683 Bacteria 1818
485 Ga0495613_0019217 3300046689 Bacteria 5094
486 Ga0495613_0120552 3300046689 Bacteria 1884
487 Ga0495624_0023352 3300046690 Bacteria 4079
488 Ga0495624_0053886 3300046690 Bacteria 2538
489 Ga0495670_0233051 3300046691 Bacteria 979
490 Ga0495589_0262103 3300046794 Bacteria 806
491 Ga0495600_0000022 3300046809 Bacteria 94789
492 Ga0495581_0009463 3300047315 Bacteria 5639
493 Ga0495581_0106586 3300047315 Bacteria 1629
494 Ga0495604_0000011 3300047317 Bacteria 292024
495 Ga0495604_0185276 3300047317 Bacteria 1454
496 Ga0495674_0000034 3300047319 Bacteria 110674
497 Ga0495674_0126910 3300047319 Bacteria 2152
498 Ga0495672_0180051 3300047320 Bacteria 1071
499 Ga0495676_0066113 3300047321 Bacteria 2803
500 Ga0495680_0000290 3300047322 Bacteria 56506
501 Ga0495680_0058556 3300047322 Bacteria 2977
502 Ga0495680_0130101 3300047322 Bacteria 1851
503 Ga0495675_0000352 3300047444 Bacteria 32304
504 Ga0495673_0130301 3300047469 Bacteria 989
505 Ga0495684_0000012 3300047471 Bacteria 187118
506 Ga0495593_0049677 3300047673 Bacteria 2225
507 Ga0495602_0000064 3300048088 Bacteria 104858
508 Ga0495602_0292304 3300048088 Bacteria 1196
509 Ga0495626_0187001 3300048091 Bacteria 856
510 Ga0496100_0009210 3300048903 Bacteria 5541
511 Ga0496100_0011779 3300048903 Bacteria 4990
512 Ga0496100_0448805 3300048903 Bacteria 988
513 Ga0496100_0467424 3300048903 Bacteria 969
514 Ga0496101_0039158 3300048904 Bacteria 3369
515 Ga0496101_0040262 3300048904 Bacteria 3328
516 Ga0496101_0401613 3300048904 Bacteria 1079
517 Ga0496102_0199888 3300048905 Bacteria 1884
518 Ga0496102_0258248 3300048905 Bacteria 1643
519 Ga0496103_0122152 3300048906 Bacteria 1659
520 Ga0496103_0143742 3300048906 Bacteria 1526
521 Ga0496104_0002163 3300048907 Bacteria 17059
522 Ga0496104_0002570 3300048907 Bacteria 15649
523 Ga0496104_0013104 3300048907 Bacteria 7471
524 Ga0496104_0024333 3300048907 Bacteria 5570
525 Ga0496104_0061109 3300048907 Bacteria 3571
526 Ga0496104_0101322 3300048907 Bacteria 2757
527 Ga0496105_0000754 3300048908 Bacteria 21960
528 Ga0496105_0007674 3300048908 Bacteria 8365
529 Ga0496105_0023000 3300048908 Bacteria 5053
530 Ga0496105_0298549 3300048908 Bacteria 1295
531 Ga0496105_0581813 3300048908 Bacteria 871
532 Ga0496106_0004480 3300048909 Bacteria 10359
533 Ga0496106_0059449 3300048909 Bacteria 2895
534 Ga0496106_0072715 3300048909 Bacteria 2630
535 Ga0496106_0203212 3300048909 Bacteria 1577
536 Ga0496106_0220224 3300048909 Unclassified 1514
537 Ga0496106_0427406 3300048909 Bacteria 1064
538 Ga0496107_0003453 3300048910 Bacteria 10559
539 Ga0496107_0133240 3300048910 Bacteria 1835
540 Ga0496107_0254466 3300048910 Bacteria 1307
541 Ga0496107_0555209 3300048910 Bacteria 850
542 Ga0496108_0002431 3300048911 Bacteria 14887
543 Ga0496108_0008557 3300048911 Bacteria 8298
544 Ga0496108_0014148 3300048911 Bacteria 6510
545 Ga0496108_0043119 3300048911 Bacteria 3768
546 Ga0496108_0069671 3300048911 Bacteria 2968
547 Ga0496108_0084505 3300048911 Bacteria 2693
548 Ga0496108_0249800 3300048911 Bacteria 1543
549 Ga0496108_0263465 3300048911 Bacteria 1500
550 Ga0496109_0001755 3300048912 Bacteria 18034
551 Ga0496109_0003909 3300048912 Bacteria 12447
552 Ga0496109_0006920 3300048912 Bacteria 9568
553 Ga0496109_0267654 3300048912 Bacteria 1610
554 Ga0496109_0455999 3300048912 Bacteria 1207
555 Ga0496110_0004771 3300048913 Bacteria 10562
556 Ga0496110_0008732 3300048913 Bacteria 8160
557 Ga0496110_0020230 3300048913 Bacteria 5617
558 Ga0496110_0033299 3300048913 Bacteria 4456
559 Ga0496110_0066301 3300048913 Bacteria 3193
560 Ga0496110_0222011 3300048913 Bacteria 1718
561 Ga0496110_0760257 3300048913 Bacteria 872
562 Ga0496111_0005128 3300048914 Bacteria 8346
563 Ga0496111_0014585 3300048914 Bacteria 5373
564 Ga0496111_0218939 3300048914 Bacteria 1414
565 Ga0496112_0010960 3300048915 Bacteria 8255
566 Ga0496112_0083030 3300048915 Bacteria 3168
567 Ga0496112_0702092 3300048915 Bacteria 939
568 Ga0496113_0006080 3300048916 Bacteria 7609
569 Ga0496113_0009343 3300048916 Bacteria 6429
570 Ga0496113_0053663 3300048916 Bacteria 3014
571 Ga0496113_0153826 3300048916 Bacteria 1815
572 Ga0496113_0168384 3300048916 Bacteria 1734
573 Ga0496114_0010617 3300048917 Bacteria 7326
574 Ga0496114_0071160 3300048917 Bacteria 2922
575 Ga0496114_0124524 3300048917 Unclassified 2220
576 Ga0496114_0287259 3300048917 Bacteria 1451
577 Ga0496114_0440542 3300048917 Bacteria 1154
578 Ga0496114_0856538 3300048917 Bacteria 789
579 Ga0496115_0007503 3300048918 Bacteria 8029
580 Ga0496115_0054889 3300048918 Bacteria 3199
581 Ga0496115_0056335 3300048918 Bacteria 3159
582 Ga0496115_0437813 3300048918 Bacteria 1057
583 Ga0501031_0030376 3300049568 Bacteria 3524
584 Ga0501032_0008464 3300049569 Bacteria 7499
585 Ga0501032_0014720 3300049569 Bacteria 5535
586 Ga0501032_0165386 3300049569 Bacteria 1451
587 Ga0501032_0211099 3300049569 Bacteria 1265
588 Ga0501033_0014185 3300049570 Bacteria 6057
589 Ga0501033_0074493 3300049570 Bacteria 2492
590 Ga0501033_0218418 3300049570 Bacteria 1357
591 Ga0501034_0000979 3300049571 Bacteria 41076
592 Ga0501034_0088424 3300049571 Bacteria 3096
593 Ga0501034_0138450 3300049571 Bacteria 2414
594 Ga0501034_0181312 3300049571 Bacteria 2071
595 Ga0501034_0311500 3300049571 Bacteria 1508
596 Ga0501034_0442377 3300049571 Bacteria 1218
597 Ga0501036_0000602 3300049572 Bacteria 26088
598 Ga0501036_0022070 3300049572 Bacteria 5354
599 Ga0501036_0127546 3300049572 Bacteria 2148
600 Ga0501036_0263856 3300049572 Bacteria 1442
601 Ga0501036_0433618 3300049572 Unclassified 1095
602 Ga0501036_0493998 3300049572 Bacteria 1018
603 Ga0501036_0664760 3300049572 Bacteria 862
604 Ga0501037_0008058 3300049573 Bacteria 7719
605 Ga0501037_0011444 3300049573 Bacteria 6530
606 Ga0501037_0021830 3300049573 Bacteria 4738
607 Ga0501037_0041725 3300049573 Bacteria 3373
608 Ga0501037_0046672 3300049573 Bacteria 3176
609 Ga0501037_0162717 3300049573 Bacteria 1590
610 Ga0501038_0123832 3300049574 Bacteria 2129
611 Ga0501038_0174553 3300049574 Bacteria 1737
612 Ga0501038_0348580 3300049574 Bacteria 1153
613 Ga0501039_0042925 3300049575 Bacteria 3493
614 Ga0501039_0152064 3300049575 Bacteria 1818
615 Ga0501039_0162449 3300049575 Bacteria 1756
616 Ga0501040_0094732 3300049576 Bacteria 2078
617 Ga0501042_0418793 3300049578 Bacteria 971
618 Ga0501043_0009053 3300049579 Bacteria 7834
619 Ga0501043_0014570 3300049579 Bacteria 6156
620 Ga0501043_0114278 3300049579 Bacteria 2119
621 Ga0501043_0140356 3300049579 Bacteria 1892
622 Ga0501046_0016349 3300049580 Bacteria 6217
623 Ga0501046_0025489 3300049580 Bacteria 4839
624 Ga0501046_0142669 3300049580 Bacteria 1811
625 Ga0501047_0000104 3300049581 Bacteria 102971
626 Ga0501047_0023793 3300049581 Bacteria 5881
627 Ga0501047_0026153 3300049581 Bacteria 5614
628 Ga0501047_0131581 3300049581 Bacteria 2382
629 Ga0501047_0200293 3300049581 Bacteria 1858
630 Ga0501047_0294041 3300049581 Bacteria 1467
631 Ga0501048_0000272 3300049582 Bacteria 34674
632 Ga0501048_0337222 3300049582 Bacteria 1075
633 Ga0501048_0445649 3300049582 Bacteria 927
634 Ga0501048_0509037 3300049582 Bacteria 863
635 Ga0501067_0351798 3300049583 Bacteria 821
636 Ga0501068_0010259 3300049584 Bacteria 5258
637 Ga0501068_0189666 3300049584 Bacteria 1301
638 Ga0501068_0189667 3300049584 Bacteria 1301
639 Ga0501069_0028225 3300049585 Bacteria 3076
640 Ga0501069_0073108 3300049585 Bacteria 1922
641 Ga0501069_0255491 3300049585 Bacteria 1023
642 Ga0501070_0010785 3300049586 Bacteria 7719
643 Ga0501070_0176167 3300049586 Bacteria 1760
644 Ga0501070_0327001 3300049586 Bacteria 1246
645 Ga0501071_0156163 3300049587 Bacteria 1703
646 Ga0501071_0390721 3300049587 Bacteria 1061
647 Ga0501072_0000464 3300049588 Bacteria 29314
648 Ga0501072_0470749 3300049588 Bacteria 995
649 Ga0501073_0010741 3300049589 Bacteria 6705
