F479472
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 290 | 758 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100005874|Ga0070665_1000058742 |
| Length | 442 |
| Sequence | MDLFDGLEESFAHGRIHKNHNFVYSVISWRVIYPAKISTYQILPDGVKCMILKTRLYTPGPTPLLPAAQFAMAAADMHHRTPEFRALFQKVLAQLKVFVGTKNDVLLLSSSGTGAMEASVSNLTSPGDKVLVLTAGKFGERWTGLAKAFGCEPEVVSAPYGETFDLRQVSAALKPEHRVVYMQSTETSTAAKHDVEAVAKLIKELVPETILVVDGITGLGTTHFDVDGWGIDILIGGSQKAVMIPPGLAYLSVSEKAWAAMEKSKNPRYYFDLRKERKNAVKGESAYTPAVALVAGLGAALDYIAGQAHGDLEKGREALVNNAIVNAEATRAGLVSLGFTLFAPTAPAAXXTAVAVPEGMDSGAVVKALKSKFALVTANGQGEMQGRIFRVAHLGFFDYMDTIAFLGAMEHIAKDTLGLKVEFGQAVAAAQKVYATRVTSGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 287 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.79 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0 |
| Rhizoplane | 5.4 |
| Rhizosphere | 92.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000825 | 3300000546 | Bacteria | 5101 |
| 2 | rootH2_10044833 | 3300003320 | Bacteria | 2690 |
| 3 | rootH2_10068046 | 3300003320 | Bacteria | 1441 |
| 4 | rootH2_10094440 | 3300003320 | Bacteria | 1380 |
| 5 | Ga0058861_10017042 | 3300004800 | Bacteria | 2949 |
| 6 | Ga0058861_11866551 | 3300004800 | Bacteria | 1342 |
| 7 | Ga0070658_10043287 | 3300005327 | Bacteria | 3637 |
| 8 | Ga0070658_10084479 | 3300005327 | Bacteria | 2610 |
| 9 | Ga0070658_10111993 | 3300005327 | Unclassified | 2262 |
| 10 | Ga0070683_100008847 | 3300005329 | Bacteria | 8569 |
| 11 | Ga0070683_100011254 | 3300005329 | Bacteria | 7721 |
| 12 | Ga0070683_100016119 | 3300005329 | Bacteria | 6580 |
| 13 | Ga0070683_100016484 | 3300005329 | Bacteria | 6517 |
| 14 | Ga0070690_100179765 | 3300005330 | Bacteria | 1461 |
| 15 | Ga0070670_100002362 | 3300005331 | Bacteria | 15558 |
| 16 | Ga0068869_100000542 | 3300005334 | Bacteria | 21123 |
| 17 | Ga0068869_100036357 | 3300005334 | Unclassified | 3497 |
| 18 | Ga0070666_10003898 | 3300005335 | Bacteria | 9060 |
| 19 | Ga0070666_10030360 | 3300005335 | Bacteria | 3560 |
| 20 | Ga0070680_100051139 | 3300005336 | Unclassified | 3371 |
| 21 | Ga0070682_100004949 | 3300005337 | Bacteria | 7402 |
| 22 | Ga0068868_100022813 | 3300005338 | Unclassified | 4730 |
| 23 | Ga0068868_100033347 | 3300005338 | Bacteria | 3968 |
| 24 | Ga0068868_100037335 | 3300005338 | Bacteria | 3765 |
| 25 | Ga0068868_100086489 | 3300005338 | Bacteria | 2520 |
| 26 | Ga0070660_100028337 | 3300005339 | Bacteria | 4189 |
| 27 | Ga0070660_100165607 | 3300005339 | Bacteria | 1783 |
| 28 | Ga0070661_100023770 | 3300005344 | Bacteria | 4396 |
| 29 | Ga0070661_100134909 | 3300005344 | Bacteria | 1856 |
| 30 | Ga0070661_100196288 | 3300005344 | Bacteria | 1541 |
| 31 | Ga0070661_100232038 | 3300005344 | Unclassified | 1419 |
| 32 | Ga0070668_100013597 | 3300005347 | Bacteria | 6077 |
| 33 | Ga0070669_100018825 | 3300005353 | Bacteria | 4937 |
| 34 | Ga0070671_100002623 | 3300005355 | Bacteria | 13917 |
| 35 | Ga0070688_100042224 | 3300005365 | Bacteria | 2804 |
| 36 | Ga0070659_100022223 | 3300005366 | Bacteria | 4839 |
| 37 | Ga0070667_100003372 | 3300005367 | Bacteria | 13630 |
| 38 | Ga0070667_100004122 | 3300005367 | Bacteria | 12286 |
| 39 | Ga0070709_10007651 | 3300005434 | Bacteria | 5931 |
| 40 | Ga0070709_10011575 | 3300005434 | Bacteria | 4919 |
| 41 | Ga0070709_10046108 | 3300005434 | Bacteria | 2709 |
| 42 | Ga0070714_100000186 | 3300005435 | Bacteria | 49870 |
| 43 | Ga0070714_100027044 | 3300005435 | Bacteria | 4747 |
| 44 | Ga0070714_100091642 | 3300005435 | Bacteria | 2663 |
| 45 | Ga0070713_100009940 | 3300005436 | Bacteria | 6851 |
| 46 | Ga0070713_100044263 | 3300005436 | Bacteria | 3643 |
| 47 | Ga0070713_100063124 | 3300005436 | Unclassified | 3104 |
| 48 | Ga0070713_100079146 | 3300005436 | Unclassified | 2799 |
| 49 | Ga0070713_100136215 | 3300005436 | Unclassified | 2170 |
| 50 | Ga0070713_100139726 | 3300005436 | Bacteria | 2144 |
| 51 | Ga0070710_10041817 | 3300005437 | Bacteria | 2532 |
| 52 | Ga0070710_10079688 | 3300005437 | Bacteria | 1909 |
| 53 | Ga0070711_100000329 | 3300005439 | Bacteria | 24414 |
| 54 | Ga0070711_100009579 | 3300005439 | Bacteria | 5971 |
| 55 | Ga0070711_100013406 | 3300005439 | Bacteria | 5148 |
| 56 | Ga0070711_100027461 | 3300005439 | Bacteria | 3737 |
| 57 | Ga0070711_100222443 | 3300005439 | Bacteria | 1468 |
| 58 | Ga0070694_100071292 | 3300005444 | Bacteria | 2395 |
| 59 | Ga0070708_100000517 | 3300005445 | Bacteria | 29011 |
| 60 | Ga0070708_100016619 | 3300005445 | Bacteria | 6112 |
| 61 | Ga0070663_100039601 | 3300005455 | Bacteria | 3294 |
| 62 | Ga0070663_100106270 | 3300005455 | Bacteria | 2102 |
| 63 | Ga0070663_100112998 | 3300005455 | Bacteria | 2043 |
| 64 | Ga0070663_100208654 | 3300005455 | Bacteria | 1528 |
| 65 | Ga0070678_100054496 | 3300005456 | Bacteria | 2914 |
| 66 | Ga0070662_100004573 | 3300005457 | Bacteria | 8760 |
| 67 | Ga0070681_10002482 | 3300005458 | Bacteria | 16888 |
| 68 | Ga0070681_10017910 | 3300005458 | Bacteria | 7081 |
| 69 | Ga0070681_10028029 | 3300005458 | Bacteria | 5661 |
| 70 | Ga0070681_10079022 | 3300005458 | Bacteria | 3246 |
| 71 | Ga0070681_10191810 | 3300005458 | Bacteria | 1963 |
| 72 | Ga0070681_10226149 | 3300005458 | Bacteria | 1786 |
| 73 | Ga0070706_100000812 | 3300005467 | Bacteria | 34622 |
| 74 | Ga0070706_100001116 | 3300005467 | Bacteria | 29051 |
| 75 | Ga0070706_100015082 | 3300005467 | Bacteria | 7137 |
| 76 | Ga0070707_100001183 | 3300005468 | Bacteria | 25694 |
| 77 | Ga0070707_100078536 | 3300005468 | Unclassified | 3184 |
| 78 | Ga0070698_100002344 | 3300005471 | Bacteria | 20941 |
| 79 | Ga0070699_100011614 | 3300005518 | Bacteria | 7602 |
| 80 | Ga0070679_100007052 | 3300005530 | Bacteria | 10483 |
| 81 | Ga0070679_100047253 | 3300005530 | Bacteria | 4290 |
| 82 | Ga0070679_100080520 | 3300005530 | Bacteria | 3246 |
| 83 | Ga0070679_100125739 | 3300005530 | Bacteria | 2546 |
| 84 | Ga0070679_100230172 | 3300005530 | Bacteria | 1813 |
| 85 | Ga0070679_100362850 | 3300005530 | Bacteria | 1396 |
| 86 | Ga0070684_100007590 | 3300005535 | Bacteria | 8450 |
| 87 | Ga0070684_100030399 | 3300005535 | Bacteria | 4588 |
| 88 | Ga0070684_100046043 | 3300005535 | Bacteria | 3779 |
| 89 | Ga0070684_100093793 | 3300005535 | Bacteria | 2672 |
| 90 | Ga0070684_100099288 | 3300005535 | Unclassified | 2598 |
| 91 | Ga0070684_100219988 | 3300005535 | Bacteria | 1732 |
| 92 | Ga0070684_100322878 | 3300005535 | Bacteria | 1418 |
| 93 | Ga0070684_100333490 | 3300005535 | Unclassified | 1394 |
| 94 | Ga0070697_100000249 | 3300005536 | Bacteria | 43436 |
| 95 | Ga0070697_100000427 | 3300005536 | Bacteria | 32332 |
| 96 | Ga0070697_100000742 | 3300005536 | Bacteria | 24336 |
| 97 | Ga0070697_100012885 | 3300005536 | Bacteria | 6551 |
| 98 | Ga0068853_100000147 | 3300005539 | Bacteria | 48276 |
| 99 | Ga0068853_100000171 | 3300005539 | Bacteria | 45170 |
| 100 | Ga0068853_100092034 | 3300005539 | Bacteria | 2667 |
| 101 | Ga0068853_100095012 | 3300005539 | Bacteria | 2628 |
| 102 | Ga0068853_100136860 | 3300005539 | Unclassified | 2196 |
| 103 | Ga0068853_100279180 | 3300005539 | Bacteria | 1540 |
| 104 | Ga0070696_100044588 | 3300005546 | Bacteria | 3071 |
| 105 | Ga0070696_100072974 | 3300005546 | Bacteria | 2417 |
| 106 | Ga0070693_100005275 | 3300005547 | Bacteria | 6191 |
| 107 | Ga0070665_100005874 | 3300005548 | Bacteria | 12580 |
| 108 | Ga0070665_100013579 | 3300005548 | Bacteria | 8193 |
| 109 | Ga0070665_100093520 | 3300005548 | Bacteria | 3011 |
| 110 | Ga0070665_100166554 | 3300005548 | Bacteria | 2206 |
| 111 | Ga0068855_100002303 | 3300005563 | Bacteria | 23607 |
| 112 | Ga0068855_100003583 | 3300005563 | Bacteria | 18970 |
| 113 | Ga0068855_100007405 | 3300005563 | Bacteria | 13288 |
| 114 | Ga0068855_100038938 | 3300005563 | Bacteria | 5645 |
| 115 | Ga0068855_100041529 | 3300005563 | Bacteria | 5451 |
| 116 | Ga0068855_100070468 | 3300005563 | Bacteria | 4067 |
| 117 | Ga0068855_100082127 | 3300005563 | Bacteria | 3735 |
| 118 | Ga0068855_100127229 | 3300005563 | Bacteria | 2912 |
| 119 | Ga0068855_100221912 | 3300005563 | Bacteria | 2119 |
| 120 | Ga0070664_100047843 | 3300005564 | Unclassified | 3614 |
| 121 | Ga0070664_100154047 | 3300005564 | Bacteria | 2030 |
| 122 | Ga0068857_100000669 | 3300005577 | Bacteria | 25401 |
| 123 | Ga0068857_100054440 | 3300005577 | Bacteria | 3550 |
| 124 | Ga0068857_100309096 | 3300005577 | Bacteria | 1458 |
| 125 | Ga0068854_100007907 | 3300005578 | Bacteria | 6805 |
| 126 | Ga0068854_100011881 | 3300005578 | Bacteria | 5687 |
| 127 | Ga0068854_100024559 | 3300005578 | Bacteria | 4128 |
| 128 | Ga0068854_100044111 | 3300005578 | Unclassified | 3164 |
| 129 | Ga0068854_100316524 | 3300005578 | Unclassified | 1267 |
| 130 | Ga0068856_100004085 | 3300005614 | Bacteria | 14594 |
| 131 | Ga0068856_100004416 | 3300005614 | Bacteria | 14018 |
| 132 | Ga0068856_100016810 | 3300005614 | Bacteria | 7088 |
| 133 | Ga0068856_100045720 | 3300005614 | Unclassified | 4312 |
| 134 | Ga0068856_100051619 | 3300005614 | Unclassified | 4055 |
| 135 | Ga0068856_100055512 | 3300005614 | Bacteria | 3909 |
| 136 | Ga0068856_100116911 | 3300005614 | Bacteria | 2667 |
| 137 | Ga0068852_100000412 | 3300005616 | Bacteria | 28562 |
| 138 | Ga0068852_100000504 | 3300005616 | Bacteria | 25669 |
| 139 | Ga0068852_100024794 | 3300005616 | Bacteria | 4851 |
| 140 | Ga0068859_100001120 | 3300005617 | Bacteria | 27379 |
| 141 | Ga0068859_100009906 | 3300005617 | Bacteria | 9626 |
| 142 | Ga0068864_100003371 | 3300005618 | Bacteria | 13209 |
| 143 | Ga0068866_10009206 | 3300005718 | Unclassified | 4186 |
| 144 | Ga0068866_10018591 | 3300005718 | Bacteria | 3146 |
| 145 | Ga0068851_10006828 | 3300005834 | Bacteria | 5226 |
| 146 | Ga0068851_10007193 | 3300005834 | Bacteria | 5101 |
| 147 | Ga0068851_10044337 | 3300005834 | Bacteria | 2244 |
| 148 | Ga0068851_10058756 | 3300005834 | Bacteria | 1966 |
| 149 | Ga0068863_100012947 | 3300005841 | Bacteria | 8045 |
| 150 | Ga0068863_100127776 | 3300005841 | Bacteria | 2426 |
| 151 | Ga0068863_100139679 | 3300005841 | Unclassified | 2315 |
| 152 | Ga0068858_100003224 | 3300005842 | Bacteria | 16286 |
| 153 | Ga0068858_100003511 | 3300005842 | Bacteria | 15542 |
| 154 | Ga0068858_100022048 | 3300005842 | Bacteria | 5948 |
| 155 | Ga0068858_100061276 | 3300005842 | Bacteria | 3478 |
| 156 | Ga0068858_100228089 | 3300005842 | Bacteria | 1765 |
| 157 | Ga0068860_100000912 | 3300005843 | Bacteria | 32785 |
| 158 | Ga0068860_100204042 | 3300005843 | Bacteria | 1917 |
