F479472

General Info

Members Datasets Scaffolds Average Seq Length
759 290 758 392

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100005874|Ga0070665_1000058742
Length 442
Sequence MDLFDGLEESFAHGRIHKNHNFVYSVISWRVIYPAKISTYQILPDGVKCMILKTRLYTPGPTPLLPAAQFAMAAADMHHRTPEFRALFQKVLAQLKVFVGTKNDVLLLSSSGTGAMEASVSNLTSPGDKVLVLTAGKFGERWTGLAKAFGCEPEVVSAPYGETFDLRQVSAALKPEHRVVYMQSTETSTAAKHDVEAVAKLIKELVPETILVVDGITGLGTTHFDVDGWGIDILIGGSQKAVMIPPGLAYLSVSEKAWAAMEKSKNPRYYFDLRKERKNAVKGESAYTPAVALVAGLGAALDYIAGQAHGDLEKGREALVNNAIVNAEATRAGLVSLGFTLFAPTAPAAXXTAVAVPEGMDSGAVVKALKSKFALVTANGQGEMQGRIFRVAHLGFFDYMDTIAFLGAMEHIAKDTLGLKVEFGQAVAAAQKVYATRVTSGQ

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.79
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 5.4
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000825 3300000546 Bacteria 5101
2 rootH2_10044833 3300003320 Bacteria 2690
3 rootH2_10068046 3300003320 Bacteria 1441
4 rootH2_10094440 3300003320 Bacteria 1380
5 Ga0058861_10017042 3300004800 Bacteria 2949
6 Ga0058861_11866551 3300004800 Bacteria 1342
7 Ga0070658_10043287 3300005327 Bacteria 3637
8 Ga0070658_10084479 3300005327 Bacteria 2610
9 Ga0070658_10111993 3300005327 Unclassified 2262
10 Ga0070683_100008847 3300005329 Bacteria 8569
11 Ga0070683_100011254 3300005329 Bacteria 7721
12 Ga0070683_100016119 3300005329 Bacteria 6580
13 Ga0070683_100016484 3300005329 Bacteria 6517
14 Ga0070690_100179765 3300005330 Bacteria 1461
15 Ga0070670_100002362 3300005331 Bacteria 15558
16 Ga0068869_100000542 3300005334 Bacteria 21123
17 Ga0068869_100036357 3300005334 Unclassified 3497
18 Ga0070666_10003898 3300005335 Bacteria 9060
19 Ga0070666_10030360 3300005335 Bacteria 3560
20 Ga0070680_100051139 3300005336 Unclassified 3371
21 Ga0070682_100004949 3300005337 Bacteria 7402
22 Ga0068868_100022813 3300005338 Unclassified 4730
23 Ga0068868_100033347 3300005338 Bacteria 3968
24 Ga0068868_100037335 3300005338 Bacteria 3765
25 Ga0068868_100086489 3300005338 Bacteria 2520
26 Ga0070660_100028337 3300005339 Bacteria 4189
27 Ga0070660_100165607 3300005339 Bacteria 1783
28 Ga0070661_100023770 3300005344 Bacteria 4396
29 Ga0070661_100134909 3300005344 Bacteria 1856
30 Ga0070661_100196288 3300005344 Bacteria 1541
31 Ga0070661_100232038 3300005344 Unclassified 1419
32 Ga0070668_100013597 3300005347 Bacteria 6077
33 Ga0070669_100018825 3300005353 Bacteria 4937
34 Ga0070671_100002623 3300005355 Bacteria 13917
35 Ga0070688_100042224 3300005365 Bacteria 2804
36 Ga0070659_100022223 3300005366 Bacteria 4839
37 Ga0070667_100003372 3300005367 Bacteria 13630
38 Ga0070667_100004122 3300005367 Bacteria 12286
39 Ga0070709_10007651 3300005434 Bacteria 5931
40 Ga0070709_10011575 3300005434 Bacteria 4919
41 Ga0070709_10046108 3300005434 Bacteria 2709
42 Ga0070714_100000186 3300005435 Bacteria 49870
43 Ga0070714_100027044 3300005435 Bacteria 4747
44 Ga0070714_100091642 3300005435 Bacteria 2663
45 Ga0070713_100009940 3300005436 Bacteria 6851
46 Ga0070713_100044263 3300005436 Bacteria 3643
47 Ga0070713_100063124 3300005436 Unclassified 3104
48 Ga0070713_100079146 3300005436 Unclassified 2799
49 Ga0070713_100136215 3300005436 Unclassified 2170
50 Ga0070713_100139726 3300005436 Bacteria 2144
51 Ga0070710_10041817 3300005437 Bacteria 2532
52 Ga0070710_10079688 3300005437 Bacteria 1909
53 Ga0070711_100000329 3300005439 Bacteria 24414
54 Ga0070711_100009579 3300005439 Bacteria 5971
55 Ga0070711_100013406 3300005439 Bacteria 5148
56 Ga0070711_100027461 3300005439 Bacteria 3737
57 Ga0070711_100222443 3300005439 Bacteria 1468
58 Ga0070694_100071292 3300005444 Bacteria 2395
59 Ga0070708_100000517 3300005445 Bacteria 29011
60 Ga0070708_100016619 3300005445 Bacteria 6112
61 Ga0070663_100039601 3300005455 Bacteria 3294
62 Ga0070663_100106270 3300005455 Bacteria 2102
63 Ga0070663_100112998 3300005455 Bacteria 2043
64 Ga0070663_100208654 3300005455 Bacteria 1528
65 Ga0070678_100054496 3300005456 Bacteria 2914
66 Ga0070662_100004573 3300005457 Bacteria 8760
67 Ga0070681_10002482 3300005458 Bacteria 16888
68 Ga0070681_10017910 3300005458 Bacteria 7081
69 Ga0070681_10028029 3300005458 Bacteria 5661
70 Ga0070681_10079022 3300005458 Bacteria 3246
71 Ga0070681_10191810 3300005458 Bacteria 1963
72 Ga0070681_10226149 3300005458 Bacteria 1786
73 Ga0070706_100000812 3300005467 Bacteria 34622
74 Ga0070706_100001116 3300005467 Bacteria 29051
75 Ga0070706_100015082 3300005467 Bacteria 7137
76 Ga0070707_100001183 3300005468 Bacteria 25694
77 Ga0070707_100078536 3300005468 Unclassified 3184
78 Ga0070698_100002344 3300005471 Bacteria 20941
79 Ga0070699_100011614 3300005518 Bacteria 7602
80 Ga0070679_100007052 3300005530 Bacteria 10483
81 Ga0070679_100047253 3300005530 Bacteria 4290
82 Ga0070679_100080520 3300005530 Bacteria 3246
83 Ga0070679_100125739 3300005530 Bacteria 2546
84 Ga0070679_100230172 3300005530 Bacteria 1813
85 Ga0070679_100362850 3300005530 Bacteria 1396
86 Ga0070684_100007590 3300005535 Bacteria 8450
87 Ga0070684_100030399 3300005535 Bacteria 4588
88 Ga0070684_100046043 3300005535 Bacteria 3779
89 Ga0070684_100093793 3300005535 Bacteria 2672
90 Ga0070684_100099288 3300005535 Unclassified 2598
91 Ga0070684_100219988 3300005535 Bacteria 1732
92 Ga0070684_100322878 3300005535 Bacteria 1418
93 Ga0070684_100333490 3300005535 Unclassified 1394
94 Ga0070697_100000249 3300005536 Bacteria 43436
95 Ga0070697_100000427 3300005536 Bacteria 32332
96 Ga0070697_100000742 3300005536 Bacteria 24336
97 Ga0070697_100012885 3300005536 Bacteria 6551
98 Ga0068853_100000147 3300005539 Bacteria 48276
99 Ga0068853_100000171 3300005539 Bacteria 45170
100 Ga0068853_100092034 3300005539 Bacteria 2667
101 Ga0068853_100095012 3300005539 Bacteria 2628
102 Ga0068853_100136860 3300005539 Unclassified 2196
103 Ga0068853_100279180 3300005539 Bacteria 1540
104 Ga0070696_100044588 3300005546 Bacteria 3071
105 Ga0070696_100072974 3300005546 Bacteria 2417
106 Ga0070693_100005275 3300005547 Bacteria 6191
107 Ga0070665_100005874 3300005548 Bacteria 12580
108 Ga0070665_100013579 3300005548 Bacteria 8193
109 Ga0070665_100093520 3300005548 Bacteria 3011
110 Ga0070665_100166554 3300005548 Bacteria 2206
111 Ga0068855_100002303 3300005563 Bacteria 23607
112 Ga0068855_100003583 3300005563 Bacteria 18970
113 Ga0068855_100007405 3300005563 Bacteria 13288
114 Ga0068855_100038938 3300005563 Bacteria 5645
115 Ga0068855_100041529 3300005563 Bacteria 5451
116 Ga0068855_100070468 3300005563 Bacteria 4067
117 Ga0068855_100082127 3300005563 Bacteria 3735
118 Ga0068855_100127229 3300005563 Bacteria 2912
119 Ga0068855_100221912 3300005563 Bacteria 2119
120 Ga0070664_100047843 3300005564 Unclassified 3614
121 Ga0070664_100154047 3300005564 Bacteria 2030
122 Ga0068857_100000669 3300005577 Bacteria 25401
123 Ga0068857_100054440 3300005577 Bacteria 3550
124 Ga0068857_100309096 3300005577 Bacteria 1458
125 Ga0068854_100007907 3300005578 Bacteria 6805
126 Ga0068854_100011881 3300005578 Bacteria 5687
127 Ga0068854_100024559 3300005578 Bacteria 4128
128 Ga0068854_100044111 3300005578 Unclassified 3164
129 Ga0068854_100316524 3300005578 Unclassified 1267
130 Ga0068856_100004085 3300005614 Bacteria 14594
131 Ga0068856_100004416 3300005614 Bacteria 14018
132 Ga0068856_100016810 3300005614 Bacteria 7088
133 Ga0068856_100045720 3300005614 Unclassified 4312
134 Ga0068856_100051619 3300005614 Unclassified 4055
135 Ga0068856_100055512 3300005614 Bacteria 3909
136 Ga0068856_100116911 3300005614 Bacteria 2667
137 Ga0068852_100000412 3300005616 Bacteria 28562
138 Ga0068852_100000504 3300005616 Bacteria 25669
139 Ga0068852_100024794 3300005616 Bacteria 4851
140 Ga0068859_100001120 3300005617 Bacteria 27379
141 Ga0068859_100009906 3300005617 Bacteria 9626
142 Ga0068864_100003371 3300005618 Bacteria 13209
143 Ga0068866_10009206 3300005718 Unclassified 4186
144 Ga0068866_10018591 3300005718 Bacteria 3146
145 Ga0068851_10006828 3300005834 Bacteria 5226
146 Ga0068851_10007193 3300005834 Bacteria 5101
147 Ga0068851_10044337 3300005834 Bacteria 2244
148 Ga0068851_10058756 3300005834 Bacteria 1966
149 Ga0068863_100012947 3300005841 Bacteria 8045
150 Ga0068863_100127776 3300005841 Bacteria 2426
151 Ga0068863_100139679 3300005841 Unclassified 2315
152 Ga0068858_100003224 3300005842 Bacteria 16286
153 Ga0068858_100003511 3300005842 Bacteria 15542
154 Ga0068858_100022048 3300005842 Bacteria 5948
155 Ga0068858_100061276 3300005842 Bacteria 3478
156 Ga0068858_100228089 3300005842 Bacteria 1765
157 Ga0068860_100000912 3300005843 Bacteria 32785
158 Ga0068860_100204042 3300005843 Bacteria 1917
159 Ga0068860_100207077 3300005843 Bacteria 1902
160 Ga0070717_10004829 3300006028 Bacteria 9809
161 Ga0070717_10037951 3300006028 Unclassified 3913
162 Ga0070717_10110496 3300006028 Bacteria 2344
163 Ga0070717_10180162 3300006028 Unclassified 1841
164 Ga0070717_10218511 3300006028 Bacteria 1674
165 Ga0070715_10083686 3300006163 Bacteria 1454
166 Ga0070716_100022165 3300006173 Unclassified 3353
167 Ga0070712_100000542 3300006175 Bacteria 21816
168 Ga0070712_100004232 3300006175 Bacteria 8832
169 Ga0070712_100163011 3300006175 Unclassified 1723
170 Ga0070712_100190118 3300006175 Bacteria 1606
171 Ga0097621_100000506 3300006237 Bacteria 27267
172 Ga0097621_100002346 3300006237 Bacteria 12975
173 Ga0097621_100009357 3300006237 Bacteria 7111
174 Ga0097621_100064758 3300006237 Bacteria 3007
175 Ga0068871_100000685 3300006358 Bacteria 23033
176 Ga0068871_100009242 3300006358 Bacteria 7130
177 Ga0075434_100000462 3300006871 Bacteria 30392
178 Ga0075434_100080753 3300006871 Bacteria 3249
179 Ga0068865_100018799 3300006881 Bacteria 4465
180 Ga0075436_100032251 3300006914 Bacteria 3610
181 Ga0097620_100001120 3300006931 Bacteria 27379
182 Ga0097620_100009906 3300006931 Bacteria 9626
183 Ga0105240_10000001 3300009093 Bacteria 2887840
184 Ga0105240_10001453 3300009093 Bacteria 40511
185 Ga0105240_10002144 3300009093 Bacteria 32229
186 Ga0105240_10002730 3300009093 Bacteria 27998
187 Ga0105240_10009959 3300009093 Bacteria 13397
188 Ga0105240_10018640 3300009093 Bacteria 9304
189 Ga0105240_10032689 3300009093 Bacteria 6732
190 Ga0105240_10037657 3300009093 Bacteria 6215
191 Ga0105240_10059946 3300009093 Bacteria 4746
192 Ga0105240_10091617 3300009093 Bacteria 3713
193 Ga0105245_10001352 3300009098 Bacteria 22189
194 Ga0105245_10004986 3300009098 Bacteria 11673
195 Ga0105245_10012963 3300009098 Bacteria 7267
196 Ga0105245_10020802 3300009098 Bacteria 5752
197 Ga0105245_10021278 3300009098 Bacteria 5687
198 Ga0105245_10178216 3300009098 Bacteria 2029
199 Ga0105247_10011709 3300009101 Bacteria 5277
200 Ga0105247_10045149 3300009101 Bacteria 2703
201 Ga0105243_10100540 3300009148 Bacteria 2399