650 Ga0501073_0134637 3300049589 Bacteria 1712
651 Ga0501074_0008255 3300049590 Bacteria 7549
652 Ga0501074_0060609 3300049590 Bacteria 2726
653 Ga0501074_0253083 3300049590 Bacteria 1252
654 Ga0501075_0209044 3300049591 Bacteria 1489
655 Ga0501075_0300528 3300049591 Bacteria 1223
656 Ga0501077_0101926 3300049593 Unclassified 1819
657 Ga0501077_0190507 3300049593 Bacteria 1303
658 Ga0501079_0053376 3300049741 Bacteria 3118
659 Ga0501079_0054215 3300049741 Bacteria 3092
660 Ga0501080_0003091 3300049742 Bacteria 14701
661 Ga0501080_0113970 3300049742 Bacteria 2506
662 Ga0501080_0127248 3300049742 Bacteria 2359
663 Ga0501080_0136624 3300049742 Bacteria 2268
664 Ga0501080_0424907 3300049742 Bacteria 1193
665 Ga0501080_0475296 3300049742 Bacteria 1119
666 Ga0501080_0695372 3300049742 Bacteria 897
667 Ga0501081_0067775 3300049743 Bacteria 2484
668 Ga0501081_0131332 3300049743 Bacteria 1789
669 Ga0501083_0000790 3300049744 Bacteria 20771
670 Ga0501083_0100005 3300049744 Bacteria 1913
671 Ga0501083_0125833 3300049744 Bacteria 1680
672 Ga0501083_0177222 3300049744 Bacteria 1392
673 Ga0501035_0071563 3300049822 Bacteria 3070
674 Ga0501035_0186822 3300049822 Bacteria 1783
675 Ga0501035_0192974 3300049822 Bacteria 1750
676 Ga0501035_0448516 3300049822 Bacteria 1067
677 Ga0501044_0027461 3300049823 Bacteria 6015
678 Ga0501044_0097117 3300049823 Bacteria 2967
679 Ga0501044_0099131 3300049823 Bacteria 2932
680 Ga0501044_0134419 3300049823 Bacteria 2465
681 Ga0501044_0136833 3300049823 Bacteria 2440
682 Ga0501044_0264771 3300049823 Bacteria 1656
683 Ga0501044_0783064 3300049823 Bacteria 834
684 nmdc:mga03683_123325_c1 3300050489 Bacteria 1154
685 nmdc:mga03683_136925_c1 3300050489 Bacteria 1099
686 nmdc:mga03683_31263_c1 3300050489 Bacteria 2134
687 nmdc:mga03683_34198_c1 3300050489 Bacteria 2055
688 nmdc:mga00v17_458157_c1 3300050491 Bacteria 828
689 nmdc:mga00v17_94127_c1 3300050491 Bacteria 1885
690 nmdc:mga0yw44_101091_c1 3300050492 Bacteria 1837
691 nmdc:mga0yw44_222635_c1 3300050492 Bacteria 1251
692 nmdc:mga0yw44_8157_c1 3300050492 Bacteria 5203
693 nmdc:mga0k408_253592_c1 3300050493 Bacteria 1050
694 nmdc:mga0k408_29387_c1 3300050493 Bacteria 3128
695 nmdc:mga0k408_87025_c1 3300050493 Bacteria 1835
696 nmdc:mga06z11_144593_c1 3300050494 Bacteria 1347
697 nmdc:mga07m45_301207_c1 3300050496 Bacteria 932
698 nmdc:mga05p37_119443_c1 3300050507 Bacteria 3239
699 nmdc:mga05p37_215_c1 3300050507 Bacteria 57982
700 nmdc:mga05p37_290900_c1 3300050507 Bacteria 1945
701 nmdc:mga05p37_36829_c1 3300050507 Bacteria 6001
702 nmdc:mga05p37_391773_c1 3300050507 Bacteria 1624
703 nmdc:mga05p37_806399_c1 3300050507 Bacteria 1026
704 nmdc:mga09592_120760_c1 3300050508 Bacteria 2251
705 nmdc:mga09592_1263_c1 3300050508 Bacteria 20295
706 nmdc:mga09592_176532_c1 3300050508 Bacteria 1847
707 nmdc:mga09592_24176_c1 3300050508 Bacteria 5023
708 nmdc:mga09592_391256_c1 3300050508 Bacteria 1202
709 nmdc:mga0qj67_105410_c1 3300050509 Bacteria 2274
710 nmdc:mga0qj67_20772_c1 3300050509 Bacteria 5028
711 nmdc:mga0qj67_60_c1 3300050509 Bacteria 80228
712 nmdc:mga06r32_1551_c1 3300050510 Bacteria 20713
713 nmdc:mga06r32_356397_c1 3300050510 Bacteria 1447
714 nmdc:mga06r32_435952_c1 3300050510 Bacteria 1291
715 nmdc:mga06r32_458043_c1 3300050510 Bacteria 1255
716 nmdc:mga06r32_50889_c1 3300050510 Bacteria 3963
717 nmdc:mga08y16_176_c1 3300050511 Bacteria 56313
718 nmdc:mga08y16_182463_c1 3300050511 Bacteria 2179
719 nmdc:mga08y16_184567_c1 3300050511 Bacteria 2165
720 nmdc:mga08y16_286252_c1 3300050511 Bacteria 1699
721 nmdc:mga08y16_80682_c1 3300050511 Bacteria 3392
722 nmdc:mga0n895_135437_c1 3300050512 Bacteria 2490
723 nmdc:mga0n895_154043_c1 3300050512 Bacteria 2329
724 nmdc:mga0n895_242086_c1 3300050512 Bacteria 1831
725 nmdc:mga0n895_3017_c1 3300050512 Bacteria 13379
726 nmdc:mga0rr50_75345_c1 3300050513 Bacteria 2586
727 nmdc:mga0rr50_801525_c1 3300050513 Bacteria 804
728 nmdc:mga08x19_442937_c1 3300050514 Bacteria 914
729 nmdc:mga08x19_56376_c1 3300050514 Bacteria 2536
730 nmdc:mga08x19_88207_c1 3300050514 Bacteria 2044
731 nmdc:mga0a205_160467_c1 3300050515 Bacteria 2145
732 nmdc:mga0a205_192658_c1 3300050515 Bacteria 1930
733 nmdc:mga0a205_487532_c1 3300050515 Bacteria 1090
734 nmdc:mga0sz30_17764_c1 3300050516 Bacteria 2840
735 Ga0495601_0000015 3300053077 Bacteria 213851
736 Ga0495601_0080642 3300053077 Bacteria 2088
737 Ga0495601_0147092 3300053077 Bacteria 1538
738 Ga0495601_0277680 3300053077 Bacteria 1092
739 Ga0495612_0000096 3300053078 Bacteria 38017
740 Ga0495612_0031628 3300053078 Bacteria 2134
741 Ga0495612_0067179 3300053078 Bacteria 1491
742 Ga0495595_0000035 3300053084 Bacteria 79822
743 Ga0495619_0000044 3300053085 Bacteria 108581
744 Ga0495619_0070397 3300053085 Bacteria 2339
745 Ga0495619_0111295 3300053085 Bacteria 1871
746 Ga0495619_0202743 3300053085 Bacteria 1373
747 Ga0500641_0008847 3300053096 Bacteria 3606
748 Ga0500642_0011422 3300053130 Bacteria 3176
749 Ga0500642_0157575 3300053130 Bacteria 1065
750 Ga0500652_150017 3300053131 Bacteria 967
751 Ga0500616_0054906 3300053153 Bacteria 2085
752 Ga0500639_064076 3300053163 Bacteria 1889
753 Ga0501084_0062669 3300054114 Bacteria 3113
754 Ga0501084_0118190 3300054114 Bacteria 2229
755 Ga0501084_0801470 3300054114 Bacteria 793
756 Ga0501082_0001642 3300060353 Bacteria 19713
757 Ga0501082_0182800 3300060353 Bacteria 1824
758 Ga0501082_0569935 3300060353 Bacteria 990
759 Ga0501082_0628744 3300060353 Bacteria 939
760 Ga0530510_0064882 3300061734 Bacteria 2645
761 Ga0530510_0246686 3300061734 Bacteria 1330

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0650710 Ga0436364_0650710_13_582 183
2 3300039450 Ga0436363_1086374 Ga0436363_1086374_44_613 183
3 3300046514 Ga0495618_0202453 Ga0495618_0202453_658_1227 183
4 3300039437 Ga0436365_0542567 Ga0436365_0542567_37_612 190
5 3300037068 Ga0373925_0734668 Ga0373925_0734668_20_637 205
6 3300005981 Ga0081538_10069016 Ga0081538_100690162 206
7 3300006048 Ga0075363_100072469 Ga0075363_1000724693 206
8 3300006186 Ga0075369_10028769 Ga0075369_100287693 206
9 3300017792 Ga0163161_10137134 Ga0163161_101371342 207
10 3300025906 Ga0207699_10171291 Ga0207699_101712911 208
11 3300035118 Ga0373954_0428376 Ga0373954_0428376_11_640 209
12 3300005983 Ga0081540_1000128 Ga0081540_100012852 210
13 3300003215 JGI25153J46596_10009294 JGI25153J46596_100092941 213
14 3300006177 Ga0075362_10117100 Ga0075362_101171002 213
15 3300006195 Ga0075366_10032042 Ga0075366_100320422 213
16 3300025297 Ga0209758_1000772 Ga0209758_100077234 213
17 3300025924 Ga0207694_10859542 Ga0207694_108595421 213
18 3300046455 Ga0495603_0117039 Ga0495603_0117039_47_727 213
19 3300050493 nmdc:mga0k408_29387_c1 nmdc:mga0k408_29387_c1_1312_1995 213
20 3300050493 nmdc:mga0k408_87025_c1 nmdc:mga0k408_87025_c1_746_1459 213
21 3300053130 Ga0500642_0011422 Ga0500642_0011422_2188_2871 213
22 3300053131 Ga0500652_150017 Ga0500652_150017_219_920 213
23 3300053153 Ga0500616_0054906 Ga0500616_0054906_421_1104 213
24 3300060353 Ga0501082_0628744 Ga0501082_0628744_95_805 213
25 3300049742 Ga0501080_0475296 Ga0501080_0475296_133_780 214
26 3300005546 Ga0070696_100455035 Ga0070696_1004550352 215
27 3300061734 Ga0530510_0064882 Ga0530510_0064882_755_1441 215
28 3300006846 Ga0075430_100017047 Ga0075430_1000170472 216
29 3300006847 Ga0075431_100124713 Ga0075431_1001247133 216
30 3300006880 Ga0075429_100045647 Ga0075429_1000456473 216
31 3300031344 Ga0265316_10063083 Ga0265316_100630832 216
32 3300046516 Ga0495628_0220125 Ga0495628_0220125_493_1149 216
33 3300046615 Ga0495656_0066295 Ga0495656_0066295_672_1358 216
34 3300046664 Ga0495659_0036047 Ga0495659_0036047_203_889 216
35 3300050508 nmdc:mga09592_120760_c1 nmdc:mga09592_120760_c1_1468_2196 216
36 3300050509 nmdc:mga0qj67_20772_c1 nmdc:mga0qj67_20772_c1_3209_3895 216
