F479654

General Info

Members Datasets Scaffolds Average Seq Length
762 449 1524 270

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0313422|Ga0495635_0313422_91_1008
Length 305
Sequence VEAMPLGGSIRNHSVRSHAIVFQNQAYQGENMPKLFRVLVTAFTVLGGIPAIATAANAQTKPAVTTLGPDFPKTGIFIGNSFFYYNNGLPGHLSLMEKAADSANKLAYRNTMVTIGGSGFDWHDVESYFRPNAVGSYSFDENNNVVFNKLDKLFDVAVMMDCSQCPIHPKLNSVFTDYAKKNSDIVRAKGAKPVFFMSWAYADKPEMTAPLAEAYTVAGNANNALVIPAGLAFAKAVGKQPELNLYAPDKRHPSPAGTYLATCVVFAALTGRSPVGSAYLAGIDTPTATFLQNVAWDTVREYYGK

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
302 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
303 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
308 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
309 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
320 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
321 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
322 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
336 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
337 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
338 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
339 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
340 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
341 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
342 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
343 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
344 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
345 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
346 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
347 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
348 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
349 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
350 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
351 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
352 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
353 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
354 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
355 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
356 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
357 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
358 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
359 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
360 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
361 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
362 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
363 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
364 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
365 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
366 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
367 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
368 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
369 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
370 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
371 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
372 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
373 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
374 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
375 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
376 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
377 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
378 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
379 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
380 2922368715
381 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
382 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
383 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
384 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
385 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
386 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
387 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
388 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
389 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
390 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
391 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
392 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
393 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
394 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
395 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
396 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
397 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
398 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
399 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
400 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
401 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
402 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
403 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
404 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
405 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
406 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
407 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
408 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
409 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
410 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
411 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
412 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
413 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
414 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
415 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
416 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
417 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
418 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
419 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
420 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
421 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
422 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
423 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
424 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
425 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
426 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
427 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
428 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
429 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
430 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
431 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
432 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
433 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
434 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
435 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
436 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
437 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
438 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
439 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
440 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
441 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
442 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
443 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
444 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
445 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
446 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
447 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
448 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
449 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.15
Metatranscriptomes 0
Isolates 14.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.98
Nodule 12.47
Rhizoplane 4.99
Rhizosphere 56.04
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0313422 3300046663 Bacteria 1051