202 Ga0105241_10000033 3300009174 Bacteria 118315
203 Ga0105241_10000610 3300009174 Bacteria 26914
204 Ga0105241_10002688 3300009174 Bacteria 13325
205 Ga0105241_10005545 3300009174 Bacteria 9319
206 Ga0105241_10015747 3300009174 Bacteria 5541
207 Ga0105241_10160384 3300009174 Bacteria 1848
208 Ga0105242_10015637 3300009176 Bacteria 5895
209 Ga0105242_10025092 3300009176 Bacteria 4712
210 Ga0105242_10179348 3300009176 Bacteria 1868
211 Ga0105248_10000007 3300009177 Bacteria 471250
212 Ga0105248_10001860 3300009177 Bacteria 23401
213 Ga0105248_10013722 3300009177 Bacteria 8920
214 Ga0105248_10015854 3300009177 Bacteria 8304
215 Ga0105248_10084006 3300009177 Bacteria 3582
216 Ga0105237_10003849 3300009545 Bacteria 17651
217 Ga0105237_10022066 3300009545 Bacteria 6535
218 Ga0105237_10040540 3300009545 Bacteria 4695
219 Ga0105237_10044667 3300009545 Bacteria 4461
220 Ga0105237_10057694 3300009545 Bacteria 3885
221 Ga0105237_10113608 3300009545 Bacteria 2700
222 Ga0105237_10115554 3300009545 Bacteria 2677
223 Ga0105238_10000171 3300009551 Bacteria 70810
224 Ga0105238_10001015 3300009551 Bacteria 28667
225 Ga0105238_10018376 3300009551 Bacteria 7115
226 Ga0105238_10054203 3300009551 Bacteria 4028
227 Ga0105238_10090334 3300009551 Unclassified 3050
228 Ga0105238_10101468 3300009551 Bacteria 2860
229 Ga0105238_10108641 3300009551 Bacteria 2755
230 Ga0105238_10131930 3300009551 Bacteria 2477
231 Ga0105238_10184060 3300009551 Bacteria 2066
232 Ga0105249_10029561 3300009553 Unclassified 4950
233 Ga0105239_10001391 3300010375 Bacteria 32418
234 Ga0105239_10002062 3300010375 Bacteria 26041
235 Ga0105239_10027569 3300010375 Bacteria 6251
236 Ga0105239_10028853 3300010375 Bacteria 6100
237 Ga0105239_10127172 3300010375 Bacteria 2833
238 Ga0105239_10128150 3300010375 Unclassified 2822
239 Ga0105246_10000907 3300011119 Bacteria 16987
240 Ga0105246_10077173 3300011119 Bacteria 2363
241 Ga0157373_10098780 3300013100 Bacteria 2054
242 Ga0157371_10014469 3300013102 Bacteria 5953
243 Ga0157371_10136127 3300013102 Bacteria 1749
244 Ga0157370_10001599 3300013104 Bacteria 28002
245 Ga0157370_10019860 3300013104 Bacteria 6723
246 Ga0157370_10029198 3300013104 Bacteria 5417
247 Ga0157370_10112141 3300013104 Bacteria 2549
248 Ga0157370_10284069 3300013104 Bacteria 1529
249 Ga0157369_10001577 3300013105 Bacteria 27889
250 Ga0157369_10008591 3300013105 Bacteria 11716
251 Ga0157369_10008672 3300013105 Bacteria 11657
252 Ga0157369_10018678 3300013105 Bacteria 7773
253 Ga0157369_10025792 3300013105 Bacteria 6520
254 Ga0157369_10027231 3300013105 Bacteria 6338
255 Ga0157369_10035283 3300013105 Bacteria 5485
256 Ga0157369_10050235 3300013105 Bacteria 4518
257 Ga0157369_10060177 3300013105 Bacteria 4096
258 Ga0157369_10096380 3300013105 Bacteria 3156
259 Ga0157369_10103066 3300013105 Bacteria 3039
260 Ga0157369_10104359 3300013105 Bacteria 3018
261 Ga0157369_10273902 3300013105 Bacteria 1758
262 Ga0157369_10344464 3300013105 Bacteria 1548
263 Ga0157369_10447555 3300013105 Bacteria 1338
264 Ga0157374_10013713 3300013296 Bacteria 7080
265 Ga0157374_10023240 3300013296 Bacteria 5542
266 Ga0157374_10051375 3300013296 Bacteria 3836
267 Ga0157374_10068623 3300013296 Bacteria 3336
268 Ga0157374_10095152 3300013296 Bacteria 2847
269 Ga0157374_10235555 3300013296 Bacteria 1799
270 Ga0157378_10001393 3300013297 Bacteria 21737
271 Ga0157378_10014964 3300013297 Bacteria 6792
272 Ga0157378_10016175 3300013297 Bacteria 6532
273 Ga0157378_10021152 3300013297 Bacteria 5722
274 Ga0157378_10179908 3300013297 Bacteria 1989
275 Ga0163162_10000822 3300013306 Bacteria 28869
276 Ga0163162_10012200 3300013306 Bacteria 8388
277 Ga0163162_10017568 3300013306 Bacteria 7000
278 Ga0163162_10055621 3300013306 Unclassified 3985
279 Ga0163162_10101803 3300013306 Bacteria 2965
280 Ga0163162_10219525 3300013306 Bacteria 2031
281 Ga0157372_10001952 3300013307 Bacteria 22395
282 Ga0157372_10009227 3300013307 Bacteria 10487
283 Ga0157372_10013111 3300013307 Bacteria 8843
284 Ga0157372_10016926 3300013307 Bacteria 7826
285 Ga0157372_10019312 3300013307 Bacteria 7341
286 Ga0157372_10032120 3300013307 Bacteria 5754
287 Ga0157372_10034128 3300013307 Bacteria 5592
288 Ga0157372_10094168 3300013307 Bacteria 3410
289 Ga0157372_10130189 3300013307 Unclassified 2894
290 Ga0157372_10137259 3300013307 Bacteria 2817
291 Ga0157372_10160791 3300013307 Bacteria 2596
292 Ga0157372_10162974 3300013307 Bacteria 2577
293 Ga0157372_10277084 3300013307 Bacteria 1950
294 Ga0157372_10279736 3300013307 Bacteria 1940
295 Ga0157375_10005008 3300013308 Bacteria 11513
296 Ga0157375_10028952 3300013308 Bacteria 5202
297 Ga0157375_10086717 3300013308 Bacteria 3182
298 Ga0157375_10127307 3300013308 Bacteria 2663
299 Ga0163163_10024393 3300014325 Bacteria 5756
300 Ga0163163_10080874 3300014325 Bacteria 3250
301 Ga0163163_10134870 3300014325 Bacteria 2509
302 Ga0157377_10053988 3300014745 Unclassified 2274
303 Ga0157379_10003129 3300014968 Bacteria 14014
304 Ga0157379_10012449 3300014968 Bacteria 7429
305 Ga0157379_10016355 3300014968 Bacteria 6526
306 Ga0157379_10056931 3300014968 Bacteria 3493
307 Ga0157379_10199098 3300014968 Bacteria 1811
308 Ga0157376_10016808 3300014969 Bacteria 5565
309 Ga0157376_10026382 3300014969 Unclassified 4590
310 Ga0157376_10034553 3300014969 Bacteria 4083
311 Ga0157376_10121320 3300014969 Bacteria 2317
312 Ga0213872_10002468 3300021361 Bacteria 10843
313 Ga0213872_10010255 3300021361 Bacteria 4466
314 Ga0209233_1003838 3300025261 Bacteria 5232
315 Ga0209233_1004869 3300025261 Bacteria 4521
316 Ga0207642_10004067 3300025899 Unclassified 4685
317 Ga0207710_10025303 3300025900 Unclassified 2562
318 Ga0207647_10001991 3300025904 Bacteria 15624
319 Ga0207647_10002648 3300025904 Bacteria 13523
320 Ga0207647_10052836 3300025904 Bacteria 2506
321 Ga0207699_10008635 3300025906 Bacteria 5038
322 Ga0207699_10031017 3300025906 Bacteria 2997
323 Ga0207645_10004353 3300025907 Bacteria 10486
324 Ga0207645_10009148 3300025907 Bacteria 6869
325 Ga0207705_10000109 3300025909 Bacteria 93256
326 Ga0207705_10010285 3300025909 Bacteria 6805
327 Ga0207705_10014420 3300025909 Bacteria 5689
328 Ga0207705_10018328 3300025909 Bacteria 5006
329 Ga0207705_10026073 3300025909 Bacteria 4171
330 Ga0207705_10045043 3300025909 Unclassified 3171
331 Ga0207705_10052030 3300025909 Bacteria 2948
332 Ga0207684_10001380 3300025910 Bacteria 26458
333 Ga0207684_10003231 3300025910 Bacteria 15997
334 Ga0207654_10000170 3300025911 Bacteria 41057
335 Ga0207654_10000368 3300025911 Bacteria 26431
336 Ga0207654_10004565 3300025911 Bacteria 6993
337 Ga0207654_10023847 3300025911 Bacteria 3283
338 Ga0207707_10007291 3300025912 Bacteria 9626
339 Ga0207707_10008391 3300025912 Bacteria 8965
340 Ga0207707_10035364 3300025912 Bacteria 4369
341 Ga0207707_10040403 3300025912 Bacteria 4074
342 Ga0207707_10090706 3300025912 Unclassified 2671
343 Ga0207695_10000001 3300025913 Bacteria 2888630
344 Ga0207695_10000030 3300025913 Bacteria 533735
345 Ga0207695_10000259 3300025913 Bacteria 133796
346 Ga0207695_10000537 3300025913 Bacteria 79113
347 Ga0207695_10000877 3300025913 Bacteria 54740
348 Ga0207695_10002346 3300025913 Bacteria 28121
349 Ga0207695_10007527 3300025913 Bacteria 13810
350 Ga0207695_10029311 3300025913 Bacteria 6085
351 Ga0207695_10035688 3300025913 Bacteria 5387
352 Ga0207695_10042919 3300025913 Bacteria 4824
353 Ga0207695_10057369 3300025913 Bacteria 4045
354 Ga0207695_10074400 3300025913 Bacteria 3459
355 Ga0207695_10118840 3300025913 Bacteria 2614
356 Ga0207695_10146374 3300025913 Bacteria 2306
357 Ga0207671_10001200 3300025914 Bacteria 30806
358 Ga0207671_10003815 3300025914 Bacteria 14757
359 Ga0207671_10090486 3300025914 Bacteria 2305
360 Ga0207671_10226462 3300025914 Unclassified 1466
361 Ga0207693_10002043 3300025915 Bacteria 17694
362 Ga0207693_10002423 3300025915 Bacteria 16201
363 Ga0207693_10006863 3300025915 Bacteria 9402
364 Ga0207693_10013373 3300025915 Bacteria 6617
365 Ga0207693_10095344 3300025915 Unclassified 2332
366 Ga0207663_10002606 3300025916 Bacteria 8681
367 Ga0207663_10206835 3300025916 Bacteria 1420
368 Ga0207660_10001656 3300025917 Bacteria 14925
369 Ga0207660_10046231 3300025917 Unclassified 3071
370 Ga0207657_10008823 3300025919 Bacteria 10198
371 Ga0207657_10013367 3300025919 Bacteria 8054
372 Ga0207657_10018860 3300025919 Bacteria 6569
373 Ga0207657_10029486 3300025919 Bacteria 4993
374 Ga0207657_10069516 3300025919 Bacteria 2987
375 Ga0207657_10073616 3300025919 Bacteria 2886
376 Ga0207649_10008695 3300025920 Bacteria 5544
377 Ga0207649_10014930 3300025920 Bacteria 4359
378 Ga0207649_10106490 3300025920 Bacteria 1865
379 Ga0207652_10003180 3300025921 Bacteria 13656
380 Ga0207652_10013893 3300025921 Bacteria 6517
381 Ga0207646_10001576 3300025922 Bacteria 27888
382 Ga0207646_10055989 3300025922 Unclassified 3526
383 Ga0207646_10140424 3300025922 Bacteria 2175
384 Ga0207681_10014471 3300025923 Bacteria 4903
385 Ga0207694_10000181 3300025924 Bacteria 65011
386 Ga0207694_10000770 3300025924 Bacteria 28760
387 Ga0207694_10003285 3300025924 Bacteria 12877
388 Ga0207694_10022226 3300025924 Bacteria 4811
389 Ga0207694_10084492 3300025924 Bacteria 2497
390 Ga0207694_10255829 3300025924 Unclassified 1434
391 Ga0207650_10028219 3300025925 Unclassified 4022
392 Ga0207687_10002934 3300025927 Bacteria 11572
393 Ga0207687_10014922 3300025927 Bacteria 5088
394 Ga0207687_10015053 3300025927 Bacteria 5067
395 Ga0207687_10027666 3300025927 Bacteria 3806
396 Ga0207700_10011869 3300025928 Bacteria 5582
397 Ga0207700_10021436 3300025928 Bacteria 4411
398 Ga0207700_10097129 3300025928 Bacteria 2341
399 Ga0207700_10137812 3300025928 Bacteria 2001
400 Ga0207664_10000086 3300025929 Bacteria 89769
401 Ga0207664_10020299 3300025929 Bacteria 4921
402 Ga0207664_10040595 3300025929 Bacteria 3620
403 Ga0207664_10062067 3300025929 Bacteria 2984
404 Ga0207644_10001417 3300025931 Bacteria 15450
405 Ga0207644_10144091 3300025931 Bacteria 1837
406 Ga0207690_10076556 3300025932 Bacteria 2323
407 Ga0207690_10086668 3300025932 Bacteria 2201
408 Ga0207706_10002992 3300025933 Bacteria 16291
409 Ga0207686_10086697 3300025934 Bacteria 2057
410 Ga0207670_10197072 3300025936 Bacteria 1528
411 Ga0207665_10001047 3300025939 Bacteria 18599
412 Ga0207665_10015038 3300025939 Bacteria 5081
413 Ga0207665_10019410 3300025939 Bacteria 4469
414 Ga0207665_10019955 3300025939 Bacteria 4405
415 Ga0207665_10022030 3300025939 Bacteria 4189
416 Ga0207711_10000014 3300025941 Bacteria 506753
417 Ga0207711_10001374 3300025941 Bacteria 22912
418 Ga0207711_10002201 3300025941 Bacteria 17507
419 Ga0207711_10008188 3300025941 Bacteria 8752
420 Ga0207689_10002258 3300025942 Bacteria 18059