37 3300050510 nmdc:mga06r32_50889_c1 nmdc:mga06r32_50889_c1_2111_2797 216
38 3300005937 Ga0081455_10021170 Ga0081455_100211705 218
39 3300048911 Ga0496108_0249800 Ga0496108_0249800_16_714 219
40 3300048905 Ga0496102_0199888 Ga0496102_0199888_921_1619 221
41 3300048907 Ga0496104_0002570 Ga0496104_0002570_7225_7923 221
42 3300048915 Ga0496112_0702092 Ga0496112_0702092_195_893 221
43 3300048918 Ga0496115_0007503 Ga0496115_0007503_1452_2150 221
44 3300028800 Ga0265338_10007515 Ga0265338_100075154 222
45 3300031249 Ga0265339_10000016 Ga0265339_10000016101 222
46 3300031595 Ga0265313_10000060 Ga0265313_1000006038 222
47 3300031712 Ga0265342_10198040 Ga0265342_101980402 222
48 3300049568 Ga0501031_0030376 Ga0501031_0030376_24_695 222
49 3300049569 Ga0501032_0008464 Ga0501032_0008464_5732_6403 222
50 3300049569 Ga0501032_0014720 Ga0501032_0014720_3032_3703 222
51 3300049569 Ga0501032_0165386 Ga0501032_0165386_543_1214 222
52 3300049569 Ga0501032_0211099 Ga0501032_0211099_459_1130 222
53 3300049570 Ga0501033_0014185 Ga0501033_0014185_63_734 222
54 3300049570 Ga0501033_0218418 Ga0501033_0218418_556_1227 222
55 3300049571 Ga0501034_0000979 Ga0501034_0000979_33218_33889 222
56 3300049571 Ga0501034_0138450 Ga0501034_0138450_234_905 222
57 3300049571 Ga0501034_0311500 Ga0501034_0311500_163_834 222
58 3300049571 Ga0501034_0442377 Ga0501034_0442377_397_1068 222
59 3300049572 Ga0501036_0000602 Ga0501036_0000602_7731_8402 222
60 3300049572 Ga0501036_0022070 Ga0501036_0022070_4309_4980 222
61 3300049572 Ga0501036_0127546 Ga0501036_0127546_852_1523 222
62 3300049572 Ga0501036_0263856 Ga0501036_0263856_238_909 222
63 3300049572 Ga0501036_0433618 Ga0501036_0433618_189_860 222
64 3300049572 Ga0501036_0493998 Ga0501036_0493998_212_883 222
65 3300049573 Ga0501037_0008058 Ga0501037_0008058_4653_5324 222
66 3300049573 Ga0501037_0011444 Ga0501037_0011444_2221_2892 222
67 3300049573 Ga0501037_0041725 Ga0501037_0041725_151_822 222
68 3300049573 Ga0501037_0046672 Ga0501037_0046672_1890_2561 222
69 3300049573 Ga0501037_0162717 Ga0501037_0162717_782_1453 222
70 3300049574 Ga0501038_0174553 Ga0501038_0174553_759_1430 222
71 3300049574 Ga0501038_0348580 Ga0501038_0348580_344_1015 222
72 3300049575 Ga0501039_0042925 Ga0501039_0042925_149_820 222
73 3300049575 Ga0501039_0152064 Ga0501039_0152064_454_1125 222
74 3300049575 Ga0501039_0162449 Ga0501039_0162449_831_1502 222
75 3300049579 Ga0501043_0009053 Ga0501043_0009053_4626_5297 222
76 3300049579 Ga0501043_0014570 Ga0501043_0014570_4152_4823 222
77 3300049579 Ga0501043_0114278 Ga0501043_0114278_1386_2057 222
78 3300049580 Ga0501046_0016349 Ga0501046_0016349_3323_3994 222
79 3300049580 Ga0501046_0025489 Ga0501046_0025489_4153_4824 222
80 3300049580 Ga0501046_0142669 Ga0501046_0142669_651_1322 222
81 3300049581 Ga0501047_0000104 Ga0501047_0000104_58695_59366 222
82 3300049581 Ga0501047_0026153 Ga0501047_0026153_4171_4842 222
83 3300049581 Ga0501047_0294041 Ga0501047_0294041_680_1351 222
84 3300049582 Ga0501048_0000272 Ga0501048_0000272_26740_27411 222
85 3300049582 Ga0501048_0445649 Ga0501048_0445649_179_850 222
86 3300049582 Ga0501048_0509037 Ga0501048_0509037_110_781 222
87 3300049584 Ga0501068_0010259 Ga0501068_0010259_3974_4645 222
88 3300049584 Ga0501068_0189666 Ga0501068_0189666_446_1117 222
89 3300049584 Ga0501068_0189667 Ga0501068_0189667_508_1179 222
90 3300049585 Ga0501069_0028225 Ga0501069_0028225_2322_2993 222
91 3300049585 Ga0501069_0073108 Ga0501069_0073108_414_1085 222
92 3300049586 Ga0501070_0010785 Ga0501070_0010785_1962_2633 222
93 3300049586 Ga0501070_0176167 Ga0501070_0176167_413_1084 222
94 3300049587 Ga0501071_0156163 Ga0501071_0156163_537_1208 222
95 3300049587 Ga0501071_0390721 Ga0501071_0390721_260_931 222
96 3300049589 Ga0501073_0010741 Ga0501073_0010741_5024_5695 222
97 3300049589 Ga0501073_0134637 Ga0501073_0134637_152_823 222
98 3300049590 Ga0501074_0008255 Ga0501074_0008255_2262_2933 222
99 3300049590 Ga0501074_0060609 Ga0501074_0060609_1223_1894 222
100 3300049590 Ga0501074_0253083 Ga0501074_0253083_49_720 222
101 3300049742 Ga0501080_0003091 Ga0501080_0003091_6843_7514 222
102 3300049742 Ga0501080_0136624 Ga0501080_0136624_1422_2093 222
103 3300049743 Ga0501081_0131332 Ga0501081_0131332_782_1453 222
104 3300049744 Ga0501083_0000790 Ga0501083_0000790_17552_18223 222
105 3300049744 Ga0501083_0177222 Ga0501083_0177222_679_1350 222
106 3300049822 Ga0501035_0192974 Ga0501035_0192974_1011_1682 222
107 3300049822 Ga0501035_0448516 Ga0501035_0448516_73_744 222
108 3300049823 Ga0501044_0027461 Ga0501044_0027461_3686_4357 222
109 3300049823 Ga0501044_0097117 Ga0501044_0097117_1168_1839 222
110 3300049823 Ga0501044_0134419 Ga0501044_0134419_671_1342 222
111 3300049823 Ga0501044_0136833 Ga0501044_0136833_459_1130 222
112 3300049823 Ga0501044_0264771 Ga0501044_0264771_509_1180 222
113 3300060353 Ga0501082_0569935 Ga0501082_0569935_33_704 222
114 iso_pu_bacteria 2643221547 2643754948 222
115 3300005985 Ga0081539_10037424 Ga0081539_100374243 223
116 3300006844 Ga0075428_100146579 Ga0075428_1001465792 223
117 3300006846 Ga0075430_100104856 Ga0075430_1001048563 223
118 3300006880 Ga0075429_100250062 Ga0075429_1002500622 223
119 3300031090 Ga0265760_10019565 Ga0265760_100195651 223
120 3300035691 Ga0373931_0087615 Ga0373931_0087615_746_1423 223
121 3300035692 Ga0373935_0048628 Ga0373935_0048628_731_1408 223
122 3300037853 Ga0436364_1119204 Ga0436364_1119204_3950_4645 223
123 3300050489 nmdc:mga03683_34198_c1 nmdc:mga03683_34198_c1_14_700 223
124 3300050508 nmdc:mga09592_176532_c1 nmdc:mga09592_176532_c1_182_868 223
125 3300050508 nmdc:mga09592_24176_c1 nmdc:mga09592_24176_c1_4274_4951 223
126 3300005330 Ga0070690_100106061 Ga0070690_1001060612 224
127 3300005343 Ga0070687_100237715 Ga0070687_1002377152 224
128 3300005355 Ga0070671_100261479 Ga0070671_1002614792 224
129 3300005455 Ga0070663_100126552 Ga0070663_1001265522 224
130 3300005457 Ga0070662_100004931 Ga0070662_1000049312 224
131 3300005457 Ga0070662_100686052 Ga0070662_1006860522 224
132 3300005616 Ga0068852_100803244 Ga0068852_1008032442 224
133 3300005618 Ga0068864_100080872 Ga0068864_1000808723 224
134 3300005718 Ga0068866_10069868 Ga0068866_100698682 224
135 3300006048 Ga0075363_100002772 Ga0075363_1000027727 224
136 3300006195 Ga0075366_10064159 Ga0075366_100641593 224
137 3300009148 Ga0105243_10124820 Ga0105243_101248203 224
138 3300009176 Ga0105242_10261222 Ga0105242_102612222 224
139 3300009177 Ga0105248_10011816 Ga0105248_100118168 224
140 3300011119 Ga0105246_10306643 Ga0105246_103066432 224
141 3300013306 Ga0163162_11339820 Ga0163162_113398201 224
142 3300013307 Ga0157372_10473240 Ga0157372_104732402 224
143 3300013308 Ga0157375_10456600 Ga0157375_104566002 224
144 3300014325 Ga0163163_10240202 Ga0163163_102402023 224
145 3300014326 Ga0157380_10332632 Ga0157380_103326322 224
146 3300014745 Ga0157377_10269812 Ga0157377_102698122 224
147 3300014968 Ga0157379_10288256 Ga0157379_102882562 224
148 3300025899 Ga0207642_10014594 Ga0207642_100145942 224
149 3300025908 Ga0207643_10118737 Ga0207643_101187372 224
150 3300025912 Ga0207707_10359853 Ga0207707_103598532 224
151 3300025920 Ga0207649_10510932 Ga0207649_105109321 224
152 3300025931 Ga0207644_10090227 Ga0207644_100902273 224
153 3300025933 Ga0207706_10081581 Ga0207706_100815812 224
154 3300025933 Ga0207706_10211951 Ga0207706_102119513 224
155 3300025935 Ga0207709_10056635 Ga0207709_100566352 224
156 3300025937 Ga0207669_10020906 Ga0207669_100209063 224
157 3300025938 Ga0207704_10105374 Ga0207704_101053741 224
158 3300025940 Ga0207691_10139739 Ga0207691_101397392 224
159 3300025960 Ga0207651_10273542 Ga0207651_102735422 224
160 3300025986 Ga0207658_10224919 Ga0207658_102249192 224
161 3300026067 Ga0207678_10177113 Ga0207678_101771132 224
162 3300026089 Ga0207648_10331332 Ga0207648_103313321 224