2 JGI24739J22299_10073577 3300001989 Bacteria 1060
3 JGI24742J22300_10003138 3300002244 Bacteria 2673
4 JGI25406J46586_10000032 3300003203 Bacteria 67745
5 JGI25165J46597_1006089 3300003214 Bacteria 2189
6 JGI25153J46596_10000703 3300003215 Bacteria 20474
7 JGI25153J46596_10009007 3300003215 Bacteria 4697
8 rootL2_10104037 3300003322 Bacteria 1655
9 JGI25160J50197_1000477 3300003354 Bacteria 24324
10 JGI25160J50197_1004410 3300003354 Bacteria 6097
11 JGI25404J52841_10002128 3300003659 Bacteria 3685
12 JGI25404J52841_10008534 3300003659 Bacteria 2184
13 JGI25404J52841_10036461 3300003659 Bacteria 1046
14 Ga0055524_1025722 3300003775 Bacteria 1836
15 Ga0055531_10004834 3300003794 Bacteria 8038
16 Ga0065165_1001332 3300005262 Bacteria 27434
17 Ga0065165_1002328 3300005262 Bacteria 16613
18 Ga0065165_1004197 3300005262 Bacteria 9179
19 Ga0065165_1026352 3300005262 Bacteria 1914
20 Ga0070658_10268080 3300005327 Bacteria 1451
21 Ga0070658_10597099 3300005327 Bacteria 957
22 Ga0070676_10151782 3300005328 Bacteria 1484
23 Ga0070676_10189963 3300005328 Bacteria 1340
24 Ga0070690_100170484 3300005330 Bacteria 1497
25 Ga0070670_100149562 3300005331 Bacteria 2021
26 Ga0070670_100160418 3300005331 Bacteria 1949
27 Ga0070670_100519621 3300005331 Bacteria 1060
28 Ga0068869_100092967 3300005334 Bacteria 2271
29 Ga0068869_100277581 3300005334 Bacteria 1347
30 Ga0070680_100177650 3300005336 Bacteria 1792
31 Ga0068868_100012337 3300005338 Bacteria 6244
32 Ga0068868_100080845 3300005338 Bacteria 2605
33 Ga0070660_100160162 3300005339 Bacteria 1813
34 Ga0070660_100362005 3300005339 Bacteria 1196
35 Ga0070660_100413811 3300005339 Bacteria 1116
36 Ga0070689_100369428 3300005340 Bacteria 1207
37 Ga0070687_100086165 3300005343 Bacteria 1726
38 Ga0070687_100227499 3300005343 Bacteria 1146
39 Ga0070668_100077918 3300005347 Bacteria 2591
40 Ga0070668_100125264 3300005347 Bacteria 2057
41 Ga0070668_100144915 3300005347 Bacteria 1916
42 Ga0070675_100159173 3300005354 Bacteria 1941
43 Ga0070675_100571165 3300005354 Bacteria 1024
44 Ga0070671_100026868 3300005355 Bacteria 4735
45 Ga0070671_100161729 3300005355 Bacteria 1892
46 Ga0070674_100203708 3300005356 Bacteria 1529
47 Ga0070674_100253795 3300005356 Bacteria 1382
48 Ga0070673_100061854 3300005364 Bacteria 2972
49 Ga0070667_100108874 3300005367 Bacteria 2401
50 Ga0070667_100169025 3300005367 Bacteria 1929
51 Ga0070667_100208898 3300005367 Bacteria 1734
52 Ga0070700_100074709 3300005441 Bacteria 2172
53 Ga0070700_100441908 3300005441 Bacteria 988
54 Ga0070663_100206634 3300005455 Bacteria 1535
55 Ga0070663_100529856 3300005455 Bacteria 982
56 Ga0070678_100016671 3300005456 Bacteria 4706
57 Ga0070678_100086825 3300005456 Bacteria 2387
58 Ga0070678_100316700 3300005456 Bacteria 1331
59 Ga0070678_100442816 3300005456 Bacteria 1136
60 Ga0070662_100102922 3300005457 Bacteria 2164
61 Ga0070681_10380892 3300005458 Bacteria 1321
62 Ga0068867_100222944 3300005459 Bacteria 1520
63 Ga0070685_10155234 3300005466 Bacteria 1454
64 Ga0070685_10162665 3300005466 Bacteria 1424
65 Ga0070698_100094939 3300005471 Bacteria 2961
66 Ga0070699_100054835 3300005518 Bacteria 3451
67 Ga0070679_100295374 3300005530 Bacteria 1571
68 Ga0070684_100035043 3300005535 Bacteria 4294
69 Ga0068853_100014361 3300005539 Bacteria 6483
70 Ga0068853_100183028 3300005539 Bacteria 1901
71 Ga0068853_100493189 3300005539 Bacteria 1156
72 Ga0068853_100675741 3300005539 Bacteria 984
73 Ga0070672_100291873 3300005543 Bacteria 1381
74 Ga0070672_100390283 3300005543 Bacteria 1192
75 Ga0070672_100400152 3300005543 Bacteria 1177
76 Ga0070696_100092959 3300005546 Bacteria 2150
77 Ga0070696_100461817 3300005546 Bacteria 1004
78 Ga0070693_100018601 3300005547 Bacteria 3633
79 Ga0070665_100101613 3300005548 Bacteria 2879
80 Ga0070665_100135781 3300005548 Bacteria 2462
81 Ga0070665_100153024 3300005548 Bacteria 2309
82 Ga0070665_100310026 3300005548 Bacteria 1582
83 Ga0068855_100020692 3300005563 Bacteria 7890
84 Ga0068855_100042555 3300005563 Bacteria 5381
85 Ga0068855_100166927 3300005563 Bacteria 2495
86 Ga0068855_100510373 3300005563 Bacteria 1305
87 Ga0070664_100534018 3300005564 Bacteria 1084
88 Ga0068857_100035497 3300005577 Bacteria 4415
89 Ga0068857_100227518 3300005577 Bacteria 1705
90 Ga0068854_100447793 3300005578 Bacteria 1078
91 Ga0068856_100057288 3300005614 Bacteria 3847
92 Ga0068856_100158894 3300005614 Bacteria 2271
93 Ga0068856_100354871 3300005614 Bacteria 1485
94 Ga0068856_100379144 3300005614 Bacteria 1433
95 Ga0070702_100031553 3300005615 Bacteria 2900
96 Ga0070702_100287464 3300005615 Unclassified 1131
97 Ga0068852_100119383 3300005616 Bacteria 2411
98 Ga0068852_100154341 3300005616 Bacteria 2137
99 Ga0068852_100680699 3300005616 Bacteria 1038
100 Ga0068859_100064180 3300005617 Bacteria 3705
101 Ga0068859_100131895 3300005617 Bacteria 2570
102 Ga0068861_100306531 3300005719 Bacteria 1377
103 Ga0068861_100369679 3300005719 Bacteria 1263
104 Ga0068870_10158318 3300005840 Bacteria 1340
105 Ga0068858_100072449 3300005842 Bacteria 3196
106 Ga0068858_100072909 3300005842 Bacteria 3187
107 Ga0068858_100321706 3300005842 Bacteria 1478
108 Ga0068858_100328021 3300005842 Bacteria 1464
109 Ga0068858_100446758 3300005842 Bacteria 1246
110 Ga0068860_100011106 3300005843 Bacteria 8877
111 Ga0068860_100104454 3300005843 Bacteria 2705
112 Ga0068860_100119905 3300005843 Bacteria 2518
113 Ga0068860_100190942 3300005843 Bacteria 1982
114 Ga0068862_100099824 3300005844 Bacteria 2538
115 Ga0068862_100246158 3300005844 Bacteria 1628
116 Ga0068862_100246855 3300005844 Bacteria 1625
117 Ga0081455_10009280 3300005937 Bacteria 10132
118 Ga0081455_10010918 3300005937 Bacteria 9161
119 Ga0081540_1003616 3300005983 Bacteria 12134
120 Ga0081540_1011521 3300005983 Bacteria 5907
121 Ga0081540_1020462 3300005983 Bacteria 3978
122 Ga0081540_1054235 3300005983 Bacteria 1961
123 Ga0081540_1056557 3300005983 Bacteria 1903
124 Ga0081539_10000129 3300005985 Bacteria 178675
125 Ga0075365_10026080 3300006038 Bacteria 3706
126 Ga0075365_10031948 3300006038 Bacteria 3380
127 Ga0075365_10037373 3300006038 Bacteria 3152
128 Ga0075365_10074762 3300006038 Bacteria 2285
129 Ga0075365_10117983 3300006038 Bacteria 1828
130 Ga0075368_10007862 3300006042 Bacteria 3780
131 Ga0075363_100008126 3300006048 Bacteria 4870
132 Ga0075363_100032810 3300006048 Bacteria 2699
133 Ga0075364_10041708 3300006051 Bacteria 2980
134 Ga0075364_10067069 3300006051 Bacteria 2358
135 Ga0075364_10185445 3300006051 Bacteria 1409
136 Ga0075364_10226100 3300006051 Bacteria 1270
137 Ga0075364_10255951 3300006051 Bacteria 1190
138 Ga0075362_10063171 3300006177 Bacteria 1679
139 Ga0075362_10116711 3300006177 Bacteria 1260
140 Ga0075367_10011678 3300006178 Bacteria 4659
141 Ga0075367_10018276 3300006178 Bacteria 3865
142 Ga0075367_10097686 3300006178 Bacteria 1792
143 Ga0075367_10109496 3300006178 Bacteria 1694
144 Ga0075367_10167511 3300006178 Bacteria 1368
145 Ga0075367_10207908 3300006178 Bacteria 1223
146 Ga0075369_10014918 3300006186 Bacteria 3110
147 Ga0075369_10019361 3300006186 Bacteria 2779
148 Ga0075369_10034113 3300006186 Bacteria 2159
149 Ga0075366_10008824 3300006195 Bacteria 5616
150 Ga0075366_10093141 3300006195 Bacteria 1806
151 Ga0075366_10108003 3300006195 Bacteria 1673
152 Ga0075366_10180723 3300006195 Bacteria 1281
153 Ga0075366_10257623 3300006195 Bacteria 1065
154 Ga0097621_100098374 3300006237 Bacteria 2458
155 Ga0097621_100122067 3300006237 Bacteria 2210
156 Ga0075370_10008824 3300006353 Bacteria 5205
157 Ga0075370_10038637 3300006353 Bacteria 2687
158 Ga0068871_100032946 3300006358 Bacteria 4098
159 Ga0068871_100077828 3300006358 Bacteria 2741
160 Ga0068871_100424294 3300006358 Bacteria 1188
161 Ga0068871_100529647 3300006358 Bacteria 1065
162 Ga0075434_100811279 3300006871 Bacteria 952