421 Ga0207689_10003567 3300025942 Bacteria 14224
422 Ga0207689_10173260 3300025942 Bacteria 1779
423 Ga0207661_10212321 3300025944 Bacteria 1706
424 Ga0207661_10318683 3300025944 Bacteria 1397
425 Ga0207679_10039884 3300025945 Unclassified 3357
426 Ga0207667_10002563 3300025949 Bacteria 22609
427 Ga0207667_10003145 3300025949 Bacteria 20433
428 Ga0207667_10011761 3300025949 Bacteria 10147
429 Ga0207667_10018922 3300025949 Bacteria 7704
430 Ga0207667_10053980 3300025949 Bacteria 4227
431 Ga0207667_10054381 3300025949 Bacteria 4211
432 Ga0207667_10128740 3300025949 Bacteria 2607
433 Ga0207667_10151770 3300025949 Bacteria 2384
434 Ga0207667_10175402 3300025949 Bacteria 2202
435 Ga0207651_10142401 3300025960 Bacteria 1854
436 Ga0207668_10115605 3300025972 Bacteria 2021
437 Ga0207640_10000117 3300025981 Bacteria 60081
438 Ga0207640_10010714 3300025981 Bacteria 5170
439 Ga0207658_10000811 3300025986 Bacteria 26164
440 Ga0207658_10101686 3300025986 Bacteria 2253
441 Ga0207677_10000242 3300026023 Bacteria 42196
442 Ga0207677_10136446 3300026023 Bacteria 1871
443 Ga0207703_10004444 3300026035 Bacteria 11519
444 Ga0207703_10004751 3300026035 Bacteria 11082
445 Ga0207703_10037100 3300026035 Bacteria 3882
446 Ga0207703_10089156 3300026035 Bacteria 2590
447 Ga0207703_10174981 3300026035 Bacteria 1891
448 Ga0207639_10000101 3300026041 Bacteria 70638
449 Ga0207639_10002332 3300026041 Bacteria 12744
450 Ga0207639_10175237 3300026041 Bacteria 1820
451 Ga0207678_10006271 3300026067 Bacteria 10562
452 Ga0207678_10007842 3300026067 Bacteria 9420
453 Ga0207678_10033347 3300026067 Bacteria 4486
454 Ga0207678_10058947 3300026067 Bacteria 3303
455 Ga0207678_10066529 3300026067 Bacteria 3095
456 Ga0207678_10140921 3300026067 Bacteria 2058
457 Ga0207708_10042782 3300026075 Bacteria 3452
458 Ga0207702_10002585 3300026078 Bacteria 17020
459 Ga0207702_10003045 3300026078 Bacteria 15578
460 Ga0207702_10043948 3300026078 Bacteria 3753
461 Ga0207702_10047255 3300026078 Bacteria 3626
462 Ga0207702_10202213 3300026078 Unclassified 1842
463 Ga0207641_10003995 3300026088 Bacteria 12874
464 Ga0207648_10028723 3300026089 Bacteria 4930
465 Ga0207676_10001904 3300026095 Bacteria 15235
466 Ga0207676_10159604 3300026095 Bacteria 1952
467 Ga0207676_10171322 3300026095 Bacteria 1892
468 Ga0207674_10001897 3300026116 Bacteria 26616
469 Ga0207674_10002204 3300026116 Bacteria 24674
470 Ga0207674_10006656 3300026116 Bacteria 13574
471 Ga0207674_10063620 3300026116 Bacteria 3724
472 Ga0207683_10000600 3300026121 Bacteria 33247
473 Ga0207683_10108455 3300026121 Bacteria 2484
474 Ga0207698_10000263 3300026142 Bacteria 32215
475 Ga0207698_10000268 3300026142 Bacteria 31619
476 Ga0207698_10012627 3300026142 Bacteria 5535
477 Ga0207698_10277198 3300026142 Bacteria 1549
478 Ga0268266_10004489 3300028379 Bacteria 13344
479 Ga0268266_10005457 3300028379 Bacteria 11845
480 Ga0268266_10029772 3300028379 Bacteria 4639
481 Ga0268266_10037935 3300028379 Bacteria 4103
482 Ga0268266_10093131 3300028379 Bacteria 2644
483 Ga0268266_10104052 3300028379 Bacteria 2506
484 Ga0268266_10124935 3300028379 Bacteria 2294
485 Ga0268266_10222389 3300028379 Unclassified 1736
486 Ga0268266_10248366 3300028379 Bacteria 1645
487 Ga0268264_10009127 3300028381 Bacteria 8222
488 Ga0268264_10025603 3300028381 Bacteria 4820
489 Ga0265334_10043510 3300028573 Bacteria 1747
490 Ga0265336_10008975 3300028666 Bacteria 3477
491 Ga0265338_10001617 3300028800 Bacteria 36047
492 Ga0265338_10006322 3300028800 Bacteria 15137
493 Ga0265338_10009997 3300028800 Bacteria 11216
494 Ga0265338_10010474 3300028800 Bacteria 10861
495 Ga0265338_10138839 3300028800 Bacteria 1906
496 Ga0265338_10143980 3300028800 Unclassified 1862
497 Ga0265762_1001427 3300030760 Bacteria 4333
498 Ga0265770_1002352 3300030878 Bacteria 2569
499 Ga0265770_1002418 3300030878 Bacteria 2533
500 Ga0265760_10000557 3300031090 Bacteria 10562
501 Ga0265330_10000326 3300031235 Bacteria 34208
502 Ga0265330_10001479 3300031235 Bacteria 13663
503 Ga0265330_10008043 3300031235 Bacteria 5103
504 Ga0265330_10052525 3300031235 Bacteria 1785
505 Ga0265332_10004965 3300031238 Bacteria 6184
506 Ga0265328_10010533 3300031239 Bacteria 3718
507 Ga0265328_10028521 3300031239 Bacteria 2088
508 Ga0265328_10029060 3300031239 Bacteria 2067
509 Ga0265325_10001354 3300031241 Bacteria 17356
510 Ga0265325_10003147 3300031241 Bacteria 10874
511 Ga0265325_10018559 3300031241 Bacteria 3857
512 Ga0265325_10046767 3300031241 Bacteria 2243
513 Ga0265325_10062162 3300031241 Bacteria 1892
514 Ga0265325_10080949 3300031241 Bacteria 1614
515 Ga0265340_10004274 3300031247 Bacteria 8009
516 Ga0265340_10009915 3300031247 Bacteria 5106
517 Ga0265340_10013357 3300031247 Bacteria 4314
518 Ga0265340_10017929 3300031247 Bacteria 3660
519 Ga0265340_10022014 3300031247 Bacteria 3262
520 Ga0265339_10000102 3300031249 Bacteria 68868
521 Ga0265339_10002713 3300031249 Bacteria 12584
522 Ga0265339_10004260 3300031249 Bacteria 9788
523 Ga0265339_10009355 3300031249 Bacteria 6166
524 Ga0265339_10030492 3300031249 Bacteria 3053
525 Ga0265339_10040250 3300031249 Bacteria 2598
526 Ga0265316_10001220 3300031344 Bacteria 27686
527 Ga0265316_10007060 3300031344 Bacteria 10635
528 Ga0265316_10007359 3300031344 Bacteria 10375
529 Ga0265316_10020829 3300031344 Bacteria 5570
530 Ga0265316_10028872 3300031344 Bacteria 4569
531 Ga0265316_10035281 3300031344 Bacteria 4054
532 Ga0265316_10037065 3300031344 Bacteria 3940
533 Ga0265316_10066620 3300031344 Bacteria 2786
534 Ga0265316_10150545 3300031344 Bacteria 1743
535 Ga0265316_10156160 3300031344 Bacteria 1707
536 Ga0265316_10215886 3300031344 Bacteria 1417
537 Ga0307408_100101971 3300031548 Bacteria 2188
538 Ga0265313_10003269 3300031595 Bacteria 13313
539 Ga0265313_10009409 3300031595 Bacteria 6347
540 Ga0265313_10016220 3300031595 Bacteria 4293
541 Ga0265313_10025707 3300031595 Bacteria 3113
542 Ga0265314_10000063 3300031711 Bacteria 159305
543 Ga0265314_10010478 3300031711 Bacteria 7727
544 Ga0265314_10020473 3300031711 Bacteria 5106
545 Ga0265314_10027560 3300031711 Bacteria 4253
546 Ga0265314_10078225 3300031711 Unclassified 2191
547 Ga0265314_10096188 3300031711 Bacteria 1916
548 Ga0265342_10001150 3300031712 Bacteria 25234
549 Ga0265342_10001877 3300031712 Bacteria 18962
550 Ga0265342_10003244 3300031712 Bacteria 13487
551 Ga0265342_10003727 3300031712 Bacteria 12329
552 Ga0265342_10029167 3300031712 Bacteria 3429
553 Ga0265342_10033310 3300031712 Bacteria 3169
554 Ga0307405_10037690 3300031731 Bacteria 2908
555 Ga0307410_10016670 3300031852 Unclassified 4390
556 Ga0307406_10028616 3300031901 Bacteria 3369
557 Ga0307409_100075685 3300031995 Unclassified 2696
558 Ga0307409_100170897 3300031995 Bacteria 1913
559 Ga0307416_100071608 3300032002 Unclassified 2881
560 Ga0307411_10141231 3300032005 Bacteria 1776
561 Ga0307411_10238717 3300032005 Unclassified 1421
562 Ga0307415_100109801 3300032126 Bacteria 2044
563 Ga0307510_10029551 3300033180 Bacteria 6236
564 Ga0373934_0051919 3300035086 Unclassified 1625
565 Ga0373940_0047496 3300035088 Bacteria 1197
566 Ga0373923_0000400 3300035111 Bacteria 10038
567 Ga0373956_0027534 3300035119 Unclassified 2468
568 Ga0373956_0042298 3300035119 Bacteria 2025
569 Ga0373943_0002431 3300035170 Bacteria 8457
570 Ga0373946_0008745 3300035171 Unclassified 3718
571 Ga0373946_0018138 3300035171 Unclassified 2698
572 Ga0373955_0014400 3300035172 Bacteria 3846
573 Ga0373924_0003464 3300035410 Bacteria 5432
574 Ga0373931_0036652 3300035691 Bacteria 2557
575 Ga0373931_0107634 3300035691 Unclassified 1577
576 Ga0373935_0003446 3300035692 Bacteria 9192
577 Ga0373935_0094799 3300035692 Bacteria 1959
578 Ga0373935_0142971 3300035692 Bacteria 1617
579 Ga0373927_0001136 3300035695 Bacteria 20149
580 Ga0373927_0001713 3300035695 Bacteria 16383
581 Ga0373933_0145937 3300035724 Bacteria 1496
582 Ga0373947_0001191 3300035725 Bacteria 16011
583 Ga0373947_0029549 3300035725 Unclassified 3216
584 Ga0373937_0000026 3300036401 Bacteria 124071
585 Ga0373937_0017855 3300036401 Bacteria 6330
586 Ga0373937_0039864 3300036401 Bacteria 4281
587 Ga0373925_0002873 3300037068 Bacteria 13598
588 Ga0373925_0055083 3300037068 Bacteria 2976
589 Ga0436361_0224127 3300039447 Bacteria 1359
590 Ga0436361_0608005 3300039447 Bacteria 15128
591 Ga0436361_0652690 3300039447 Bacteria 39906
592 Ga0436361_1068732 3300039447 Bacteria 3530
593 Ga0466966_0066721 3300044684 Bacteria 2261
594 Ga0466966_0072063 3300044684 Bacteria 2164
595 Ga0466963_0000116 3300044694 Bacteria 29494
596 Ga0466963_0152210 3300044694 Unclassified 1607
597 Ga0466957_0000246 3300044842 Bacteria 25999
598 Ga0466959_0076064 3300045049 Bacteria 2425
599 Ga0451576_0036535 3300045051 Bacteria 5207
600 Ga0451576_0451756 3300045051 Bacteria 1349
601 Ga0451576_0603020 3300045051 Unclassified 1154
602 Ga0466967_0000227 3300045976 Bacteria 24293
603 Ga0466967_0002031 3300045976 Bacteria 12348
604 Ga0495617_056061 3300046452 Bacteria 1307
605 Ga0495592_0196950 3300046454 Bacteria 1362
606 Ga0495603_0005762 3300046455 Bacteria 7410
607 Ga0495629_0006748 3300046459 Bacteria 8487
608 Ga0495629_0043096 3300046459 Bacteria 3170
609 Ga0495629_0081742 3300046459 Bacteria 2255
610 Ga0495651_0010087 3300046462 Bacteria 7256
611 Ga0495651_0037611 3300046462 Bacteria 3769
612 Ga0495651_0071104 3300046462 Unclassified 2646
613 Ga0495653_0001794 3300046463 Bacteria 16923
614 Ga0495650_0000037 3300046471 Bacteria 390090
615 Ga0495650_0006514 3300046471 Bacteria 7256
616 Ga0495580_0003126 3300046472 Bacteria 14184
617 Ga0495580_0039510 3300046472 Bacteria 3376
618 Ga0495580_0049926 3300046472 Bacteria 2959
619 Ga0495580_0056552 3300046472 Bacteria 2762
620 Ga0495582_0004081 3300046473 Bacteria 8203
621 Ga0495605_0044647 3300046474 Bacteria 2190
622 Ga0495639_0001894 3300046475 Bacteria 9271
623 Ga0495664_0001180 3300046477 Bacteria 13616
624 Ga0495664_0049978 3300046477 Unclassified 2482
625 Ga0495664_0146885 3300046477 Bacteria 1430
626 Ga0495584_0072575 3300046491 Bacteria 1730
627 Ga0495585_0005391 3300046492 Bacteria 8068
628 Ga0495594_0000357 3300046499 Bacteria 22945
629 Ga0495594_0001304 3300046499 Bacteria 12994
630 Ga0495594_0006703 3300046499 Bacteria 5922
631 Ga0495596_0015901 3300046500 Bacteria 3135
632 Ga0495583_0022628 3300046506 Bacteria 3201
633 Ga0495583_0072514 3300046506 Bacteria 1511
634 Ga0495618_0032463 3300046514 Bacteria 3270
635 Ga0495628_0127888 3300046516 Bacteria 1945
636 Ga0495631_0005469 3300046518 Bacteria 6644
637 Ga0495644_0000004 3300046523 Bacteria 158166
638 Ga0495642_0047448 3300046528 Bacteria 1759
639 Ga0495652_0004537 3300046529 Bacteria 13251