163 3300026095 Ga0207676_10116011 Ga0207676_101160113 224
164 3300026142 Ga0207698_10391670 Ga0207698_103916702 224
165 3300031247 Ga0265340_10067785 Ga0265340_100677852 224
166 3300035085 Ga0373929_0002536 Ga0373929_0002536_175_855 224
167 3300035092 Ga0373952_0024649 Ga0373952_0024649_439_1119 224
168 3300035170 Ga0373943_0335117 Ga0373943_0335117_11_691 224
169 3300035241 Ga0373961_0011313 Ga0373961_0011313_20_700 224
170 3300035242 Ga0373962_0031845 Ga0373962_0031845_294_974 224
171 3300035242 Ga0373962_0033586 Ga0373962_0033586_345_1025 224
172 3300035691 Ga0373931_0004738 Ga0373931_0004738_489_1169 224
173 3300035692 Ga0373935_0451215 Ga0373935_0451215_238_918 224
174 3300035695 Ga0373927_0246941 Ga0373927_0246941_247_927 224
175 3300048088 Ga0495602_0292304 Ga0495602_0292304_458_1138 224
176 3300048903 Ga0496100_0009210 Ga0496100_0009210_3618_4298 224
177 3300048904 Ga0496101_0039158 Ga0496101_0039158_2026_2706 224
178 3300048907 Ga0496104_0013104 Ga0496104_0013104_6498_7178 224
179 3300048908 Ga0496105_0023000 Ga0496105_0023000_243_923 224
180 3300048909 Ga0496106_0427406 Ga0496106_0427406_160_840 224
181 3300048910 Ga0496107_0133240 Ga0496107_0133240_427_1107 224
182 3300048911 Ga0496108_0043119 Ga0496108_0043119_866_1546 224
183 3300048911 Ga0496108_0069671 Ga0496108_0069671_1047_1727 224
184 3300048912 Ga0496109_0455999 Ga0496109_0455999_140_820 224
185 3300048913 Ga0496110_0004771 Ga0496110_0004771_6790_7470 224
186 3300048914 Ga0496111_0218939 Ga0496111_0218939_250_930 224
187 3300048915 Ga0496112_0083030 Ga0496112_0083030_1077_1757 224
188 3300048917 Ga0496114_0010617 Ga0496114_0010617_1852_2532 224
189 3300048917 Ga0496114_0287259 Ga0496114_0287259_292_972 224
190 3300048917 Ga0496114_0856538 Ga0496114_0856538_41_721 224
191 3300048918 Ga0496115_0054889 Ga0496115_0054889_1810_2490 224
192 3300049742 Ga0501080_0424907 Ga0501080_0424907_25_708 224
193 3300049742 Ga0501080_0695372 Ga0501080_0695372_148_834 224
194 3300050514 nmdc:mga08x19_442937_c1 nmdc:mga08x19_442937_c1_14_694 224
195 3300053078 Ga0495612_0067179 Ga0495612_0067179_326_1006 224
196 3300003203 JGI25406J46586_10022905 JGI25406J46586_100229052 225
197 3300005288 Ga0065714_10165718 Ga0065714_101657181 225
198 3300005328 Ga0070676_10108578 Ga0070676_101085782 225
199 3300005330 Ga0070690_100262431 Ga0070690_1002624313 225
200 3300005333 Ga0070677_10027484 Ga0070677_100274843 225
201 3300005340 Ga0070689_100286663 Ga0070689_1002866633 225
202 3300005354 Ga0070675_100138786 Ga0070675_1001387863 225
203 3300005354 Ga0070675_100206641 Ga0070675_1002066411 225
204 3300005356 Ga0070674_100023249 Ga0070674_1000232498 225
205 3300005458 Ga0070681_10064707 Ga0070681_100647072 225
206 3300005466 Ga0070685_10104108 Ga0070685_101041083 225
207 3300005466 Ga0070685_10132614 Ga0070685_101326142 225
208 3300005615 Ga0070702_100152804 Ga0070702_1001528041 225
209 3300005617 Ga0068859_100044884 Ga0068859_1000448845 225
210 3300005618 Ga0068864_100010077 Ga0068864_1000100775 225
211 3300005719 Ga0068861_100376546 Ga0068861_1003765462 225
212 3300005983 Ga0081540_1047300 Ga0081540_10473001 225
213 3300005985 Ga0081539_10002027 Ga0081539_1000202716 225
214 3300006051 Ga0075364_10444775 Ga0075364_104447752 225
215 3300006186 Ga0075369_10079845 Ga0075369_100798452 225
216 3300006195 Ga0075366_10048225 Ga0075366_100482252 225
217 3300006195 Ga0075366_10110469 Ga0075366_101104692 225
218 3300006237 Ga0097621_100652065 Ga0097621_1006520652 225
219 3300006844 Ga0075428_100218274 Ga0075428_1002182742 225
220 3300006871 Ga0075434_101010754 Ga0075434_1010107541 225
221 3300006881 Ga0068865_100074714 Ga0068865_1000747142 225
222 3300006931 Ga0097620_100044882 Ga0097620_1000448822 225
223 3300009094 Ga0111539_10205729 Ga0111539_102057291 225
224 3300009098 Ga0105245_10396357 Ga0105245_103963572 225
225 3300009147 Ga0114129_10355109 Ga0114129_103551091 225
226 3300009148 Ga0105243_10425642 Ga0105243_104256421 225
227 3300009177 Ga0105248_10273483 Ga0105248_102734831 225
228 3300009551 Ga0105238_10079541 Ga0105238_100795413 225
229 3300013297 Ga0157378_10831962 Ga0157378_108319622 225
230 3300013307 Ga0157372_10781068 Ga0157372_107810682 225
231 3300013308 Ga0157375_10617338 Ga0157375_106173382 225
232 3300014326 Ga0157380_10420840 Ga0157380_104208402 225
233 3300014969 Ga0157376_10920891 Ga0157376_109208911 225
234 3300025261 Ga0209233_1032547 Ga0209233_10325472 225
235 3300025297 Ga0209758_1072316 Ga0209758_10723161 225
236 3300025893 Ga0207682_10006602 Ga0207682_100066021 225
237 3300025900 Ga0207710_10023264 Ga0207710_100232642 225
238 3300025904 Ga0207647_10107971 Ga0207647_101079711 225
239 3300025911 Ga0207654_10012606 Ga0207654_100126063 225
240 3300025913 Ga0207695_10419652 Ga0207695_104196521 225
241 3300025918 Ga0207662_10058968 Ga0207662_100589684 225
242 3300025919 Ga0207657_10459204 Ga0207657_104592042 225
243 3300025923 Ga0207681_10063327 Ga0207681_100633276 225
244 3300025923 Ga0207681_10153997 Ga0207681_101539972 225
245 3300025924 Ga0207694_10065655 Ga0207694_100656553 225
246 3300025926 Ga0207659_10102646 Ga0207659_101026462 225
247 3300025927 Ga0207687_10127230 Ga0207687_101272302 225
248 3300025927 Ga0207687_10579154 Ga0207687_105791542 225
249 3300025933 Ga0207706_10246977 Ga0207706_102469772 225
250 3300025937 Ga0207669_10113152 Ga0207669_101131522 225
251 3300025937 Ga0207669_10114182 Ga0207669_101141824 225
252 3300025939 Ga0207665_10337399 Ga0207665_103373992 225
253 3300025940 Ga0207691_10071075 Ga0207691_100710754 225
254 3300025942 Ga0207689_10342058 Ga0207689_103420582 225
255 3300025961 Ga0207712_10555092 Ga0207712_105550922 225
256 3300026095 Ga0207676_10008313 Ga0207676_100083136 225
257 3300026116 Ga0207674_10063716 Ga0207674_100637163 225
258 3300026118 Ga0207675_100323138 Ga0207675_1003231381 225
259 3300026118 Ga0207675_100806521 Ga0207675_1008065211 225
260 3300026121 Ga0207683_10007038 Ga0207683_1000703810 225
261 3300027907 Ga0207428_10132182 Ga0207428_101321824 225
262 3300028381 Ga0268264_10575093 Ga0268264_105750931 225
263 3300028794 Ga0307515_10199783 Ga0307515_101997832 225
264 3300031238 Ga0265332_10009877 Ga0265332_100098773 225
265 3300031241 Ga0265325_10000305 Ga0265325_100003056 225
266 3300031241 Ga0265325_10065751 Ga0265325_100657512 225
267 3300031241 Ga0265325_10072198 Ga0265325_100721983 225
268 3300031242 Ga0265329_10007626 Ga0265329_100076265 225
269 3300031247 Ga0265340_10027879 Ga0265340_100278792 225
270 3300031247 Ga0265340_10051008 Ga0265340_100510082 225
271 3300031247 Ga0265340_10053364 Ga0265340_100533644 225
272 3300031249 Ga0265339_10036835 Ga0265339_100368352 225
273 3300031249 Ga0265339_10116781 Ga0265339_101167812 225
274 3300031250 Ga0265331_10040198 Ga0265331_100401982 225
275 3300031344 Ga0265316_10129880 Ga0265316_101298802 225
276 3300031344 Ga0265316_10176046 Ga0265316_101760461 225
277 3300031595 Ga0265313_10062066 Ga0265313_100620662 225
278 3300031711 Ga0265314_10186869 Ga0265314_101868692 225
279 3300031712 Ga0265342_10024831 Ga0265342_100248314 225
280 3300031712 Ga0265342_10185734 Ga0265342_101857342 225
281 3300035171 Ga0373946_0196316 Ga0373946_0196316_168_851 225
282 3300039438 Ga0436360_0115274 Ga0436360_0115274_355_1056 225
283 3300039453 Ga0436362_0779349 Ga0436362_0779349_56_772 225
284 3300041453 Ga0451797_0849193 Ga0451797_0849193_31_714 225
285 3300042003 Ga0439443_009503 Ga0439443_009503_595_1305 225
286 3300042461 Ga0439460_0102492 Ga0439460_0102492_154_864 225
287 3300046537 Ga0495598_0028650 Ga0495598_0028650_47_733 225
288 3300046539 Ga0495621_0056375 Ga0495621_0056375_585_1265 225
289 3300047469 Ga0495673_0130301 Ga0495673_0130301_156_932 225
290 3300048913 Ga0496110_0760257 Ga0496110_0760257_18_704 225
291 3300048918 Ga0496115_0056335 Ga0496115_0056335_2344_3027 225