| 159 | Ga0068860_100207077 | 3300005843 | Bacteria | 1902 |
| 160 | Ga0070717_10004829 | 3300006028 | Bacteria | 9809 |
| 161 | Ga0070717_10037951 | 3300006028 | Unclassified | 3913 |
| 162 | Ga0070717_10110496 | 3300006028 | Bacteria | 2344 |
| 163 | Ga0070717_10180162 | 3300006028 | Unclassified | 1841 |
| 164 | Ga0070717_10218511 | 3300006028 | Bacteria | 1674 |
| 165 | Ga0070715_10083686 | 3300006163 | Bacteria | 1454 |
| 166 | Ga0070716_100022165 | 3300006173 | Unclassified | 3353 |
| 167 | Ga0070712_100000542 | 3300006175 | Bacteria | 21816 |
| 168 | Ga0070712_100004232 | 3300006175 | Bacteria | 8832 |
| 169 | Ga0070712_100163011 | 3300006175 | Unclassified | 1723 |
| 170 | Ga0070712_100190118 | 3300006175 | Bacteria | 1606 |
| 171 | Ga0097621_100000506 | 3300006237 | Bacteria | 27267 |
| 172 | Ga0097621_100002346 | 3300006237 | Bacteria | 12975 |
| 173 | Ga0097621_100009357 | 3300006237 | Bacteria | 7111 |
| 174 | Ga0097621_100064758 | 3300006237 | Bacteria | 3007 |
| 175 | Ga0068871_100000685 | 3300006358 | Bacteria | 23033 |
| 176 | Ga0068871_100009242 | 3300006358 | Bacteria | 7130 |
| 177 | Ga0075434_100000462 | 3300006871 | Bacteria | 30392 |
| 178 | Ga0075434_100080753 | 3300006871 | Bacteria | 3249 |
| 179 | Ga0068865_100018799 | 3300006881 | Bacteria | 4465 |
| 180 | Ga0075436_100032251 | 3300006914 | Bacteria | 3610 |
| 181 | Ga0097620_100001120 | 3300006931 | Bacteria | 27379 |
| 182 | Ga0097620_100009906 | 3300006931 | Bacteria | 9626 |
| 183 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 184 | Ga0105240_10001453 | 3300009093 | Bacteria | 40511 |
| 185 | Ga0105240_10002144 | 3300009093 | Bacteria | 32229 |
| 186 | Ga0105240_10002730 | 3300009093 | Bacteria | 27998 |
| 187 | Ga0105240_10009959 | 3300009093 | Bacteria | 13397 |
| 188 | Ga0105240_10018640 | 3300009093 | Bacteria | 9304 |
| 189 | Ga0105240_10032689 | 3300009093 | Bacteria | 6732 |
| 190 | Ga0105240_10037657 | 3300009093 | Bacteria | 6215 |
| 191 | Ga0105240_10059946 | 3300009093 | Bacteria | 4746 |
| 192 | Ga0105240_10091617 | 3300009093 | Bacteria | 3713 |
| 193 | Ga0105245_10001352 | 3300009098 | Bacteria | 22189 |
| 194 | Ga0105245_10004986 | 3300009098 | Bacteria | 11673 |
| 195 | Ga0105245_10012963 | 3300009098 | Bacteria | 7267 |
| 196 | Ga0105245_10020802 | 3300009098 | Bacteria | 5752 |
| 197 | Ga0105245_10021278 | 3300009098 | Bacteria | 5687 |
| 198 | Ga0105245_10178216 | 3300009098 | Bacteria | 2029 |
| 199 | Ga0105247_10011709 | 3300009101 | Bacteria | 5277 |
| 200 | Ga0105247_10045149 | 3300009101 | Bacteria | 2703 |
| 201 | Ga0105243_10100540 | 3300009148 | Bacteria | 2399 |
| 202 | Ga0105241_10000033 | 3300009174 | Bacteria | 118315 |
| 203 | Ga0105241_10000610 | 3300009174 | Bacteria | 26914 |
| 204 | Ga0105241_10002688 | 3300009174 | Bacteria | 13325 |
| 205 | Ga0105241_10005545 | 3300009174 | Bacteria | 9319 |
| 206 | Ga0105241_10015747 | 3300009174 | Bacteria | 5541 |
| 207 | Ga0105241_10160384 | 3300009174 | Bacteria | 1848 |
| 208 | Ga0105242_10015637 | 3300009176 | Bacteria | 5895 |
| 209 | Ga0105242_10025092 | 3300009176 | Bacteria | 4712 |
| 210 | Ga0105242_10179348 | 3300009176 | Bacteria | 1868 |
| 211 | Ga0105248_10000007 | 3300009177 | Bacteria | 471250 |
| 212 | Ga0105248_10001860 | 3300009177 | Bacteria | 23401 |
| 213 | Ga0105248_10013722 | 3300009177 | Bacteria | 8920 |
| 214 | Ga0105248_10015854 | 3300009177 | Bacteria | 8304 |
| 215 | Ga0105248_10084006 | 3300009177 | Bacteria | 3582 |
| 216 | Ga0105237_10003849 | 3300009545 | Bacteria | 17651 |
| 217 | Ga0105237_10022066 | 3300009545 | Bacteria | 6535 |
| 218 | Ga0105237_10040540 | 3300009545 | Bacteria | 4695 |
| 219 | Ga0105237_10044667 | 3300009545 | Bacteria | 4461 |
| 220 | Ga0105237_10057694 | 3300009545 | Bacteria | 3885 |
| 221 | Ga0105237_10113608 | 3300009545 | Bacteria | 2700 |
| 222 | Ga0105237_10115554 | 3300009545 | Bacteria | 2677 |
| 223 | Ga0105238_10000171 | 3300009551 | Bacteria | 70810 |
| 224 | Ga0105238_10001015 | 3300009551 | Bacteria | 28667 |
| 225 | Ga0105238_10018376 | 3300009551 | Bacteria | 7115 |
| 226 | Ga0105238_10054203 | 3300009551 | Bacteria | 4028 |
| 227 | Ga0105238_10090334 | 3300009551 | Unclassified | 3050 |
| 228 | Ga0105238_10101468 | 3300009551 | Bacteria | 2860 |
| 229 | Ga0105238_10108641 | 3300009551 | Bacteria | 2755 |
| 230 | Ga0105238_10131930 | 3300009551 | Bacteria | 2477 |
| 231 | Ga0105238_10184060 | 3300009551 | Bacteria | 2066 |
| 232 | Ga0105249_10029561 | 3300009553 | Unclassified | 4950 |
| 233 | Ga0105239_10001391 | 3300010375 | Bacteria | 32418 |
| 234 | Ga0105239_10002062 | 3300010375 | Bacteria | 26041 |
| 235 | Ga0105239_10027569 | 3300010375 | Bacteria | 6251 |
| 236 | Ga0105239_10028853 | 3300010375 | Bacteria | 6100 |
| 237 | Ga0105239_10127172 | 3300010375 | Bacteria | 2833 |
| 238 | Ga0105239_10128150 | 3300010375 | Unclassified | 2822 |
| 239 | Ga0105246_10000907 | 3300011119 | Bacteria | 16987 |
| 240 | Ga0105246_10077173 | 3300011119 | Bacteria | 2363 |
| 241 | Ga0157373_10098780 | 3300013100 | Bacteria | 2054 |
| 242 | Ga0157371_10014469 | 3300013102 | Bacteria | 5953 |
| 243 | Ga0157371_10136127 | 3300013102 | Bacteria | 1749 |
| 244 | Ga0157370_10001599 | 3300013104 | Bacteria | 28002 |
| 245 | Ga0157370_10019860 | 3300013104 | Bacteria | 6723 |
| 246 | Ga0157370_10029198 | 3300013104 | Bacteria | 5417 |
| 247 | Ga0157370_10112141 | 3300013104 | Bacteria | 2549 |
| 248 | Ga0157370_10284069 | 3300013104 | Bacteria | 1529 |
| 249 | Ga0157369_10001577 | 3300013105 | Bacteria | 27889 |
| 250 | Ga0157369_10008591 | 3300013105 | Bacteria | 11716 |
| 251 | Ga0157369_10008672 | 3300013105 | Bacteria | 11657 |
| 252 | Ga0157369_10018678 | 3300013105 | Bacteria | 7773 |
| 253 | Ga0157369_10025792 | 3300013105 | Bacteria | 6520 |
| 254 | Ga0157369_10027231 | 3300013105 | Bacteria | 6338 |
| 255 | Ga0157369_10035283 | 3300013105 | Bacteria | 5485 |
| 256 | Ga0157369_10050235 | 3300013105 | Bacteria | 4518 |
| 257 | Ga0157369_10060177 | 3300013105 | Bacteria | 4096 |
| 258 | Ga0157369_10096380 | 3300013105 | Bacteria | 3156 |
| 259 | Ga0157369_10103066 | 3300013105 | Bacteria | 3039 |
| 260 | Ga0157369_10104359 | 3300013105 | Bacteria | 3018 |
| 261 | Ga0157369_10273902 | 3300013105 | Bacteria | 1758 |
| 262 | Ga0157369_10344464 | 3300013105 | Bacteria | 1548 |
| 263 | Ga0157369_10447555 | 3300013105 | Bacteria | 1338 |
| 264 | Ga0157374_10013713 | 3300013296 | Bacteria | 7080 |
| 265 | Ga0157374_10023240 | 3300013296 | Bacteria | 5542 |
| 266 | Ga0157374_10051375 | 3300013296 | Bacteria | 3836 |
| 267 | Ga0157374_10068623 | 3300013296 | Bacteria | 3336 |
| 268 | Ga0157374_10095152 | 3300013296 | Bacteria | 2847 |
| 269 | Ga0157374_10235555 | 3300013296 | Bacteria | 1799 |
| 270 | Ga0157378_10001393 | 3300013297 | Bacteria | 21737 |
| 271 | Ga0157378_10014964 | 3300013297 | Bacteria | 6792 |
| 272 | Ga0157378_10016175 | 3300013297 | Bacteria | 6532 |
| 273 | Ga0157378_10021152 | 3300013297 | Bacteria | 5722 |
| 274 | Ga0157378_10179908 | 3300013297 | Bacteria | 1989 |
| 275 | Ga0163162_10000822 | 3300013306 | Bacteria | 28869 |
| 276 | Ga0163162_10012200 | 3300013306 | Bacteria | 8388 |
| 277 | Ga0163162_10017568 | 3300013306 | Bacteria | 7000 |
| 278 | Ga0163162_10055621 | 3300013306 | Unclassified | 3985 |
| 279 | Ga0163162_10101803 | 3300013306 | Bacteria | 2965 |
| 280 | Ga0163162_10219525 | 3300013306 | Bacteria | 2031 |
| 281 | Ga0157372_10001952 | 3300013307 | Bacteria | 22395 |
| 282 | Ga0157372_10009227 | 3300013307 | Bacteria | 10487 |
| 283 | Ga0157372_10013111 | 3300013307 | Bacteria | 8843 |
| 284 | Ga0157372_10016926 | 3300013307 | Bacteria | 7826 |
| 285 | Ga0157372_10019312 | 3300013307 | Bacteria | 7341 |
| 286 | Ga0157372_10032120 | 3300013307 | Bacteria | 5754 |
| 287 | Ga0157372_10034128 | 3300013307 | Bacteria | 5592 |
| 288 | Ga0157372_10094168 | 3300013307 | Bacteria | 3410 |
| 289 | Ga0157372_10130189 | 3300013307 | Unclassified | 2894 |
| 290 | Ga0157372_10137259 | 3300013307 | Bacteria | 2817 |
| 291 | Ga0157372_10160791 | 3300013307 | Bacteria | 2596 |
| 292 | Ga0157372_10162974 | 3300013307 | Bacteria | 2577 |
| 293 | Ga0157372_10277084 | 3300013307 | Bacteria | 1950 |
| 294 | Ga0157372_10279736 | 3300013307 | Bacteria | 1940 |
| 295 | Ga0157375_10005008 | 3300013308 | Bacteria | 11513 |
| 296 | Ga0157375_10028952 | 3300013308 | Bacteria | 5202 |
| 297 | Ga0157375_10086717 | 3300013308 | Bacteria | 3182 |
| 298 | Ga0157375_10127307 | 3300013308 | Bacteria | 2663 |
| 299 | Ga0163163_10024393 | 3300014325 | Bacteria | 5756 |
| 300 | Ga0163163_10080874 | 3300014325 | Bacteria | 3250 |
| 301 | Ga0163163_10134870 | 3300014325 | Bacteria | 2509 |
| 302 | Ga0157377_10053988 | 3300014745 | Unclassified | 2274 |
| 303 | Ga0157379_10003129 | 3300014968 | Bacteria | 14014 |
| 304 | Ga0157379_10012449 | 3300014968 | Bacteria | 7429 |
| 305 | Ga0157379_10016355 | 3300014968 | Bacteria | 6526 |
| 306 | Ga0157379_10056931 | 3300014968 | Bacteria | 3493 |
| 307 | Ga0157379_10199098 | 3300014968 | Bacteria | 1811 |
| 308 | Ga0157376_10016808 | 3300014969 | Bacteria | 5565 |
| 309 | Ga0157376_10026382 | 3300014969 | Unclassified | 4590 |
| 310 | Ga0157376_10034553 | 3300014969 | Bacteria | 4083 |
| 311 | Ga0157376_10121320 | 3300014969 | Bacteria | 2317 |
| 312 | Ga0213872_10002468 | 3300021361 | Bacteria | 10843 |
| 313 | Ga0213872_10010255 | 3300021361 | Bacteria | 4466 |
| 314 | Ga0209233_1003838 | 3300025261 | Bacteria | 5232 |
| 315 | Ga0209233_1004869 | 3300025261 | Bacteria | 4521 |
| 316 | Ga0207642_10004067 | 3300025899 | Unclassified | 4685 |
| 317 | Ga0207710_10025303 | 3300025900 | Unclassified | 2562 |
| 318 | Ga0207647_10001991 | 3300025904 | Bacteria | 15624 |
| 319 | Ga0207647_10002648 | 3300025904 | Bacteria | 13523 |
| 320 | Ga0207647_10052836 | 3300025904 | Bacteria | 2506 |
| 321 | Ga0207699_10008635 | 3300025906 | Bacteria | 5038 |
| 322 | Ga0207699_10031017 | 3300025906 | Bacteria | 2997 |
| 323 | Ga0207645_10004353 | 3300025907 | Bacteria | 10486 |
| 324 | Ga0207645_10009148 | 3300025907 | Bacteria | 6869 |
| 325 | Ga0207705_10000109 | 3300025909 | Bacteria | 93256 |
| 326 | Ga0207705_10010285 | 3300025909 | Bacteria | 6805 |
| 327 | Ga0207705_10014420 | 3300025909 | Bacteria | 5689 |
| 328 | Ga0207705_10018328 | 3300025909 | Bacteria | 5006 |
| 329 | Ga0207705_10026073 | 3300025909 | Bacteria | 4171 |
| 330 | Ga0207705_10045043 | 3300025909 | Unclassified | 3171 |
| 331 | Ga0207705_10052030 | 3300025909 | Bacteria | 2948 |
| 332 | Ga0207684_10001380 | 3300025910 | Bacteria | 26458 |