640 Ga0495652_0054462 3300046529 Bacteria 3406
641 Ga0495652_0098395 3300046529 Bacteria 2378
642 Ga0495665_0002033 3300046531 Bacteria 10952
643 Ga0495640_0009979 3300046533 Bacteria 7360
644 Ga0495586_0003036 3300046535 Bacteria 9052
645 Ga0495609_0026554 3300046538 Bacteria 2651
646 Ga0495633_0035845 3300046558 Bacteria 2380
647 Ga0495667_0009281 3300046559 Bacteria 6672
648 Ga0495656_0056874 3300046615 Bacteria 1692
649 Ga0495668_0158253 3300046616 Bacteria 1241
650 Ga0495625_0000166 3300046660 Bacteria 102927
651 Ga0495625_0008870 3300046660 Bacteria 8509
652 Ga0495625_0047937 3300046660 Bacteria 3079
653 Ga0495635_0001143 3300046663 Bacteria 17685
654 Ga0495659_0002804 3300046664 Bacteria 5601
655 Ga0495661_0022579 3300046665 Bacteria 4094
656 Ga0495599_0005781 3300046678 Bacteria 7422
657 Ga0495623_0016828 3300046679 Bacteria 4724
658 Ga0495646_0015770 3300046680 Bacteria 4796
659 Ga0495669_0001311 3300046684 Bacteria 10299
660 Ga0495669_0044969 3300046684 Bacteria 1968
661 Ga0495669_0045967 3300046684 Bacteria 1948
662 Ga0495613_0008425 3300046689 Bacteria 7652
663 Ga0495624_0001490 3300046690 Bacteria 18174
664 Ga0495649_0023508 3300046694 Bacteria 3443
665 Ga0495649_0052110 3300046694 Bacteria 2218
666 Ga0495600_0004064 3300046809 Bacteria 8701
667 Ga0495581_0102114 3300047315 Unclassified 1666
668 Ga0495604_0019623 3300047317 Bacteria 5410
669 Ga0495604_0031403 3300047317 Bacteria 4212
670 Ga0495604_0033274 3300047317 Unclassified 4082
671 Ga0495674_0041535 3300047319 Bacteria 4107
672 Ga0495672_0004803 3300047320 Bacteria 10899
673 Ga0495676_0004397 3300047321 Bacteria 12878
674 Ga0495680_0013716 3300047322 Bacteria 7053
675 Ga0495680_0153254 3300047322 Bacteria 1679
676 Ga0495675_0001672 3300047444 Bacteria 13294
677 Ga0495684_0010561 3300047471 Bacteria 7135
678 Ga0495686_0000006 3300047472 Bacteria 770778
679 Ga0495686_0001113 3300047472 Bacteria 31863
680 Ga0495686_0001457 3300047472 Bacteria 25789
681 Ga0495602_0110587 3300048088 Unclassified 2233
682 Ga0495602_0225586 3300048088 Bacteria 1411
683 Ga0495614_0002636 3300048089 Bacteria 7975
684 Ga0496100_0099849 3300048903 Bacteria 1998
685 Ga0496100_0105718 3300048903 Bacteria 1947
686 Ga0496102_0001003 3300048905 Bacteria 26467
687 Ga0496102_0043116 3300048905 Bacteria 4090
688 Ga0496102_0053501 3300048905 Bacteria 3679
689 Ga0496102_0331617 3300048905 Bacteria 1433
690 Ga0496103_0012752 3300048906 Bacteria 4986
691 Ga0496104_0002870 3300048907 Bacteria 14860
692 Ga0496104_0023246 3300048907 Bacteria 5699
693 Ga0496104_0037784 3300048907 Bacteria 4514
694 Ga0496104_0043377 3300048907 Bacteria 4225
695 Ga0496104_0067312 3300048907 Bacteria 3402
696 Ga0496104_0124216 3300048907 Bacteria 2478
697 Ga0496105_0020835 3300048908 Bacteria 5301
698 Ga0496105_0064958 3300048908 Bacteria 3012
699 Ga0496105_0067449 3300048908 Bacteria 2954
700 Ga0496105_0068298 3300048908 Bacteria 2936
701 Ga0496106_0036829 3300048909 Bacteria 3660
702 Ga0496106_0063264 3300048909 Bacteria 2812
703 Ga0496107_0088373 3300048910 Bacteria 2262
704 Ga0496107_0141836 3300048910 Bacteria 1776
705 Ga0496107_0209514 3300048910 Bacteria 1449
706 Ga0496108_0204051 3300048911 Bacteria 1715
707 Ga0496109_0137587 3300048912 Bacteria 2283
708 Ga0496109_0258142 3300048912 Bacteria 1641
709 Ga0496110_0019179 3300048913 Bacteria 5751
710 Ga0496111_0006043 3300048914 Bacteria 7822
711 Ga0496112_0077201 3300048915 Bacteria 3294
712 Ga0496112_0090564 3300048915 Bacteria 3028
713 Ga0496112_0095614 3300048915 Bacteria 2941
714 Ga0496112_0126133 3300048915 Unclassified 2530
715 Ga0496112_0165147 3300048915 Bacteria 2180
716 Ga0496112_0344304 3300048915 Bacteria 1434
717 Ga0496113_0040525 3300048916 Bacteria 3432
718 Ga0496113_0052929 3300048916 Unclassified 3034
719 Ga0496113_0085594 3300048916 Bacteria 2421
720 Ga0496114_0026750 3300048917 Bacteria 4725
721 Ga0496115_0012654 3300048918 Bacteria 6359
722 Ga0496115_0040201 3300048918 Bacteria 3717
723 Ga0496115_0056447 3300048918 Bacteria 3156
724 Ga0496115_0068390 3300048918 Bacteria 2875
725 Ga0496126_0000085 3300048929 Bacteria 216528
726 Ga0496126_0001139 3300048929 Bacteria 44245
727 Ga0496126_0001781 3300048929 Bacteria 31809
728 Ga0496126_0009231 3300048929 Bacteria 10515
729 Ga0495682_0008805 3300049460 Bacteria 3967
730 Ga0495682_0043789 3300049460 Bacteria 1639
731 Ga0501031_0046555 3300049568 Bacteria 2828
732 Ga0501032_0001186 3300049569 Bacteria 20875
733 Ga0501033_0013422 3300049570 Bacteria 6239
734 Ga0501034_0005607 3300049571 Bacteria 13671
735 Ga0501036_0013543 3300049572 Bacteria 6780
736 Ga0501037_0003398 3300049573 Bacteria 11576
737 Ga0501038_0000661 3300049574 Bacteria 30645
738 Ga0501043_0000632 3300049579 Bacteria 31136
739 Ga0501046_0000036 3300049580 Bacteria 159823
740 Ga0501047_0012234 3300049581 Bacteria 8125
741 Ga0501073_0010534 3300049589 Bacteria 6771
742 Ga0501073_0048226 3300049589 Bacteria 2990
743 Ga0501074_0079359 3300049590 Bacteria 2355
744 Ga0501080_0009240 3300049742 Bacteria 8985
745 Ga0501083_0132819 3300049744 Unclassified 1632
746 Ga0501035_0003113 3300049822 Bacteria 15938
747 Ga0501044_0010234 3300049823 Bacteria 10184
748 nmdc:mga0n895_1746_c1 3300050512 Bacteria 16448
749 nmdc:mga08x19_56386_c1 3300050514 Bacteria 2536
750 Ga0495601_0020434 3300053077 Unclassified 4045
751 Ga0495601_0044442 3300053077 Bacteria 2792
752 Ga0500643_029950 3300053087 Bacteria 1671
753 Ga0500644_0044987 3300053088 Bacteria 1485
754 Ga0500651_0000009 3300053093 Bacteria 270362
755 Ga0500595_000072 3300053119 Bacteria 71795
756 Ga0501084_0052972 3300054114 Bacteria 3394
757 Ga0500661_006105 3300055283 Bacteria 2247
758 Ga0501082_0051892 3300060353 Bacteria 3535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0603020 Ga0451576_0603020_82_1113 342
2 3300035119 Ga0373956_0042298 Ga0373956_0042298_135_1250 353
3 3300046615 Ga0495656_0056874 Ga0495656_0056874_219_1349 354
4 3300046664 Ga0495659_0002804 Ga0495659_0002804_4317_5447 354
5 3300046684 Ga0495669_0045967 Ga0495669_0045967_155_1285 354
6 3300005563 Ga0068855_100127229 Ga0068855_1001272293 355
7 3300013105 Ga0157369_10008672 Ga0157369_100086724 355
8 3300025949 Ga0207667_10175402 Ga0207667_101754022 355
9 3300005535 Ga0070684_100046043 Ga0070684_1000460432 356
10 3300035088 Ga0373940_0047496 Ga0373940_0047496_99_1184 356
11 3300036401 Ga0373937_0017855 Ga0373937_0017855_4150_5265 356
12 3300047315 Ga0495581_0102114 Ga0495581_0102114_43_1158 356
13 3300046459 Ga0495629_0043096 Ga0495629_0043096_161_1264 364
14 3300048915 Ga0496112_0344304 Ga0496112_0344304_320_1423 364
15 3300031241 Ga0265325_10018559 Ga0265325_100185592 365
16 3300035086 Ga0373934_0051919 Ga0373934_0051919_26_1153 365
17 3300035724 Ga0373933_0145937 Ga0373933_0145937_332_1438 365
18 3300009093 Ga0105240_10000001 Ga0105240_100000011243 366
19 3300009098 Ga0105245_10020802 Ga0105245_100208025 366
20 3300009101 Ga0105247_10045149 Ga0105247_100451492 366
21 3300009174 Ga0105241_10015747 Ga0105241_100157472 366
22 3300009545 Ga0105237_10003849 Ga0105237_100038492 366
23 3300010375 Ga0105239_10028853 Ga0105239_100288533 366
24 3300011119 Ga0105246_10000907 Ga0105246_100009076 366
25 3300013296 Ga0157374_10023240 Ga0157374_100232402 366
26 3300013307 Ga0157372_10130189 Ga0157372_101301891 366
27 3300013308 Ga0157375_10005008 Ga0157375_100050089 366
28 3300014325 Ga0163163_10024393 Ga0163163_100243932 366
29 3300014968 Ga0157379_10012449 Ga0157379_100124492 366
30 3300014969 Ga0157376_10016808 Ga0157376_100168081 366
31 3300025261 Ga0209233_1004869 Ga0209233_10048691 366
32 3300025913 Ga0207695_10000001 Ga0207695_100000011248 366
33 3300013105 Ga0157369_10060177 Ga0157369_100601771 367
34 3300025920 Ga0207649_10106490 Ga0207649_101064902 367
35 3300045976 Ga0466967_0002031 Ga0466967_0002031_3079_4191 367
36 3300046616 Ga0495668_0158253 Ga0495668_0158253_108_1223 367
37 3300046660 Ga0495625_0047937 Ga0495625_0047937_1152_2267 367
38 3300049568 Ga0501031_0046555 Ga0501031_0046555_741_1859 367
39 3300049569 Ga0501032_0001186 Ga0501032_0001186_10141_11259 367
40 3300049570 Ga0501033_0013422 Ga0501033_0013422_825_1943 367
41 3300049571 Ga0501034_0005607 Ga0501034_0005607_1953_3071 367
42 3300049572 Ga0501036_0013543 Ga0501036_0013543_1291_2409 367
43 3300049573 Ga0501037_0003398 Ga0501037_0003398_93_1211 367
44 3300049574 Ga0501038_0000661 Ga0501038_0000661_20588_21706 367
45 3300049579 Ga0501043_0000632 Ga0501043_0000632_16497_17615 367
46 3300049580 Ga0501046_0000036 Ga0501046_0000036_127317_128435 367
47 3300049581 Ga0501047_0012234 Ga0501047_0012234_504_1622 367
48 3300049589 Ga0501073_0048226 Ga0501073_0048226_83_1201 367
49 3300049590 Ga0501074_0079359 Ga0501074_0079359_561_1679 367
50 3300049742 Ga0501080_0009240 Ga0501080_0009240_222_1340 367
51 3300049822 Ga0501035_0003113 Ga0501035_0003113_5880_6998 367
52 3300049823 Ga0501044_0010234 Ga0501044_0010234_4553_5671 367
53 3300009174 Ga0105241_10002688 Ga0105241_100026882 368
54 3300009551 Ga0105238_10101468 Ga0105238_101014682 368
55 3300013105 Ga0157369_10096380 Ga0157369_100963802 368
56 3300013306 Ga0163162_10219525 Ga0163162_102195253 368
57 3300006028 Ga0070717_10004829 Ga0070717_100048297 369
58 3300009545 Ga0105237_10044667 Ga0105237_100446673 369
59 3300010375 Ga0105239_10127172 Ga0105239_101271722 369
60 3300013105 Ga0157369_10050235 Ga0157369_100502354 369
61 3300013105 Ga0157369_10273902 Ga0157369_102739022 369
62 3300013105 Ga0157369_10447555 Ga0157369_104475551 369
63 3300013308 Ga0157375_10127307 Ga0157375_101273073 369
64 3300035692 Ga0373935_0094799 Ga0373935_0094799_790_1905 369
65 3300044694 Ga0466963_0000116 Ga0466963_0000116_11988_13103 369
66 3300045976 Ga0466967_0000227 Ga0466967_0000227_4618_5733 369
67 3300009098 Ga0105245_10178216 Ga0105245_101782162 371
68 3300009174 Ga0105241_10005545 Ga0105241_100055452 371
69 3300009551 Ga0105238_10131930 Ga0105238_101319302 371
70 3300011119 Ga0105246_10077173 Ga0105246_100771732 371
71 3300013100 Ga0157373_10098780 Ga0157373_100987802 371
72 3300013297 Ga0157378_10179908 Ga0157378_101799083 371
73 3300013306 Ga0163162_10000822 Ga0163162_1000082225 371
74 3300014325 Ga0163163_10080874 Ga0163163_100808742 371
75 3300037068 Ga0373925_0055083 Ga0373925_0055083_713_1846 371
76 3300045051 Ga0451576_0451756 Ga0451576_0451756_92_1222 371
77 3300046472 Ga0495580_0049926 Ga0495580_0049926_880_2010 371
78 3300048907 Ga0496104_0124216 Ga0496104_0124216_1335_2468 371
79 3300048908 Ga0496105_0068298 Ga0496105_0068298_459_1592 371
80 3300048910 Ga0496107_0141836 Ga0496107_0141836_13_1146 371
81 3300048917 Ga0496114_0026750 Ga0496114_0026750_2250_3383 371
82 3300048918 Ga0496115_0056447 Ga0496115_0056447_917_2050 371