292 3300049571 Ga0501034_0181312 Ga0501034_0181312_1013_1699 225
293 3300049573 Ga0501037_0021830 Ga0501037_0021830_2946_3629 225
294 3300049574 Ga0501038_0123832 Ga0501038_0123832_897_1580 225
295 3300049578 Ga0501042_0418793 Ga0501042_0418793_257_940 225
296 3300049579 Ga0501043_0140356 Ga0501043_0140356_151_909 225
297 3300049581 Ga0501047_0023793 Ga0501047_0023793_4707_5390 225
298 3300049583 Ga0501067_0351798 Ga0501067_0351798_73_756 225
299 3300049585 Ga0501069_0255491 Ga0501069_0255491_254_940 225
300 3300049586 Ga0501070_0327001 Ga0501070_0327001_69_752 225
301 3300049588 Ga0501072_0000464 Ga0501072_0000464_2263_2946 225
302 3300049593 Ga0501077_0101926 Ga0501077_0101926_292_975 225
303 3300049741 Ga0501079_0054215 Ga0501079_0054215_491_1249 225
304 3300049742 Ga0501080_0113970 Ga0501080_0113970_889_1572 225
305 3300049743 Ga0501081_0067775 Ga0501081_0067775_780_1463 225
306 3300049744 Ga0501083_0100005 Ga0501083_0100005_49_735 225
307 3300049822 Ga0501035_0071563 Ga0501035_0071563_510_1193 225
308 3300049823 Ga0501044_0099131 Ga0501044_0099131_1175_1858 225
309 3300050489 nmdc:mga03683_123325_c1 nmdc:mga03683_123325_c1_27_710 225
310 3300050489 nmdc:mga03683_136925_c1 nmdc:mga03683_136925_c1_129_812 225
311 3300050489 nmdc:mga03683_31263_c1 nmdc:mga03683_31263_c1_620_1300 225
312 3300050491 nmdc:mga00v17_458157_c1 nmdc:mga00v17_458157_c1_119_802 225
313 3300050491 nmdc:mga00v17_94127_c1 nmdc:mga00v17_94127_c1_305_988 225
314 3300050492 nmdc:mga0yw44_101091_c1 nmdc:mga0yw44_101091_c1_1055_1738 225
315 3300050494 nmdc:mga06z11_144593_c1 nmdc:mga06z11_144593_c1_242_925 225
316 3300050496 nmdc:mga07m45_301207_c1 nmdc:mga07m45_301207_c1_126_806 225
317 3300050507 nmdc:mga05p37_391773_c1 nmdc:mga05p37_391773_c1_17_700 225
318 3300050511 nmdc:mga08y16_286252_c1 nmdc:mga08y16_286252_c1_721_1407 225
319 3300050516 nmdc:mga0sz30_17764_c1 nmdc:mga0sz30_17764_c1_574_1257 225
320 3300053096 Ga0500641_0008847 Ga0500641_0008847_677_1360 225
321 3300054114 Ga0501084_0062669 Ga0501084_0062669_854_1537 225
322 3300054114 Ga0501084_0118190 Ga0501084_0118190_32_718 225
323 3300060353 Ga0501082_0001642 Ga0501082_0001642_12450_13217 225
324 3300005458 Ga0070681_10052487 Ga0070681_100524872 226
325 3300005530 Ga0070679_100321383 Ga0070679_1003213832 226
326 3300005545 Ga0070695_100397478 Ga0070695_1003974782 226
327 3300005981 Ga0081538_10002038 Ga0081538_1000203823 226
328 3300006177 Ga0075362_10150570 Ga0075362_101505702 226
329 3300006847 Ga0075431_100247828 Ga0075431_1002478282 226
330 3300006871 Ga0075434_100034653 Ga0075434_1000346535 226
331 3300025912 Ga0207707_10082390 Ga0207707_100823902 226
332 3300025921 Ga0207652_10137924 Ga0207652_101379242 226
333 3300025939 Ga0207665_10493146 Ga0207665_104931461 226
334 3300026078 Ga0207702_10534559 Ga0207702_105345592 226
335 3300037853 Ga0436364_0836051 Ga0436364_0836051_98_778 226
336 3300039453 Ga0436362_1220292 Ga0436362_1220292_65_784 226
337 3300041496 Ga0451839_0860984 Ga0451839_0860984_92_796 226
338 3300048903 Ga0496100_0467424 Ga0496100_0467424_236_934 226
339 3300048907 Ga0496104_0024333 Ga0496104_0024333_3042_3740 226
340 3300048908 Ga0496105_0007674 Ga0496105_0007674_3126_3824 226
341 3300048918 Ga0496115_0437813 Ga0496115_0437813_236_934 226
342 3300049572 Ga0501036_0664760 Ga0501036_0664760_76_762 226
343 3300049591 Ga0501075_0300528 Ga0501075_0300528_143_832 226
344 3300050510 nmdc:mga06r32_458043_c1 nmdc:mga06r32_458043_c1_184_873 226
345 3300054114 Ga0501084_0801470 Ga0501084_0801470_70_759 226
346 3300005434 Ga0070709_10140180 Ga0070709_101401802 227
347 3300005434 Ga0070709_10365977 Ga0070709_103659772 227
348 3300005435 Ga0070714_100013728 Ga0070714_1000137284 227
349 3300005435 Ga0070714_100089356 Ga0070714_1000893562 227
350 3300005436 Ga0070713_100320173 Ga0070713_1003201732 227
351 3300005437 Ga0070710_10045175 Ga0070710_100451754 227
352 3300005437 Ga0070710_10088849 Ga0070710_100888492 227
353 3300006028 Ga0070717_10036056 Ga0070717_100360563 227
354 3300006028 Ga0070717_10483827 Ga0070717_104838272 227
355 3300006038 Ga0075365_10007739 Ga0075365_100077394 227
356 3300006163 Ga0070715_10044669 Ga0070715_100446692 227
357 3300006173 Ga0070716_100467196 Ga0070716_1004671962 227
358 3300006175 Ga0070712_100222991 Ga0070712_1002229913 227
359 3300006175 Ga0070712_100451138 Ga0070712_1004511382 227
360 3300006852 Ga0075433_10014525 Ga0075433_100145252 227
361 3300006871 Ga0075434_100236467 Ga0075434_1002364672 227
362 3300006914 Ga0075436_100010935 Ga0075436_1000109353 227
363 3300007076 Ga0075435_100187081 Ga0075435_1001870812 227
364 3300007076 Ga0075435_100190124 Ga0075435_1001901242 227
365 3300007788 Ga0099795_10030011 Ga0099795_100300111 227
366 3300009094 Ga0111539_10438547 Ga0111539_104385472 227
367 3300010159 Ga0099796_10008664 Ga0099796_100086644 227
368 3300021384 Ga0213876_10026242 Ga0213876_100262422 227
369 3300021388 Ga0213875_10000040 Ga0213875_100000409 227
370 3300025898 Ga0207692_10247175 Ga0207692_102471752 227
371 3300025898 Ga0207692_10259191 Ga0207692_102591912 227
372 3300025905 Ga0207685_10177582 Ga0207685_101775822 227
373 3300025915 Ga0207693_10024520 Ga0207693_100245206 227
374 3300025915 Ga0207693_10489514 Ga0207693_104895141 227
375 3300025916 Ga0207663_10154499 Ga0207663_101544991 227
376 3300025929 Ga0207664_10129219 Ga0207664_101292192 227
377 3300025939 Ga0207665_10013404 Ga0207665_100134045 227
378 3300027512 Ga0209179_1002880 Ga0209179_10028803 227
379 3300027907 Ga0207428_10332694 Ga0207428_103326942 227
380 3300035116 Ga0373945_0002025 Ga0373945_0002025_908_1600 227
381 3300035117 Ga0373953_0178149 Ga0373953_0178149_200_892 227
382 3300035118 Ga0373954_0000496 Ga0373954_0000496_4573_5265 227
383 3300035118 Ga0373954_0022672 Ga0373954_0022672_1197_1901 227
384 3300035120 Ga0373957_0002404 Ga0373957_0002404_1140_1832 227
385 3300035170 Ga0373943_0001174 Ga0373943_0001174_2743_3435 227
386 3300035171 Ga0373946_0000733 Ga0373946_0000733_4892_5584 227
387 3300035172 Ga0373955_0062369 Ga0373955_0062369_1020_1712 227
388 3300035410 Ga0373924_0000869 Ga0373924_0000869_7841_8533 227
389 3300035692 Ga0373935_0001176 Ga0373935_0001176_11624_12316 227
390 3300035695 Ga0373927_0001966 Ga0373927_0001966_14454_15146 227
391 3300035724 Ga0373933_0001354 Ga0373933_0001354_5975_6667 227
392 3300035725 Ga0373947_0001670 Ga0373947_0001670_1113_1805 227
393 3300036401 Ga0373937_0000356 Ga0373937_0000356_24540_25232 227
394 3300037068 Ga0373925_0000462 Ga0373925_0000462_25460_26152 227
395 3300037853 Ga0436364_0576120 Ga0436364_0576120_5683_6372 227
396 3300039437 Ga0436365_1115437 Ga0436365_1115437_35_724 227
397 3300039437 Ga0436365_1298720 Ga0436365_1298720_842_1531 227
398 3300039450 Ga0436363_0033945 Ga0436363_0033945_82_786 227
399 3300039453 Ga0436362_1278674 Ga0436362_1278674_58_747 227
400 3300046454 Ga0495592_0000090 Ga0495592_0000090_14766_15458 227
401 3300046459 Ga0495629_0019883 Ga0495629_0019883_2288_2980 227
402 3300046459 Ga0495629_0042536 Ga0495629_0042536_1369_2073 227
403 3300046462 Ga0495651_0000682 Ga0495651_0000682_14778_15470 227
404 3300046463 Ga0495653_0000322 Ga0495653_0000322_23489_24181 227
405 3300046476 Ga0495662_0304774 Ga0495662_0304774_47_739 227
406 3300046477 Ga0495664_0000078 Ga0495664_0000078_29628_30320 227
407 3300046511 Ga0495608_0000022 Ga0495608_0000022_147362_148054 227
408 3300046514 Ga0495618_0000229 Ga0495618_0000229_25480_26172 227
409 3300046516 Ga0495628_0000035 Ga0495628_0000035_95186_95878 227
410 3300046517 Ga0495630_0000377 Ga0495630_0000377_6363_7055 227
411 3300046529 Ga0495652_0000062 Ga0495652_0000062_95198_95890 227
412 3300046533 Ga0495640_0000021 Ga0495640_0000021_17058_17750 227
413 3300046533 Ga0495640_0150748 Ga0495640_0150748_674_1378 227
414 3300046536 Ga0495587_0000006 Ga0495587_0000006_95198_95890 227