163 Ga0068865_100068455 3300006881 Bacteria 2510
164 Ga0068865_100147439 3300006881 Bacteria 1781
165 Ga0097620_100064181 3300006931 Bacteria 3705
166 Ga0097620_100131895 3300006931 Bacteria 2570
167 Ga0075435_100540707 3300007076 Bacteria 1008
168 Ga0099794_10028249 3300007265 Bacteria 2608
169 Ga0099794_10107773 3300007265 Bacteria 1394
170 Ga0105250_10102951 3300009092 Bacteria 1166
171 Ga0105240_10018175 3300009093 Bacteria 9452
172 Ga0105240_10066059 3300009093 Bacteria 4489
173 Ga0105240_10101333 3300009093 Bacteria 3502
174 Ga0105240_10264432 3300009093 Bacteria 1983
175 Ga0111539_10280269 3300009094 Bacteria 1940
176 Ga0105245_10025888 3300009098 Bacteria 5160
177 Ga0105245_10102992 3300009098 Bacteria 2644
178 Ga0105245_10181032 3300009098 Bacteria 2014
179 Ga0105245_10379185 3300009098 Bacteria 1408
180 Ga0105247_10029142 3300009101 Bacteria 3343
181 Ga0105247_10083958 3300009101 Bacteria 2012
182 Ga0105247_10140180 3300009101 Bacteria 1584
183 Ga0114129_10924860 3300009147 Bacteria 1103
184 Ga0105243_10085274 3300009148 Bacteria 2588
185 Ga0105243_10438902 3300009148 Bacteria 1222
186 Ga0105241_10077267 3300009174 Bacteria 2598
187 Ga0105241_10102753 3300009174 Bacteria 2275
188 Ga0105241_10493649 3300009174 Bacteria 1090
189 Ga0105242_10094414 3300009176 Bacteria 2523
190 Ga0105242_10302781 3300009176 Bacteria 1460
191 Ga0105248_10066430 3300009177 Bacteria 4050
192 Ga0105248_10087042 3300009177 Unclassified 3515
193 Ga0105248_10107533 3300009177 Bacteria 3145
194 Ga0105248_10224038 3300009177 Bacteria 2117
195 Ga0105237_10022649 3300009545 Bacteria 6443
196 Ga0105237_10064803 3300009545 Bacteria 3650
197 Ga0105237_10262593 3300009545 Bacteria 1729
198 Ga0105238_10008285 3300009551 Bacteria 10396
199 Ga0105238_10021126 3300009551 Bacteria 6634
200 Ga0105238_10088796 3300009551 Bacteria 3077
201 Ga0105238_10136717 3300009551 Bacteria 2428
202 Ga0105238_10141113 3300009551 Bacteria 2386
203 Ga0105238_10394653 3300009551 Bacteria 1376
204 Ga0105238_10736805 3300009551 Bacteria 999
205 Ga0099796_10011674 3300010159 Bacteria 2458
206 Ga0099796_10053678 3300010159 Bacteria 1406
207 Ga0105239_10016541 3300010375 Bacteria 8154
208 Ga0105239_10049807 3300010375 Bacteria 4594
209 Ga0105239_10063898 3300010375 Bacteria 4041
210 Ga0105239_10069094 3300010375 Bacteria 3882
211 Ga0105239_10144477 3300010375 Bacteria 2652
212 Ga0105239_10314126 3300010375 Bacteria 1766
213 Ga0105239_10922580 3300010375 Bacteria 1003
214 Ga0105246_10013142 3300011119 Bacteria 5183
215 Ga0105246_10036170 3300011119 Bacteria 3306
216 Ga0105246_10290767 3300011119 Bacteria 1315
217 Ga0105246_10341893 3300011119 Bacteria 1223
218 Ga0157370_10065946 3300013104 Bacteria 3425
219 Ga0157370_10152169 3300013104 Bacteria 2153
220 Ga0157370_10410285 3300013104 Bacteria 1246
221 Ga0157374_10032115 3300013296 Bacteria 4778
222 Ga0157374_10043874 3300013296 Bacteria 4132
223 Ga0157374_10189659 3300013296 Bacteria 2010
224 Ga0157374_10247280 3300013296 Bacteria 1754
225 Ga0157378_10036012 3300013297 Bacteria 4380
226 Ga0163162_10142100 3300013306 Bacteria 2514
227 Ga0163162_10147048 3300013306 Bacteria 2473
228 Ga0163162_10209212 3300013306 Bacteria 2080
229 Ga0157375_10016776 3300013308 Bacteria 6592
230 Ga0157375_10086459 3300013308 Bacteria 3186
231 Ga0157375_10230235 3300013308 Bacteria 2012
232 Ga0157375_10278925 3300013308 Bacteria 1834
233 Ga0157375_10592269 3300013308 Bacteria 1268
234 Ga0157375_10804285 3300013308 Bacteria 1089
235 Ga0157380_10072111 3300014326 Bacteria 2796
236 Ga0157380_10097137 3300014326 Bacteria 2444
237 Ga0157380_10122732 3300014326 Bacteria 2203
238 Ga0157380_10404893 3300014326 Bacteria 1296
239 Ga0157379_10033950 3300014968 Bacteria 4548
240 Ga0157379_10065109 3300014968 Bacteria 3258
241 Ga0157379_10138997 3300014968 Bacteria 2189
242 Ga0157376_10010552 3300014969 Bacteria 6764
243 Ga0157376_10212542 3300014969 Bacteria 1787
244 Ga0157376_10306236 3300014969 Bacteria 1506
245 Ga0163161_10029860 3300017792 Bacteria 3875
246 Ga0213876_10071762 3300021384 Bacteria 1828
247 Ga0209148_1000613 3300025254 Bacteria 31818
248 Ga0209233_1016071 3300025261 Bacteria 2069
249 Ga0209233_1041547 3300025261 Bacteria 993
250 Ga0209455_1006964 3300025272 Bacteria 3265
251 Ga0209758_1000140 3300025297 Bacteria 174267
252 Ga0209758_1002974 3300025297 Bacteria 16246
253 Ga0209758_1004986 3300025297 Bacteria 10607
254 Ga0209256_1002028 3300025299 Bacteria 18027
255 Ga0209256_1031892 3300025299 Bacteria 1435
256 Ga0207426_1000626 3300025302 Bacteria 44875
257 Ga0207426_1001273 3300025302 Bacteria 21945
258 Ga0207426_1005335 3300025302 Bacteria 5905
259 Ga0209257_1002350 3300025304 Bacteria 19025
260 Ga0209257_1043110 3300025304 Bacteria 1325
261 Ga0207656_10027165 3300025321 Bacteria 2339
262 Ga0207710_10024752 3300025900 Bacteria 2588
263 Ga0207688_10042130 3300025901 Bacteria 2541
264 Ga0207688_10156202 3300025901 Bacteria 1350
265 Ga0207680_10056023 3300025903 Bacteria 2379
266 Ga0207680_10171494 3300025903 Bacteria 1462
267 Ga0207647_10013090 3300025904 Bacteria 5763
268 Ga0207645_10058839 3300025907 Bacteria 2454
269 Ga0207645_10115898 3300025907 Bacteria 1737
270 Ga0207705_10204989 3300025909 Bacteria 1495
271 Ga0207654_10004914 3300025911 Bacteria 6767
272 Ga0207707_10000555 3300025912 Bacteria 37837
273 Ga0207671_10007288 3300025914 Bacteria 9622
274 Ga0207671_10051903 3300025914 Bacteria 3038
275 Ga0207671_10054333 3300025914 Bacteria 2968
276 Ga0207660_10010799 3300025917 Bacteria 5935
277 Ga0207657_10006568 3300025919 Bacteria 12044
278 Ga0207657_10156458 3300025919 Bacteria 1853
279 Ga0207657_10157040 3300025919 Bacteria 1849
280 Ga0207649_10232464 3300025920 Bacteria 1319
281 Ga0207649_10295852 3300025920 Bacteria 1182
282 Ga0207652_10003864 3300025921 Bacteria 12271
283 Ga0207694_10124020 3300025924 Bacteria 2065
284 Ga0207694_10155775 3300025924 Bacteria 1842
285 Ga0207694_10588051 3300025924 Bacteria 936
286 Ga0207650_10139734 3300025925 Viruses 1903
287 Ga0207650_10143467 3300025925 Bacteria 1879
288 Ga0207659_10126260 3300025926 Bacteria 1968
289 Ga0207659_10319424 3300025926 Bacteria 1281
290 Ga0207687_10056056 3300025927 Bacteria 2763
291 Ga0207687_10164050 3300025927 Bacteria 1708
292 Ga0207700_10127217 3300025928 Bacteria 2075
293 Ga0207706_10029805 3300025933 Bacteria 4870
294 Ga0207706_10126203 3300025933 Bacteria 2251
295 Ga0207709_10037318 3300025935 Bacteria 2887
296 Ga0207669_10054487 3300025937 Bacteria 2416
297 Ga0207704_10299860 3300025938 Bacteria 1230
298 Ga0207691_10052085 3300025940 Bacteria 3739
299 Ga0207691_10065308 3300025940 Bacteria 3295
300 Ga0207711_10086987 3300025941 Bacteria 2741
301 Ga0207667_10009120 3300025949 Bacteria 11721
302 Ga0207667_10206576 3300025949 Bacteria 2014
303 Ga0207651_10259850 3300025960 Bacteria 1425
304 Ga0207712_10009125 3300025961 Bacteria 6276
305 Ga0207668_10061752 3300025972 Bacteria 2636
306 Ga0207668_10136380 3300025972 Bacteria 1881
307 Ga0207668_10250794 3300025972 Bacteria 1437
308 Ga0207640_10108185 3300025981 Bacteria 1964
309 Ga0207658_10105885 3300025986 Bacteria 2213
310 Ga0207658_10129812 3300025986 Bacteria 2023
311 Ga0207677_10094235 3300026023 Bacteria 2185
312 Ga0207677_10264943 3300026023 Bacteria 1403
313 Ga0207703_10034345 3300026035 Bacteria 4024
314 Ga0207703_10345835 3300026035 Bacteria 1368
315 Ga0207703_10382993 3300026035 Bacteria 1301
316 Ga0207703_10530439 3300026035 Bacteria 1108
317 Ga0207639_10096146 3300026041 Bacteria 2382
318 Ga0207639_10104906 3300026041 Bacteria 2292
319 Ga0207639_10437191 3300026041 Bacteria 1185
320 Ga0207639_10666466 3300026041 Bacteria 963
321 Ga0207678_10060305 3300026067 Bacteria 3263
322 Ga0207678_10081476 3300026067 Bacteria 2770
323 Ga0207678_10507462 3300026067 Bacteria 1052
324 Ga0207702_10100574 3300026078 Bacteria 2551