83 3300049589 Ga0501073_0010534 Ga0501073_0010534_91_1215 371
84 3300054114 Ga0501084_0052972 Ga0501084_0052972_676_1800 371
85 3300060353 Ga0501082_0051892 Ga0501082_0051892_538_1662 371
86 3300005439 Ga0070711_100222443 Ga0070711_1002224432 372
87 3300044694 Ga0466963_0152210 Ga0466963_0152210_173_1357 372
88 3300046471 Ga0495650_0000037 Ga0495650_0000037_224268_225407 375
89 3300046665 Ga0495661_0022579 Ga0495661_0022579_1065_2204 375
90 3300053087 Ga0500643_029950 Ga0500643_029950_188_1327 375
91 3300053093 Ga0500651_0000009 Ga0500651_0000009_40983_42122 375
92 3300005436 Ga0070713_100063124 Ga0070713_1000631242 376
93 3300048907 Ga0496104_0023246 Ga0496104_0023246_3038_4219 376
94 3300048929 Ga0496126_0001781 Ga0496126_0001781_11548_12726 376
95 3300048916 Ga0496113_0085594 Ga0496113_0085594_1131_2312 377
96 3300005435 Ga0070714_100091642 Ga0070714_1000916421 378
97 3300005436 Ga0070713_100044263 Ga0070713_1000442631 378
98 3300005437 Ga0070710_10041817 Ga0070710_100418171 378
99 3300005439 Ga0070711_100009579 Ga0070711_1000095792 378
100 3300005439 Ga0070711_100027461 Ga0070711_1000274612 378
101 3300006914 Ga0075436_100032251 Ga0075436_1000322512 378
102 3300009093 Ga0105240_10002144 Ga0105240_1000214412 378
103 3300013105 Ga0157369_10018678 Ga0157369_100186788 378
104 3300013296 Ga0157374_10235555 Ga0157374_102355551 378
105 3300013307 Ga0157372_10160791 Ga0157372_101607912 378
106 3300013307 Ga0157372_10162974 Ga0157372_101629743 378
107 3300014325 Ga0163163_10134870 Ga0163163_101348703 378
108 3300025906 Ga0207699_10008635 Ga0207699_100086353 378
109 3300025913 Ga0207695_10000259 Ga0207695_1000025929 378
110 3300025915 Ga0207693_10006863 Ga0207693_1000686311 378
111 3300025928 Ga0207700_10011869 Ga0207700_100118695 378
112 3300025929 Ga0207664_10040595 Ga0207664_100405952 378
113 3300026078 Ga0207702_10043948 Ga0207702_100439483 378
114 3300030878 Ga0265770_1002418 Ga0265770_10024183 378
115 3300031247 Ga0265340_10013357 Ga0265340_100133573 378
116 3300035171 Ga0373946_0018138 Ga0373946_0018138_1382_2563 378
117 3300035692 Ga0373935_0142971 Ga0373935_0142971_148_1329 378
118 3300035695 Ga0373927_0001713 Ga0373927_0001713_1019_2200 378
119 3300035725 Ga0373947_0029549 Ga0373947_0029549_961_2142 378
120 3300044684 Ga0466966_0066721 Ga0466966_0066721_637_1848 378
121 3300044684 Ga0466966_0072063 Ga0466966_0072063_671_1882 378
122 3300045049 Ga0466959_0076064 Ga0466959_0076064_1158_2369 378
123 3300048903 Ga0496100_0099849 Ga0496100_0099849_435_1577 378
124 3300048907 Ga0496104_0067312 Ga0496104_0067312_1356_2498 378
125 3300048908 Ga0496105_0064958 Ga0496105_0064958_1029_2171 378
126 3300048911 Ga0496108_0204051 Ga0496108_0204051_72_1214 378
127 3300048912 Ga0496109_0137587 Ga0496109_0137587_533_1675 378
128 3300048916 Ga0496113_0040525 Ga0496113_0040525_1230_2372 378
129 3300053077 Ga0495601_0044442 Ga0495601_0044442_1135_2277 378
130 3300031344 Ga0265316_10150545 Ga0265316_101505452 379
131 3300045051 Ga0451576_0036535 Ga0451576_0036535_3878_5038 379
132 3300005458 Ga0070681_10226149 Ga0070681_102261491 382
133 3300006028 Ga0070717_10180162 Ga0070717_101801621 383
134 3300028800 Ga0265338_10001617 Ga0265338_1000161733 383
135 3300031249 Ga0265339_10040250 Ga0265339_100402502 383
136 3300031711 Ga0265314_10020473 Ga0265314_100204732 383
137 3300006871 Ga0075434_100080753 Ga0075434_1000807532 384
138 3300009093 Ga0105240_10059946 Ga0105240_100599464 384
139 3300025913 Ga0207695_10146374 Ga0207695_101463742 384
140 3300046459 Ga0495629_0081742 Ga0495629_0081742_815_1996 384
141 3300046472 Ga0495580_0039510 Ga0495580_0039510_1244_2425 384
142 3300047472 Ga0495686_0001457 Ga0495686_0001457_18317_19486 384
143 3300048088 Ga0495602_0225586 Ga0495602_0225586_61_1242 384
144 3300048918 Ga0496115_0068390 Ga0496115_0068390_877_2058 384
145 3300050514 nmdc:mga08x19_56386_c1 nmdc:mga08x19_56386_c1_373_1569 384
146 3300053077 Ga0495601_0020434 Ga0495601_0020434_2730_3890 384
147 3300014968 Ga0157379_10056931 Ga0157379_100569314 385
148 iso_pu_bacteria 2884215851 2884218592 385
149 3300005335 Ga0070666_10003898 Ga0070666_100038988 386
150 3300005338 Ga0068868_100086489 Ga0068868_1000864892 386
151 3300005456 Ga0070678_100054496 Ga0070678_1000544963 386
152 3300005458 Ga0070681_10191810 Ga0070681_101918102 386
153 3300005535 Ga0070684_100322878 Ga0070684_1003228781 386
154 3300005578 Ga0068854_100316524 Ga0068854_1003165241 386
155 3300005614 Ga0068856_100004085 Ga0068856_10000408511 386
156 3300006237 Ga0097621_100009357 Ga0097621_1000093576 386
157 3300009098 Ga0105245_10012963 Ga0105245_100129633 386
158 3300009176 Ga0105242_10179348 Ga0105242_101793482 386
159 3300009545 Ga0105237_10022066 Ga0105237_100220662 386
160 3300009551 Ga0105238_10054203 Ga0105238_100542032 386
161 3300013307 Ga0157372_10277084 Ga0157372_102770842 386
162 3300014968 Ga0157379_10199098 Ga0157379_101990982 386
163 3300025907 Ga0207645_10009148 Ga0207645_100091485 386
164 3300025913 Ga0207695_10074400 Ga0207695_100744003 386
165 3300025919 Ga0207657_10069516 Ga0207657_100695161 386
166 3300025949 Ga0207667_10053980 Ga0207667_100539805 386
167 3300025960 Ga0207651_10142401 Ga0207651_101424012 386
168 3300025986 Ga0207658_10101686 Ga0207658_101016862 386
169 3300026035 Ga0207703_10037100 Ga0207703_100371003 386
170 3300026121 Ga0207683_10000600 Ga0207683_1000060015 386
171 3300028573 Ga0265334_10043510 Ga0265334_100435101 386
172 3300028666 Ga0265336_10008975 Ga0265336_100089751 386
173 3300028800 Ga0265338_10009997 Ga0265338_100099979 386
174 3300028800 Ga0265338_10010474 Ga0265338_100104747 386
175 3300031235 Ga0265330_10001479 Ga0265330_1000147912 386
176 3300031238 Ga0265332_10004965 Ga0265332_100049655 386
177 3300031239 Ga0265328_10010533 Ga0265328_100105331 386
178 3300031239 Ga0265328_10029060 Ga0265328_100290601 386
179 3300031241 Ga0265325_10003147 Ga0265325_1000314711 386
180 3300031247 Ga0265340_10004274 Ga0265340_100042744 386
181 3300031247 Ga0265340_10022014 Ga0265340_100220143 386
182 3300031249 Ga0265339_10004260 Ga0265339_100042603 386
183 3300031249 Ga0265339_10009355 Ga0265339_100093552 386
184 3300031344 Ga0265316_10007359 Ga0265316_100073595 386
185 3300031711 Ga0265314_10000063 Ga0265314_1000006354 386
186 3300031712 Ga0265342_10001877 Ga0265342_1000187710 386
187 3300031712 Ga0265342_10029167 Ga0265342_100291672 386
188 3300046684 Ga0495669_0044969 Ga0495669_0044969_767_1936 386
189 3300048918 Ga0496115_0012654 Ga0496115_0012654_3870_5039 386
190 3300005435 Ga0070714_100000186 Ga0070714_10000018638 387
191 3300013307 Ga0157372_10279736 Ga0157372_102797361 387
192 3300025914 Ga0207671_10226462 Ga0207671_102264621 387
193 3300025929 Ga0207664_10000086 Ga0207664_1000008652 387
194 3300031548 Ga0307408_100101971 Ga0307408_1001019711 387
195 3300031731 Ga0307405_10037690 Ga0307405_100376902 387
196 3300031852 Ga0307410_10016670 Ga0307410_100166704 387
197 3300031901 Ga0307406_10028616 Ga0307406_100286164 387
198 3300031995 Ga0307409_100075685 Ga0307409_1000756852 387
199 3300031995 Ga0307409_100170897 Ga0307409_1001708972 387
200 3300032002 Ga0307416_100071608 Ga0307416_1000716082 387
201 3300032005 Ga0307411_10141231 Ga0307411_101412311 387
202 3300032005 Ga0307411_10238717 Ga0307411_102387171 387
203 3300032126 Ga0307415_100109801 Ga0307415_1001098012 387
204 3300035119 Ga0373956_0027534 Ga0373956_0027534_1211_2404 387
205 3300049460 Ga0495682_0043789 Ga0495682_0043789_19_1212 387
206 3300005329 Ga0070683_100016119 Ga0070683_1000161195 388
207 3300005331 Ga0070670_100002362 Ga0070670_1000023622 388
208 3300005334 Ga0068869_100036357 Ga0068869_1000363572 388
209 3300005338 Ga0068868_100037335 Ga0068868_1000373352 388
210 3300005344 Ga0070661_100023770 Ga0070661_1000237702 388
211 3300005355 Ga0070671_100002623 Ga0070671_10000262313 388
212 3300005367 Ga0070667_100004122 Ga0070667_1000041229 388
213 3300005530 Ga0070679_100007052 Ga0070679_1000070528 388
214 3300005535 Ga0070684_100007590 Ga0070684_1000075905 388
215 3300005535 Ga0070684_100030399 Ga0070684_1000303992 388
216 3300005535 Ga0070684_100099288 Ga0070684_1000992882 388
217 3300005539 Ga0068853_100000147 Ga0068853_10000014751 388
218 3300005539 Ga0068853_100279180 Ga0068853_1002791802 388
219 3300005563 Ga0068855_100002303 Ga0068855_10000230314 388
220 3300005564 Ga0070664_100047843 Ga0070664_1000478434 388
221 3300005577 Ga0068857_100000669 Ga0068857_10000066920 388
222 3300005578 Ga0068854_100044111 Ga0068854_1000441112 388
223 3300005614 Ga0068856_100004416 Ga0068856_1000044167 388
224 3300005616 Ga0068852_100000412 Ga0068852_10000041215 388
225 3300005616 Ga0068852_100000504 Ga0068852_10000050421 388
226 3300005617 Ga0068859_100001120 Ga0068859_10000112016 388
227 3300005618 Ga0068864_100003371 Ga0068864_10000337110 388
228 3300005834 Ga0068851_10006828 Ga0068851_100068282 388
229 3300005841 Ga0068863_100012947 Ga0068863_1000129475 388
230 3300005842 Ga0068858_100003224 Ga0068858_1000032249 388
231 3300005843 Ga0068860_100000912 Ga0068860_1000009124 388
232 3300006237 Ga0097621_100002346 Ga0097621_10000234611 388
233 3300006358 Ga0068871_100009242 Ga0068871_1000092425 388
234 3300006931 Ga0097620_100001120 Ga0097620_10000112012 388
235 3300009093 Ga0105240_10001453 Ga0105240_1000145311 388
236 3300009093 Ga0105240_10002730 Ga0105240_1000273013 388
237 3300009093 Ga0105240_10018640 Ga0105240_100186408 388
238 3300009101 Ga0105247_10011709 Ga0105247_100117092 388
239 3300009174 Ga0105241_10000610 Ga0105241_100006105 388
240 3300009545 Ga0105237_10040540 Ga0105237_100405403 388
241 3300009551 Ga0105238_10000171 Ga0105238_1000017120 388
242 3300009551 Ga0105238_10001015 Ga0105238_1000101511 388
243 3300009551 Ga0105238_10090334 Ga0105238_100903342 388
244 3300009551 Ga0105238_10184060 Ga0105238_101840602 388
245 3300009553 Ga0105249_10029561 Ga0105249_100295613 388
246 3300010375 Ga0105239_10001391 Ga0105239_1000139110 388
247 3300013104 Ga0157370_10001599 Ga0157370_1000159912 388
248 3300013105 Ga0157369_10001577 Ga0157369_1000157713 388
249 3300013105 Ga0157369_10027231 Ga0157369_100272315 388
250 3300013296 Ga0157374_10051375 Ga0157374_100513754 388
251 3300013297 Ga0157378_10016175 Ga0157378_100161753 388
252 3300013297 Ga0157378_10021152 Ga0157378_100211523 388
253 3300013307 Ga0157372_10001952 Ga0157372_100019527 388
254 3300013307 Ga0157372_10019312 Ga0157372_100193126 388
255 3300014745 Ga0157377_10053988 Ga0157377_100539882 388
256 3300025900 Ga0207710_10025303 Ga0207710_100253032 388
257 3300025909 Ga0207705_10045043 Ga0207705_100450434 388
258 3300025911 Ga0207654_10000170 Ga0207654_100001702 388
259 3300025911 Ga0207654_10004565 Ga0207654_100045657 388