| 333 | Ga0207684_10003231 | 3300025910 | Bacteria | 15997 |
| 334 | Ga0207654_10000170 | 3300025911 | Bacteria | 41057 |
| 335 | Ga0207654_10000368 | 3300025911 | Bacteria | 26431 |
| 336 | Ga0207654_10004565 | 3300025911 | Bacteria | 6993 |
| 337 | Ga0207654_10023847 | 3300025911 | Bacteria | 3283 |
| 338 | Ga0207707_10007291 | 3300025912 | Bacteria | 9626 |
| 339 | Ga0207707_10008391 | 3300025912 | Bacteria | 8965 |
| 340 | Ga0207707_10035364 | 3300025912 | Bacteria | 4369 |
| 341 | Ga0207707_10040403 | 3300025912 | Bacteria | 4074 |
| 342 | Ga0207707_10090706 | 3300025912 | Unclassified | 2671 |
| 343 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 344 | Ga0207695_10000030 | 3300025913 | Bacteria | 533735 |
| 345 | Ga0207695_10000259 | 3300025913 | Bacteria | 133796 |
| 346 | Ga0207695_10000537 | 3300025913 | Bacteria | 79113 |
| 347 | Ga0207695_10000877 | 3300025913 | Bacteria | 54740 |
| 348 | Ga0207695_10002346 | 3300025913 | Bacteria | 28121 |
| 349 | Ga0207695_10007527 | 3300025913 | Bacteria | 13810 |
| 350 | Ga0207695_10029311 | 3300025913 | Bacteria | 6085 |
| 351 | Ga0207695_10035688 | 3300025913 | Bacteria | 5387 |
| 352 | Ga0207695_10042919 | 3300025913 | Bacteria | 4824 |
| 353 | Ga0207695_10057369 | 3300025913 | Bacteria | 4045 |
| 354 | Ga0207695_10074400 | 3300025913 | Bacteria | 3459 |
| 355 | Ga0207695_10118840 | 3300025913 | Bacteria | 2614 |
| 356 | Ga0207695_10146374 | 3300025913 | Bacteria | 2306 |
| 357 | Ga0207671_10001200 | 3300025914 | Bacteria | 30806 |
| 358 | Ga0207671_10003815 | 3300025914 | Bacteria | 14757 |
| 359 | Ga0207671_10090486 | 3300025914 | Bacteria | 2305 |
| 360 | Ga0207671_10226462 | 3300025914 | Unclassified | 1466 |
| 361 | Ga0207693_10002043 | 3300025915 | Bacteria | 17694 |
| 362 | Ga0207693_10002423 | 3300025915 | Bacteria | 16201 |
| 363 | Ga0207693_10006863 | 3300025915 | Bacteria | 9402 |
| 364 | Ga0207693_10013373 | 3300025915 | Bacteria | 6617 |
| 365 | Ga0207693_10095344 | 3300025915 | Unclassified | 2332 |
| 366 | Ga0207663_10002606 | 3300025916 | Bacteria | 8681 |
| 367 | Ga0207663_10206835 | 3300025916 | Bacteria | 1420 |
| 368 | Ga0207660_10001656 | 3300025917 | Bacteria | 14925 |
| 369 | Ga0207660_10046231 | 3300025917 | Unclassified | 3071 |
| 370 | Ga0207657_10008823 | 3300025919 | Bacteria | 10198 |
| 371 | Ga0207657_10013367 | 3300025919 | Bacteria | 8054 |
| 372 | Ga0207657_10018860 | 3300025919 | Bacteria | 6569 |
| 373 | Ga0207657_10029486 | 3300025919 | Bacteria | 4993 |
| 374 | Ga0207657_10069516 | 3300025919 | Bacteria | 2987 |
| 375 | Ga0207657_10073616 | 3300025919 | Bacteria | 2886 |
| 376 | Ga0207649_10008695 | 3300025920 | Bacteria | 5544 |
| 377 | Ga0207649_10014930 | 3300025920 | Bacteria | 4359 |
| 378 | Ga0207649_10106490 | 3300025920 | Bacteria | 1865 |
| 379 | Ga0207652_10003180 | 3300025921 | Bacteria | 13656 |
| 380 | Ga0207652_10013893 | 3300025921 | Bacteria | 6517 |
| 381 | Ga0207646_10001576 | 3300025922 | Bacteria | 27888 |
| 382 | Ga0207646_10055989 | 3300025922 | Unclassified | 3526 |
| 383 | Ga0207646_10140424 | 3300025922 | Bacteria | 2175 |
| 384 | Ga0207681_10014471 | 3300025923 | Bacteria | 4903 |
| 385 | Ga0207694_10000181 | 3300025924 | Bacteria | 65011 |
| 386 | Ga0207694_10000770 | 3300025924 | Bacteria | 28760 |
| 387 | Ga0207694_10003285 | 3300025924 | Bacteria | 12877 |
| 388 | Ga0207694_10022226 | 3300025924 | Bacteria | 4811 |
| 389 | Ga0207694_10084492 | 3300025924 | Bacteria | 2497 |
| 390 | Ga0207694_10255829 | 3300025924 | Unclassified | 1434 |
| 391 | Ga0207650_10028219 | 3300025925 | Unclassified | 4022 |
| 392 | Ga0207687_10002934 | 3300025927 | Bacteria | 11572 |
| 393 | Ga0207687_10014922 | 3300025927 | Bacteria | 5088 |
| 394 | Ga0207687_10015053 | 3300025927 | Bacteria | 5067 |
| 395 | Ga0207687_10027666 | 3300025927 | Bacteria | 3806 |
| 396 | Ga0207700_10011869 | 3300025928 | Bacteria | 5582 |
| 397 | Ga0207700_10021436 | 3300025928 | Bacteria | 4411 |
| 398 | Ga0207700_10097129 | 3300025928 | Bacteria | 2341 |
| 399 | Ga0207700_10137812 | 3300025928 | Bacteria | 2001 |
| 400 | Ga0207664_10000086 | 3300025929 | Bacteria | 89769 |
| 401 | Ga0207664_10020299 | 3300025929 | Bacteria | 4921 |
| 402 | Ga0207664_10040595 | 3300025929 | Bacteria | 3620 |
| 403 | Ga0207664_10062067 | 3300025929 | Bacteria | 2984 |
| 404 | Ga0207644_10001417 | 3300025931 | Bacteria | 15450 |
| 405 | Ga0207644_10144091 | 3300025931 | Bacteria | 1837 |
| 406 | Ga0207690_10076556 | 3300025932 | Bacteria | 2323 |
| 407 | Ga0207690_10086668 | 3300025932 | Bacteria | 2201 |
| 408 | Ga0207706_10002992 | 3300025933 | Bacteria | 16291 |
| 409 | Ga0207686_10086697 | 3300025934 | Bacteria | 2057 |
| 410 | Ga0207670_10197072 | 3300025936 | Bacteria | 1528 |
| 411 | Ga0207665_10001047 | 3300025939 | Bacteria | 18599 |
| 412 | Ga0207665_10015038 | 3300025939 | Bacteria | 5081 |
| 413 | Ga0207665_10019410 | 3300025939 | Bacteria | 4469 |
| 414 | Ga0207665_10019955 | 3300025939 | Bacteria | 4405 |
| 415 | Ga0207665_10022030 | 3300025939 | Bacteria | 4189 |
| 416 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 417 | Ga0207711_10001374 | 3300025941 | Bacteria | 22912 |
| 418 | Ga0207711_10002201 | 3300025941 | Bacteria | 17507 |
| 419 | Ga0207711_10008188 | 3300025941 | Bacteria | 8752 |
| 420 | Ga0207689_10002258 | 3300025942 | Bacteria | 18059 |
| 421 | Ga0207689_10003567 | 3300025942 | Bacteria | 14224 |
| 422 | Ga0207689_10173260 | 3300025942 | Bacteria | 1779 |
| 423 | Ga0207661_10212321 | 3300025944 | Bacteria | 1706 |
| 424 | Ga0207661_10318683 | 3300025944 | Bacteria | 1397 |
| 425 | Ga0207679_10039884 | 3300025945 | Unclassified | 3357 |
| 426 | Ga0207667_10002563 | 3300025949 | Bacteria | 22609 |
| 427 | Ga0207667_10003145 | 3300025949 | Bacteria | 20433 |
| 428 | Ga0207667_10011761 | 3300025949 | Bacteria | 10147 |
| 429 | Ga0207667_10018922 | 3300025949 | Bacteria | 7704 |
| 430 | Ga0207667_10053980 | 3300025949 | Bacteria | 4227 |
| 431 | Ga0207667_10054381 | 3300025949 | Bacteria | 4211 |
| 432 | Ga0207667_10128740 | 3300025949 | Bacteria | 2607 |
| 433 | Ga0207667_10151770 | 3300025949 | Bacteria | 2384 |
| 434 | Ga0207667_10175402 | 3300025949 | Bacteria | 2202 |
| 435 | Ga0207651_10142401 | 3300025960 | Bacteria | 1854 |
| 436 | Ga0207668_10115605 | 3300025972 | Bacteria | 2021 |
| 437 | Ga0207640_10000117 | 3300025981 | Bacteria | 60081 |
| 438 | Ga0207640_10010714 | 3300025981 | Bacteria | 5170 |
| 439 | Ga0207658_10000811 | 3300025986 | Bacteria | 26164 |
| 440 | Ga0207658_10101686 | 3300025986 | Bacteria | 2253 |
| 441 | Ga0207677_10000242 | 3300026023 | Bacteria | 42196 |
| 442 | Ga0207677_10136446 | 3300026023 | Bacteria | 1871 |
| 443 | Ga0207703_10004444 | 3300026035 | Bacteria | 11519 |
| 444 | Ga0207703_10004751 | 3300026035 | Bacteria | 11082 |
| 445 | Ga0207703_10037100 | 3300026035 | Bacteria | 3882 |
| 446 | Ga0207703_10089156 | 3300026035 | Bacteria | 2590 |
| 447 | Ga0207703_10174981 | 3300026035 | Bacteria | 1891 |
| 448 | Ga0207639_10000101 | 3300026041 | Bacteria | 70638 |
| 449 | Ga0207639_10002332 | 3300026041 | Bacteria | 12744 |
| 450 | Ga0207639_10175237 | 3300026041 | Bacteria | 1820 |
| 451 | Ga0207678_10006271 | 3300026067 | Bacteria | 10562 |
| 452 | Ga0207678_10007842 | 3300026067 | Bacteria | 9420 |
| 453 | Ga0207678_10033347 | 3300026067 | Bacteria | 4486 |
| 454 | Ga0207678_10058947 | 3300026067 | Bacteria | 3303 |
| 455 | Ga0207678_10066529 | 3300026067 | Bacteria | 3095 |
| 456 | Ga0207678_10140921 | 3300026067 | Bacteria | 2058 |
| 457 | Ga0207708_10042782 | 3300026075 | Bacteria | 3452 |
| 458 | Ga0207702_10002585 | 3300026078 | Bacteria | 17020 |
| 459 | Ga0207702_10003045 | 3300026078 | Bacteria | 15578 |
| 460 | Ga0207702_10043948 | 3300026078 | Bacteria | 3753 |
| 461 | Ga0207702_10047255 | 3300026078 | Bacteria | 3626 |
| 462 | Ga0207702_10202213 | 3300026078 | Unclassified | 1842 |
| 463 | Ga0207641_10003995 | 3300026088 | Bacteria | 12874 |
| 464 | Ga0207648_10028723 | 3300026089 | Bacteria | 4930 |
| 465 | Ga0207676_10001904 | 3300026095 | Bacteria | 15235 |
| 466 | Ga0207676_10159604 | 3300026095 | Bacteria | 1952 |
| 467 | Ga0207676_10171322 | 3300026095 | Bacteria | 1892 |
| 468 | Ga0207674_10001897 | 3300026116 | Bacteria | 26616 |
| 469 | Ga0207674_10002204 | 3300026116 | Bacteria | 24674 |
| 470 | Ga0207674_10006656 | 3300026116 | Bacteria | 13574 |
| 471 | Ga0207674_10063620 | 3300026116 | Bacteria | 3724 |
| 472 | Ga0207683_10000600 | 3300026121 | Bacteria | 33247 |
| 473 | Ga0207683_10108455 | 3300026121 | Bacteria | 2484 |
| 474 | Ga0207698_10000263 | 3300026142 | Bacteria | 32215 |
| 475 | Ga0207698_10000268 | 3300026142 | Bacteria | 31619 |
| 476 | Ga0207698_10012627 | 3300026142 | Bacteria | 5535 |
| 477 | Ga0207698_10277198 | 3300026142 | Bacteria | 1549 |
| 478 | Ga0268266_10004489 | 3300028379 | Bacteria | 13344 |
| 479 | Ga0268266_10005457 | 3300028379 | Bacteria | 11845 |
| 480 | Ga0268266_10029772 | 3300028379 | Bacteria | 4639 |
| 481 | Ga0268266_10037935 | 3300028379 | Bacteria | 4103 |
| 482 | Ga0268266_10093131 | 3300028379 | Bacteria | 2644 |
| 483 | Ga0268266_10104052 | 3300028379 | Bacteria | 2506 |
| 484 | Ga0268266_10124935 | 3300028379 | Bacteria | 2294 |
| 485 | Ga0268266_10222389 | 3300028379 | Unclassified | 1736 |
| 486 | Ga0268266_10248366 | 3300028379 | Bacteria | 1645 |
| 487 | Ga0268264_10009127 | 3300028381 | Bacteria | 8222 |
| 488 | Ga0268264_10025603 | 3300028381 | Bacteria | 4820 |
| 489 | Ga0265334_10043510 | 3300028573 | Bacteria | 1747 |
| 490 | Ga0265336_10008975 | 3300028666 | Bacteria | 3477 |
| 491 | Ga0265338_10001617 | 3300028800 | Bacteria | 36047 |
| 492 | Ga0265338_10006322 | 3300028800 | Bacteria | 15137 |
| 493 | Ga0265338_10009997 | 3300028800 | Bacteria | 11216 |
| 494 | Ga0265338_10010474 | 3300028800 | Bacteria | 10861 |
| 495 | Ga0265338_10138839 | 3300028800 | Bacteria | 1906 |
| 496 | Ga0265338_10143980 | 3300028800 | Unclassified | 1862 |
| 497 | Ga0265762_1001427 | 3300030760 | Bacteria | 4333 |
| 498 | Ga0265770_1002352 | 3300030878 | Bacteria | 2569 |
| 499 | Ga0265770_1002418 | 3300030878 | Bacteria | 2533 |
| 500 | Ga0265760_10000557 | 3300031090 | Bacteria | 10562 |
| 501 | Ga0265330_10000326 | 3300031235 | Bacteria | 34208 |
| 502 | Ga0265330_10001479 | 3300031235 | Bacteria | 13663 |
| 503 | Ga0265330_10008043 | 3300031235 | Bacteria | 5103 |
| 504 | Ga0265330_10052525 | 3300031235 | Bacteria | 1785 |
| 505 | Ga0265332_10004965 | 3300031238 | Bacteria | 6184 |