325 Ga0207641_10101402 3300026088 Bacteria 2537
326 Ga0207641_10152289 3300026088 Bacteria 2095
327 Ga0207641_10455405 3300026088 Bacteria 1237
328 Ga0207641_10595345 3300026088 Bacteria 1082
329 Ga0207648_10319859 3300026089 Bacteria 1394
330 Ga0207676_10203094 3300026095 Bacteria 1753
331 Ga0207676_10450515 3300026095 Bacteria 1213
332 Ga0207674_10088043 3300026116 Bacteria 3098
333 Ga0207674_10206577 3300026116 Bacteria 1913
334 Ga0207675_100105063 3300026118 Bacteria 2662
335 Ga0207675_100127357 3300026118 Bacteria 2413
336 Ga0207675_100176213 3300026118 Bacteria 2046
337 Ga0207683_10002410 3300026121 Bacteria 16328
338 Ga0207683_10034443 3300026121 Bacteria 4401
339 Ga0207683_10224161 3300026121 Bacteria 1713
340 Ga0207683_10373615 3300026121 Bacteria 1310
341 Ga0207698_10279262 3300026142 Bacteria 1544
342 Ga0207698_10702806 3300026142 Bacteria 1006
343 Ga0209588_1065940 3300027671 Bacteria 1170
344 Ga0209813_10007110 3300027866 Bacteria 2780
345 Ga0207428_10170084 3300027907 Bacteria 1651
346 Ga0268266_10002269 3300028379 Bacteria 20890
347 Ga0268266_10038873 3300028379 Bacteria 4051
348 Ga0268266_10091551 3300028379 Bacteria 2666
349 Ga0268266_10147359 3300028379 Bacteria 2118
350 Ga0268266_10226125 3300028379 Bacteria 1722
351 Ga0268266_10259674 3300028379 Bacteria 1609
352 Ga0268266_10282415 3300028379 Bacteria 1544
353 Ga0268266_10570185 3300028379 Bacteria 1086
354 Ga0268265_10279340 3300028380 Bacteria 1493
355 Ga0268264_10000050 3300028381 Bacteria 323697
356 Ga0268264_10137373 3300028381 Bacteria 2175
357 Ga0268264_10145844 3300028381 Bacteria 2116
358 Ga0268264_10546012 3300028381 Bacteria 1136
359 Ga0307517_10000495 3300028786 Bacteria 67515
360 Ga0307517_10078944 3300028786 Bacteria 2839
361 Ga0307517_10182522 3300028786 Bacteria 1351
362 Ga0307515_10032002 3300028794 Bacteria 8735
363 Ga0307515_10079738 3300028794 Bacteria 4283
364 Ga0307515_10293439 3300028794 Bacteria 1319
365 Ga0265332_10013869 3300031238 Bacteria 3568
366 Ga0265331_10085589 3300031250 Bacteria 1460
367 Ga0307513_10060769 3300031456 Bacteria 4004
368 Ga0307513_10129744 3300031456 Bacteria 2469
369 Ga0307408_100058770 3300031548 Bacteria 2797
370 Ga0307508_10168165 3300031616 Bacteria 1796
371 Ga0265314_10000442 3300031711 Bacteria 55420
372 Ga0265314_10178592 3300031711 Bacteria 1274
373 Ga0265342_10011414 3300031712 Bacteria 6083
374 Ga0307516_10278258 3300031730 Bacteria 1356
375 Ga0307409_100325612 3300031995 Bacteria 1440
376 Ga0307416_100115994 3300032002 Bacteria 2373
377 Ga0307507_10295652 3300033179 Bacteria 998
378 Ga0307510_10001298 3300033180 Bacteria 27246
379 Ga0307510_10039508 3300033180 Bacteria 5196
380 Ga0307510_10201440 3300033180 Bacteria 1525
381 Ga0373930_0005297 3300034816 Bacteria 2139
382 Ga0373943_0264148 3300035170 Bacteria 970
383 Ga0373931_0001558 3300035691 Bacteria 9898
384 Ga0373927_0015634 3300035695 Bacteria 5012
385 Ga0373927_0042369 3300035695 Bacteria 2949
386 Ga0373925_0358835 3300037068 Bacteria 1184
387 Ga0395900_0067717 3300037418 Bacteria 3668
388 Ga0395901_0373807 3300038443 Bacteria 1468
389 Ga0451791_0289323 3300041451 Bacteria 1047
390 Ga0451797_0849116 3300041453 Bacteria 1099
391 Ga0451798_1007744 3300041458 Bacteria 1623
392 Ga0451833_0392613 3300041491 Bacteria 1403
393 Ga0451833_1391652 3300041491 Bacteria 1018
394 Ga0451849_0828767 3300041505 Bacteria 1440
395 Ga0451853_2008620 3300041512 Bacteria 1263
396 Ga0451577_0353543 3300042876 Bacteria 1333
397 Ga0466966_0000655 3300044684 Bacteria 22032
398 Ga0466961_0000824 3300044693 Bacteria 19377
399 Ga0466959_0006092 3300045049 Bacteria 8326
400 Ga0495617_015380 3300046452 Bacteria 2594
401 Ga0495592_0243001 3300046454 Bacteria 1194
402 Ga0495592_0313511 3300046454 Bacteria 1016
403 Ga0495603_0001476 3300046455 Bacteria 13701
404 Ga0495603_0044365 3300046455 Bacteria 2653
405 Ga0495603_0053020 3300046455 Bacteria 2407
406 Ga0495603_0060516 3300046455 Bacteria 2238
407 Ga0495603_0104697 3300046455 Bacteria 1651
408 Ga0495629_0189679 3300046459 Bacteria 1423
409 Ga0495629_0428533 3300046459 Bacteria 897
410 Ga0495638_0004917 3300046460 Bacteria 10042
411 Ga0495638_0026905 3300046460 Bacteria 3726
412 Ga0495638_0029197 3300046460 Bacteria 3556
413 Ga0495638_0104533 3300046460 Bacteria 1689
414 Ga0495641_0047271 3300046461 Bacteria 1976
415 Ga0495651_0000395 3300046462 Bacteria 33751
416 Ga0495651_0304948 3300046462 Bacteria 1067
417 Ga0495653_0120166 3300046463 Bacteria 1874
418 Ga0495580_0029577 3300046472 Bacteria 3975
419 Ga0495582_0149653 3300046473 Bacteria 1325
420 Ga0495605_0014418 3300046474 Bacteria 4332
421 Ga0495605_0088216 3300046474 Bacteria 1441
422 Ga0495639_0140609 3300046475 Bacteria 1160
423 Ga0495664_0005525 3300046477 Bacteria 6944
424 Ga0495664_0166283 3300046477 Bacteria 1338
425 Ga0495664_0357674 3300046477 Bacteria 879
426 Ga0495584_0073038 3300046491 Bacteria 1724
427 Ga0495585_0054480 3300046492 Bacteria 2211
428 Ga0495594_0013538 3300046499 Bacteria 4260
429 Ga0495606_0002695 3300046507 Bacteria 20064
430 Ga0495606_0005408 3300046507 Bacteria 12237
431 Ga0495606_0023051 3300046507 Bacteria 4522
432 Ga0495606_0108326 3300046507 Bacteria 1679
433 Ga0495608_0056460 3300046511 Bacteria 2593
434 Ga0495610_0057902 3300046512 Bacteria 1856
435 Ga0495610_0103940 3300046512 Bacteria 1268
436 Ga0495616_0080764 3300046513 Bacteria 1556
437 Ga0495628_0197967 3300046516 Bacteria 1515
438 Ga0495631_0167614 3300046518 Bacteria 942
439 Ga0495632_0033994 3300046519 Bacteria 2612
440 Ga0495632_0153126 3300046519 Bacteria 1065
441 Ga0495643_0091776 3300046522 Bacteria 1566
442 Ga0495648_0028364 3300046524 Bacteria 3730
443 Ga0495648_0156087 3300046524 Bacteria 1185
444 Ga0495652_0091231 3300046529 Bacteria 2491
445 Ga0495652_0115648 3300046529 Bacteria 2149
446 Ga0495587_0030030 3300046536 Bacteria 3297
447 Ga0495598_0051873 3300046537 Bacteria 1238
448 Ga0495621_0005132 3300046539 Bacteria 3742
449 Ga0495597_0031913 3300046542 Bacteria 2393
450 Ga0495645_0017202 3300046543 Bacteria 5178
451 Ga0495622_0017060 3300046557 Bacteria 3381
452 Ga0495622_0034133 3300046557 Bacteria 2374
453 Ga0495633_0148741 3300046558 Bacteria 1082
454 Ga0495667_0003397 3300046559 Bacteria 10663
455 Ga0495656_0001789 3300046615 Bacteria 7062
456 Ga0495656_0071481 3300046615 Bacteria 1542
457 Ga0495668_0023230 3300046616 Bacteria 3539
458 Ga0495668_0048621 3300046616 Bacteria 2353
459 Ga0495668_0153681 3300046616 Bacteria 1260
460 Ga0495611_0039664 3300046648 Bacteria 2097
461 Ga0495611_0054655 3300046648 Bacteria 1805
462 Ga0495625_0189004 3300046660 Bacteria 1365
463 Ga0495661_0180013 3300046665 Bacteria 1121
464 Ga0495588_0073891 3300046674 Bacteria 1775
465 Ga0495657_0005829 3300046675 Bacteria 9696
466 Ga0495599_0009822 3300046678 Bacteria 5857
467 Ga0495623_0075014 3300046679 Bacteria 2101
468 Ga0495646_0006037 3300046680 Bacteria 7682
469 Ga0495669_0001679 3300046684 Bacteria 9065
470 Ga0495669_0022934 3300046684 Bacteria 2713
471 Ga0495669_0195226 3300046684 Bacteria 966
472 Ga0495613_0083424 3300046689 Bacteria 2321
473 Ga0495670_0008532 3300046691 Bacteria 5044
474 Ga0495670_0015674 3300046691 Bacteria 3725
475 Ga0495670_0051046 3300046691 Bacteria 2070
476 Ga0495671_0035014 3300046692 Bacteria 2552
477 Ga0495649_0007606 3300046694 Bacteria 6586
478 Ga0495589_0060081 3300046794 Bacteria 1867
479 Ga0495600_0000352 3300046809 Bacteria 24397
480 Ga0495604_0000797 3300047317 Bacteria 26510
481 Ga0495674_0030963 3300047319 Bacteria 4862
482 Ga0495674_0163857 3300047319 Bacteria 1859
483 Ga0495674_0239118 3300047319 Bacteria 1497
484 Ga0495672_0011502 3300047320 Bacteria 6240
485 Ga0495672_0060962 3300047320 Bacteria 2176
486 Ga0495672_0093631 3300047320 Bacteria 1645
487 Ga0495672_0108218 3300047320 Bacteria 1496