260 3300025913 Ga0207695_10000537 Ga0207695_1000053778 388
261 3300025913 Ga0207695_10000877 Ga0207695_1000087733 388
262 3300025913 Ga0207695_10002346 Ga0207695_1000234612 388
263 3300025913 Ga0207695_10035688 Ga0207695_100356885 388
264 3300025914 Ga0207671_10001200 Ga0207671_100012005 388
265 3300025914 Ga0207671_10003815 Ga0207671_100038155 388
266 3300025919 Ga0207657_10018860 Ga0207657_100188606 388
267 3300025920 Ga0207649_10014930 Ga0207649_100149303 388
268 3300025921 Ga0207652_10003180 Ga0207652_100031803 388
269 3300025924 Ga0207694_10000181 Ga0207694_1000018111 388
270 3300025924 Ga0207694_10000770 Ga0207694_1000077018 388
271 3300025924 Ga0207694_10255829 Ga0207694_102558291 388
272 3300025925 Ga0207650_10028219 Ga0207650_100282193 388
273 3300025927 Ga0207687_10015053 Ga0207687_100150531 388
274 3300025931 Ga0207644_10001417 Ga0207644_100014172 388
275 3300025942 Ga0207689_10002258 Ga0207689_100022587 388
276 3300025944 Ga0207661_10212321 Ga0207661_102123212 388
277 3300025945 Ga0207679_10039884 Ga0207679_100398844 388
278 3300025949 Ga0207667_10002563 Ga0207667_100025637 388
279 3300025981 Ga0207640_10010714 Ga0207640_100107146 388
280 3300025986 Ga0207658_10000811 Ga0207658_100008117 388
281 3300026023 Ga0207677_10000242 Ga0207677_1000024226 388
282 3300026035 Ga0207703_10004751 Ga0207703_1000475110 388
283 3300026041 Ga0207639_10000101 Ga0207639_1000010120 388
284 3300026078 Ga0207702_10002585 Ga0207702_100025855 388
285 3300026078 Ga0207702_10003045 Ga0207702_1000304515 388
286 3300026088 Ga0207641_10003995 Ga0207641_100039959 388
287 3300026095 Ga0207676_10001904 Ga0207676_100019049 388
288 3300026116 Ga0207674_10001897 Ga0207674_1000189712 388
289 3300026116 Ga0207674_10006656 Ga0207674_1000665610 388
290 3300026142 Ga0207698_10000263 Ga0207698_1000026310 388
291 3300026142 Ga0207698_10000268 Ga0207698_1000026813 388
292 3300028379 Ga0268266_10222389 Ga0268266_102223892 388
293 3300028381 Ga0268264_10009127 Ga0268264_100091274 388
294 3300031235 Ga0265330_10000326 Ga0265330_1000032625 388
295 3300031235 Ga0265330_10008043 Ga0265330_100080431 388
296 3300031235 Ga0265330_10052525 Ga0265330_100525251 388
297 3300031239 Ga0265328_10028521 Ga0265328_100285211 388
298 3300031241 Ga0265325_10001354 Ga0265325_1000135413 388
299 3300031241 Ga0265325_10046767 Ga0265325_100467673 388
300 3300031241 Ga0265325_10062162 Ga0265325_100621622 388
301 3300031247 Ga0265340_10009915 Ga0265340_100099152 388
302 3300031249 Ga0265339_10000102 Ga0265339_1000010257 388
303 3300031344 Ga0265316_10001220 Ga0265316_1000122023 388
304 3300031344 Ga0265316_10007060 Ga0265316_100070608 388
305 3300031344 Ga0265316_10035281 Ga0265316_100352813 388
306 3300031344 Ga0265316_10215886 Ga0265316_102158861 388
307 3300031595 Ga0265313_10003269 Ga0265313_1000326912 388
308 3300031595 Ga0265313_10009409 Ga0265313_100094094 388
309 3300031595 Ga0265313_10025707 Ga0265313_100257072 388
310 3300031711 Ga0265314_10078225 Ga0265314_100782252 388
311 3300031711 Ga0265314_10096188 Ga0265314_100961882 388
312 3300031712 Ga0265342_10001150 Ga0265342_1000115020 388
313 3300031712 Ga0265342_10003244 Ga0265342_100032444 388
314 3300031712 Ga0265342_10003727 Ga0265342_1000372711 388
315 3300047472 Ga0495686_0001113 Ga0495686_0001113_22332_23510 388
316 3300048909 Ga0496106_0063264 Ga0496106_0063264_1605_2786 388
317 3300048915 Ga0496112_0126133 Ga0496112_0126133_979_2160 388
318 3300048916 Ga0496113_0052929 Ga0496113_0052929_574_1749 388
319 3300003320 rootH2_10068046 rootH2_100680461 389
320 3300003320 rootH2_10094440 rootH2_100944401 389
321 3300005327 Ga0070658_10043287 Ga0070658_100432872 389
322 3300005327 Ga0070658_10084479 Ga0070658_100844792 389
323 3300005329 Ga0070683_100011254 Ga0070683_1000112544 389
324 3300005339 Ga0070660_100028337 Ga0070660_1000283373 389
325 3300005344 Ga0070661_100134909 Ga0070661_1001349092 389
326 3300005366 Ga0070659_100022223 Ga0070659_1000222234 389
327 3300005455 Ga0070663_100106270 Ga0070663_1001062702 389
328 3300005455 Ga0070663_100112998 Ga0070663_1001129982 389
329 3300005458 Ga0070681_10028029 Ga0070681_100280292 389
330 3300005530 Ga0070679_100047253 Ga0070679_1000472532 389
331 3300005539 Ga0068853_100000171 Ga0068853_10000017142 389
332 3300005563 Ga0068855_100003583 Ga0068855_1000035832 389
333 3300005563 Ga0068855_100070468 Ga0068855_1000704684 389
334 3300005563 Ga0068855_100082127 Ga0068855_1000821272 389
335 3300005577 Ga0068857_100054440 Ga0068857_1000544404 389
336 3300005578 Ga0068854_100007907 Ga0068854_1000079079 389
337 3300005578 Ga0068854_100024559 Ga0068854_1000245592 389
338 3300005614 Ga0068856_100051619 Ga0068856_1000516193 389
339 3300009093 Ga0105240_10032689 Ga0105240_100326894 389
340 3300009093 Ga0105240_10037657 Ga0105240_100376572 389
341 3300009093 Ga0105240_10091617 Ga0105240_100916172 389
342 3300009545 Ga0105237_10113608 Ga0105237_101136082 389
343 3300009551 Ga0105238_10018376 Ga0105238_100183764 389
344 3300013102 Ga0157371_10136127 Ga0157371_101361272 389
345 3300013104 Ga0157370_10029198 Ga0157370_100291985 389
346 3300013105 Ga0157369_10025792 Ga0157369_100257923 389
347 3300013105 Ga0157369_10035283 Ga0157369_100352834 389
348 3300013306 Ga0163162_10017568 Ga0163162_100175684 389
349 3300013307 Ga0157372_10009227 Ga0157372_100092276 389
350 3300013307 Ga0157372_10013111 Ga0157372_100131117 389
351 3300013307 Ga0157372_10094168 Ga0157372_100941683 389
352 3300013307 Ga0157372_10137259 Ga0157372_101372592 389
353 3300025261 Ga0209233_1003838 Ga0209233_10038385 389
354 3300025904 Ga0207647_10002648 Ga0207647_100026482 389
355 3300025909 Ga0207705_10010285 Ga0207705_100102853 389
356 3300025909 Ga0207705_10014420 Ga0207705_100144203 389
357 3300025909 Ga0207705_10018328 Ga0207705_100183285 389
358 3300025912 Ga0207707_10040403 Ga0207707_100404034 389
359 3300025913 Ga0207695_10029311 Ga0207695_100293112 389
360 3300025913 Ga0207695_10057369 Ga0207695_100573694 389
361 3300025919 Ga0207657_10008823 Ga0207657_100088234 389
362 3300025919 Ga0207657_10029486 Ga0207657_100294864 389
363 3300025931 Ga0207644_10144091 Ga0207644_101440911 389
364 3300025932 Ga0207690_10076556 Ga0207690_100765562 389
365 3300025949 Ga0207667_10018922 Ga0207667_100189229 389
366 3300025949 Ga0207667_10128740 Ga0207667_101287402 389
367 3300025981 Ga0207640_10000117 Ga0207640_100001179 389
368 3300026041 Ga0207639_10002332 Ga0207639_100023324 389
369 3300026041 Ga0207639_10175237 Ga0207639_101752372 389
370 3300026067 Ga0207678_10006271 Ga0207678_100062719 389
371 3300026067 Ga0207678_10007842 Ga0207678_100078424 389
372 3300026067 Ga0207678_10033347 Ga0207678_100333472 389
373 3300026095 Ga0207676_10159604 Ga0207676_101596042 389
374 3300026116 Ga0207674_10002204 Ga0207674_1000220422 389
375 3300028379 Ga0268266_10037935 Ga0268266_100379353 389
376 3300028379 Ga0268266_10093131 Ga0268266_100931313 389
377 3300028800 Ga0265338_10006322 Ga0265338_1000632213 389
378 3300031249 Ga0265339_10002713 Ga0265339_1000271312 389
379 3300031344 Ga0265316_10028872 Ga0265316_100288723 389
380 3300031595 Ga0265313_10016220 Ga0265313_100162202 389
381 3300031711 Ga0265314_10010478 Ga0265314_100104784 389
382 3300031712 Ga0265342_10033310 Ga0265342_100333103 389
383 3300033180 Ga0307510_10029551 Ga0307510_100295515 389
384 3300046452 Ga0495617_056061 Ga0495617_056061_102_1283 389
385 3300046454 Ga0495592_0196950 Ga0495592_0196950_10_1206 389
386 3300046455 Ga0495603_0005762 Ga0495603_0005762_6053_7234 389
387 3300046459 Ga0495629_0006748 Ga0495629_0006748_2655_3836 389
388 3300046462 Ga0495651_0010087 Ga0495651_0010087_4412_5593 389
389 3300046462 Ga0495651_0037611 Ga0495651_0037611_1022_2203 389
390 3300046463 Ga0495653_0001794 Ga0495653_0001794_15096_16277 389
391 3300046472 Ga0495580_0056552 Ga0495580_0056552_760_1941 389
392 3300046473 Ga0495582_0004081 Ga0495582_0004081_6319_7500 389
393 3300046474 Ga0495605_0044647 Ga0495605_0044647_340_1521 389
394 3300046475 Ga0495639_0001894 Ga0495639_0001894_3939_5120 389
395 3300046477 Ga0495664_0001180 Ga0495664_0001180_8688_9869 389
396 3300046477 Ga0495664_0146885 Ga0495664_0146885_89_1285 389
397 3300046492 Ga0495585_0005391 Ga0495585_0005391_3638_4819 389
398 3300046499 Ga0495594_0000357 Ga0495594_0000357_1199_2380 389
399 3300046499 Ga0495594_0001304 Ga0495594_0001304_476_1657 389
400 3300046499 Ga0495594_0006703 Ga0495594_0006703_829_2010 389
401 3300046500 Ga0495596_0015901 Ga0495596_0015901_919_2100 389
402 3300046506 Ga0495583_0022628 Ga0495583_0022628_890_2074 389
403 3300046506 Ga0495583_0072514 Ga0495583_0072514_66_1247 389
404 3300046514 Ga0495618_0032463 Ga0495618_0032463_2076_3257 389
405 3300046516 Ga0495628_0127888 Ga0495628_0127888_400_1596 389
406 3300046518 Ga0495631_0005469 Ga0495631_0005469_1571_2752 389
407 3300046523 Ga0495644_0000004 Ga0495644_0000004_105655_106836 389
408 3300046528 Ga0495642_0047448 Ga0495642_0047448_500_1681 389
409 3300046529 Ga0495652_0004537 Ga0495652_0004537_4968_6149 389
410 3300046529 Ga0495652_0054462 Ga0495652_0054462_611_1807 389
411 3300046531 Ga0495665_0002033 Ga0495665_0002033_4251_5432 389
412 3300046533 Ga0495640_0009979 Ga0495640_0009979_5657_6838 389
413 3300046535 Ga0495586_0003036 Ga0495586_0003036_5371_6552 389
414 3300046538 Ga0495609_0026554 Ga0495609_0026554_894_2075 389
415 3300046558 Ga0495633_0035845 Ga0495633_0035845_1121_2302 389
416 3300046559 Ga0495667_0009281 Ga0495667_0009281_4967_6148 389
417 3300046660 Ga0495625_0008870 Ga0495625_0008870_2974_4155 389
418 3300046663 Ga0495635_0001143 Ga0495635_0001143_11338_12519 389
419 3300046678 Ga0495599_0005781 Ga0495599_0005781_4123_5304 389
420 3300046680 Ga0495646_0015770 Ga0495646_0015770_476_1657 389
421 3300046684 Ga0495669_0001311 Ga0495669_0001311_2041_3222 389
422 3300046689 Ga0495613_0008425 Ga0495613_0008425_2064_3245 389
423 3300046690 Ga0495624_0001490 Ga0495624_0001490_1861_3042 389
424 3300046694 Ga0495649_0023508 Ga0495649_0023508_1751_2932 389
425 3300046694 Ga0495649_0052110 Ga0495649_0052110_937_2121 389
426 3300046809 Ga0495600_0004064 Ga0495600_0004064_4364_5545 389
427 3300047317 Ga0495604_0019623 Ga0495604_0019623_1965_3146 389
428 3300047317 Ga0495604_0031403 Ga0495604_0031403_1126_2322 389
429 3300047319 Ga0495674_0041535 Ga0495674_0041535_991_2172 389
430 3300047321 Ga0495676_0004397 Ga0495676_0004397_534_1715 389
431 3300047322 Ga0495680_0013716 Ga0495680_0013716_4123_5304 389
432 3300047444 Ga0495675_0001672 Ga0495675_0001672_392_1573 389
433 3300047471 Ga0495684_0010561 Ga0495684_0010561_4490_5671 389
434 3300048089 Ga0495614_0002636 Ga0495614_0002636_6191_7372 389
435 3300048907 Ga0496104_0043377 Ga0496104_0043377_2106_3287 389