| 506 | Ga0265328_10010533 | 3300031239 | Bacteria | 3718 |
| 507 | Ga0265328_10028521 | 3300031239 | Bacteria | 2088 |
| 508 | Ga0265328_10029060 | 3300031239 | Bacteria | 2067 |
| 509 | Ga0265325_10001354 | 3300031241 | Bacteria | 17356 |
| 510 | Ga0265325_10003147 | 3300031241 | Bacteria | 10874 |
| 511 | Ga0265325_10018559 | 3300031241 | Bacteria | 3857 |
| 512 | Ga0265325_10046767 | 3300031241 | Bacteria | 2243 |
| 513 | Ga0265325_10062162 | 3300031241 | Bacteria | 1892 |
| 514 | Ga0265325_10080949 | 3300031241 | Bacteria | 1614 |
| 515 | Ga0265340_10004274 | 3300031247 | Bacteria | 8009 |
| 516 | Ga0265340_10009915 | 3300031247 | Bacteria | 5106 |
| 517 | Ga0265340_10013357 | 3300031247 | Bacteria | 4314 |
| 518 | Ga0265340_10017929 | 3300031247 | Bacteria | 3660 |
| 519 | Ga0265340_10022014 | 3300031247 | Bacteria | 3262 |
| 520 | Ga0265339_10000102 | 3300031249 | Bacteria | 68868 |
| 521 | Ga0265339_10002713 | 3300031249 | Bacteria | 12584 |
| 522 | Ga0265339_10004260 | 3300031249 | Bacteria | 9788 |
| 523 | Ga0265339_10009355 | 3300031249 | Bacteria | 6166 |
| 524 | Ga0265339_10030492 | 3300031249 | Bacteria | 3053 |
| 525 | Ga0265339_10040250 | 3300031249 | Bacteria | 2598 |
| 526 | Ga0265316_10001220 | 3300031344 | Bacteria | 27686 |
| 527 | Ga0265316_10007060 | 3300031344 | Bacteria | 10635 |
| 528 | Ga0265316_10007359 | 3300031344 | Bacteria | 10375 |
| 529 | Ga0265316_10020829 | 3300031344 | Bacteria | 5570 |
| 530 | Ga0265316_10028872 | 3300031344 | Bacteria | 4569 |
| 531 | Ga0265316_10035281 | 3300031344 | Bacteria | 4054 |
| 532 | Ga0265316_10037065 | 3300031344 | Bacteria | 3940 |
| 533 | Ga0265316_10066620 | 3300031344 | Bacteria | 2786 |
| 534 | Ga0265316_10150545 | 3300031344 | Bacteria | 1743 |
| 535 | Ga0265316_10156160 | 3300031344 | Bacteria | 1707 |
| 536 | Ga0265316_10215886 | 3300031344 | Bacteria | 1417 |
| 537 | Ga0307408_100101971 | 3300031548 | Bacteria | 2188 |
| 538 | Ga0265313_10003269 | 3300031595 | Bacteria | 13313 |
| 539 | Ga0265313_10009409 | 3300031595 | Bacteria | 6347 |
| 540 | Ga0265313_10016220 | 3300031595 | Bacteria | 4293 |
| 541 | Ga0265313_10025707 | 3300031595 | Bacteria | 3113 |
| 542 | Ga0265314_10000063 | 3300031711 | Bacteria | 159305 |
| 543 | Ga0265314_10010478 | 3300031711 | Bacteria | 7727 |
| 544 | Ga0265314_10020473 | 3300031711 | Bacteria | 5106 |
| 545 | Ga0265314_10027560 | 3300031711 | Bacteria | 4253 |
| 546 | Ga0265314_10078225 | 3300031711 | Unclassified | 2191 |
| 547 | Ga0265314_10096188 | 3300031711 | Bacteria | 1916 |
| 548 | Ga0265342_10001150 | 3300031712 | Bacteria | 25234 |
| 549 | Ga0265342_10001877 | 3300031712 | Bacteria | 18962 |
| 550 | Ga0265342_10003244 | 3300031712 | Bacteria | 13487 |
| 551 | Ga0265342_10003727 | 3300031712 | Bacteria | 12329 |
| 552 | Ga0265342_10029167 | 3300031712 | Bacteria | 3429 |
| 553 | Ga0265342_10033310 | 3300031712 | Bacteria | 3169 |
| 554 | Ga0307405_10037690 | 3300031731 | Bacteria | 2908 |
| 555 | Ga0307410_10016670 | 3300031852 | Unclassified | 4390 |
| 556 | Ga0307406_10028616 | 3300031901 | Bacteria | 3369 |
| 557 | Ga0307409_100075685 | 3300031995 | Unclassified | 2696 |
| 558 | Ga0307409_100170897 | 3300031995 | Bacteria | 1913 |
| 559 | Ga0307416_100071608 | 3300032002 | Unclassified | 2881 |
| 560 | Ga0307411_10141231 | 3300032005 | Bacteria | 1776 |
| 561 | Ga0307411_10238717 | 3300032005 | Unclassified | 1421 |
| 562 | Ga0307415_100109801 | 3300032126 | Bacteria | 2044 |
| 563 | Ga0307510_10029551 | 3300033180 | Bacteria | 6236 |
| 564 | Ga0373934_0051919 | 3300035086 | Unclassified | 1625 |
| 565 | Ga0373940_0047496 | 3300035088 | Bacteria | 1197 |
| 566 | Ga0373923_0000400 | 3300035111 | Bacteria | 10038 |
| 567 | Ga0373956_0027534 | 3300035119 | Unclassified | 2468 |
| 568 | Ga0373956_0042298 | 3300035119 | Bacteria | 2025 |
| 569 | Ga0373943_0002431 | 3300035170 | Bacteria | 8457 |
| 570 | Ga0373946_0008745 | 3300035171 | Unclassified | 3718 |
| 571 | Ga0373946_0018138 | 3300035171 | Unclassified | 2698 |
| 572 | Ga0373955_0014400 | 3300035172 | Bacteria | 3846 |
| 573 | Ga0373924_0003464 | 3300035410 | Bacteria | 5432 |
| 574 | Ga0373931_0036652 | 3300035691 | Bacteria | 2557 |
| 575 | Ga0373931_0107634 | 3300035691 | Unclassified | 1577 |
| 576 | Ga0373935_0003446 | 3300035692 | Bacteria | 9192 |
| 577 | Ga0373935_0094799 | 3300035692 | Bacteria | 1959 |
| 578 | Ga0373935_0142971 | 3300035692 | Bacteria | 1617 |
| 579 | Ga0373927_0001136 | 3300035695 | Bacteria | 20149 |
| 580 | Ga0373927_0001713 | 3300035695 | Bacteria | 16383 |
| 581 | Ga0373933_0145937 | 3300035724 | Bacteria | 1496 |
| 582 | Ga0373947_0001191 | 3300035725 | Bacteria | 16011 |
| 583 | Ga0373947_0029549 | 3300035725 | Unclassified | 3216 |
| 584 | Ga0373937_0000026 | 3300036401 | Bacteria | 124071 |
| 585 | Ga0373937_0017855 | 3300036401 | Bacteria | 6330 |
| 586 | Ga0373937_0039864 | 3300036401 | Bacteria | 4281 |
| 587 | Ga0373925_0002873 | 3300037068 | Bacteria | 13598 |
| 588 | Ga0373925_0055083 | 3300037068 | Bacteria | 2976 |
| 589 | Ga0436361_0224127 | 3300039447 | Bacteria | 1359 |
| 590 | Ga0436361_0608005 | 3300039447 | Bacteria | 15128 |
| 591 | Ga0436361_0652690 | 3300039447 | Bacteria | 39906 |
| 592 | Ga0436361_1068732 | 3300039447 | Bacteria | 3530 |
| 593 | Ga0466966_0066721 | 3300044684 | Bacteria | 2261 |
| 594 | Ga0466966_0072063 | 3300044684 | Bacteria | 2164 |
| 595 | Ga0466963_0000116 | 3300044694 | Bacteria | 29494 |
| 596 | Ga0466963_0152210 | 3300044694 | Unclassified | 1607 |
| 597 | Ga0466957_0000246 | 3300044842 | Bacteria | 25999 |
| 598 | Ga0466959_0076064 | 3300045049 | Bacteria | 2425 |
| 599 | Ga0451576_0036535 | 3300045051 | Bacteria | 5207 |
| 600 | Ga0451576_0451756 | 3300045051 | Bacteria | 1349 |
| 601 | Ga0451576_0603020 | 3300045051 | Unclassified | 1154 |
| 602 | Ga0466967_0000227 | 3300045976 | Bacteria | 24293 |
| 603 | Ga0466967_0002031 | 3300045976 | Bacteria | 12348 |
| 604 | Ga0495617_056061 | 3300046452 | Bacteria | 1307 |
| 605 | Ga0495592_0196950 | 3300046454 | Bacteria | 1362 |
| 606 | Ga0495603_0005762 | 3300046455 | Bacteria | 7410 |
| 607 | Ga0495629_0006748 | 3300046459 | Bacteria | 8487 |
| 608 | Ga0495629_0043096 | 3300046459 | Bacteria | 3170 |
| 609 | Ga0495629_0081742 | 3300046459 | Bacteria | 2255 |
| 610 | Ga0495651_0010087 | 3300046462 | Bacteria | 7256 |
| 611 | Ga0495651_0037611 | 3300046462 | Bacteria | 3769 |
| 612 | Ga0495651_0071104 | 3300046462 | Unclassified | 2646 |
| 613 | Ga0495653_0001794 | 3300046463 | Bacteria | 16923 |
| 614 | Ga0495650_0000037 | 3300046471 | Bacteria | 390090 |
| 615 | Ga0495650_0006514 | 3300046471 | Bacteria | 7256 |
| 616 | Ga0495580_0003126 | 3300046472 | Bacteria | 14184 |
| 617 | Ga0495580_0039510 | 3300046472 | Bacteria | 3376 |
| 618 | Ga0495580_0049926 | 3300046472 | Bacteria | 2959 |
| 619 | Ga0495580_0056552 | 3300046472 | Bacteria | 2762 |
| 620 | Ga0495582_0004081 | 3300046473 | Bacteria | 8203 |
| 621 | Ga0495605_0044647 | 3300046474 | Bacteria | 2190 |
| 622 | Ga0495639_0001894 | 3300046475 | Bacteria | 9271 |
| 623 | Ga0495664_0001180 | 3300046477 | Bacteria | 13616 |
| 624 | Ga0495664_0049978 | 3300046477 | Unclassified | 2482 |
| 625 | Ga0495664_0146885 | 3300046477 | Bacteria | 1430 |
| 626 | Ga0495584_0072575 | 3300046491 | Bacteria | 1730 |
| 627 | Ga0495585_0005391 | 3300046492 | Bacteria | 8068 |
| 628 | Ga0495594_0000357 | 3300046499 | Bacteria | 22945 |
| 629 | Ga0495594_0001304 | 3300046499 | Bacteria | 12994 |
| 630 | Ga0495594_0006703 | 3300046499 | Bacteria | 5922 |
| 631 | Ga0495596_0015901 | 3300046500 | Bacteria | 3135 |
| 632 | Ga0495583_0022628 | 3300046506 | Bacteria | 3201 |
| 633 | Ga0495583_0072514 | 3300046506 | Bacteria | 1511 |
| 634 | Ga0495618_0032463 | 3300046514 | Bacteria | 3270 |
| 635 | Ga0495628_0127888 | 3300046516 | Bacteria | 1945 |
| 636 | Ga0495631_0005469 | 3300046518 | Bacteria | 6644 |
| 637 | Ga0495644_0000004 | 3300046523 | Bacteria | 158166 |
| 638 | Ga0495642_0047448 | 3300046528 | Bacteria | 1759 |
| 639 | Ga0495652_0004537 | 3300046529 | Bacteria | 13251 |
| 640 | Ga0495652_0054462 | 3300046529 | Bacteria | 3406 |
| 641 | Ga0495652_0098395 | 3300046529 | Bacteria | 2378 |
| 642 | Ga0495665_0002033 | 3300046531 | Bacteria | 10952 |
| 643 | Ga0495640_0009979 | 3300046533 | Bacteria | 7360 |
| 644 | Ga0495586_0003036 | 3300046535 | Bacteria | 9052 |
| 645 | Ga0495609_0026554 | 3300046538 | Bacteria | 2651 |
| 646 | Ga0495633_0035845 | 3300046558 | Bacteria | 2380 |
| 647 | Ga0495667_0009281 | 3300046559 | Bacteria | 6672 |
| 648 | Ga0495656_0056874 | 3300046615 | Bacteria | 1692 |
| 649 | Ga0495668_0158253 | 3300046616 | Bacteria | 1241 |
| 650 | Ga0495625_0000166 | 3300046660 | Bacteria | 102927 |
| 651 | Ga0495625_0008870 | 3300046660 | Bacteria | 8509 |
| 652 | Ga0495625_0047937 | 3300046660 | Bacteria | 3079 |
| 653 | Ga0495635_0001143 | 3300046663 | Bacteria | 17685 |
| 654 | Ga0495659_0002804 | 3300046664 | Bacteria | 5601 |
| 655 | Ga0495661_0022579 | 3300046665 | Bacteria | 4094 |
| 656 | Ga0495599_0005781 | 3300046678 | Bacteria | 7422 |
| 657 | Ga0495623_0016828 | 3300046679 | Bacteria | 4724 |
| 658 | Ga0495646_0015770 | 3300046680 | Bacteria | 4796 |
| 659 | Ga0495669_0001311 | 3300046684 | Bacteria | 10299 |
| 660 | Ga0495669_0044969 | 3300046684 | Bacteria | 1968 |
| 661 | Ga0495669_0045967 | 3300046684 | Bacteria | 1948 |
| 662 | Ga0495613_0008425 | 3300046689 | Bacteria | 7652 |
| 663 | Ga0495624_0001490 | 3300046690 | Bacteria | 18174 |
| 664 | Ga0495649_0023508 | 3300046694 | Bacteria | 3443 |
| 665 | Ga0495649_0052110 | 3300046694 | Bacteria | 2218 |
| 666 | Ga0495600_0004064 | 3300046809 | Bacteria | 8701 |
| 667 | Ga0495581_0102114 | 3300047315 | Unclassified | 1666 |
| 668 | Ga0495604_0019623 | 3300047317 | Bacteria | 5410 |
| 669 | Ga0495604_0031403 | 3300047317 | Bacteria | 4212 |
| 670 | Ga0495604_0033274 | 3300047317 | Unclassified | 4082 |
| 671 | Ga0495674_0041535 | 3300047319 | Bacteria | 4107 |
| 672 | Ga0495672_0004803 | 3300047320 | Bacteria | 10899 |
| 673 | Ga0495676_0004397 | 3300047321 | Bacteria | 12878 |
| 674 | Ga0495680_0013716 | 3300047322 | Bacteria | 7053 |
| 675 | Ga0495680_0153254 | 3300047322 | Bacteria | 1679 |
| 676 | Ga0495675_0001672 | 3300047444 | Bacteria | 13294 |
| 677 | Ga0495684_0010561 | 3300047471 | Bacteria | 7135 |
| 678 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 679 | Ga0495686_0001113 | 3300047472 | Bacteria | 31863 |
| 680 | Ga0495686_0001457 | 3300047472 | Bacteria | 25789 |