488 Ga0495680_0006443 3300047322 Bacteria 10909
489 Ga0495675_0005946 3300047444 Bacteria 7459
490 Ga0495673_0030206 3300047469 Bacteria 2548
491 Ga0495686_0102584 3300047472 Bacteria 1724
492 Ga0495686_0125704 3300047472 Bacteria 1525
493 Ga0495602_0002266 3300048088 Bacteria 19452
494 Ga0495626_0048722 3300048091 Bacteria 1965
495 Ga0496100_0020531 3300048903 Bacteria 3962
496 Ga0496100_0273976 3300048903 Bacteria 1256
497 Ga0496101_0003593 3300048904 Bacteria 9679
498 Ga0496102_0005788 3300048905 Bacteria 10508
499 Ga0496102_0018930 3300048905 Bacteria 6058
500 Ga0496102_0040929 3300048905 Bacteria 4194
501 Ga0496102_0218405 3300048905 Bacteria 1797
502 Ga0496102_0705489 3300048905 Bacteria 932
503 Ga0496103_0052255 3300048906 Bacteria 2531
504 Ga0496104_0128624 3300048907 Bacteria 2432
505 Ga0496105_0018872 3300048908 Bacteria 5554
506 Ga0496105_0097928 3300048908 Bacteria 2422
507 Ga0496106_0000738 3300048909 Bacteria 23578
508 Ga0496106_0014619 3300048909 Bacteria 5801
509 Ga0496106_0088442 3300048909 Bacteria 2388
510 Ga0496107_0093754 3300048910 Bacteria 2196
511 Ga0496107_0280210 3300048910 Bacteria 1241
512 Ga0496108_0029232 3300048911 Bacteria 4562
513 Ga0496108_0077168 3300048911 Bacteria 2817
514 Ga0496108_0284283 3300048911 Bacteria 1440
515 Ga0496109_0223856 3300048912 Bacteria 1769
516 Ga0496109_0276965 3300048912 Bacteria 1581
517 Ga0496110_0007940 3300048913 Bacteria 8499
518 Ga0496110_0109651 3300048913 Bacteria 2479
519 Ga0496111_0034218 3300048914 Bacteria 3627
520 Ga0496111_0082118 3300048914 Bacteria 2353
521 Ga0496111_0343681 3300048914 Bacteria 1105
522 Ga0496112_0000015 3300048915 Bacteria 206423
523 Ga0496112_0001393 3300048915 Bacteria 18457
524 Ga0496112_0150732 3300048915 Bacteria 2292
525 Ga0496112_0799562 3300048915 Bacteria 868
526 Ga0496113_0001153 3300048916 Bacteria 14398
527 Ga0496115_0034876 3300048918 Bacteria 3977
528 Ga0496115_0075205 3300048918 Bacteria 2743
529 Ga0496115_0402774 3300048918 Bacteria 1110
530 Ga0496117_0076483 3300048920 Bacteria 2219
531 Ga0496117_0164809 3300048920 Bacteria 1294
532 Ga0496118_0010607 3300048921 Bacteria 9099
533 Ga0496118_0022899 3300048921 Bacteria 5444
534 Ga0496119_0136004 3300048922 Bacteria 1333
535 Ga0496120_0023761 3300048923 Bacteria 3833
536 Ga0496121_0002715 3300048924 Bacteria 26458
537 Ga0496121_0014116 3300048924 Bacteria 8513
538 Ga0496121_0027043 3300048924 Bacteria 5381
539 Ga0496121_0074827 3300048924 Bacteria 2707
540 Ga0496121_0165466 3300048924 Bacteria 1612
541 Ga0496122_0048297 3300048925 Bacteria 3275
542 Ga0496122_0050580 3300048925 Bacteria 3168
543 Ga0496122_0098809 3300048925 Bacteria 1959
544 Ga0496122_0135798 3300048925 Bacteria 1550
545 Ga0496124_0006828 3300048927 Bacteria 12312
546 Ga0496124_0044848 3300048927 Bacteria 3792
547 Ga0496124_0115256 3300048927 Bacteria 2157
548 Ga0496124_0123757 3300048927 Bacteria 2063
549 Ga0496125_0000048 3300048928 Bacteria 290651
550 Ga0496125_0038986 3300048928 Bacteria 4101
551 Ga0496125_0055323 3300048928 Bacteria 3234
552 Ga0496125_0108637 3300048928 Bacteria 2017
553 Ga0496126_0007732 3300048929 Bacteria 11722
554 Ga0496126_0009056 3300048929 Bacteria 10641
555 Ga0496126_0017000 3300048929 Bacteria 7257
556 Ga0496126_0038894 3300048929 Bacteria 4421
557 Ga0495678_082848 3300049459 Bacteria 1147
558 Ga0495682_0026950 3300049460 Bacteria 2133
559 Ga0501031_0072835 3300049568 Bacteria 2237
560 Ga0501033_0006948 3300049570 Bacteria 8839
561 Ga0501034_0220130 3300049571 Bacteria 1851
562 Ga0501047_0494994 3300049581 Bacteria 1049
563 Ga0501044_0115610 3300049823 Bacteria 2688
564 Ga0501045_0166113 3300049824 Bacteria 1644
565 nmdc:mga03n38_4822_c1 3300050490 Bacteria 4517
566 nmdc:mga00v17_218456_c1 3300050491 Bacteria 1234
567 nmdc:mga0yw44_187000_c1 3300050492 Bacteria 1365
568 nmdc:mga0yw44_54474_c1 3300050492 Bacteria 2431
569 nmdc:mga0yw44_76500_c1 3300050492 Bacteria 2089
570 nmdc:mga0k408_131574_c1 3300050493 Bacteria 1485
571 nmdc:mga0k408_138284_c1 3300050493 Bacteria 1448
572 nmdc:mga06z11_117317_c1 3300050494 Bacteria 1481
573 nmdc:mga06z11_196356_c1 3300050494 Bacteria 1170
574 nmdc:mga06z11_270306_c1 3300050494 Bacteria 1005
575 nmdc:mga06z11_64602_c1 3300050494 Bacteria 1919
576 nmdc:mga04h51_48244_c1 3300050495 Bacteria 1418
577 nmdc:mga07m45_119636_c1 3300050496 Bacteria 1521
578 nmdc:mga07m45_14479_c1 3300050496 Bacteria 4201
579 nmdc:mga07m45_40676_c1 3300050496 Bacteria 2601
580 nmdc:mga05p37_159096_c1 3300050507 Bacteria 2759
581 nmdc:mga0n895_517121_c1 3300050512 Bacteria 1201
582 nmdc:mga0sz30_11539_c3 3300050516 Bacteria 1428
583 nmdc:mga0sz30_26760_c1 3300050516 Bacteria 2366
584 nmdc:mga0sz30_3020_c1 3300050516 Bacteria 6030
585 Ga0495601_0129317 3300053077 Bacteria 1644
586 Ga0495619_0005951 3300053085 Bacteria 7726
587 Ga0500578_0272097 3300053086 Bacteria 1013
588 Ga0500643_000032 3300053087 Bacteria 200350
589 Ga0500643_017001 3300053087 Bacteria 2446
590 Ga0500644_0000586 3300053088 Bacteria 13950
591 Ga0500644_0030887 3300053088 Bacteria 1699
592 Ga0500647_0045308 3300053091 Bacteria 2112
593 Ga0500583_0041284 3300053092 Bacteria 2094
594 Ga0500583_0089177 3300053092 Bacteria 1499
595 Ga0500651_0014957 3300053093 Bacteria 4756
596 Ga0500651_0201876 3300053093 Bacteria 1173
597 Ga0500566_0001286 3300053094 Bacteria 14643
598 Ga0500566_0065992 3300053094 Bacteria 2040
599 Ga0500641_0000979 3300053096 Bacteria 10157
600 Ga0500641_0038479 3300053096 Bacteria 1922
601 Ga0500650_0104794 3300053098 Bacteria 1322
602 Ga0500554_002479 3300053102 Bacteria 3639
603 Ga0500555_000661 3300053103 Bacteria 13191
604 Ga0500556_0087384 3300053104 Bacteria 1187
605 Ga0500557_000087 3300053105 Bacteria 32155
606 Ga0500562_009297 3300053108 Bacteria 2485
607 Ga0500562_015597 3300053108 Bacteria 1950
608 Ga0500569_020848 3300053109 Bacteria 1725
609 Ga0500592_006334 3300053116 Bacteria 1885
610 Ga0500594_0013024 3300053118 Bacteria 1970
611 Ga0500595_000002 3300053119 Bacteria 1074388
612 Ga0500595_003475 3300053119 Bacteria 7332
613 Ga0500595_003663 3300053119 Bacteria 7110
614 Ga0500607_104610 3300053121 Bacteria 1399
615 Ga0500614_005932 3300053123 Bacteria 2566
616 Ga0500642_0000205 3300053130 Bacteria 24114
617 Ga0500655_017967 3300053133 Bacteria 1312
618 Ga0500658_0069955 3300053134 Bacteria 1478
619 Ga0500559_0000466 3300053136 Bacteria 28794
620 Ga0500564_047188 3300053138 Bacteria 1975
621 Ga0500568_0022169 3300053139 Bacteria 2723
622 Ga0500568_0075717 3300053139 Bacteria 1283
623 Ga0500568_0087825 3300053139 Bacteria 1175
624 Ga0500577_0024408 3300053142 Bacteria 2033
625 Ga0500577_0038318 3300053142 Bacteria 1730
626 Ga0500585_043718 3300053144 Bacteria 1587
627 Ga0500586_000420 3300053145 Bacteria 8504
628 Ga0500589_038837 3300053147 Bacteria 2222
629 Ga0500589_042316 3300053147 Bacteria 2124
630 Ga0500590_124461 3300053148 Bacteria 1203
631 Ga0500590_128495 3300053148 Bacteria 1176
632 Ga0500590_197829 3300053148 Bacteria 854
633 Ga0500603_000363 3300053150 Bacteria 11878
634 Ga0500616_0104823 3300053153 Bacteria 1376
635 Ga0500622_0014555 3300053156 Bacteria 4222
636 Ga0500627_0118462 3300053158 Bacteria 1193
637 Ga0500633_0119695 3300053160 Bacteria 979
638 Ga0500634_0087687 3300053161 Bacteria 1588
639 Ga0500638_084349 3300053162 Bacteria 1505
640 Ga0500638_126007 3300053162 Bacteria 1166
641 Ga0500636_0000276 3300053177 Bacteria 28456
642 Ga0500636_0006002 3300053177 Bacteria 6963
643 Ga0500636_0128743 3300053177 Bacteria 1413
644 Ga0500637_0000154 3300053178 Bacteria 25097
645 Ga0500625_000180 3300053729 Bacteria 13895
646 Ga0500645_025087 3300053730 Bacteria 1820
647 Ga0500645_025428 3300053730 Bacteria 1806
648 Ga0500599_014657 3300053736 Bacteria 1070
649 2507508441 2507262055 Bacteria 8048963
650 2508542510 2508501009 Bacteria 7784016