436 3300048929 Ga0496126_0000085 Ga0496126_0000085_53834_55009 389
437 3300048929 Ga0496126_0001139 Ga0496126_0001139_29672_30853 389
438 3300049460 Ga0495682_0008805 Ga0495682_0008805_796_1980 389
439 3300053119 Ga0500595_000072 Ga0500595_000072_1620_2801 389
440 3300055283 Ga0500661_006105 Ga0500661_006105_27_1208 389
441 3300005327 Ga0070658_10111993 Ga0070658_101119932 390
442 3300005344 Ga0070661_100196288 Ga0070661_1001962881 390
443 3300005344 Ga0070661_100232038 Ga0070661_1002320381 390
444 3300005455 Ga0070663_100039601 Ga0070663_1000396012 390
445 3300005455 Ga0070663_100208654 Ga0070663_1002086542 390
446 3300005530 Ga0070679_100230172 Ga0070679_1002301721 390
447 3300005539 Ga0068853_100136860 Ga0068853_1001368601 390
448 3300005548 Ga0070665_100005874 Ga0070665_1000058742 390
449 3300005548 Ga0070665_100013579 Ga0070665_1000135792 390
450 3300005563 Ga0068855_100041529 Ga0068855_1000415292 390
451 3300005614 Ga0068856_100045720 Ga0068856_1000457203 390
452 3300005842 Ga0068858_100228089 Ga0068858_1002280892 390
453 3300009093 Ga0105240_10009959 Ga0105240_100099593 390
454 3300009174 Ga0105241_10000033 Ga0105241_100000339 390
455 3300009177 Ga0105248_10001860 Ga0105248_1000186018 390
456 3300010375 Ga0105239_10002062 Ga0105239_1000206223 390
457 3300013105 Ga0157369_10008591 Ga0157369_100085915 390
458 3300013296 Ga0157374_10095152 Ga0157374_100951522 390
459 3300025909 Ga0207705_10000109 Ga0207705_1000010935 390
460 3300025911 Ga0207654_10000368 Ga0207654_100003689 390
461 3300025913 Ga0207695_10000030 Ga0207695_10000030222 390
462 3300025913 Ga0207695_10042919 Ga0207695_100429192 390
463 3300025924 Ga0207694_10003285 Ga0207694_100032855 390
464 3300025941 Ga0207711_10001374 Ga0207711_1000137419 390
465 3300025944 Ga0207661_10318683 Ga0207661_103186832 390
466 3300025949 Ga0207667_10054381 Ga0207667_100543814 390
467 3300026035 Ga0207703_10174981 Ga0207703_101749812 390
468 3300026067 Ga0207678_10058947 Ga0207678_100589471 390
469 3300026067 Ga0207678_10066529 Ga0207678_100665292 390
470 3300028379 Ga0268266_10004489 Ga0268266_100044895 390
471 3300028379 Ga0268266_10005457 Ga0268266_1000545712 390
472 3300028379 Ga0268266_10029772 Ga0268266_100297722 390
473 3300031344 Ga0265316_10020829 Ga0265316_100208295 390
474 3300031344 Ga0265316_10066620 Ga0265316_100666202 390
475 3300031344 Ga0265316_10156160 Ga0265316_101561602 390
476 3300044842 Ga0466957_0000246 Ga0466957_0000246_4073_5251 390
477 3300046471 Ga0495650_0006514 Ga0495650_0006514_2827_4014 390
478 3300046660 Ga0495625_0000166 Ga0495625_0000166_67943_69130 390
479 3300047320 Ga0495672_0004803 Ga0495672_0004803_691_1878 390
480 3300047472 Ga0495686_0000006 Ga0495686_0000006_394943_396121 390
481 3300048907 Ga0496104_0037784 Ga0496104_0037784_2979_4157 390
482 3300048915 Ga0496112_0090564 Ga0496112_0090564_1104_2294 390
483 3300004800 Ga0058861_10017042 Ga0058861_100170422 391
484 3300004800 Ga0058861_11866551 Ga0058861_118665511 391
485 3300005329 Ga0070683_100008847 Ga0070683_1000088477 391
486 3300005336 Ga0070680_100051139 Ga0070680_1000511393 391
487 3300005434 Ga0070709_10011575 Ga0070709_100115754 391
488 3300005435 Ga0070714_100027044 Ga0070714_1000270441 391
489 3300005436 Ga0070713_100079146 Ga0070713_1000791462 391
490 3300005436 Ga0070713_100136215 Ga0070713_1001362152 391
491 3300005458 Ga0070681_10017910 Ga0070681_100179107 391
492 3300005458 Ga0070681_10079022 Ga0070681_100790222 391
493 3300005530 Ga0070679_100080520 Ga0070679_1000805202 391
494 3300005535 Ga0070684_100219988 Ga0070684_1002199882 391
495 3300005535 Ga0070684_100333490 Ga0070684_1003334901 391
496 3300005539 Ga0068853_100095012 Ga0068853_1000950122 391
497 3300005563 Ga0068855_100038938 Ga0068855_1000389381 391
498 3300005614 Ga0068856_100055512 Ga0068856_1000555122 391
499 3300005834 Ga0068851_10007193 Ga0068851_100071932 391
500 3300006028 Ga0070717_10037951 Ga0070717_100379513 391
501 3300006028 Ga0070717_10110496 Ga0070717_101104961 391
502 3300006028 Ga0070717_10218511 Ga0070717_102185112 391
503 3300006163 Ga0070715_10083686 Ga0070715_100836862 391
504 3300006175 Ga0070712_100163011 Ga0070712_1001630112 391
505 3300009098 Ga0105245_10004986 Ga0105245_100049867 391
506 3300009098 Ga0105245_10021278 Ga0105245_100212782 391
507 3300009174 Ga0105241_10160384 Ga0105241_101603842 391
508 3300013104 Ga0157370_10019860 Ga0157370_100198602 391
509 3300013297 Ga0157378_10014964 Ga0157378_100149644 391
510 3300025909 Ga0207705_10026073 Ga0207705_100260732 391
511 3300025912 Ga0207707_10008391 Ga0207707_100083917 391
512 3300025912 Ga0207707_10090706 Ga0207707_100907062 391
513 3300025913 Ga0207695_10118840 Ga0207695_101188402 391
514 3300025914 Ga0207671_10090486 Ga0207671_100904863 391
515 3300025916 Ga0207663_10206835 Ga0207663_102068352 391
516 3300025917 Ga0207660_10001656 Ga0207660_1000165613 391
517 3300025917 Ga0207660_10046231 Ga0207660_100462312 391
518 3300025921 Ga0207652_10013893 Ga0207652_100138935 391
519 3300025924 Ga0207694_10084492 Ga0207694_100844922 391
520 3300025927 Ga0207687_10002934 Ga0207687_100029349 391
521 3300025927 Ga0207687_10027666 Ga0207687_100276663 391
522 3300025928 Ga0207700_10021436 Ga0207700_100214362 391
523 3300025928 Ga0207700_10137812 Ga0207700_101378121 391
524 3300025929 Ga0207664_10062067 Ga0207664_100620671 391
525 3300025939 Ga0207665_10015038 Ga0207665_100150383 391
526 3300025949 Ga0207667_10011761 Ga0207667_100117619 391
527 3300025949 Ga0207667_10151770 Ga0207667_101517702 391
528 3300026078 Ga0207702_10047255 Ga0207702_100472552 391
529 3300035172 Ga0373955_0014400 Ga0373955_0014400_2236_3465 391
530 3300035410 Ga0373924_0003464 Ga0373924_0003464_2149_3330 391
531 3300036401 Ga0373937_0000026 Ga0373937_0000026_119789_120970 391
532 3300036401 Ga0373937_0039864 Ga0373937_0039864_1557_2738 391
533 3300046462 Ga0495651_0071104 Ga0495651_0071104_1362_2546 391
534 3300046529 Ga0495652_0098395 Ga0495652_0098395_220_1401 391
535 3300046679 Ga0495623_0016828 Ga0495623_0016828_481_1662 391
536 3300047317 Ga0495604_0033274 Ga0495604_0033274_1464_2648 391
537 3300047322 Ga0495680_0153254 Ga0495680_0153254_398_1582 391
538 3300048905 Ga0496102_0043116 Ga0496102_0043116_1210_2391 391
539 3300048905 Ga0496102_0053501 Ga0496102_0053501_1034_2215 391
540 3300048908 Ga0496105_0020835 Ga0496105_0020835_2327_3508 391
541 3300048913 Ga0496110_0019179 Ga0496110_0019179_1698_2927 391
542 3300048914 Ga0496111_0006043 Ga0496111_0006043_3249_4478 391
543 3300048915 Ga0496112_0165147 Ga0496112_0165147_391_1572 391
544 3300048918 Ga0496115_0040201 Ga0496115_0040201_1267_2448 391
545 3300005436 Ga0070713_100009940 Ga0070713_1000099403 392
546 3300005458 Ga0070681_10002482 Ga0070681_100024823 392
547 3300005467 Ga0070706_100015082 Ga0070706_1000150824 392
548 3300005530 Ga0070679_100362850 Ga0070679_1003628502 392
549 3300005546 Ga0070696_100044588 Ga0070696_1000445883 392
550 3300005614 Ga0068856_100116911 Ga0068856_1001169112 392
551 3300006173 Ga0070716_100022165 Ga0070716_1000221654 392
552 3300013307 Ga0157372_10032120 Ga0157372_100321205 392
553 3300013307 Ga0157372_10034128 Ga0157372_100341285 392
554 3300014969 Ga0157376_10026382 Ga0157376_100263824 392
555 3300025912 Ga0207707_10007291 Ga0207707_100072913 392
556 3300025915 Ga0207693_10095344 Ga0207693_100953442 392
557 3300025939 Ga0207665_10022030 Ga0207665_100220304 392
558 3300028800 Ga0265338_10138839 Ga0265338_101388392 392
559 3300030760 Ga0265762_1001427 Ga0265762_10014274 392
560 3300031241 Ga0265325_10080949 Ga0265325_100809491 392
561 3300031247 Ga0265340_10017929 Ga0265340_100179292 392
562 3300031249 Ga0265339_10030492 Ga0265339_100304924 392
563 3300031344 Ga0265316_10037065 Ga0265316_100370653 392
564 3300031711 Ga0265314_10027560 Ga0265314_100275605 392
565 3300035111 Ga0373923_0000400 Ga0373923_0000400_4140_5333 392
566 3300035170 Ga0373943_0002431 Ga0373943_0002431_2262_3455 392
567 3300035171 Ga0373946_0008745 Ga0373946_0008745_1023_2216 392
568 3300035692 Ga0373935_0003446 Ga0373935_0003446_3122_4315 392
569 3300035695 Ga0373927_0001136 Ga0373927_0001136_13926_15119 392
570 3300035725 Ga0373947_0001191 Ga0373947_0001191_5159_6352 392
571 3300037068 Ga0373925_0002873 Ga0373925_0002873_6919_8112 392
572 3300046477 Ga0495664_0049978 Ga0495664_0049978_696_1889 392
573 3300048088 Ga0495602_0110587 Ga0495602_0110587_255_1448 392
574 3300005329 Ga0070683_100016484 Ga0070683_1000164847 393
575 3300005330 Ga0070690_100179765 Ga0070690_1001797651 393
576 3300005334 Ga0068869_100000542 Ga0068869_10000054212 393
577 3300005335 Ga0070666_10030360 Ga0070666_100303603 393
578 3300005337 Ga0070682_100004949 Ga0070682_1000049499 393
579 3300005338 Ga0068868_100022813 Ga0068868_1000228133 393
580 3300005338 Ga0068868_100033347 Ga0068868_1000333473 393
581 3300005339 Ga0070660_100165607 Ga0070660_1001656072 393
582 3300005347 Ga0070668_100013597 Ga0070668_1000135972 393
583 3300005353 Ga0070669_100018825 Ga0070669_1000188253 393
584 3300005365 Ga0070688_100042224 Ga0070688_1000422244 393
585 3300005367 Ga0070667_100003372 Ga0070667_1000033722 393
586 3300005434 Ga0070709_10007651 Ga0070709_100076513 393
587 3300005434 Ga0070709_10046108 Ga0070709_100461082 393
588 3300005436 Ga0070713_100139726 Ga0070713_1001397262 393
589 3300005437 Ga0070710_10079688 Ga0070710_100796882 393
590 3300005439 Ga0070711_100000329 Ga0070711_10000032914 393
591 3300005439 Ga0070711_100013406 Ga0070711_1000134064 393
592 3300005444 Ga0070694_100071292 Ga0070694_1000712922 393
593 3300005445 Ga0070708_100016619 Ga0070708_1000166196 393
594 3300005457 Ga0070662_100004573 Ga0070662_1000045735 393
595 3300005467 Ga0070706_100000812 Ga0070706_1000008129 393
596 3300005530 Ga0070679_100125739 Ga0070679_1001257393 393
597 3300005535 Ga0070684_100093793 Ga0070684_1000937931 393
598 3300005536 Ga0070697_100000249 Ga0070697_10000024938 393
599 3300005539 Ga0068853_100092034 Ga0068853_1000920342 393
600 3300005546 Ga0070696_100072974 Ga0070696_1000729742 393
601 3300005547 Ga0070693_100005275 Ga0070693_1000052753 393
602 3300005548 Ga0070665_100093520 Ga0070665_1000935203 393
603 3300005564 Ga0070664_100154047 Ga0070664_1001540472 393
604 3300005578 Ga0068854_100011881 Ga0068854_1000118816 393
605 3300005614 Ga0068856_100016810 Ga0068856_1000168101 393
606 3300005617 Ga0068859_100009906 Ga0068859_1000099064 393
607 3300005718 Ga0068866_10009206 Ga0068866_100092063 393
608 3300005718 Ga0068866_10018591 Ga0068866_100185911 393
609 3300005834 Ga0068851_10044337 Ga0068851_100443371 393
610 3300005841 Ga0068863_100127776 Ga0068863_1001277763 393
611 3300005841 Ga0068863_100139679 Ga0068863_1001396792 393