| 681 | Ga0495602_0110587 | 3300048088 | Unclassified | 2233 |
| 682 | Ga0495602_0225586 | 3300048088 | Bacteria | 1411 |
| 683 | Ga0495614_0002636 | 3300048089 | Bacteria | 7975 |
| 684 | Ga0496100_0099849 | 3300048903 | Bacteria | 1998 |
| 685 | Ga0496100_0105718 | 3300048903 | Bacteria | 1947 |
| 686 | Ga0496102_0001003 | 3300048905 | Bacteria | 26467 |
| 687 | Ga0496102_0043116 | 3300048905 | Bacteria | 4090 |
| 688 | Ga0496102_0053501 | 3300048905 | Bacteria | 3679 |
| 689 | Ga0496102_0331617 | 3300048905 | Bacteria | 1433 |
| 690 | Ga0496103_0012752 | 3300048906 | Bacteria | 4986 |
| 691 | Ga0496104_0002870 | 3300048907 | Bacteria | 14860 |
| 692 | Ga0496104_0023246 | 3300048907 | Bacteria | 5699 |
| 693 | Ga0496104_0037784 | 3300048907 | Bacteria | 4514 |
| 694 | Ga0496104_0043377 | 3300048907 | Bacteria | 4225 |
| 695 | Ga0496104_0067312 | 3300048907 | Bacteria | 3402 |
| 696 | Ga0496104_0124216 | 3300048907 | Bacteria | 2478 |
| 697 | Ga0496105_0020835 | 3300048908 | Bacteria | 5301 |
| 698 | Ga0496105_0064958 | 3300048908 | Bacteria | 3012 |
| 699 | Ga0496105_0067449 | 3300048908 | Bacteria | 2954 |
| 700 | Ga0496105_0068298 | 3300048908 | Bacteria | 2936 |
| 701 | Ga0496106_0036829 | 3300048909 | Bacteria | 3660 |
| 702 | Ga0496106_0063264 | 3300048909 | Bacteria | 2812 |
| 703 | Ga0496107_0088373 | 3300048910 | Bacteria | 2262 |
| 704 | Ga0496107_0141836 | 3300048910 | Bacteria | 1776 |
| 705 | Ga0496107_0209514 | 3300048910 | Bacteria | 1449 |
| 706 | Ga0496108_0204051 | 3300048911 | Bacteria | 1715 |
| 707 | Ga0496109_0137587 | 3300048912 | Bacteria | 2283 |
| 708 | Ga0496109_0258142 | 3300048912 | Bacteria | 1641 |
| 709 | Ga0496110_0019179 | 3300048913 | Bacteria | 5751 |
| 710 | Ga0496111_0006043 | 3300048914 | Bacteria | 7822 |
| 711 | Ga0496112_0077201 | 3300048915 | Bacteria | 3294 |
| 712 | Ga0496112_0090564 | 3300048915 | Bacteria | 3028 |
| 713 | Ga0496112_0095614 | 3300048915 | Bacteria | 2941 |
| 714 | Ga0496112_0126133 | 3300048915 | Unclassified | 2530 |
| 715 | Ga0496112_0165147 | 3300048915 | Bacteria | 2180 |
| 716 | Ga0496112_0344304 | 3300048915 | Bacteria | 1434 |
| 717 | Ga0496113_0040525 | 3300048916 | Bacteria | 3432 |
| 718 | Ga0496113_0052929 | 3300048916 | Unclassified | 3034 |
| 719 | Ga0496113_0085594 | 3300048916 | Bacteria | 2421 |
| 720 | Ga0496114_0026750 | 3300048917 | Bacteria | 4725 |
| 721 | Ga0496115_0012654 | 3300048918 | Bacteria | 6359 |
| 722 | Ga0496115_0040201 | 3300048918 | Bacteria | 3717 |
| 723 | Ga0496115_0056447 | 3300048918 | Bacteria | 3156 |
| 724 | Ga0496115_0068390 | 3300048918 | Bacteria | 2875 |
| 725 | Ga0496126_0000085 | 3300048929 | Bacteria | 216528 |
| 726 | Ga0496126_0001139 | 3300048929 | Bacteria | 44245 |
| 727 | Ga0496126_0001781 | 3300048929 | Bacteria | 31809 |
| 728 | Ga0496126_0009231 | 3300048929 | Bacteria | 10515 |
| 729 | Ga0495682_0008805 | 3300049460 | Bacteria | 3967 |
| 730 | Ga0495682_0043789 | 3300049460 | Bacteria | 1639 |
| 731 | Ga0501031_0046555 | 3300049568 | Bacteria | 2828 |
| 732 | Ga0501032_0001186 | 3300049569 | Bacteria | 20875 |
| 733 | Ga0501033_0013422 | 3300049570 | Bacteria | 6239 |
| 734 | Ga0501034_0005607 | 3300049571 | Bacteria | 13671 |
| 735 | Ga0501036_0013543 | 3300049572 | Bacteria | 6780 |
| 736 | Ga0501037_0003398 | 3300049573 | Bacteria | 11576 |
| 737 | Ga0501038_0000661 | 3300049574 | Bacteria | 30645 |
| 738 | Ga0501043_0000632 | 3300049579 | Bacteria | 31136 |
| 739 | Ga0501046_0000036 | 3300049580 | Bacteria | 159823 |
| 740 | Ga0501047_0012234 | 3300049581 | Bacteria | 8125 |
| 741 | Ga0501073_0010534 | 3300049589 | Bacteria | 6771 |
| 742 | Ga0501073_0048226 | 3300049589 | Bacteria | 2990 |
| 743 | Ga0501074_0079359 | 3300049590 | Bacteria | 2355 |
| 744 | Ga0501080_0009240 | 3300049742 | Bacteria | 8985 |
| 745 | Ga0501083_0132819 | 3300049744 | Unclassified | 1632 |
| 746 | Ga0501035_0003113 | 3300049822 | Bacteria | 15938 |
| 747 | Ga0501044_0010234 | 3300049823 | Bacteria | 10184 |
| 748 | nmdc:mga0n895_1746_c1 | 3300050512 | Bacteria | 16448 |
| 749 | nmdc:mga08x19_56386_c1 | 3300050514 | Bacteria | 2536 |
| 750 | Ga0495601_0020434 | 3300053077 | Unclassified | 4045 |
| 751 | Ga0495601_0044442 | 3300053077 | Bacteria | 2792 |
| 752 | Ga0500643_029950 | 3300053087 | Bacteria | 1671 |
| 753 | Ga0500644_0044987 | 3300053088 | Bacteria | 1485 |
| 754 | Ga0500651_0000009 | 3300053093 | Bacteria | 270362 |
| 755 | Ga0500595_000072 | 3300053119 | Bacteria | 71795 |
| 756 | Ga0501084_0052972 | 3300054114 | Bacteria | 3394 |
| 757 | Ga0500661_006105 | 3300055283 | Bacteria | 2247 |
| 758 | Ga0501082_0051892 | 3300060353 | Bacteria | 3535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0603020 | Ga0451576_0603020_82_1113 | 342 |
| 2 | 3300035119 | Ga0373956_0042298 | Ga0373956_0042298_135_1250 | 353 |
| 3 | 3300046615 | Ga0495656_0056874 | Ga0495656_0056874_219_1349 | 354 |
| 4 | 3300046664 | Ga0495659_0002804 | Ga0495659_0002804_4317_5447 | 354 |
| 5 | 3300046684 | Ga0495669_0045967 | Ga0495669_0045967_155_1285 | 354 |
| 6 | 3300005563 | Ga0068855_100127229 | Ga0068855_1001272293 | 355 |
| 7 | 3300013105 | Ga0157369_10008672 | Ga0157369_100086724 | 355 |
| 8 | 3300025949 | Ga0207667_10175402 | Ga0207667_101754022 | 355 |
| 9 | 3300005535 | Ga0070684_100046043 | Ga0070684_1000460432 | 356 |
| 10 | 3300035088 | Ga0373940_0047496 | Ga0373940_0047496_99_1184 | 356 |
| 11 | 3300036401 | Ga0373937_0017855 | Ga0373937_0017855_4150_5265 | 356 |
| 12 | 3300047315 | Ga0495581_0102114 | Ga0495581_0102114_43_1158 | 356 |
| 13 | 3300046459 | Ga0495629_0043096 | Ga0495629_0043096_161_1264 | 364 |
| 14 | 3300048915 | Ga0496112_0344304 | Ga0496112_0344304_320_1423 | 364 |
| 15 | 3300031241 | Ga0265325_10018559 | Ga0265325_100185592 | 365 |
| 16 | 3300035086 | Ga0373934_0051919 | Ga0373934_0051919_26_1153 | 365 |
| 17 | 3300035724 | Ga0373933_0145937 | Ga0373933_0145937_332_1438 | 365 |
| 18 | 3300009093 | Ga0105240_10000001 | Ga0105240_100000011243 | 366 |
| 19 | 3300009098 | Ga0105245_10020802 | Ga0105245_100208025 | 366 |
| 20 | 3300009101 | Ga0105247_10045149 | Ga0105247_100451492 | 366 |
| 21 | 3300009174 | Ga0105241_10015747 | Ga0105241_100157472 | 366 |
| 22 | 3300009545 | Ga0105237_10003849 | Ga0105237_100038492 | 366 |
| 23 | 3300010375 | Ga0105239_10028853 | Ga0105239_100288533 | 366 |
| 24 | 3300011119 | Ga0105246_10000907 | Ga0105246_100009076 | 366 |
| 25 | 3300013296 | Ga0157374_10023240 | Ga0157374_100232402 | 366 |
| 26 | 3300013307 | Ga0157372_10130189 | Ga0157372_101301891 | 366 |
| 27 | 3300013308 | Ga0157375_10005008 | Ga0157375_100050089 | 366 |
| 28 | 3300014325 | Ga0163163_10024393 | Ga0163163_100243932 | 366 |
| 29 | 3300014968 | Ga0157379_10012449 | Ga0157379_100124492 | 366 |
| 30 | 3300014969 | Ga0157376_10016808 | Ga0157376_100168081 | 366 |
| 31 | 3300025261 | Ga0209233_1004869 | Ga0209233_10048691 | 366 |
| 32 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011248 | 366 |
| 33 | 3300013105 | Ga0157369_10060177 | Ga0157369_100601771 | 367 |
| 34 | 3300025920 | Ga0207649_10106490 | Ga0207649_101064902 | 367 |
| 35 | 3300045976 | Ga0466967_0002031 | Ga0466967_0002031_3079_4191 | 367 |
| 36 | 3300046616 | Ga0495668_0158253 | Ga0495668_0158253_108_1223 | 367 |
| 37 | 3300046660 | Ga0495625_0047937 | Ga0495625_0047937_1152_2267 | 367 |
| 38 | 3300049568 | Ga0501031_0046555 | Ga0501031_0046555_741_1859 | 367 |
| 39 | 3300049569 | Ga0501032_0001186 | Ga0501032_0001186_10141_11259 | 367 |
| 40 | 3300049570 | Ga0501033_0013422 | Ga0501033_0013422_825_1943 | 367 |
| 41 | 3300049571 | Ga0501034_0005607 | Ga0501034_0005607_1953_3071 | 367 |
| 42 | 3300049572 | Ga0501036_0013543 | Ga0501036_0013543_1291_2409 | 367 |
| 43 | 3300049573 | Ga0501037_0003398 | Ga0501037_0003398_93_1211 | 367 |
| 44 | 3300049574 | Ga0501038_0000661 | Ga0501038_0000661_20588_21706 | 367 |
| 45 | 3300049579 | Ga0501043_0000632 | Ga0501043_0000632_16497_17615 | 367 |
| 46 | 3300049580 | Ga0501046_0000036 | Ga0501046_0000036_127317_128435 | 367 |
| 47 | 3300049581 | Ga0501047_0012234 | Ga0501047_0012234_504_1622 | 367 |
| 48 | 3300049589 | Ga0501073_0048226 | Ga0501073_0048226_83_1201 | 367 |
| 49 | 3300049590 | Ga0501074_0079359 | Ga0501074_0079359_561_1679 | 367 |
| 50 | 3300049742 | Ga0501080_0009240 | Ga0501080_0009240_222_1340 | 367 |
| 51 | 3300049822 | Ga0501035_0003113 | Ga0501035_0003113_5880_6998 | 367 |
| 52 | 3300049823 | Ga0501044_0010234 | Ga0501044_0010234_4553_5671 | 367 |
| 53 | 3300009174 | Ga0105241_10002688 | Ga0105241_100026882 | 368 |
| 54 | 3300009551 | Ga0105238_10101468 | Ga0105238_101014682 | 368 |
| 55 | 3300013105 | Ga0157369_10096380 | Ga0157369_100963802 | 368 |
| 56 | 3300013306 | Ga0163162_10219525 | Ga0163162_102195253 | 368 |
| 57 | 3300006028 | Ga0070717_10004829 | Ga0070717_100048297 | 369 |
| 58 | 3300009545 | Ga0105237_10044667 | Ga0105237_100446673 | 369 |
| 59 | 3300010375 | Ga0105239_10127172 | Ga0105239_101271722 | 369 |
| 60 | 3300013105 | Ga0157369_10050235 | Ga0157369_100502354 | 369 |
| 61 | 3300013105 | Ga0157369_10273902 | Ga0157369_102739022 | 369 |
| 62 | 3300013105 | Ga0157369_10447555 | Ga0157369_104475551 | 369 |
| 63 | 3300013308 | Ga0157375_10127307 | Ga0157375_101273073 | 369 |
| 64 | 3300035692 | Ga0373935_0094799 | Ga0373935_0094799_790_1905 | 369 |
| 65 | 3300044694 | Ga0466963_0000116 | Ga0466963_0000116_11988_13103 | 369 |
| 66 | 3300045976 | Ga0466967_0000227 | Ga0466967_0000227_4618_5733 | 369 |
| 67 | 3300009098 | Ga0105245_10178216 | Ga0105245_101782162 | 371 |
| 68 | 3300009174 | Ga0105241_10005545 | Ga0105241_100055452 | 371 |
| 69 | 3300009551 | Ga0105238_10131930 | Ga0105238_101319302 | 371 |
| 70 | 3300011119 | Ga0105246_10077173 | Ga0105246_100771732 | 371 |
| 71 | 3300013100 | Ga0157373_10098780 | Ga0157373_100987802 | 371 |
| 72 | 3300013297 | Ga0157378_10179908 | Ga0157378_101799083 | 371 |
| 73 | 3300013306 | Ga0163162_10000822 | Ga0163162_1000082225 | 371 |
| 74 | 3300014325 | Ga0163163_10080874 | Ga0163163_100808742 | 371 |
| 75 | 3300037068 | Ga0373925_0055083 | Ga0373925_0055083_713_1846 | 371 |
| 76 | 3300045051 | Ga0451576_0451756 | Ga0451576_0451756_92_1222 | 371 |
| 77 | 3300046472 | Ga0495580_0049926 | Ga0495580_0049926_880_2010 | 371 |
| 78 | 3300048907 | Ga0496104_0124216 | Ga0496104_0124216_1335_2468 | 371 |
| 79 | 3300048908 | Ga0496105_0068298 | Ga0496105_0068298_459_1592 | 371 |
| 80 | 3300048910 | Ga0496107_0141836 | Ga0496107_0141836_13_1146 | 371 |
| 81 | 3300048917 | Ga0496114_0026750 | Ga0496114_0026750_2250_3383 | 371 |