651 2508691717 2508501042 Bacteria 8719808
652 2511394206 2511231028 Bacteria 8046582
653 2513592952 2513237087 Bacteria 5817514
654 2513645698 2513237095 Bacteria 8976980
655 2513872911 2513237139 Bacteria 8737671
656 2515627066 2515154112 Bacteria 8294334
657 2517107748 2517093001 Bacteria 9002274
658 2524437488 2524023205 Bacteria 8918781
659 2528852365 2528768022 Bacteria 10457665
660 2617347373 2617270735 Bacteria 9163226
661 2644302446 2643221654 Bacteria 5273570
662 2745076520 2744054633 Bacteria 8678936
663 2793065404 2791355196 Bacteria 7323613
664 2805915191 2802429603 Bacteria 8777136
665 2818238743 2816332527 Bacteria 8933356
666 2824669280 2824661429 Bacteria 9877870
667 2824701496 2824696289 Bacteria 8335049
668 2824709065 2824704595 Bacteria 9667483
669 2824761789 2824753945 Bacteria 9787441
670 2824769982 2824763712 Bacteria 9792355
671 2824780877 2824773399 Bacteria 8360218
672 2841958806 2841957949 Bacteria 8652217
673 2842038917 2842038055 Bacteria 8002051
674 2842048137 2842045827 Bacteria 8006841
675 2847946710 2847939898 Bacteria 8606328
676 2874598196 2874590934 Bacteria 8299676
677 2874627692 2874620515 Bacteria 8290088
678 2874631997 2874628541 Bacteria 8630250
679 2874652748 2874645413 Bacteria 8214782
680 2876764655 2876761206 Bacteria 10111113
681 2876778326 2876771140 Bacteria 8287509
682 2876825805 2876818435 Bacteria 8274608
683 2879082120 2879074833 Bacteria 8279565
684 2879105763 2879099564 Bacteria 10442239
685 2879135267 2879127579 Bacteria 8294491
686 2879150476 2879142872 Bacteria 8267021
687 2885411359 2885409591 Bacteria 9235467
688 2888384211 2888378607 Bacteria 9652610
689 2889035770 2889033259 Bacteria 9099371
690 2904672988 2904666416 Bacteria 8226587
691 2904714807 2904711408 Bacteria 9771557
692 2908764790 2908756301 Bacteria 8864324
693 2922374552
694 2929618217 2929615660 Bacteria 9193770
695 2929632405 2929624759 Bacteria 9339455
696 2932790512 2932784394 Bacteria 9704911
697 2932799810 2932794094 Bacteria 7915132
698 2932806939 2932801729 Bacteria 7987968
699 2932810933 2932809354 Bacteria 9135765
700 2932823737 2932818245 Bacteria 9955613
701 2932830143 2932828146 Bacteria 9745859
702 2933580145 2933577622 Bacteria 9116884
703 2935609021 2935608549 Bacteria 8203142
704 2935622631 2935616580 Bacteria 9032984
705 2935642569 2935638405 Bacteria 10015038
706 2935653273 2935648319 Bacteria 8801166
707 2935660256 2935656913 Bacteria 8965014
708 2935668127 2935665750 Bacteria 9571747
709 2935676161 2935675223 Bacteria 9928132
710 2935686144 2935684952 Bacteria 9590419
711 2935701230 2935694250 Bacteria 9291695
712 2935705987 2935703347 Bacteria 10242284
713 2935714696 2935713505 Bacteria 9608509
714 2935725315 2935722832 Bacteria 9608746
715 2935732325 2935732158 Bacteria 9706831
716 2935741704 2935741537 Bacteria 9707219
717 2935752109 2935750917 Bacteria 9590372
718 2935766457 2935760218 Bacteria 9817913
719 2935802986 2935801545 Bacteria 9301974
720 2935814303 2935810662 Bacteria 9401221
721 2935822181 2935819856 Bacteria 8261050
722 2935831440 2935827899 Bacteria 10038562
723 2935838300 2935837841 Bacteria 9454360
724 2935847763 2935847175 Bacteria 8228321
725 2935860880 2935855204 Bacteria 9035059
726 2935869783 2935864058 Bacteria 9784707
727 2935878798 2935873716 Bacteria 9632195
728 2935886937 2935883170 Bacteria 7964738
729 2935908965 2935908558 Bacteria 8568796
730 2935919683 2935916978 Bacteria 9113783
731 2935926461 2935926038 Bacteria 8601059
732 2935934911 2935934488 Bacteria 8602579
733 2935943361 2935942939 Bacteria 8599779
734 2935951799 2935951376 Bacteria 8602333
735 2935967924 2935967501 Bacteria 8603075
736 2935978548 2935975950 Bacteria 8347125
737 2935991264 2935984226 Bacteria 8302647
738 2935994806 2935992306 Bacteria 9802711
739 2936003448 2936002035 Bacteria 9362176
740 2936016143 2936011229 Bacteria 8801034
741 2936024776 2936019824 Bacteria 8804134
742 2936032024 2936028420 Bacteria 8965941
743 2936039859 2936037263 Bacteria 9446081
744 2936049885 2936046547 Bacteria 8903709
745 2936060837 2936055302 Bacteria 8785755
746 2940557088 2940556831 Bacteria 9590747
747 2941539032 2941538514 Bacteria 9402094
748 3005484463 3005483717 Bacteria 7877331
749 8016522170 8016511872 Bacteria 9921665
750 8016640176 8016630954 Bacteria 9217207
751 8017063501 8017057580 Bacteria 10023680
752 8019582821 8019576017 Bacteria 10049540
753 8019600741 8019597564 Bacteria 10041141
754 8019617811 8019608314 Bacteria 10042931
755 8019628330 8019619141 Bacteria 9218857
756 8019634300 8019629233 Bacteria 8687553
757 8019645437 8019638758 Bacteria 9062356
758 8019662172 8019659431 Bacteria 8577854
759 8019671689 8019668869 Bacteria 8791617
760 8019684408 8019678201 Bacteria 8863603
761 8019690222 8019687851 Bacteria 8712826
762 8055746194 8055742211 Bacteria 9226248
763 Ga0495635_0313422
764 JGI24739J22299_10073577
765 JGI24742J22300_10003138
766 JGI25406J46586_10000032
767 JGI25165J46597_1006089
768 JGI25153J46596_10000703
769 JGI25153J46596_10009007
770 rootL2_10104037
771 JGI25160J50197_1000477
772 JGI25160J50197_1004410
773 JGI25404J52841_10002128
774 JGI25404J52841_10008534
775 JGI25404J52841_10036461
776 Ga0055524_1025722
777 Ga0055531_10004834
778 Ga0065165_1001332
779 Ga0065165_1002328
780 Ga0065165_1004197
781 Ga0065165_1026352
782 Ga0070658_10268080
783 Ga0070658_10597099
784 Ga0070676_10151782
785 Ga0070676_10189963
786 Ga0070690_100170484
787 Ga0070670_100149562
788 Ga0070670_100160418
789 Ga0070670_100519621
790 Ga0068869_100092967
791 Ga0068869_100277581
792 Ga0070680_100177650
793 Ga0068868_100012337
794 Ga0068868_100080845
795 Ga0070660_100160162
796 Ga0070660_100362005
797 Ga0070660_100413811
798 Ga0070689_100369428
799 Ga0070687_100086165
800 Ga0070687_100227499
801 Ga0070668_100077918
802 Ga0070668_100125264
803 Ga0070668_100144915
804 Ga0070675_100159173
805 Ga0070675_100571165
806 Ga0070671_100026868
807 Ga0070671_100161729
808 Ga0070674_100203708
809 Ga0070674_100253795
810 Ga0070673_100061854
811 Ga0070667_100108874
812 Ga0070667_100169025
813 Ga0070667_100208898
814 Ga0070700_100074709
815 Ga0070700_100441908
816 Ga0070663_100206634
817 Ga0070663_100529856
818 Ga0070678_100016671
819 Ga0070678_100086825
820 Ga0070678_100316700
821 Ga0070678_100442816
822 Ga0070662_100102922
823 Ga0070681_10380892
824 Ga0068867_100222944
825 Ga0070685_10155234
826 Ga0070685_10162665
827 Ga0070698_100094939
828 Ga0070699_100054835
829 Ga0070679_100295374
830 Ga0070684_100035043
831 Ga0068853_100014361
832 Ga0068853_100183028
833 Ga0068853_100493189
834 Ga0068853_100675741
835 Ga0070672_100291873
836 Ga0070672_100390283
837 Ga0070672_100400152
838 Ga0070696_100092959
839 Ga0070696_100461817
840 Ga0070693_100018601
841 Ga0070665_100101613
842 Ga0070665_100135781
843 Ga0070665_100153024
844 Ga0070665_100310026
845 Ga0068855_100020692
846 Ga0068855_100042555
847 Ga0068855_100166927
848 Ga0068855_100510373
849 Ga0070664_100534018
850 Ga0068857_100035497
851 Ga0068857_100227518
852 Ga0068854_100447793
853 Ga0068856_100057288
854 Ga0068856_100158894
855 Ga0068856_100354871
856 Ga0068856_100379144
857 Ga0070702_100031553
858 Ga0070702_100287464
859 Ga0068852_100119383
860 Ga0068852_100154341
861 Ga0068852_100680699
862 Ga0068859_100064180
863 Ga0068859_100131895
864 Ga0068861_100306531
865 Ga0068861_100369679
866 Ga0068870_10158318
867 Ga0068858_100072449
868 Ga0068858_100072909
869 Ga0068858_100321706
870 Ga0068858_100328021
871 Ga0068858_100446758
872 Ga0068860_100011106
873 Ga0068860_100104454
874 Ga0068860_100119905
875 Ga0068860_100190942
876 Ga0068862_100099824
877 Ga0068862_100246158
878 Ga0068862_100246855
879 Ga0081455_10009280
880 Ga0081455_10010918
881 Ga0081540_1003616
882 Ga0081540_1011521
883 Ga0081540_1020462
884 Ga0081540_1054235
885 Ga0081540_1056557
886 Ga0081539_10000129