612 3300005842 Ga0068858_100003511 Ga0068858_10000351114 393
613 3300005842 Ga0068858_100022048 Ga0068858_1000220488 393
614 3300005842 Ga0068858_100061276 Ga0068858_1000612764 393
615 3300005843 Ga0068860_100204042 Ga0068860_1002040422 393
616 3300005843 Ga0068860_100207077 Ga0068860_1002070772 393
617 3300006175 Ga0070712_100000542 Ga0070712_10000054211 393
618 3300006175 Ga0070712_100004232 Ga0070712_1000042325 393
619 3300006175 Ga0070712_100190118 Ga0070712_1001901182 393
620 3300006237 Ga0097621_100000506 Ga0097621_1000005069 393
621 3300006237 Ga0097621_100064758 Ga0097621_1000647583 393
622 3300006358 Ga0068871_100000685 Ga0068871_10000068524 393
623 3300006871 Ga0075434_100000462 Ga0075434_10000046212 393
624 3300006881 Ga0068865_100018799 Ga0068865_1000187991 393
625 3300006931 Ga0097620_100009906 Ga0097620_10000990611 393
626 3300009098 Ga0105245_10001352 Ga0105245_1000135218 393
627 3300009176 Ga0105242_10015637 Ga0105242_100156378 393
628 3300009176 Ga0105242_10025092 Ga0105242_100250927 393
629 3300009177 Ga0105248_10013722 Ga0105248_1001372210 393
630 3300009177 Ga0105248_10015854 Ga0105248_100158542 393
631 3300009177 Ga0105248_10084006 Ga0105248_100840062 393
632 3300009545 Ga0105237_10057694 Ga0105237_100576944 393
633 3300010375 Ga0105239_10027569 Ga0105239_100275698 393
634 3300010375 Ga0105239_10128150 Ga0105239_101281503 393
635 3300013102 Ga0157371_10014469 Ga0157371_100144692 393
636 3300013105 Ga0157369_10344464 Ga0157369_103444642 393
637 3300013296 Ga0157374_10013713 Ga0157374_100137133 393
638 3300013296 Ga0157374_10068623 Ga0157374_100686234 393
639 3300013297 Ga0157378_10001393 Ga0157378_1000139313 393
640 3300013306 Ga0163162_10012200 Ga0163162_100122009 393
641 3300013306 Ga0163162_10055621 Ga0163162_100556216 393
642 3300013306 Ga0163162_10101803 Ga0163162_101018033 393
643 3300013308 Ga0157375_10028952 Ga0157375_100289523 393
644 3300013308 Ga0157375_10086717 Ga0157375_100867173 393
645 3300014968 Ga0157379_10003129 Ga0157379_1000312913 393
646 3300014968 Ga0157379_10016355 Ga0157379_100163551 393
647 3300014969 Ga0157376_10121320 Ga0157376_101213202 393
648 3300025899 Ga0207642_10004067 Ga0207642_100040674 393
649 3300025904 Ga0207647_10052836 Ga0207647_100528362 393
650 3300025906 Ga0207699_10031017 Ga0207699_100310173 393
651 3300025907 Ga0207645_10004353 Ga0207645_1000435312 393
652 3300025910 Ga0207684_10003231 Ga0207684_100032313 393
653 3300025911 Ga0207654_10023847 Ga0207654_100238472 393
654 3300025912 Ga0207707_10035364 Ga0207707_100353641 393
655 3300025913 Ga0207695_10007527 Ga0207695_100075277 393
656 3300025915 Ga0207693_10002043 Ga0207693_1000204318 393
657 3300025915 Ga0207693_10002423 Ga0207693_1000242311 393
658 3300025915 Ga0207693_10013373 Ga0207693_100133732 393
659 3300025916 Ga0207663_10002606 Ga0207663_100026064 393
660 3300025919 Ga0207657_10013367 Ga0207657_100133674 393
661 3300025920 Ga0207649_10008695 Ga0207649_100086954 393
662 3300025923 Ga0207681_10014471 Ga0207681_100144713 393
663 3300025927 Ga0207687_10014922 Ga0207687_100149224 393
664 3300025928 Ga0207700_10097129 Ga0207700_100971291 393
665 3300025933 Ga0207706_10002992 Ga0207706_100029924 393
666 3300025934 Ga0207686_10086697 Ga0207686_100866972 393
667 3300025936 Ga0207670_10197072 Ga0207670_101970721 393
668 3300025939 Ga0207665_10001047 Ga0207665_100010479 393
669 3300025939 Ga0207665_10019410 Ga0207665_100194104 393
670 3300025939 Ga0207665_10019955 Ga0207665_100199554 393
671 3300025941 Ga0207711_10002201 Ga0207711_100022017 393
672 3300025941 Ga0207711_10008188 Ga0207711_100081882 393
673 3300025942 Ga0207689_10003567 Ga0207689_1000356710 393
674 3300025942 Ga0207689_10173260 Ga0207689_101732601 393
675 3300025972 Ga0207668_10115605 Ga0207668_101156053 393
676 3300026023 Ga0207677_10136446 Ga0207677_101364462 393
677 3300026035 Ga0207703_10004444 Ga0207703_100044446 393
678 3300026067 Ga0207678_10140921 Ga0207678_101409211 393
679 3300026075 Ga0207708_10042782 Ga0207708_100427822 393
680 3300026078 Ga0207702_10202213 Ga0207702_102022132 393
681 3300026089 Ga0207648_10028723 Ga0207648_100287237 393
682 3300026095 Ga0207676_10171322 Ga0207676_101713223 393
683 3300026116 Ga0207674_10063620 Ga0207674_100636202 393
684 3300026121 Ga0207683_10108455 Ga0207683_101084553 393
685 3300026142 Ga0207698_10277198 Ga0207698_102771981 393
686 3300028381 Ga0268264_10025603 Ga0268264_100256032 393
687 3300028800 Ga0265338_10143980 Ga0265338_101439801 393
688 3300035691 Ga0373931_0036652 Ga0373931_0036652_659_1855 393
689 3300035691 Ga0373931_0107634 Ga0373931_0107634_62_1327 393
690 3300046472 Ga0495580_0003126 Ga0495580_0003126_2381_3571 393
691 3300046491 Ga0495584_0072575 Ga0495584_0072575_323_1513 393
692 3300048903 Ga0496100_0105718 Ga0496100_0105718_519_1784 393
693 3300048905 Ga0496102_0001003 Ga0496102_0001003_17297_18562 393
694 3300048905 Ga0496102_0331617 Ga0496102_0331617_153_1349 393
695 3300048906 Ga0496103_0012752 Ga0496103_0012752_1759_3024 393
696 3300048907 Ga0496104_0002870 Ga0496104_0002870_3968_5233 393
697 3300048908 Ga0496105_0067449 Ga0496105_0067449_148_1413 393
698 3300048909 Ga0496106_0036829 Ga0496106_0036829_195_1460 393
699 3300048910 Ga0496107_0088373 Ga0496107_0088373_14_1279 393
700 3300048910 Ga0496107_0209514 Ga0496107_0209514_115_1311 393
701 3300048912 Ga0496109_0258142 Ga0496109_0258142_333_1529 393
702 3300048915 Ga0496112_0077201 Ga0496112_0077201_1644_2843 393
703 3300048915 Ga0496112_0095614 Ga0496112_0095614_128_1327 393
704 3300050512 nmdc:mga0n895_1746_c1 nmdc:mga0n895_1746_c1_6241_7431 393
705 3300005445 Ga0070708_100000517 Ga0070708_1000005173 394
706 3300005467 Ga0070706_100001116 Ga0070706_10000111623 394
707 3300005468 Ga0070707_100001183 Ga0070707_10000118318 394
708 3300005471 Ga0070698_100002344 Ga0070698_10000234419 394
709 3300005518 Ga0070699_100011614 Ga0070699_1000116148 394
710 3300005536 Ga0070697_100000427 Ga0070697_10000042729 394
711 3300005536 Ga0070697_100012885 Ga0070697_1000128853 394
712 3300025910 Ga0207684_10001380 Ga0207684_100013802 394
713 3300025922 Ga0207646_10001576 Ga0207646_1000157613 394
714 3300025922 Ga0207646_10140424 Ga0207646_101404243 394
715 3300030878 Ga0265770_1002352 Ga0265770_10023522 394
716 3300031090 Ga0265760_10000557 Ga0265760_100005574 394
717 3300049744 Ga0501083_0132819 Ga0501083_0132819_39_1229 394
718 3300005468 Ga0070707_100078536 Ga0070707_1000785362 395
719 3300005536 Ga0070697_100000742 Ga0070697_10000074217 395
720 3300025922 Ga0207646_10055989 Ga0207646_100559891 395
721 3300009148 Ga0105243_10100540 Ga0105243_101005402 398
722 3300009177 Ga0105248_10000007 Ga0105248_10000007334 398
723 3300013104 Ga0157370_10112141 Ga0157370_101121412 398
724 3300013105 Ga0157369_10103066 Ga0157369_101030661 398
725 3300014969 Ga0157376_10034553 Ga0157376_100345532 398
726 3300021361 Ga0213872_10002468 Ga0213872_100024686 398
727 3300021361 Ga0213872_10010255 Ga0213872_100102554 398
728 3300025941 Ga0207711_10000014 Ga0207711_1000001480 398
729 3300028379 Ga0268266_10104052 Ga0268266_101040523 398
730 3300028379 Ga0268266_10124935 Ga0268266_101249352 398
731 3300039447 Ga0436361_0224127 Ga0436361_0224127_68_1282 398
732 3300039447 Ga0436361_0608005 Ga0436361_0608005_9233_10447 398
733 3300039447 Ga0436361_0652690 Ga0436361_0652690_10540_11754 398
734 3300039447 Ga0436361_1068732 Ga0436361_1068732_2293_3507 398
735 3300053088 Ga0500644_0044987 Ga0500644_0044987_104_1357 398
736 3300009545 Ga0105237_10115554 Ga0105237_101155543 399
737 3300009551 Ga0105238_10108641 Ga0105238_101086412 399
738 3300025924 Ga0207694_10022226 Ga0207694_100222265 399
739 3300025929 Ga0207664_10020299 Ga0207664_100202992 399
740 3300026035 Ga0207703_10089156 Ga0207703_100891562 399
741 3300000546 LJNas_1000825 LJNas_10008255 400
742 3300003320 rootH2_10044833 rootH2_100448332 400
743 3300005548 Ga0070665_100166554 Ga0070665_1001665542 400
744 3300005563 Ga0068855_100007405 Ga0068855_10000740510 400
745 3300005563 Ga0068855_100221912 Ga0068855_1002219122 400
746 3300005577 Ga0068857_100309096 Ga0068857_1003090961 400
747 3300005616 Ga0068852_100024794 Ga0068852_1000247943 400
748 3300005834 Ga0068851_10058756 Ga0068851_100587562 400
749 3300013104 Ga0157370_10284069 Ga0157370_102840691 400
750 3300013105 Ga0157369_10104359 Ga0157369_101043592 400
751 3300013307 Ga0157372_10016926 Ga0157372_100169265 400
752 3300025904 Ga0207647_10001991 Ga0207647_100019919 400
753 3300025909 Ga0207705_10052030 Ga0207705_100520302 400
754 3300025919 Ga0207657_10073616 Ga0207657_100736162 400
755 3300025932 Ga0207690_10086668 Ga0207690_100866682 400
756 3300025949 Ga0207667_10003145 Ga0207667_100031457 400
757 3300026142 Ga0207698_10012627 Ga0207698_100126273 400
758 3300028379 Ga0268266_10248366 Ga0268266_102483662 400
759 3300048929 Ga0496126_0009231 Ga0496126_0009231_3065_4267 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

67

386

0.79

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

79

240

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9518 6 365
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9412 6 365
3f0h-assembly1.cif.gz_A-2 crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution 0.9382 5 367
2dr1-assembly1.cif.gz_B crystal structure of the ph1308 protein from pyrococcus horikoshii ot3 0.9372 4 371
3f0h-assembly1.cif.gz_A-2 crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution 0.9208 5 367
ID Description Score Start End Superfamily
af_Q2FXK2_10_249_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9623 10 244 3.40.640.10
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9619 19 225 3.40.640.10
af_Q58369_38_263_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9576 36 254 3.40.640.10
af_B6T171_24_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9569 19 254 3.40.640.10
2dr1B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9506 16 258 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A5N9GKV6-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.982 10 112 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A1D2UES3-F1-model_v4 L-aspartate aminotransferase / phosphoserine aminotransferase 0.9805 1 394 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A1D2UES3-F1-model_v4 L-aspartate aminotransferase / phosphoserine aminotransferase 0.9708 1 394 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A804LT04-F1-model_v4 Aminotransferase class V domain-containing protein 0.9706 8 225 GO:0008483
AF-A0A7C2KHR0-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9683 4 214 GO:0004760
GO:0005777
GO:0008453
GO:0019265

Feature Viewer

pLDDT pTM Quality
92.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map