| 82 | 3300048918 | Ga0496115_0056447 | Ga0496115_0056447_917_2050 | 371 |
| 83 | 3300049589 | Ga0501073_0010534 | Ga0501073_0010534_91_1215 | 371 |
| 84 | 3300054114 | Ga0501084_0052972 | Ga0501084_0052972_676_1800 | 371 |
| 85 | 3300060353 | Ga0501082_0051892 | Ga0501082_0051892_538_1662 | 371 |
| 86 | 3300005439 | Ga0070711_100222443 | Ga0070711_1002224432 | 372 |
| 87 | 3300044694 | Ga0466963_0152210 | Ga0466963_0152210_173_1357 | 372 |
| 88 | 3300046471 | Ga0495650_0000037 | Ga0495650_0000037_224268_225407 | 375 |
| 89 | 3300046665 | Ga0495661_0022579 | Ga0495661_0022579_1065_2204 | 375 |
| 90 | 3300053087 | Ga0500643_029950 | Ga0500643_029950_188_1327 | 375 |
| 91 | 3300053093 | Ga0500651_0000009 | Ga0500651_0000009_40983_42122 | 375 |
| 92 | 3300005436 | Ga0070713_100063124 | Ga0070713_1000631242 | 376 |
| 93 | 3300048907 | Ga0496104_0023246 | Ga0496104_0023246_3038_4219 | 376 |
| 94 | 3300048929 | Ga0496126_0001781 | Ga0496126_0001781_11548_12726 | 376 |
| 95 | 3300048916 | Ga0496113_0085594 | Ga0496113_0085594_1131_2312 | 377 |
| 96 | 3300005435 | Ga0070714_100091642 | Ga0070714_1000916421 | 378 |
| 97 | 3300005436 | Ga0070713_100044263 | Ga0070713_1000442631 | 378 |
| 98 | 3300005437 | Ga0070710_10041817 | Ga0070710_100418171 | 378 |
| 99 | 3300005439 | Ga0070711_100009579 | Ga0070711_1000095792 | 378 |
| 100 | 3300005439 | Ga0070711_100027461 | Ga0070711_1000274612 | 378 |
| 101 | 3300006914 | Ga0075436_100032251 | Ga0075436_1000322512 | 378 |
| 102 | 3300009093 | Ga0105240_10002144 | Ga0105240_1000214412 | 378 |
| 103 | 3300013105 | Ga0157369_10018678 | Ga0157369_100186788 | 378 |
| 104 | 3300013296 | Ga0157374_10235555 | Ga0157374_102355551 | 378 |
| 105 | 3300013307 | Ga0157372_10160791 | Ga0157372_101607912 | 378 |
| 106 | 3300013307 | Ga0157372_10162974 | Ga0157372_101629743 | 378 |
| 107 | 3300014325 | Ga0163163_10134870 | Ga0163163_101348703 | 378 |
| 108 | 3300025906 | Ga0207699_10008635 | Ga0207699_100086353 | 378 |
| 109 | 3300025913 | Ga0207695_10000259 | Ga0207695_1000025929 | 378 |
| 110 | 3300025915 | Ga0207693_10006863 | Ga0207693_1000686311 | 378 |
| 111 | 3300025928 | Ga0207700_10011869 | Ga0207700_100118695 | 378 |
| 112 | 3300025929 | Ga0207664_10040595 | Ga0207664_100405952 | 378 |
| 113 | 3300026078 | Ga0207702_10043948 | Ga0207702_100439483 | 378 |
| 114 | 3300030878 | Ga0265770_1002418 | Ga0265770_10024183 | 378 |
| 115 | 3300031247 | Ga0265340_10013357 | Ga0265340_100133573 | 378 |
| 116 | 3300035171 | Ga0373946_0018138 | Ga0373946_0018138_1382_2563 | 378 |
| 117 | 3300035692 | Ga0373935_0142971 | Ga0373935_0142971_148_1329 | 378 |
| 118 | 3300035695 | Ga0373927_0001713 | Ga0373927_0001713_1019_2200 | 378 |
| 119 | 3300035725 | Ga0373947_0029549 | Ga0373947_0029549_961_2142 | 378 |
| 120 | 3300044684 | Ga0466966_0066721 | Ga0466966_0066721_637_1848 | 378 |
| 121 | 3300044684 | Ga0466966_0072063 | Ga0466966_0072063_671_1882 | 378 |
| 122 | 3300045049 | Ga0466959_0076064 | Ga0466959_0076064_1158_2369 | 378 |
| 123 | 3300048903 | Ga0496100_0099849 | Ga0496100_0099849_435_1577 | 378 |
| 124 | 3300048907 | Ga0496104_0067312 | Ga0496104_0067312_1356_2498 | 378 |
| 125 | 3300048908 | Ga0496105_0064958 | Ga0496105_0064958_1029_2171 | 378 |
| 126 | 3300048911 | Ga0496108_0204051 | Ga0496108_0204051_72_1214 | 378 |
| 127 | 3300048912 | Ga0496109_0137587 | Ga0496109_0137587_533_1675 | 378 |
| 128 | 3300048916 | Ga0496113_0040525 | Ga0496113_0040525_1230_2372 | 378 |
| 129 | 3300053077 | Ga0495601_0044442 | Ga0495601_0044442_1135_2277 | 378 |
| 130 | 3300031344 | Ga0265316_10150545 | Ga0265316_101505452 | 379 |
| 131 | 3300045051 | Ga0451576_0036535 | Ga0451576_0036535_3878_5038 | 379 |
| 132 | 3300005458 | Ga0070681_10226149 | Ga0070681_102261491 | 382 |
| 133 | 3300006028 | Ga0070717_10180162 | Ga0070717_101801621 | 383 |
| 134 | 3300028800 | Ga0265338_10001617 | Ga0265338_1000161733 | 383 |
| 135 | 3300031249 | Ga0265339_10040250 | Ga0265339_100402502 | 383 |
| 136 | 3300031711 | Ga0265314_10020473 | Ga0265314_100204732 | 383 |
| 137 | 3300006871 | Ga0075434_100080753 | Ga0075434_1000807532 | 384 |
| 138 | 3300009093 | Ga0105240_10059946 | Ga0105240_100599464 | 384 |
| 139 | 3300025913 | Ga0207695_10146374 | Ga0207695_101463742 | 384 |
| 140 | 3300046459 | Ga0495629_0081742 | Ga0495629_0081742_815_1996 | 384 |
| 141 | 3300046472 | Ga0495580_0039510 | Ga0495580_0039510_1244_2425 | 384 |
| 142 | 3300047472 | Ga0495686_0001457 | Ga0495686_0001457_18317_19486 | 384 |
| 143 | 3300048088 | Ga0495602_0225586 | Ga0495602_0225586_61_1242 | 384 |
| 144 | 3300048918 | Ga0496115_0068390 | Ga0496115_0068390_877_2058 | 384 |
| 145 | 3300050514 | nmdc:mga08x19_56386_c1 | nmdc:mga08x19_56386_c1_373_1569 | 384 |
| 146 | 3300053077 | Ga0495601_0020434 | Ga0495601_0020434_2730_3890 | 384 |
| 147 | 3300014968 | Ga0157379_10056931 | Ga0157379_100569314 | 385 |
| 148 | iso_pu_bacteria | 2884215851 | 2884218592 | 385 |
| 149 | 3300005335 | Ga0070666_10003898 | Ga0070666_100038988 | 386 |
| 150 | 3300005338 | Ga0068868_100086489 | Ga0068868_1000864892 | 386 |
| 151 | 3300005456 | Ga0070678_100054496 | Ga0070678_1000544963 | 386 |
| 152 | 3300005458 | Ga0070681_10191810 | Ga0070681_101918102 | 386 |
| 153 | 3300005535 | Ga0070684_100322878 | Ga0070684_1003228781 | 386 |
| 154 | 3300005578 | Ga0068854_100316524 | Ga0068854_1003165241 | 386 |
| 155 | 3300005614 | Ga0068856_100004085 | Ga0068856_10000408511 | 386 |
| 156 | 3300006237 | Ga0097621_100009357 | Ga0097621_1000093576 | 386 |
| 157 | 3300009098 | Ga0105245_10012963 | Ga0105245_100129633 | 386 |
| 158 | 3300009176 | Ga0105242_10179348 | Ga0105242_101793482 | 386 |
| 159 | 3300009545 | Ga0105237_10022066 | Ga0105237_100220662 | 386 |
| 160 | 3300009551 | Ga0105238_10054203 | Ga0105238_100542032 | 386 |
| 161 | 3300013307 | Ga0157372_10277084 | Ga0157372_102770842 | 386 |
| 162 | 3300014968 | Ga0157379_10199098 | Ga0157379_101990982 | 386 |
| 163 | 3300025907 | Ga0207645_10009148 | Ga0207645_100091485 | 386 |
| 164 | 3300025913 | Ga0207695_10074400 | Ga0207695_100744003 | 386 |
| 165 | 3300025919 | Ga0207657_10069516 | Ga0207657_100695161 | 386 |
| 166 | 3300025949 | Ga0207667_10053980 | Ga0207667_100539805 | 386 |
| 167 | 3300025960 | Ga0207651_10142401 | Ga0207651_101424012 | 386 |
| 168 | 3300025986 | Ga0207658_10101686 | Ga0207658_101016862 | 386 |
| 169 | 3300026035 | Ga0207703_10037100 | Ga0207703_100371003 | 386 |
| 170 | 3300026121 | Ga0207683_10000600 | Ga0207683_1000060015 | 386 |
| 171 | 3300028573 | Ga0265334_10043510 | Ga0265334_100435101 | 386 |
| 172 | 3300028666 | Ga0265336_10008975 | Ga0265336_100089751 | 386 |
| 173 | 3300028800 | Ga0265338_10009997 | Ga0265338_100099979 | 386 |
| 174 | 3300028800 | Ga0265338_10010474 | Ga0265338_100104747 | 386 |
| 175 | 3300031235 | Ga0265330_10001479 | Ga0265330_1000147912 | 386 |
| 176 | 3300031238 | Ga0265332_10004965 | Ga0265332_100049655 | 386 |
| 177 | 3300031239 | Ga0265328_10010533 | Ga0265328_100105331 | 386 |
| 178 | 3300031239 | Ga0265328_10029060 | Ga0265328_100290601 | 386 |
| 179 | 3300031241 | Ga0265325_10003147 | Ga0265325_1000314711 | 386 |
| 180 | 3300031247 | Ga0265340_10004274 | Ga0265340_100042744 | 386 |
| 181 | 3300031247 | Ga0265340_10022014 | Ga0265340_100220143 | 386 |
| 182 | 3300031249 | Ga0265339_10004260 | Ga0265339_100042603 | 386 |
| 183 | 3300031249 | Ga0265339_10009355 | Ga0265339_100093552 | 386 |
| 184 | 3300031344 | Ga0265316_10007359 | Ga0265316_100073595 | 386 |
| 185 | 3300031711 | Ga0265314_10000063 | Ga0265314_1000006354 | 386 |
| 186 | 3300031712 | Ga0265342_10001877 | Ga0265342_1000187710 | 386 |
| 187 | 3300031712 | Ga0265342_10029167 | Ga0265342_100291672 | 386 |
| 188 | 3300046684 | Ga0495669_0044969 | Ga0495669_0044969_767_1936 | 386 |
| 189 | 3300048918 | Ga0496115_0012654 | Ga0496115_0012654_3870_5039 | 386 |
| 190 | 3300005435 | Ga0070714_100000186 | Ga0070714_10000018638 | 387 |
| 191 | 3300013307 | Ga0157372_10279736 | Ga0157372_102797361 | 387 |
| 192 | 3300025914 | Ga0207671_10226462 | Ga0207671_102264621 | 387 |
| 193 | 3300025929 | Ga0207664_10000086 | Ga0207664_1000008652 | 387 |
| 194 | 3300031548 | Ga0307408_100101971 | Ga0307408_1001019711 | 387 |
| 195 | 3300031731 | Ga0307405_10037690 | Ga0307405_100376902 | 387 |
| 196 | 3300031852 | Ga0307410_10016670 | Ga0307410_100166704 | 387 |
| 197 | 3300031901 | Ga0307406_10028616 | Ga0307406_100286164 | 387 |
| 198 | 3300031995 | Ga0307409_100075685 | Ga0307409_1000756852 | 387 |
| 199 | 3300031995 | Ga0307409_100170897 | Ga0307409_1001708972 | 387 |
| 200 | 3300032002 | Ga0307416_100071608 | Ga0307416_1000716082 | 387 |
| 201 | 3300032005 | Ga0307411_10141231 | Ga0307411_101412311 | 387 |
| 202 | 3300032005 | Ga0307411_10238717 | Ga0307411_102387171 | 387 |
| 203 | 3300032126 | Ga0307415_100109801 | Ga0307415_1001098012 | 387 |
| 204 | 3300035119 | Ga0373956_0027534 | Ga0373956_0027534_1211_2404 | 387 |
| 205 | 3300049460 | Ga0495682_0043789 | Ga0495682_0043789_19_1212 | 387 |
| 206 | 3300005329 | Ga0070683_100016119 | Ga0070683_1000161195 | 388 |
| 207 | 3300005331 | Ga0070670_100002362 | Ga0070670_1000023622 | 388 |
| 208 | 3300005334 | Ga0068869_100036357 | Ga0068869_1000363572 | 388 |
| 209 | 3300005338 | Ga0068868_100037335 | Ga0068868_1000373352 | 388 |
| 210 | 3300005344 | Ga0070661_100023770 | Ga0070661_1000237702 | 388 |
| 211 | 3300005355 | Ga0070671_100002623 | Ga0070671_10000262313 | 388 |
| 212 | 3300005367 | Ga0070667_100004122 | Ga0070667_1000041229 | 388 |
| 213 | 3300005530 | Ga0070679_100007052 | Ga0070679_1000070528 | 388 |
| 214 | 3300005535 | Ga0070684_100007590 | Ga0070684_1000075905 | 388 |
| 215 | 3300005535 | Ga0070684_100030399 | Ga0070684_1000303992 | 388 |
| 216 | 3300005535 | Ga0070684_100099288 | Ga0070684_1000992882 | 388 |
| 217 | 3300005539 | Ga0068853_100000147 | Ga0068853_10000014751 | 388 |
| 218 | 3300005539 | Ga0068853_100279180 | Ga0068853_1002791802 | 388 |
| 219 | 3300005563 | Ga0068855_100002303 | Ga0068855_10000230314 | 388 |
| 220 | 3300005564 | Ga0070664_100047843 | Ga0070664_1000478434 | 388 |
| 221 | 3300005577 | Ga0068857_100000669 | Ga0068857_10000066920 | 388 |
| 222 | 3300005578 | Ga0068854_100044111 | Ga0068854_1000441112 | 388 |
| 223 | 3300005614 | Ga0068856_100004416 | Ga0068856_1000044167 | 388 |
| 224 | 3300005616 | Ga0068852_100000412 | Ga0068852_10000041215 | 388 |
| 225 | 3300005616 | Ga0068852_100000504 | Ga0068852_10000050421 | 388 |
| 226 | 3300005617 | Ga0068859_100001120 | Ga0068859_10000112016 | 388 |