887 Ga0075365_10026080
888 Ga0075365_10031948
889 Ga0075365_10037373
890 Ga0075365_10074762
891 Ga0075365_10117983
892 Ga0075368_10007862
893 Ga0075363_100008126
894 Ga0075363_100032810
895 Ga0075364_10041708
896 Ga0075364_10067069
897 Ga0075364_10185445
898 Ga0075364_10226100
899 Ga0075364_10255951
900 Ga0075362_10063171
901 Ga0075362_10116711
902 Ga0075367_10011678
903 Ga0075367_10018276
904 Ga0075367_10097686
905 Ga0075367_10109496
906 Ga0075367_10167511
907 Ga0075367_10207908
908 Ga0075369_10014918
909 Ga0075369_10019361
910 Ga0075369_10034113
911 Ga0075366_10008824
912 Ga0075366_10093141
913 Ga0075366_10108003
914 Ga0075366_10180723
915 Ga0075366_10257623
916 Ga0097621_100098374
917 Ga0097621_100122067
918 Ga0075370_10008824
919 Ga0075370_10038637
920 Ga0068871_100032946
921 Ga0068871_100077828
922 Ga0068871_100424294
923 Ga0068871_100529647
924 Ga0075434_100811279
925 Ga0068865_100068455
926 Ga0068865_100147439
927 Ga0097620_100064181
928 Ga0097620_100131895
929 Ga0075435_100540707
930 Ga0099794_10028249
931 Ga0099794_10107773
932 Ga0105250_10102951
933 Ga0105240_10018175
934 Ga0105240_10066059
935 Ga0105240_10101333
936 Ga0105240_10264432
937 Ga0111539_10280269
938 Ga0105245_10025888
939 Ga0105245_10102992
940 Ga0105245_10181032
941 Ga0105245_10379185
942 Ga0105247_10029142
943 Ga0105247_10083958
944 Ga0105247_10140180
945 Ga0114129_10924860
946 Ga0105243_10085274
947 Ga0105243_10438902
948 Ga0105241_10077267
949 Ga0105241_10102753
950 Ga0105241_10493649
951 Ga0105242_10094414
952 Ga0105242_10302781
953 Ga0105248_10066430
954 Ga0105248_10087042
955 Ga0105248_10107533
956 Ga0105248_10224038
957 Ga0105237_10022649
958 Ga0105237_10064803
959 Ga0105237_10262593
960 Ga0105238_10008285
961 Ga0105238_10021126
962 Ga0105238_10088796
963 Ga0105238_10136717
964 Ga0105238_10141113
965 Ga0105238_10394653
966 Ga0105238_10736805
967 Ga0099796_10011674
968 Ga0099796_10053678
969 Ga0105239_10016541
970 Ga0105239_10049807
971 Ga0105239_10063898
972 Ga0105239_10069094
973 Ga0105239_10144477
974 Ga0105239_10314126
975 Ga0105239_10922580
976 Ga0105246_10013142
977 Ga0105246_10036170
978 Ga0105246_10290767
979 Ga0105246_10341893
980 Ga0157370_10065946
981 Ga0157370_10152169
982 Ga0157370_10410285
983 Ga0157374_10032115
984 Ga0157374_10043874
985 Ga0157374_10189659
986 Ga0157374_10247280
987 Ga0157378_10036012
988 Ga0163162_10142100
989 Ga0163162_10147048
990 Ga0163162_10209212
991 Ga0157375_10016776
992 Ga0157375_10086459
993 Ga0157375_10230235
994 Ga0157375_10278925
995 Ga0157375_10592269
996 Ga0157375_10804285
997 Ga0157380_10072111
998 Ga0157380_10097137
999 Ga0157380_10122732
1000 Ga0157380_10404893
1001 Ga0157379_10033950
1002 Ga0157379_10065109
1003 Ga0157379_10138997
1004 Ga0157376_10010552
1005 Ga0157376_10212542
1006 Ga0157376_10306236
1007 Ga0163161_10029860
1008 Ga0213876_10071762
1009 Ga0209148_1000613
1010 Ga0209233_1016071
1011 Ga0209233_1041547
1012 Ga0209455_1006964
1013 Ga0209758_1000140
1014 Ga0209758_1002974
1015 Ga0209758_1004986
1016 Ga0209256_1002028
1017 Ga0209256_1031892
1018 Ga0207426_1000626
1019 Ga0207426_1001273
1020 Ga0207426_1005335
1021 Ga0209257_1002350
1022 Ga0209257_1043110
1023 Ga0207656_10027165
1024 Ga0207710_10024752
1025 Ga0207688_10042130
1026 Ga0207688_10156202
1027 Ga0207680_10056023
1028 Ga0207680_10171494
1029 Ga0207647_10013090
1030 Ga0207645_10058839
1031 Ga0207645_10115898
1032 Ga0207705_10204989
1033 Ga0207654_10004914
1034 Ga0207707_10000555
1035 Ga0207671_10007288
1036 Ga0207671_10051903
1037 Ga0207671_10054333
1038 Ga0207660_10010799
1039 Ga0207657_10006568
1040 Ga0207657_10156458
1041 Ga0207657_10157040
1042 Ga0207649_10232464
1043 Ga0207649_10295852
1044 Ga0207652_10003864
1045 Ga0207694_10124020
1046 Ga0207694_10155775
1047 Ga0207694_10588051
1048 Ga0207650_10139734
1049 Ga0207650_10143467
1050 Ga0207659_10126260
1051 Ga0207659_10319424
1052 Ga0207687_10056056
1053 Ga0207687_10164050
1054 Ga0207700_10127217
1055 Ga0207706_10029805
1056 Ga0207706_10126203
1057 Ga0207709_10037318
1058 Ga0207669_10054487
1059 Ga0207704_10299860
1060 Ga0207691_10052085
1061 Ga0207691_10065308
1062 Ga0207711_10086987
1063 Ga0207667_10009120
1064 Ga0207667_10206576
1065 Ga0207651_10259850
1066 Ga0207712_10009125
1067 Ga0207668_10061752
1068 Ga0207668_10136380
1069 Ga0207668_10250794
1070 Ga0207640_10108185
1071 Ga0207658_10105885
1072 Ga0207658_10129812
1073 Ga0207677_10094235
1074 Ga0207677_10264943
1075 Ga0207703_10034345
1076 Ga0207703_10345835
1077 Ga0207703_10382993
1078 Ga0207703_10530439
1079 Ga0207639_10096146
1080 Ga0207639_10104906
1081 Ga0207639_10437191
1082 Ga0207639_10666466
1083 Ga0207678_10060305
1084 Ga0207678_10081476
1085 Ga0207678_10507462
1086 Ga0207702_10100574
1087 Ga0207641_10101402
1088 Ga0207641_10152289
1089 Ga0207641_10455405
1090 Ga0207641_10595345
1091 Ga0207648_10319859
1092 Ga0207676_10203094
1093 Ga0207676_10450515
1094 Ga0207674_10088043
1095 Ga0207674_10206577
1096 Ga0207675_100105063
1097 Ga0207675_100127357
1098 Ga0207675_100176213
1099 Ga0207683_10002410
1100 Ga0207683_10034443
1101 Ga0207683_10224161
1102 Ga0207683_10373615
1103 Ga0207698_10279262
1104 Ga0207698_10702806
1105 Ga0209588_1065940
1106 Ga0209813_10007110
1107 Ga0207428_10170084
1108 Ga0268266_10002269
1109 Ga0268266_10038873
1110 Ga0268266_10091551
1111 Ga0268266_10147359
1112 Ga0268266_10226125
1113 Ga0268266_10259674
1114 Ga0268266_10282415
1115 Ga0268266_10570185
1116 Ga0268265_10279340
1117 Ga0268264_10000050
1118 Ga0268264_10137373
1119 Ga0268264_10145844
1120 Ga0268264_10546012
1121 Ga0307517_10000495
1122 Ga0307517_10078944
1123 Ga0307517_10182522
1124 Ga0307515_10032002
1125 Ga0307515_10079738
1126 Ga0307515_10293439
1127 Ga0265332_10013869
1128 Ga0265331_10085589
1129 Ga0307513_10060769
1130 Ga0307513_10129744
1131 Ga0307408_100058770
1132 Ga0307508_10168165
1133 Ga0265314_10000442
1134 Ga0265314_10178592
1135 Ga0265342_10011414
1136 Ga0307516_10278258
1137 Ga0307409_100325612
1138 Ga0307416_100115994
1139 Ga0307507_10295652
1140 Ga0307510_10001298
1141 Ga0307510_10039508
1142 Ga0307510_10201440
1143 Ga0373930_0005297
1144 Ga0373943_0264148
1145 Ga0373931_0001558
1146 Ga0373927_0015634
1147 Ga0373927_0042369
1148 Ga0373925_0358835
1149 Ga0395900_0067717
1150 Ga0395901_0373807
1151 Ga0451791_0289323
1152 Ga0451797_0849116
1153 Ga0451798_1007744
1154 Ga0451833_0392613
1155 Ga0451833_1391652
1156 Ga0451849_0828767
1157 Ga0451853_2008620
1158 Ga0451577_0353543
1159 Ga0466966_0000655
1160 Ga0466961_0000824
1161 Ga0466959_0006092
1162 Ga0495617_015380
1163 Ga0495592_0243001
1164 Ga0495592_0313511
1165 Ga0495603_0001476
1166 Ga0495603_0044365
1167 Ga0495603_0053020
1168 Ga0495603_0060516
1169 Ga0495603_0104697
1170 Ga0495629_0189679
1171 Ga0495629_0428533
1172 Ga0495638_0004917
1173 Ga0495638_0026905
1174 Ga0495638_0029197
1175 Ga0495638_0104533
1176 Ga0495641_0047271
1177 Ga0495651_0000395
1178 Ga0495651_0304948
1179 Ga0495653_0120166
1180 Ga0495580_0029577
1181 Ga0495582_0149653
1182 Ga0495605_0014418
1183 Ga0495605_0088216
1184 Ga0495639_0140609
1185 Ga0495664_0005525
1186 Ga0495664_0166283
1187 Ga0495664_0357674
1188 Ga0495584_0073038
1189 Ga0495585_0054480
1190 Ga0495594_0013538
1191 Ga0495606_0002695
1192 Ga0495606_0005408
1193 Ga0495606_0023051
1194 Ga0495606_0108326
1195 Ga0495608_0056460
1196 Ga0495610_0057902
1197 Ga0495610_0103940
1198 Ga0495616_0080764
1199 Ga0495628_0197967
1200 Ga0495631_0167614
1201 Ga0495632_0033994
1202 Ga0495632_0153126
1203 Ga0495643_0091776
1204 Ga0495648_0028364
1205 Ga0495648_0156087
1206 Ga0495652_0091231
1207 Ga0495652_0115648
1208 Ga0495587_0030030
1209 Ga0495598_0051873
1210 Ga0495621_0005132
1211 Ga0495597_0031913
1212 Ga0495645_0017202
1213 Ga0495622_0017060
1214 Ga0495622_0034133
1215 Ga0495633_0148741
1216 Ga0495667_0003397
1217 Ga0495656_0001789