415 3300046543 Ga0495645_0000174 Ga0495645_0000174_29351_30043 227
416 3300046559 Ga0495667_0000161 Ga0495667_0000161_29407_30099 227
417 3300046642 Ga0495634_0000350 Ga0495634_0000350_14757_15449 227
418 3300046663 Ga0495635_0000018 Ga0495635_0000018_178115_178807 227
419 3300046675 Ga0495657_0000245 Ga0495657_0000245_33915_34607 227
420 3300046675 Ga0495657_0172814 Ga0495657_0172814_286_990 227
421 3300046678 Ga0495599_0000032 Ga0495599_0000032_92798_93490 227
422 3300046679 Ga0495623_0000004 Ga0495623_0000004_19418_20110 227
423 3300046680 Ga0495646_0000083 Ga0495646_0000083_15085_15777 227
424 3300046689 Ga0495613_0019217 Ga0495613_0019217_3446_4138 227
425 3300046689 Ga0495613_0120552 Ga0495613_0120552_115_819 227
426 3300046690 Ga0495624_0053886 Ga0495624_0053886_92_784 227
427 3300046809 Ga0495600_0000022 Ga0495600_0000022_77040_77732 227
428 3300047315 Ga0495581_0009463 Ga0495581_0009463_2130_2822 227
429 3300047317 Ga0495604_0000011 Ga0495604_0000011_14785_15477 227
430 3300047319 Ga0495674_0000034 Ga0495674_0000034_95198_95890 227
431 3300047322 Ga0495680_0000290 Ga0495680_0000290_14778_15470 227
432 3300047322 Ga0495680_0058556 Ga0495680_0058556_1503_2207 227
433 3300047444 Ga0495675_0000352 Ga0495675_0000352_14559_15251 227
434 3300047471 Ga0495684_0000012 Ga0495684_0000012_169484_170176 227
435 3300047673 Ga0495593_0049677 Ga0495593_0049677_459_1163 227
436 3300048088 Ga0495602_0000064 Ga0495602_0000064_14785_15477 227
437 3300049570 Ga0501033_0074493 Ga0501033_0074493_139_828 227
438 3300050492 nmdc:mga0yw44_8157_c1 nmdc:mga0yw44_8157_c1_2476_3159 227
439 3300050511 nmdc:mga08y16_184567_c1 nmdc:mga08y16_184567_c1_1041_1733 227
440 3300050512 nmdc:mga0n895_242086_c1 nmdc:mga0n895_242086_c1_325_1029 227
441 3300050512 nmdc:mga0n895_3017_c1 nmdc:mga0n895_3017_c1_10715_11407 227
442 3300050513 nmdc:mga0rr50_801525_c1 nmdc:mga0rr50_801525_c1_40_744 227
443 3300050514 nmdc:mga08x19_56376_c1 nmdc:mga08x19_56376_c1_1338_2033 227
444 3300050515 nmdc:mga0a205_160467_c1 nmdc:mga0a205_160467_c1_875_1567 227
445 3300053077 Ga0495601_0000015 Ga0495601_0000015_14785_15477 227
446 3300053078 Ga0495612_0000096 Ga0495612_0000096_22541_23233 227
447 3300053084 Ga0495595_0000035 Ga0495595_0000035_64403_65095 227
448 3300053085 Ga0495619_0000044 Ga0495619_0000044_15085_15777 227
449 3300053163 Ga0500639_064076 Ga0500639_064076_1189_1878 227
450 3300002070 JGI24750J21931_1007582 JGI24750J21931_10075821 228
451 3300002075 JGI24738J21930_10014278 JGI24738J21930_100142781 228
452 3300002077 JGI24744J21845_10036505 JGI24744J21845_100365052 228
453 3300005327 Ga0070658_10144164 Ga0070658_101441641 228
454 3300005330 Ga0070690_100041601 Ga0070690_1000416013 228
455 3300005331 Ga0070670_100006191 Ga0070670_1000061918 228
456 3300005333 Ga0070677_10295773 Ga0070677_102957731 228
457 3300005334 Ga0068869_100368644 Ga0068869_1003686442 228
458 3300005338 Ga0068868_100486796 Ga0068868_1004867961 228
459 3300005339 Ga0070660_100366774 Ga0070660_1003667742 228
460 3300005340 Ga0070689_100109108 Ga0070689_1001091082 228
461 3300005344 Ga0070661_100090904 Ga0070661_1000909042 228
462 3300005347 Ga0070668_100167692 Ga0070668_1001676922 228
463 3300005353 Ga0070669_100301988 Ga0070669_1003019882 228
464 3300005354 Ga0070675_100308118 Ga0070675_1003081182 228
465 3300005356 Ga0070674_100120424 Ga0070674_1001204242 228
466 3300005364 Ga0070673_100084573 Ga0070673_1000845733 228
467 3300005366 Ga0070659_100389825 Ga0070659_1003898252 228
468 3300005434 Ga0070709_10002877 Ga0070709_100028778 228
469 3300005435 Ga0070714_100020943 Ga0070714_1000209433 228
470 3300005436 Ga0070713_100046565 Ga0070713_1000465652 228
471 3300005439 Ga0070711_100170954 Ga0070711_1001709542 228
472 3300005440 Ga0070705_100049873 Ga0070705_1000498732 228
473 3300005445 Ga0070708_100342720 Ga0070708_1003427202 228
474 3300005455 Ga0070663_100235834 Ga0070663_1002358342 228
475 3300005456 Ga0070678_100185978 Ga0070678_1001859782 228
476 3300005457 Ga0070662_100096129 Ga0070662_1000961292 228
477 3300005468 Ga0070707_100769295 Ga0070707_1007692951 228
478 3300005535 Ga0070684_100182942 Ga0070684_1001829422 228
479 3300005536 Ga0070697_100269173 Ga0070697_1002691732 228
480 3300005543 Ga0070672_100242451 Ga0070672_1002424512 228
481 3300005544 Ga0070686_100126861 Ga0070686_1001268612 228
482 3300005545 Ga0070695_100267543 Ga0070695_1002675432 228
483 3300005548 Ga0070665_100263592 Ga0070665_1002635922 228
484 3300005549 Ga0070704_100066309 Ga0070704_1000663091 228
485 3300005549 Ga0070704_100117978 Ga0070704_1001179782 228
486 3300005563 Ga0068855_100483814 Ga0068855_1004838142 228
487 3300005564 Ga0070664_100161867 Ga0070664_1001618672 228
488 3300005564 Ga0070664_100292745 Ga0070664_1002927452 228
489 3300005578 Ga0068854_100311689 Ga0068854_1003116892 228
490 3300005614 Ga0068856_100501721 Ga0068856_1005017212 228
491 3300005616 Ga0068852_100315603 Ga0068852_1003156032 228
492 3300005617 Ga0068859_100804121 Ga0068859_1008041212 228
493 3300005618 Ga0068864_100403400 Ga0068864_1004034002 228
494 3300005718 Ga0068866_10137413 Ga0068866_101374132 228
495 3300005841 Ga0068863_100109532 Ga0068863_1001095324 228
496 3300005843 Ga0068860_101038898 Ga0068860_1010388981 228
497 3300005937 Ga0081455_10001263 Ga0081455_1000126313 228
498 3300005937 Ga0081455_10012438 Ga0081455_100124387 228
499 3300005937 Ga0081455_10126652 Ga0081455_101266523 228
500 3300005981 Ga0081538_10020895 Ga0081538_100208954 228
501 3300005983 Ga0081540_1000922 Ga0081540_10009223 228
502 3300005983 Ga0081540_1014099 Ga0081540_10140994 228
503 3300005985 Ga0081539_10194043 Ga0081539_101940432 228
504 3300006028 Ga0070717_10016903 Ga0070717_100169034 228
505 3300006028 Ga0070717_10240965 Ga0070717_102409652 228
506 3300006038 Ga0075365_10017704 Ga0075365_100177042 228
507 3300006038 Ga0075365_10113997 Ga0075365_101139972 228
508 3300006048 Ga0075363_100161548 Ga0075363_1001615482 228
509 3300006058 Ga0075432_10116034 Ga0075432_101160342 228
510 3300006163 Ga0070715_10005149 Ga0070715_100051493 228
511 3300006173 Ga0070716_100010344 Ga0070716_1000103443 228
512 3300006175 Ga0070712_100116272 Ga0070712_1001162722 228
513 3300006178 Ga0075367_10092180 Ga0075367_100921802 228
514 3300006844 Ga0075428_100151669 Ga0075428_1001516692 228
515 3300006844 Ga0075428_100353996 Ga0075428_1003539962 228
516 3300006844 Ga0075428_100421721 Ga0075428_1004217212 228
517 3300006844 Ga0075428_100438038 Ga0075428_1004380382 228
518 3300006846 Ga0075430_100000067 Ga0075430_10000006734 228
519 3300006846 Ga0075430_100002682 Ga0075430_1000026826 228
520 3300006846 Ga0075430_100112465 Ga0075430_1001124652 228
521 3300006847 Ga0075431_100000003 Ga0075431_10000000347 228
522 3300006847 Ga0075431_100181750 Ga0075431_1001817502 228
523 3300006847 Ga0075431_100186987 Ga0075431_1001869872 228
524 3300006852 Ga0075433_10031250 Ga0075433_100312503 228
525 3300006871 Ga0075434_100003124 Ga0075434_10000312410 228
526 3300006871 Ga0075434_100020197 Ga0075434_1000201975 228
527 3300006871 Ga0075434_100138122 Ga0075434_1001381223 228
528 3300006871 Ga0075434_100208075 Ga0075434_1002080752 228
529 3300006871 Ga0075434_100521189 Ga0075434_1005211892 228
530 3300006880 Ga0075429_100000288 Ga0075429_10000028831 228
531 3300006880 Ga0075429_100267850 Ga0075429_1002678502 228
532 3300006881 Ga0068865_100062764 Ga0068865_1000627642 228
533 3300006914 Ga0075436_100109432 Ga0075436_1001094323 228
534 3300006931 Ga0097620_100804072 Ga0097620_1008040722 228
535 3300007076 Ga0075435_100385789 Ga0075435_1003857892 228
536 3300007265 Ga0099794_10018981 Ga0099794_100189812 228
537 3300007788 Ga0099795_10078185 Ga0099795_100781852 228
538 3300009094 Ga0111539_10000753 Ga0111539_1000075313 228
539 3300009094 Ga0111539_10008081 Ga0111539_100080813 228
540 3300009094 Ga0111539_10217739 Ga0111539_102177392 228