| 227 | 3300005618 | Ga0068864_100003371 | Ga0068864_10000337110 | 388 |
| 228 | 3300005834 | Ga0068851_10006828 | Ga0068851_100068282 | 388 |
| 229 | 3300005841 | Ga0068863_100012947 | Ga0068863_1000129475 | 388 |
| 230 | 3300005842 | Ga0068858_100003224 | Ga0068858_1000032249 | 388 |
| 231 | 3300005843 | Ga0068860_100000912 | Ga0068860_1000009124 | 388 |
| 232 | 3300006237 | Ga0097621_100002346 | Ga0097621_10000234611 | 388 |
| 233 | 3300006358 | Ga0068871_100009242 | Ga0068871_1000092425 | 388 |
| 234 | 3300006931 | Ga0097620_100001120 | Ga0097620_10000112012 | 388 |
| 235 | 3300009093 | Ga0105240_10001453 | Ga0105240_1000145311 | 388 |
| 236 | 3300009093 | Ga0105240_10002730 | Ga0105240_1000273013 | 388 |
| 237 | 3300009093 | Ga0105240_10018640 | Ga0105240_100186408 | 388 |
| 238 | 3300009101 | Ga0105247_10011709 | Ga0105247_100117092 | 388 |
| 239 | 3300009174 | Ga0105241_10000610 | Ga0105241_100006105 | 388 |
| 240 | 3300009545 | Ga0105237_10040540 | Ga0105237_100405403 | 388 |
| 241 | 3300009551 | Ga0105238_10000171 | Ga0105238_1000017120 | 388 |
| 242 | 3300009551 | Ga0105238_10001015 | Ga0105238_1000101511 | 388 |
| 243 | 3300009551 | Ga0105238_10090334 | Ga0105238_100903342 | 388 |
| 244 | 3300009551 | Ga0105238_10184060 | Ga0105238_101840602 | 388 |
| 245 | 3300009553 | Ga0105249_10029561 | Ga0105249_100295613 | 388 |
| 246 | 3300010375 | Ga0105239_10001391 | Ga0105239_1000139110 | 388 |
| 247 | 3300013104 | Ga0157370_10001599 | Ga0157370_1000159912 | 388 |
| 248 | 3300013105 | Ga0157369_10001577 | Ga0157369_1000157713 | 388 |
| 249 | 3300013105 | Ga0157369_10027231 | Ga0157369_100272315 | 388 |
| 250 | 3300013296 | Ga0157374_10051375 | Ga0157374_100513754 | 388 |
| 251 | 3300013297 | Ga0157378_10016175 | Ga0157378_100161753 | 388 |
| 252 | 3300013297 | Ga0157378_10021152 | Ga0157378_100211523 | 388 |
| 253 | 3300013307 | Ga0157372_10001952 | Ga0157372_100019527 | 388 |
| 254 | 3300013307 | Ga0157372_10019312 | Ga0157372_100193126 | 388 |
| 255 | 3300014745 | Ga0157377_10053988 | Ga0157377_100539882 | 388 |
| 256 | 3300025900 | Ga0207710_10025303 | Ga0207710_100253032 | 388 |
| 257 | 3300025909 | Ga0207705_10045043 | Ga0207705_100450434 | 388 |
| 258 | 3300025911 | Ga0207654_10000170 | Ga0207654_100001702 | 388 |
| 259 | 3300025911 | Ga0207654_10004565 | Ga0207654_100045657 | 388 |
| 260 | 3300025913 | Ga0207695_10000537 | Ga0207695_1000053778 | 388 |
| 261 | 3300025913 | Ga0207695_10000877 | Ga0207695_1000087733 | 388 |
| 262 | 3300025913 | Ga0207695_10002346 | Ga0207695_1000234612 | 388 |
| 263 | 3300025913 | Ga0207695_10035688 | Ga0207695_100356885 | 388 |
| 264 | 3300025914 | Ga0207671_10001200 | Ga0207671_100012005 | 388 |
| 265 | 3300025914 | Ga0207671_10003815 | Ga0207671_100038155 | 388 |
| 266 | 3300025919 | Ga0207657_10018860 | Ga0207657_100188606 | 388 |
| 267 | 3300025920 | Ga0207649_10014930 | Ga0207649_100149303 | 388 |
| 268 | 3300025921 | Ga0207652_10003180 | Ga0207652_100031803 | 388 |
| 269 | 3300025924 | Ga0207694_10000181 | Ga0207694_1000018111 | 388 |
| 270 | 3300025924 | Ga0207694_10000770 | Ga0207694_1000077018 | 388 |
| 271 | 3300025924 | Ga0207694_10255829 | Ga0207694_102558291 | 388 |
| 272 | 3300025925 | Ga0207650_10028219 | Ga0207650_100282193 | 388 |
| 273 | 3300025927 | Ga0207687_10015053 | Ga0207687_100150531 | 388 |
| 274 | 3300025931 | Ga0207644_10001417 | Ga0207644_100014172 | 388 |
| 275 | 3300025942 | Ga0207689_10002258 | Ga0207689_100022587 | 388 |
| 276 | 3300025944 | Ga0207661_10212321 | Ga0207661_102123212 | 388 |
| 277 | 3300025945 | Ga0207679_10039884 | Ga0207679_100398844 | 388 |
| 278 | 3300025949 | Ga0207667_10002563 | Ga0207667_100025637 | 388 |
| 279 | 3300025981 | Ga0207640_10010714 | Ga0207640_100107146 | 388 |
| 280 | 3300025986 | Ga0207658_10000811 | Ga0207658_100008117 | 388 |
| 281 | 3300026023 | Ga0207677_10000242 | Ga0207677_1000024226 | 388 |
| 282 | 3300026035 | Ga0207703_10004751 | Ga0207703_1000475110 | 388 |
| 283 | 3300026041 | Ga0207639_10000101 | Ga0207639_1000010120 | 388 |
| 284 | 3300026078 | Ga0207702_10002585 | Ga0207702_100025855 | 388 |
| 285 | 3300026078 | Ga0207702_10003045 | Ga0207702_1000304515 | 388 |
| 286 | 3300026088 | Ga0207641_10003995 | Ga0207641_100039959 | 388 |
| 287 | 3300026095 | Ga0207676_10001904 | Ga0207676_100019049 | 388 |
| 288 | 3300026116 | Ga0207674_10001897 | Ga0207674_1000189712 | 388 |
| 289 | 3300026116 | Ga0207674_10006656 | Ga0207674_1000665610 | 388 |
| 290 | 3300026142 | Ga0207698_10000263 | Ga0207698_1000026310 | 388 |
| 291 | 3300026142 | Ga0207698_10000268 | Ga0207698_1000026813 | 388 |
| 292 | 3300028379 | Ga0268266_10222389 | Ga0268266_102223892 | 388 |
| 293 | 3300028381 | Ga0268264_10009127 | Ga0268264_100091274 | 388 |
| 294 | 3300031235 | Ga0265330_10000326 | Ga0265330_1000032625 | 388 |
| 295 | 3300031235 | Ga0265330_10008043 | Ga0265330_100080431 | 388 |
| 296 | 3300031235 | Ga0265330_10052525 | Ga0265330_100525251 | 388 |
| 297 | 3300031239 | Ga0265328_10028521 | Ga0265328_100285211 | 388 |
| 298 | 3300031241 | Ga0265325_10001354 | Ga0265325_1000135413 | 388 |
| 299 | 3300031241 | Ga0265325_10046767 | Ga0265325_100467673 | 388 |
| 300 | 3300031241 | Ga0265325_10062162 | Ga0265325_100621622 | 388 |
| 301 | 3300031247 | Ga0265340_10009915 | Ga0265340_100099152 | 388 |
| 302 | 3300031249 | Ga0265339_10000102 | Ga0265339_1000010257 | 388 |
| 303 | 3300031344 | Ga0265316_10001220 | Ga0265316_1000122023 | 388 |
| 304 | 3300031344 | Ga0265316_10007060 | Ga0265316_100070608 | 388 |
| 305 | 3300031344 | Ga0265316_10035281 | Ga0265316_100352813 | 388 |
| 306 | 3300031344 | Ga0265316_10215886 | Ga0265316_102158861 | 388 |
| 307 | 3300031595 | Ga0265313_10003269 | Ga0265313_1000326912 | 388 |
| 308 | 3300031595 | Ga0265313_10009409 | Ga0265313_100094094 | 388 |
| 309 | 3300031595 | Ga0265313_10025707 | Ga0265313_100257072 | 388 |
| 310 | 3300031711 | Ga0265314_10078225 | Ga0265314_100782252 | 388 |
| 311 | 3300031711 | Ga0265314_10096188 | Ga0265314_100961882 | 388 |
| 312 | 3300031712 | Ga0265342_10001150 | Ga0265342_1000115020 | 388 |
| 313 | 3300031712 | Ga0265342_10003244 | Ga0265342_100032444 | 388 |
| 314 | 3300031712 | Ga0265342_10003727 | Ga0265342_1000372711 | 388 |
| 315 | 3300047472 | Ga0495686_0001113 | Ga0495686_0001113_22332_23510 | 388 |
| 316 | 3300048909 | Ga0496106_0063264 | Ga0496106_0063264_1605_2786 | 388 |
| 317 | 3300048915 | Ga0496112_0126133 | Ga0496112_0126133_979_2160 | 388 |
| 318 | 3300048916 | Ga0496113_0052929 | Ga0496113_0052929_574_1749 | 388 |
| 319 | 3300003320 | rootH2_10068046 | rootH2_100680461 | 389 |
| 320 | 3300003320 | rootH2_10094440 | rootH2_100944401 | 389 |
| 321 | 3300005327 | Ga0070658_10043287 | Ga0070658_100432872 | 389 |
| 322 | 3300005327 | Ga0070658_10084479 | Ga0070658_100844792 | 389 |
| 323 | 3300005329 | Ga0070683_100011254 | Ga0070683_1000112544 | 389 |
| 324 | 3300005339 | Ga0070660_100028337 | Ga0070660_1000283373 | 389 |
| 325 | 3300005344 | Ga0070661_100134909 | Ga0070661_1001349092 | 389 |
| 326 | 3300005366 | Ga0070659_100022223 | Ga0070659_1000222234 | 389 |
| 327 | 3300005455 | Ga0070663_100106270 | Ga0070663_1001062702 | 389 |
| 328 | 3300005455 | Ga0070663_100112998 | Ga0070663_1001129982 | 389 |
| 329 | 3300005458 | Ga0070681_10028029 | Ga0070681_100280292 | 389 |
| 330 | 3300005530 | Ga0070679_100047253 | Ga0070679_1000472532 | 389 |
| 331 | 3300005539 | Ga0068853_100000171 | Ga0068853_10000017142 | 389 |
| 332 | 3300005563 | Ga0068855_100003583 | Ga0068855_1000035832 | 389 |
| 333 | 3300005563 | Ga0068855_100070468 | Ga0068855_1000704684 | 389 |
| 334 | 3300005563 | Ga0068855_100082127 | Ga0068855_1000821272 | 389 |
| 335 | 3300005577 | Ga0068857_100054440 | Ga0068857_1000544404 | 389 |
| 336 | 3300005578 | Ga0068854_100007907 | Ga0068854_1000079079 | 389 |
| 337 | 3300005578 | Ga0068854_100024559 | Ga0068854_1000245592 | 389 |
| 338 | 3300005614 | Ga0068856_100051619 | Ga0068856_1000516193 | 389 |
| 339 | 3300009093 | Ga0105240_10032689 | Ga0105240_100326894 | 389 |
| 340 | 3300009093 | Ga0105240_10037657 | Ga0105240_100376572 | 389 |
| 341 | 3300009093 | Ga0105240_10091617 | Ga0105240_100916172 | 389 |
| 342 | 3300009545 | Ga0105237_10113608 | Ga0105237_101136082 | 389 |
| 343 | 3300009551 | Ga0105238_10018376 | Ga0105238_100183764 | 389 |
| 344 | 3300013102 | Ga0157371_10136127 | Ga0157371_101361272 | 389 |
| 345 | 3300013104 | Ga0157370_10029198 | Ga0157370_100291985 | 389 |
| 346 | 3300013105 | Ga0157369_10025792 | Ga0157369_100257923 | 389 |
| 347 | 3300013105 | Ga0157369_10035283 | Ga0157369_100352834 | 389 |
| 348 | 3300013306 | Ga0163162_10017568 | Ga0163162_100175684 | 389 |
| 349 | 3300013307 | Ga0157372_10009227 | Ga0157372_100092276 | 389 |
| 350 | 3300013307 | Ga0157372_10013111 | Ga0157372_100131117 | 389 |
| 351 | 3300013307 | Ga0157372_10094168 | Ga0157372_100941683 | 389 |
| 352 | 3300013307 | Ga0157372_10137259 | Ga0157372_101372592 | 389 |
| 353 | 3300025261 | Ga0209233_1003838 | Ga0209233_10038385 | 389 |
| 354 | 3300025904 | Ga0207647_10002648 | Ga0207647_100026482 | 389 |
| 355 | 3300025909 | Ga0207705_10010285 | Ga0207705_100102853 | 389 |
| 356 | 3300025909 | Ga0207705_10014420 | Ga0207705_100144203 | 389 |
| 357 | 3300025909 | Ga0207705_10018328 | Ga0207705_100183285 | 389 |
| 358 | 3300025912 | Ga0207707_10040403 | Ga0207707_100404034 | 389 |
| 359 | 3300025913 | Ga0207695_10029311 | Ga0207695_100293112 | 389 |
| 360 | 3300025913 | Ga0207695_10057369 | Ga0207695_100573694 | 389 |
| 361 | 3300025919 | Ga0207657_10008823 | Ga0207657_100088234 | 389 |
| 362 | 3300025919 | Ga0207657_10029486 | Ga0207657_100294864 | 389 |
| 363 | 3300025931 | Ga0207644_10144091 | Ga0207644_101440911 | 389 |
| 364 | 3300025932 | Ga0207690_10076556 | Ga0207690_100765562 | 389 |
| 365 | 3300025949 | Ga0207667_10018922 | Ga0207667_100189229 | 389 |
| 366 | 3300025949 | Ga0207667_10128740 | Ga0207667_101287402 | 389 |
| 367 | 3300025981 | Ga0207640_10000117 | Ga0207640_100001179 | 389 |
| 368 | 3300026041 | Ga0207639_10002332 | Ga0207639_100023324 | 389 |
| 369 | 3300026041 | Ga0207639_10175237 | Ga0207639_101752372 | 389 |
| 370 | 3300026067 | Ga0207678_10006271 | Ga0207678_100062719 | 389 |
| 371 | 3300026067 | Ga0207678_10007842 | Ga0207678_100078424 | 389 |
| 372 | 3300026067 | Ga0207678_10033347 | Ga0207678_100333472 | 389 |
| 373 | 3300026095 | Ga0207676_10159604 | Ga0207676_101596042 | 389 |
| 374 | 3300026116 | Ga0207674_10002204 | Ga0207674_1000220422 | 389 |
| 375 | 3300028379 | Ga0268266_10037935 | Ga0268266_100379353 | 389 |