1218 Ga0495656_0071481
1219 Ga0495668_0023230
1220 Ga0495668_0048621
1221 Ga0495668_0153681
1222 Ga0495611_0039664
1223 Ga0495611_0054655
1224 Ga0495625_0189004
1225 Ga0495661_0180013
1226 Ga0495588_0073891
1227 Ga0495657_0005829
1228 Ga0495599_0009822
1229 Ga0495623_0075014
1230 Ga0495646_0006037
1231 Ga0495669_0001679
1232 Ga0495669_0022934
1233 Ga0495669_0195226
1234 Ga0495613_0083424
1235 Ga0495670_0008532
1236 Ga0495670_0015674
1237 Ga0495670_0051046
1238 Ga0495671_0035014
1239 Ga0495649_0007606
1240 Ga0495589_0060081
1241 Ga0495600_0000352
1242 Ga0495604_0000797
1243 Ga0495674_0030963
1244 Ga0495674_0163857
1245 Ga0495674_0239118
1246 Ga0495672_0011502
1247 Ga0495672_0060962
1248 Ga0495672_0093631
1249 Ga0495672_0108218
1250 Ga0495680_0006443
1251 Ga0495675_0005946
1252 Ga0495673_0030206
1253 Ga0495686_0102584
1254 Ga0495686_0125704
1255 Ga0495602_0002266
1256 Ga0495626_0048722
1257 Ga0496100_0020531
1258 Ga0496100_0273976
1259 Ga0496101_0003593
1260 Ga0496102_0005788
1261 Ga0496102_0018930
1262 Ga0496102_0040929
1263 Ga0496102_0218405
1264 Ga0496102_0705489
1265 Ga0496103_0052255
1266 Ga0496104_0128624
1267 Ga0496105_0018872
1268 Ga0496105_0097928
1269 Ga0496106_0000738
1270 Ga0496106_0014619
1271 Ga0496106_0088442
1272 Ga0496107_0093754
1273 Ga0496107_0280210
1274 Ga0496108_0029232
1275 Ga0496108_0077168
1276 Ga0496108_0284283
1277 Ga0496109_0223856
1278 Ga0496109_0276965
1279 Ga0496110_0007940
1280 Ga0496110_0109651
1281 Ga0496111_0034218
1282 Ga0496111_0082118
1283 Ga0496111_0343681
1284 Ga0496112_0000015
1285 Ga0496112_0001393
1286 Ga0496112_0150732
1287 Ga0496112_0799562
1288 Ga0496113_0001153
1289 Ga0496115_0034876
1290 Ga0496115_0075205
1291 Ga0496115_0402774
1292 Ga0496117_0076483
1293 Ga0496117_0164809
1294 Ga0496118_0010607
1295 Ga0496118_0022899
1296 Ga0496119_0136004
1297 Ga0496120_0023761
1298 Ga0496121_0002715
1299 Ga0496121_0014116
1300 Ga0496121_0027043
1301 Ga0496121_0074827
1302 Ga0496121_0165466
1303 Ga0496122_0048297
1304 Ga0496122_0050580
1305 Ga0496122_0098809
1306 Ga0496122_0135798
1307 Ga0496124_0006828
1308 Ga0496124_0044848
1309 Ga0496124_0115256
1310 Ga0496124_0123757
1311 Ga0496125_0000048
1312 Ga0496125_0038986
1313 Ga0496125_0055323
1314 Ga0496125_0108637
1315 Ga0496126_0007732
1316 Ga0496126_0009056
1317 Ga0496126_0017000
1318 Ga0496126_0038894
1319 Ga0495678_082848
1320 Ga0495682_0026950
1321 Ga0501031_0072835
1322 Ga0501033_0006948
1323 Ga0501034_0220130
1324 Ga0501047_0494994
1325 Ga0501044_0115610
1326 Ga0501045_0166113
1327 nmdc:mga03n38_4822_c1
1328 nmdc:mga00v17_218456_c1
1329 nmdc:mga0yw44_187000_c1
1330 nmdc:mga0yw44_54474_c1
1331 nmdc:mga0yw44_76500_c1
1332 nmdc:mga0k408_131574_c1
1333 nmdc:mga0k408_138284_c1
1334 nmdc:mga06z11_117317_c1
1335 nmdc:mga06z11_196356_c1
1336 nmdc:mga06z11_270306_c1
1337 nmdc:mga06z11_64602_c1
1338 nmdc:mga04h51_48244_c1
1339 nmdc:mga07m45_119636_c1
1340 nmdc:mga07m45_14479_c1
1341 nmdc:mga07m45_40676_c1
1342 nmdc:mga05p37_159096_c1
1343 nmdc:mga0n895_517121_c1
1344 nmdc:mga0sz30_11539_c3
1345 nmdc:mga0sz30_26760_c1
1346 nmdc:mga0sz30_3020_c1
1347 Ga0495601_0129317
1348 Ga0495619_0005951
1349 Ga0500578_0272097
1350 Ga0500643_000032
1351 Ga0500643_017001
1352 Ga0500644_0000586
1353 Ga0500644_0030887
1354 Ga0500647_0045308
1355 Ga0500583_0041284
1356 Ga0500583_0089177
1357 Ga0500651_0014957
1358 Ga0500651_0201876
1359 Ga0500566_0001286
1360 Ga0500566_0065992
1361 Ga0500641_0000979
1362 Ga0500641_0038479
1363 Ga0500650_0104794
1364 Ga0500554_002479
1365 Ga0500555_000661
1366 Ga0500556_0087384
1367 Ga0500557_000087
1368 Ga0500562_009297
1369 Ga0500562_015597
1370 Ga0500569_020848
1371 Ga0500592_006334
1372 Ga0500594_0013024
1373 Ga0500595_000002
1374 Ga0500595_003475
1375 Ga0500595_003663
1376 Ga0500607_104610
1377 Ga0500614_005932
1378 Ga0500642_0000205
1379 Ga0500655_017967
1380 Ga0500658_0069955
1381 Ga0500559_0000466
1382 Ga0500564_047188
1383 Ga0500568_0022169
1384 Ga0500568_0075717
1385 Ga0500568_0087825
1386 Ga0500577_0024408
1387 Ga0500577_0038318
1388 Ga0500585_043718
1389 Ga0500586_000420
1390 Ga0500589_038837
1391 Ga0500589_042316
1392 Ga0500590_124461
1393 Ga0500590_128495
1394 Ga0500590_197829
1395 Ga0500603_000363
1396 Ga0500616_0104823
1397 Ga0500622_0014555
1398 Ga0500627_0118462
1399 Ga0500633_0119695
1400 Ga0500634_0087687
1401 Ga0500638_084349
1402 Ga0500638_126007
1403 Ga0500636_0000276
1404 Ga0500636_0006002
1405 Ga0500636_0128743
1406 Ga0500637_0000154
1407 Ga0500625_000180
1408 Ga0500645_025087
1409 Ga0500645_025428
1410 Ga0500599_014657
1411 2507508441
1412 2508542510
1413 2508691717
1414 2511394206
1415 2513592952
1416 2513645698
1417 2513872911
1418 2515627066
1419 2517107748
1420 2524437488
1421 2528852365
1422 2617347373
1423 2644302446
1424 2745076520
1425 2793065404
1426 2805915191
1427 2818238743
1428 2824669280
1429 2824701496
1430 2824709065
1431 2824761789
1432 2824769982
1433 2824780877
1434 2841958806
1435 2842038917
1436 2842048137
1437 2847946710
1438 2874598196
1439 2874627692
1440 2874631997
1441 2874652748
1442 2876764655
1443 2876778326
1444 2876825805
1445 2879082120
1446 2879105763
1447 2879135267
1448 2879150476
1449 2885411359
1450 2888384211
1451 2889035770
1452 2904672988
1453 2904714807
1454 2908764790
1455 2922374552
1456 2929618217
1457 2929632405
1458 2932790512
1459 2932799810
1460 2932806939
1461 2932810933
1462 2932823737
1463 2932830143
1464 2933580145
1465 2935609021
1466 2935622631
1467 2935642569
1468 2935653273
1469 2935660256
1470 2935668127
1471 2935676161
1472 2935686144
1473 2935701230
1474 2935705987
1475 2935714696
1476 2935725315
1477 2935732325
1478 2935741704
1479 2935752109
1480 2935766457
1481 2935802986
1482 2935814303
1483 2935822181
1484 2935831440
1485 2935838300
1486 2935847763
1487 2935860880
1488 2935869783
1489 2935878798
1490 2935886937
1491 2935908965
1492 2935919683
1493 2935926461
1494 2935934911
1495 2935943361
1496 2935951799
1497 2935967924
1498 2935978548
1499 2935991264
1500 2935994806
1501 2936003448
1502 2936016143
1503 2936024776
1504 2936032024
1505 2936039859
1506 2936049885
1507 2936060837
1508 2940557088
1509 2941539032
1510 3005484463
1511 8016522170
1512 8016640176
1513 8017063501
1514 8019582821
1515 8019600741
1516 8019617811
1517 8019628330
1518 8019634300
1519 8019645437
1520 8019662172
1521 8019671689
1522 8019684408
1523 8019690222
1524 8055746194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1p-assembly1.cif.gz_A shel_16390 protein, a putative sgnh hydrolase from slackia heliotrinireducens 0.7652 40 234
4jgg-assembly2.cif.gz_B crystal structure of tesa 0.7652 40 237
4jgg-assembly2.cif.gz_B crystal structure of tesa 0.7502 40 237
4rsh-assembly3.cif.gz_C structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2 0.7447 39 235
4s1p-assembly1.cif.gz_A shel_16390 protein, a putative sgnh hydrolase from slackia heliotrinireducens 0.7416 40 234
ID Description Score Start End Superfamily
af_I6YB54_43_336_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7846 120 166 3.20.20.80
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7652 40 237 3.40.50.1110
4s1pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7648 40 234 3.40.50.1110
4s1pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7526 40 234 3.40.50.1110
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7502 40 237 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A536SD25-F1-model_v4 DUF4886 domain-containing protein 0.9916 124 272 GO:0052689
AF-A0A536SD25-F1-model_v4 DUF4886 domain-containing protein 0.9784 124 272 GO:0052689
AF-A0A6H0AAB2-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9777 149 220 GO:0052689
AF-A0A388Q5Y2-F1-model_v4 Xanthomonalisin 0.9774 192 268
AF-A0A0H3DPJ1-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9751 149 272 GO:0052689

Map