541 3300009098 Ga0105245_10180925 Ga0105245_101809252 228
542 3300009147 Ga0114129_10000104 Ga0114129_1000010442 228
543 3300009147 Ga0114129_10009491 Ga0114129_100094917 228
544 3300009147 Ga0114129_10012500 Ga0114129_100125007 228
545 3300009147 Ga0114129_10034990 Ga0114129_100349905 228
546 3300009147 Ga0114129_10339881 Ga0114129_103398812 228
547 3300009147 Ga0114129_10719070 Ga0114129_107190702 228
548 3300009147 Ga0114129_10800854 Ga0114129_108008542 228
549 3300009148 Ga0105243_10301494 Ga0105243_103014942 228
550 3300009553 Ga0105249_10422349 Ga0105249_104223492 228
551 3300009553 Ga0105249_10700876 Ga0105249_107008761 228
552 3300010159 Ga0099796_10011549 Ga0099796_100115492 228
553 3300010375 Ga0105239_10125876 Ga0105239_101258762 228
554 3300010375 Ga0105239_10619579 Ga0105239_106195792 228
555 3300011119 Ga0105246_10107510 Ga0105246_101075103 228
556 3300011119 Ga0105246_10184605 Ga0105246_101846051 228
557 3300013296 Ga0157374_10193688 Ga0157374_101936882 228
558 3300013297 Ga0157378_10228098 Ga0157378_102280982 228
559 3300013297 Ga0157378_10433098 Ga0157378_104330982 228
560 3300013306 Ga0163162_10354808 Ga0163162_103548082 228
561 3300013308 Ga0157375_10507594 Ga0157375_105075942 228
562 3300013308 Ga0157375_11085451 Ga0157375_110854512 228
563 3300014745 Ga0157377_10047889 Ga0157377_100478892 228
564 3300014968 Ga0157379_10108513 Ga0157379_101085133 228
565 3300014969 Ga0157376_10224125 Ga0157376_102241252 228
566 3300025321 Ga0207656_10021259 Ga0207656_100212591 228
567 3300025885 Ga0207653_10004559 Ga0207653_100045594 228
568 3300025901 Ga0207688_10001688 Ga0207688_1000168810 228
569 3300025904 Ga0207647_10016309 Ga0207647_100163094 228
570 3300025905 Ga0207685_10028604 Ga0207685_100286042 228
571 3300025906 Ga0207699_10039458 Ga0207699_100394583 228
572 3300025907 Ga0207645_10023211 Ga0207645_100232113 228
573 3300025908 Ga0207643_10005230 Ga0207643_100052307 228
574 3300025910 Ga0207684_10114815 Ga0207684_101148152 228
575 3300025911 Ga0207654_10194017 Ga0207654_101940171 228
576 3300025915 Ga0207693_10091980 Ga0207693_100919802 228
577 3300025915 Ga0207693_10357759 Ga0207693_103577592 228
578 3300025916 Ga0207663_10072276 Ga0207663_100722762 228
579 3300025916 Ga0207663_10249185 Ga0207663_102491852 228
580 3300025918 Ga0207662_10015482 Ga0207662_100154823 228
581 3300025919 Ga0207657_10053343 Ga0207657_100533433 228
582 3300025920 Ga0207649_10196138 Ga0207649_101961382 228
583 3300025923 Ga0207681_10225105 Ga0207681_102251052 228
584 3300025925 Ga0207650_10001375 Ga0207650_100013755 228
585 3300025925 Ga0207650_10102203 Ga0207650_101022032 228
586 3300025927 Ga0207687_10156151 Ga0207687_101561512 228
587 3300025928 Ga0207700_10286292 Ga0207700_102862922 228
588 3300025928 Ga0207700_10372447 Ga0207700_103724472 228
589 3300025929 Ga0207664_10021536 Ga0207664_100215363 228
590 3300025931 Ga0207644_10342592 Ga0207644_103425922 228
591 3300025933 Ga0207706_10001850 Ga0207706_100018503 228
592 3300025939 Ga0207665_10003686 Ga0207665_100036864 228
593 3300025940 Ga0207691_10001076 Ga0207691_100010764 228
594 3300025942 Ga0207689_10020535 Ga0207689_100205355 228
595 3300025945 Ga0207679_10228012 Ga0207679_102280122 228
596 3300025960 Ga0207651_10120639 Ga0207651_101206392 228
597 3300025961 Ga0207712_10651372 Ga0207712_106513722 228
598 3300026067 Ga0207678_10010390 Ga0207678_100103907 228
599 3300026075 Ga0207708_10034492 Ga0207708_100344923 228
600 3300026089 Ga0207648_10264802 Ga0207648_102648022 228
601 3300026095 Ga0207676_10042344 Ga0207676_100423442 228
602 3300026116 Ga0207674_10056816 Ga0207674_100568162 228
603 3300026118 Ga0207675_100082953 Ga0207675_1000829532 228
604 3300026121 Ga0207683_10016714 Ga0207683_100167142 228
605 3300026142 Ga0207698_10213682 Ga0207698_102136822 228
606 3300027907 Ga0207428_10000831 Ga0207428_1000083122 228
607 3300027907 Ga0207428_10237183 Ga0207428_102371832 228
608 3300027907 Ga0207428_10384791 Ga0207428_103847912 228
609 3300034957 Ga0373938_0052969 Ga0373938_0052969_219_905 228
610 3300035083 Ga0373926_0159624 Ga0373926_0159624_155_841 228
611 3300035091 Ga0373951_0021480 Ga0373951_0021480_288_974 228
612 3300035092 Ga0373952_0039412 Ga0373952_0039412_127_813 228
613 3300035116 Ga0373945_0108418 Ga0373945_0108418_94_780 228
614 3300035121 Ga0373960_0010722 Ga0373960_0010722_1006_1692 228
615 3300035170 Ga0373943_0009357 Ga0373943_0009357_734_1420 228
616 3300035171 Ga0373946_0051880 Ga0373946_0051880_155_841 228
617 3300035171 Ga0373946_0131802 Ga0373946_0131802_189_875 228
618 3300035691 Ga0373931_0015862 Ga0373931_0015862_2520_3206 228
619 3300035691 Ga0373931_0155316 Ga0373931_0155316_473_1159 228
620 3300035692 Ga0373935_0517867 Ga0373935_0517867_156_842 228
621 3300035695 Ga0373927_0001072 Ga0373927_0001072_19249_19935 228
622 3300035725 Ga0373947_0018359 Ga0373947_0018359_126_812 228
623 3300035725 Ga0373947_0321477 Ga0373947_0321477_52_738 228
624 3300037068 Ga0373925_0017857 Ga0373925_0017857_285_971 228
625 3300037068 Ga0373925_0268721 Ga0373925_0268721_263_949 228
626 3300037466 Ga0395898_0079427 Ga0395898_0079427_488_1174 228
627 3300037471 Ga0395905_0324694 Ga0395905_0324694_528_1214 228
628 3300039447 Ga0436361_0476009 Ga0436361_0476009_6759_7445 228
629 3300039450 Ga0436363_1218092 Ga0436363_1218092_641_1327 228
630 3300041512 Ga0451853_2233956 Ga0451853_2233956_206_892 228
631 3300044735 Ga0466968_0194990 Ga0466968_0194990_228_914 228
632 3300046457 Ga0495590_0159123 Ga0495590_0159123_124_810 228
633 3300046458 Ga0495591_049312 Ga0495591_049312_261_947 228
634 3300046460 Ga0495638_0034007 Ga0495638_0034007_764_1450 228
635 3300046461 Ga0495641_0013506 Ga0495641_0013506_1688_2374 228
636 3300046463 Ga0495653_0299130 Ga0495653_0299130_12_698 228
637 3300046473 Ga0495582_0065403 Ga0495582_0065403_899_1585 228
638 3300046473 Ga0495582_0125793 Ga0495582_0125793_563_1249 228
639 3300046476 Ga0495662_0022104 Ga0495662_0022104_131_817 228
640 3300046491 Ga0495584_0021084 Ga0495584_0021084_1835_2521 228
641 3300046491 Ga0495584_0104900 Ga0495584_0104900_671_1357 228
642 3300046491 Ga0495584_0245827 Ga0495584_0245827_41_727 228
643 3300046492 Ga0495585_0214711 Ga0495585_0214711_199_885 228
644 3300046499 Ga0495594_0190880 Ga0495594_0190880_314_1000 228
645 3300046500 Ga0495596_0121100 Ga0495596_0121100_82_768 228
646 3300046513 Ga0495616_0068741 Ga0495616_0068741_1013_1699 228
647 3300046514 Ga0495618_0114975 Ga0495618_0114975_480_1166 228
648 3300046517 Ga0495630_0077980 Ga0495630_0077980_750_1436 228
649 3300046523 Ga0495644_0031325 Ga0495644_0031325_159_845 228
650 3300046525 Ga0495663_0013480 Ga0495663_0013480_1299_1985 228
651 3300046526 Ga0495666_0078784 Ga0495666_0078784_29_715 228
652 3300046529 Ga0495652_0165067 Ga0495652_0165067_635_1321 228
653 3300046531 Ga0495665_0065518 Ga0495665_0065518_1143_1829 228
654 3300046537 Ga0495598_0000955 Ga0495598_0000955_4871_5557 228
655 3300046559 Ga0495667_0168868 Ga0495667_0168868_586_1272 228
656 3300046642 Ga0495634_0107379 Ga0495634_0107379_662_1348 228
657 3300046642 Ga0495634_0364182 Ga0495634_0364182_139_825 228
658 3300046663 Ga0495635_0099459 Ga0495635_0099459_1195_1881 228
659 3300046674 Ga0495588_0035374 Ga0495588_0035374_1339_2025 228
660 3300046683 Ga0495658_0089708 Ga0495658_0089708_1079_1765 228
661 3300046690 Ga0495624_0023352 Ga0495624_0023352_3232_3918 228
662 3300046691 Ga0495670_0233051 Ga0495670_0233051_182_868 228
663 3300046794 Ga0495589_0262103 Ga0495589_0262103_88_774 228
664 3300047315 Ga0495581_0106586 Ga0495581_0106586_266_952 228
665 3300047317 Ga0495604_0185276 Ga0495604_0185276_627_1313 228
666 3300047319 Ga0495674_0126910 Ga0495674_0126910_1114_1800 228
667 3300047320 Ga0495672_0180051 Ga0495672_0180051_216_902 228
668 3300047321 Ga0495676_0066113 Ga0495676_0066113_159_845 228
669 3300047322 Ga0495680_0130101 Ga0495680_0130101_742_1428 228
670 3300048091 Ga0495626_0187001 Ga0495626_0187001_88_774 228
671 3300048903 Ga0496100_0011779 Ga0496100_0011779_2289_2984 228
672 3300048903 Ga0496100_0448805 Ga0496100_0448805_130_816 228
673 3300048904 Ga0496101_0040262 Ga0496101_0040262_1593_2279 228
674 3300048904 Ga0496101_0401613 Ga0496101_0401613_148_843 228
675 3300048905 Ga0496102_0258248 Ga0496102_0258248_130_816 228
676 3300048906 Ga0496103_0122152 Ga0496103_0122152_575_1261 228
677 3300048906 Ga0496103_0143742 Ga0496103_0143742_610_1296 228
678 3300048907 Ga0496104_0002163 Ga0496104_0002163_2523_3209 228
679 3300048907 Ga0496104_0061109 Ga0496104_0061109_1883_2578 228
680 3300048907 Ga0496104_0101322 Ga0496104_0101322_401_1087 228
681 3300048908 Ga0496105_0000754 Ga0496105_0000754_18189_18875 228
682 3300048908 Ga0496105_0298549 Ga0496105_0298549_312_998 228
683 3300048908 Ga0496105_0581813 Ga0496105_0581813_72_767 228
684 3300048909 Ga0496106_0004480 Ga0496106_0004480_1421_2107 228
685 3300048909 Ga0496106_0059449 Ga0496106_0059449_443_1129 228
686 3300048909 Ga0496106_0072715 Ga0496106_0072715_970_1665 228
687 3300048909 Ga0496106_0203212 Ga0496106_0203212_523_1209 228
688 3300048909 Ga0496106_0220224 Ga0496106_0220224_269_955 228
689 3300048910 Ga0496107_0003453 Ga0496107_0003453_8785_9471 228
690 3300048910 Ga0496107_0254466 Ga0496107_0254466_11_697 228
691 3300048910 Ga0496107_0555209 Ga0496107_0555209_115_801 228
692 3300048911 Ga0496108_0002431 Ga0496108_0002431_12656_13342 228
693 3300048911 Ga0496108_0008557 Ga0496108_0008557_5751_6437 228
694 3300048911 Ga0496108_0014148 Ga0496108_0014148_2120_2806 228
695 3300048911 Ga0496108_0084505 Ga0496108_0084505_1470_2156 228
696 3300048911 Ga0496108_0263465 Ga0496108_0263465_578_1273 228
697 3300048912 Ga0496109_0001755 Ga0496109_0001755_11421_12107 228
698 3300048912 Ga0496109_0003909 Ga0496109_0003909_8891_9577 228
699 3300048912 Ga0496109_0006920 Ga0496109_0006920_8383_9069 228
700 3300048912 Ga0496109_0267654 Ga0496109_0267654_814_1512 228
701 3300048913 Ga0496110_0008732 Ga0496110_0008732_6924_7610 228
702 3300048913 Ga0496110_0020230 Ga0496110_0020230_485_1171 228
703 3300048913 Ga0496110_0033299 Ga0496110_0033299_2690_3376 228
704 3300048913 Ga0496110_0066301 Ga0496110_0066301_2257_2943 228
705 3300048913 Ga0496110_0222011 Ga0496110_0222011_313_999 228
706 3300048914 Ga0496111_0005128 Ga0496111_0005128_7308_7994 228
707 3300048914 Ga0496111_0014585 Ga0496111_0014585_3448_4134 228
708 3300048915 Ga0496112_0010960 Ga0496112_0010960_7185_7871 228
709 3300048916 Ga0496113_0006080 Ga0496113_0006080_3188_3874 228
710 3300048916 Ga0496113_0009343 Ga0496113_0009343_4698_5384 228
711 3300048916 Ga0496113_0053663 Ga0496113_0053663_2185_2883 228
712 3300048916 Ga0496113_0153826 Ga0496113_0153826_428_1114 228
713 3300048916 Ga0496113_0168384 Ga0496113_0168384_641_1327 228
714 3300048917 Ga0496114_0071160 Ga0496114_0071160_1308_2003 228
715 3300048917 Ga0496114_0124524 Ga0496114_0124524_1072_1758 228
716 3300048917 Ga0496114_0440542 Ga0496114_0440542_103_789 228
717 3300049571 Ga0501034_0088424 Ga0501034_0088424_635_1366 228
718 3300049576 Ga0501040_0094732 Ga0501040_0094732_1014_1700 228
719 3300049581 Ga0501047_0131581 Ga0501047_0131581_1287_1979 228
720 3300049581 Ga0501047_0200293 Ga0501047_0200293_141_872 228
721 3300049582 Ga0501048_0337222 Ga0501048_0337222_10_696 228
722 3300049588 Ga0501072_0470749 Ga0501072_0470749_23_709 228
723 3300049591 Ga0501075_0209044 Ga0501075_0209044_222_908 228
724 3300049593 Ga0501077_0190507 Ga0501077_0190507_536_1222 228
725 3300049741 Ga0501079_0053376 Ga0501079_0053376_1617_2303 228
726 3300049742 Ga0501080_0127248 Ga0501080_0127248_1213_1899 228
727 3300049744 Ga0501083_0125833 Ga0501083_0125833_599_1291 228
728 3300049822 Ga0501035_0186822 Ga0501035_0186822_309_1001 228
729 3300049823 Ga0501044_0783064 Ga0501044_0783064_96_791 228
730 3300050492 nmdc:mga0yw44_222635_c1 nmdc:mga0yw44_222635_c1_407_1093 228
731 3300050493 nmdc:mga0k408_253592_c1 nmdc:mga0k408_253592_c1_265_951 228
732 3300050507 nmdc:mga05p37_119443_c1 nmdc:mga05p37_119443_c1_2039_2725 228
733 3300050507 nmdc:mga05p37_215_c1 nmdc:mga05p37_215_c1_28794_29486 228
734 3300050507 nmdc:mga05p37_290900_c1 nmdc:mga05p37_290900_c1_674_1360 228
735 3300050507 nmdc:mga05p37_36829_c1 nmdc:mga05p37_36829_c1_2517_3206 228
736 3300050507 nmdc:mga05p37_806399_c1 nmdc:mga05p37_806399_c1_44_730 228
737 3300050508 nmdc:mga09592_1263_c1 nmdc:mga09592_1263_c1_451_1143 228
738 3300050508 nmdc:mga09592_391256_c1 nmdc:mga09592_391256_c1_383_1069 228
739 3300050509 nmdc:mga0qj67_105410_c1 nmdc:mga0qj67_105410_c1_1217_1903 228
740 3300050509 nmdc:mga0qj67_60_c1 nmdc:mga0qj67_60_c1_72199_72969 228
741 3300050510 nmdc:mga06r32_1551_c1 nmdc:mga06r32_1551_c1_996_1688 228
742 3300050510 nmdc:mga06r32_356397_c1 nmdc:mga06r32_356397_c1_419_1105 228
743 3300050510 nmdc:mga06r32_435952_c1 nmdc:mga06r32_435952_c1_569_1255 228
744 3300050511 nmdc:mga08y16_176_c1 nmdc:mga08y16_176_c1_30150_30842 228
745 3300050511 nmdc:mga08y16_182463_c1 nmdc:mga08y16_182463_c1_268_954 228
746 3300050511 nmdc:mga08y16_80682_c1 nmdc:mga08y16_80682_c1_1266_1952 228
747 3300050512 nmdc:mga0n895_135437_c1 nmdc:mga0n895_135437_c1_758_1444 228
748 3300050512 nmdc:mga0n895_154043_c1 nmdc:mga0n895_154043_c1_818_1504 228
749 3300050513 nmdc:mga0rr50_75345_c1 nmdc:mga0rr50_75345_c1_326_1012 228
750 3300050514 nmdc:mga08x19_88207_c1 nmdc:mga08x19_88207_c1_444_1130 228
751 3300050515 nmdc:mga0a205_192658_c1 nmdc:mga0a205_192658_c1_613_1299 228
752 3300050515 nmdc:mga0a205_487532_c1 nmdc:mga0a205_487532_c1_346_1032 228
753 3300053077 Ga0495601_0080642 Ga0495601_0080642_645_1331 228
754 3300053077 Ga0495601_0147092 Ga0495601_0147092_343_1038 228
755 3300053077 Ga0495601_0277680 Ga0495601_0277680_302_988 228
756 3300053078 Ga0495612_0031628 Ga0495612_0031628_910_1596 228
757 3300053085 Ga0495619_0070397 Ga0495619_0070397_1639_2325 228
758 3300053085 Ga0495619_0111295 Ga0495619_0111295_935_1621 228
759 3300053085 Ga0495619_0202743 Ga0495619_0202743_455_1150 228
760 3300053130 Ga0500642_0157575 Ga0500642_0157575_284_976 228
761 3300060353 Ga0501082_0182800 Ga0501082_0182800_1114_1800 228
762 3300061734 Ga0530510_0246686 Ga0530510_0246686_44_736 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

45

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ir2-assembly1.cif.gz_A crystal structure of novel cellulases from microbes associated with the gut ecosystem 0.8122 1 207
2yjv-assembly1.cif.gz_A crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb 0.7848 15 186
3k4i-assembly1.cif.gz_C crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.7817 1 226
3noj-assembly1.cif.gz_A the structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida 0.7803 1 218
2pcn-assembly1.cif.gz_A crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 0.7719 15 187
ID Description Score Start End Superfamily
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8151 24 188 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.806 24 188 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8047 1 207 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7965 5 188 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7874 5 188 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A6L5FJI4-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9844 3 227 GO:0046872
AF-A0A537T2X2-F1-model_v4 RraA family protein 0.9802 1 180
AF-A0A537R9C4-F1-model_v4 RraA family protein 0.9749 35 172
AF-A0A2E6P336-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9733 2 226 GO:0016740
GO:0046872
AF-A0A4Q5P2E3-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9725 3 226 GO:0046872

Feature Viewer

pLDDT pTM Quality
92.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map