| 376 | 3300028379 | Ga0268266_10093131 | Ga0268266_100931313 | 389 |
| 377 | 3300028800 | Ga0265338_10006322 | Ga0265338_1000632213 | 389 |
| 378 | 3300031249 | Ga0265339_10002713 | Ga0265339_1000271312 | 389 |
| 379 | 3300031344 | Ga0265316_10028872 | Ga0265316_100288723 | 389 |
| 380 | 3300031595 | Ga0265313_10016220 | Ga0265313_100162202 | 389 |
| 381 | 3300031711 | Ga0265314_10010478 | Ga0265314_100104784 | 389 |
| 382 | 3300031712 | Ga0265342_10033310 | Ga0265342_100333103 | 389 |
| 383 | 3300033180 | Ga0307510_10029551 | Ga0307510_100295515 | 389 |
| 384 | 3300046452 | Ga0495617_056061 | Ga0495617_056061_102_1283 | 389 |
| 385 | 3300046454 | Ga0495592_0196950 | Ga0495592_0196950_10_1206 | 389 |
| 386 | 3300046455 | Ga0495603_0005762 | Ga0495603_0005762_6053_7234 | 389 |
| 387 | 3300046459 | Ga0495629_0006748 | Ga0495629_0006748_2655_3836 | 389 |
| 388 | 3300046462 | Ga0495651_0010087 | Ga0495651_0010087_4412_5593 | 389 |
| 389 | 3300046462 | Ga0495651_0037611 | Ga0495651_0037611_1022_2203 | 389 |
| 390 | 3300046463 | Ga0495653_0001794 | Ga0495653_0001794_15096_16277 | 389 |
| 391 | 3300046472 | Ga0495580_0056552 | Ga0495580_0056552_760_1941 | 389 |
| 392 | 3300046473 | Ga0495582_0004081 | Ga0495582_0004081_6319_7500 | 389 |
| 393 | 3300046474 | Ga0495605_0044647 | Ga0495605_0044647_340_1521 | 389 |
| 394 | 3300046475 | Ga0495639_0001894 | Ga0495639_0001894_3939_5120 | 389 |
| 395 | 3300046477 | Ga0495664_0001180 | Ga0495664_0001180_8688_9869 | 389 |
| 396 | 3300046477 | Ga0495664_0146885 | Ga0495664_0146885_89_1285 | 389 |
| 397 | 3300046492 | Ga0495585_0005391 | Ga0495585_0005391_3638_4819 | 389 |
| 398 | 3300046499 | Ga0495594_0000357 | Ga0495594_0000357_1199_2380 | 389 |
| 399 | 3300046499 | Ga0495594_0001304 | Ga0495594_0001304_476_1657 | 389 |
| 400 | 3300046499 | Ga0495594_0006703 | Ga0495594_0006703_829_2010 | 389 |
| 401 | 3300046500 | Ga0495596_0015901 | Ga0495596_0015901_919_2100 | 389 |
| 402 | 3300046506 | Ga0495583_0022628 | Ga0495583_0022628_890_2074 | 389 |
| 403 | 3300046506 | Ga0495583_0072514 | Ga0495583_0072514_66_1247 | 389 |
| 404 | 3300046514 | Ga0495618_0032463 | Ga0495618_0032463_2076_3257 | 389 |
| 405 | 3300046516 | Ga0495628_0127888 | Ga0495628_0127888_400_1596 | 389 |
| 406 | 3300046518 | Ga0495631_0005469 | Ga0495631_0005469_1571_2752 | 389 |
| 407 | 3300046523 | Ga0495644_0000004 | Ga0495644_0000004_105655_106836 | 389 |
| 408 | 3300046528 | Ga0495642_0047448 | Ga0495642_0047448_500_1681 | 389 |
| 409 | 3300046529 | Ga0495652_0004537 | Ga0495652_0004537_4968_6149 | 389 |
| 410 | 3300046529 | Ga0495652_0054462 | Ga0495652_0054462_611_1807 | 389 |
| 411 | 3300046531 | Ga0495665_0002033 | Ga0495665_0002033_4251_5432 | 389 |
| 412 | 3300046533 | Ga0495640_0009979 | Ga0495640_0009979_5657_6838 | 389 |
| 413 | 3300046535 | Ga0495586_0003036 | Ga0495586_0003036_5371_6552 | 389 |
| 414 | 3300046538 | Ga0495609_0026554 | Ga0495609_0026554_894_2075 | 389 |
| 415 | 3300046558 | Ga0495633_0035845 | Ga0495633_0035845_1121_2302 | 389 |
| 416 | 3300046559 | Ga0495667_0009281 | Ga0495667_0009281_4967_6148 | 389 |
| 417 | 3300046660 | Ga0495625_0008870 | Ga0495625_0008870_2974_4155 | 389 |
| 418 | 3300046663 | Ga0495635_0001143 | Ga0495635_0001143_11338_12519 | 389 |
| 419 | 3300046678 | Ga0495599_0005781 | Ga0495599_0005781_4123_5304 | 389 |
| 420 | 3300046680 | Ga0495646_0015770 | Ga0495646_0015770_476_1657 | 389 |
| 421 | 3300046684 | Ga0495669_0001311 | Ga0495669_0001311_2041_3222 | 389 |
| 422 | 3300046689 | Ga0495613_0008425 | Ga0495613_0008425_2064_3245 | 389 |
| 423 | 3300046690 | Ga0495624_0001490 | Ga0495624_0001490_1861_3042 | 389 |
| 424 | 3300046694 | Ga0495649_0023508 | Ga0495649_0023508_1751_2932 | 389 |
| 425 | 3300046694 | Ga0495649_0052110 | Ga0495649_0052110_937_2121 | 389 |
| 426 | 3300046809 | Ga0495600_0004064 | Ga0495600_0004064_4364_5545 | 389 |
| 427 | 3300047317 | Ga0495604_0019623 | Ga0495604_0019623_1965_3146 | 389 |
| 428 | 3300047317 | Ga0495604_0031403 | Ga0495604_0031403_1126_2322 | 389 |
| 429 | 3300047319 | Ga0495674_0041535 | Ga0495674_0041535_991_2172 | 389 |
| 430 | 3300047321 | Ga0495676_0004397 | Ga0495676_0004397_534_1715 | 389 |
| 431 | 3300047322 | Ga0495680_0013716 | Ga0495680_0013716_4123_5304 | 389 |
| 432 | 3300047444 | Ga0495675_0001672 | Ga0495675_0001672_392_1573 | 389 |
| 433 | 3300047471 | Ga0495684_0010561 | Ga0495684_0010561_4490_5671 | 389 |
| 434 | 3300048089 | Ga0495614_0002636 | Ga0495614_0002636_6191_7372 | 389 |
| 435 | 3300048907 | Ga0496104_0043377 | Ga0496104_0043377_2106_3287 | 389 |
| 436 | 3300048929 | Ga0496126_0000085 | Ga0496126_0000085_53834_55009 | 389 |
| 437 | 3300048929 | Ga0496126_0001139 | Ga0496126_0001139_29672_30853 | 389 |
| 438 | 3300049460 | Ga0495682_0008805 | Ga0495682_0008805_796_1980 | 389 |
| 439 | 3300053119 | Ga0500595_000072 | Ga0500595_000072_1620_2801 | 389 |
| 440 | 3300055283 | Ga0500661_006105 | Ga0500661_006105_27_1208 | 389 |
| 441 | 3300005327 | Ga0070658_10111993 | Ga0070658_101119932 | 390 |
| 442 | 3300005344 | Ga0070661_100196288 | Ga0070661_1001962881 | 390 |
| 443 | 3300005344 | Ga0070661_100232038 | Ga0070661_1002320381 | 390 |
| 444 | 3300005455 | Ga0070663_100039601 | Ga0070663_1000396012 | 390 |
| 445 | 3300005455 | Ga0070663_100208654 | Ga0070663_1002086542 | 390 |
| 446 | 3300005530 | Ga0070679_100230172 | Ga0070679_1002301721 | 390 |
| 447 | 3300005539 | Ga0068853_100136860 | Ga0068853_1001368601 | 390 |
| 448 | 3300005548 | Ga0070665_100005874 | Ga0070665_1000058742 | 390 |
| 449 | 3300005548 | Ga0070665_100013579 | Ga0070665_1000135792 | 390 |
| 450 | 3300005563 | Ga0068855_100041529 | Ga0068855_1000415292 | 390 |
| 451 | 3300005614 | Ga0068856_100045720 | Ga0068856_1000457203 | 390 |
| 452 | 3300005842 | Ga0068858_100228089 | Ga0068858_1002280892 | 390 |
| 453 | 3300009093 | Ga0105240_10009959 | Ga0105240_100099593 | 390 |
| 454 | 3300009174 | Ga0105241_10000033 | Ga0105241_100000339 | 390 |
| 455 | 3300009177 | Ga0105248_10001860 | Ga0105248_1000186018 | 390 |
| 456 | 3300010375 | Ga0105239_10002062 | Ga0105239_1000206223 | 390 |
| 457 | 3300013105 | Ga0157369_10008591 | Ga0157369_100085915 | 390 |
| 458 | 3300013296 | Ga0157374_10095152 | Ga0157374_100951522 | 390 |
| 459 | 3300025909 | Ga0207705_10000109 | Ga0207705_1000010935 | 390 |
| 460 | 3300025911 | Ga0207654_10000368 | Ga0207654_100003689 | 390 |
| 461 | 3300025913 | Ga0207695_10000030 | Ga0207695_10000030222 | 390 |
| 462 | 3300025913 | Ga0207695_10042919 | Ga0207695_100429192 | 390 |
| 463 | 3300025924 | Ga0207694_10003285 | Ga0207694_100032855 | 390 |
| 464 | 3300025941 | Ga0207711_10001374 | Ga0207711_1000137419 | 390 |
| 465 | 3300025944 | Ga0207661_10318683 | Ga0207661_103186832 | 390 |
| 466 | 3300025949 | Ga0207667_10054381 | Ga0207667_100543814 | 390 |
| 467 | 3300026035 | Ga0207703_10174981 | Ga0207703_101749812 | 390 |
| 468 | 3300026067 | Ga0207678_10058947 | Ga0207678_100589471 | 390 |
| 469 | 3300026067 | Ga0207678_10066529 | Ga0207678_100665292 | 390 |
| 470 | 3300028379 | Ga0268266_10004489 | Ga0268266_100044895 | 390 |
| 471 | 3300028379 | Ga0268266_10005457 | Ga0268266_1000545712 | 390 |
| 472 | 3300028379 | Ga0268266_10029772 | Ga0268266_100297722 | 390 |
| 473 | 3300031344 | Ga0265316_10020829 | Ga0265316_100208295 | 390 |
| 474 | 3300031344 | Ga0265316_10066620 | Ga0265316_100666202 | 390 |
| 475 | 3300031344 | Ga0265316_10156160 | Ga0265316_101561602 | 390 |
| 476 | 3300044842 | Ga0466957_0000246 | Ga0466957_0000246_4073_5251 | 390 |
| 477 | 3300046471 | Ga0495650_0006514 | Ga0495650_0006514_2827_4014 | 390 |
| 478 | 3300046660 | Ga0495625_0000166 | Ga0495625_0000166_67943_69130 | 390 |
| 479 | 3300047320 | Ga0495672_0004803 | Ga0495672_0004803_691_1878 | 390 |
| 480 | 3300047472 | Ga0495686_0000006 | Ga0495686_0000006_394943_396121 | 390 |
| 481 | 3300048907 | Ga0496104_0037784 | Ga0496104_0037784_2979_4157 | 390 |
| 482 | 3300048915 | Ga0496112_0090564 | Ga0496112_0090564_1104_2294 | 390 |
| 483 | 3300004800 | Ga0058861_10017042 | Ga0058861_100170422 | 391 |
| 484 | 3300004800 | Ga0058861_11866551 | Ga0058861_118665511 | 391 |
| 485 | 3300005329 | Ga0070683_100008847 | Ga0070683_1000088477 | 391 |
| 486 | 3300005336 | Ga0070680_100051139 | Ga0070680_1000511393 | 391 |
| 487 | 3300005434 | Ga0070709_10011575 | Ga0070709_100115754 | 391 |
| 488 | 3300005435 | Ga0070714_100027044 | Ga0070714_1000270441 | 391 |
| 489 | 3300005436 | Ga0070713_100079146 | Ga0070713_1000791462 | 391 |
| 490 | 3300005436 | Ga0070713_100136215 | Ga0070713_1001362152 | 391 |
| 491 | 3300005458 | Ga0070681_10017910 | Ga0070681_100179107 | 391 |
| 492 | 3300005458 | Ga0070681_10079022 | Ga0070681_100790222 | 391 |
| 493 | 3300005530 | Ga0070679_100080520 | Ga0070679_1000805202 | 391 |
| 494 | 3300005535 | Ga0070684_100219988 | Ga0070684_1002199882 | 391 |
| 495 | 3300005535 | Ga0070684_100333490 | Ga0070684_1003334901 | 391 |
| 496 | 3300005539 | Ga0068853_100095012 | Ga0068853_1000950122 | 391 |
| 497 | 3300005563 | Ga0068855_100038938 | Ga0068855_1000389381 | 391 |
| 498 | 3300005614 | Ga0068856_100055512 | Ga0068856_1000555122 | 391 |
| 499 | 3300005834 | Ga0068851_10007193 | Ga0068851_100071932 | 391 |
| 500 | 3300006028 | Ga0070717_10037951 | Ga0070717_100379513 | 391 |
| 501 | 3300006028 | Ga0070717_10110496 | Ga0070717_101104961 | 391 |
| 502 | 3300006028 | Ga0070717_10218511 | Ga0070717_102185112 | 391 |
| 503 | 3300006163 | Ga0070715_10083686 | Ga0070715_100836862 | 391 |
| 504 | 3300006175 | Ga0070712_100163011 | Ga0070712_1001630112 | 391 |
| 505 | 3300009098 | Ga0105245_10004986 | Ga0105245_100049867 | 391 |
| 506 | 3300009098 | Ga0105245_10021278 | Ga0105245_100212782 | 391 |
| 507 | 3300009174 | Ga0105241_10160384 | Ga0105241_101603842 | 391 |
| 508 | 3300013104 | Ga0157370_10019860 | Ga0157370_100198602 | 391 |
| 509 | 3300013297 | Ga0157378_10014964 | Ga0157378_100149644 | 391 |
| 510 | 3300025909 | Ga0207705_10026073 | Ga0207705_100260732 | 391 |
| 511 | 3300025912 | Ga0207707_10008391 | Ga0207707_100083917 | 391 |
| 512 | 3300025912 | Ga0207707_10090706 | Ga0207707_100907062 | 391 |
| 513 | 3300025913 | Ga0207695_10118840 | Ga0207695_101188402 | 391 |
| 514 | 3300025914 | Ga0207671_10090486 | Ga0207671_100904863 | 391 |
| 515 | 3300025916 | Ga0207663_10206835 | Ga0207663_102068352 | 391 |
| 516 | 3300025917 | Ga0207660_10001656 | Ga0207660_1000165613 | 391 |
| 517 | 3300025917 | Ga0207660_10046231 | Ga0207660_100462312 | 391 |
| 518 | 3300025921 | Ga0207652_10013893 | Ga0207652_100138935 | 391 |
| 519 | 3300025924 | Ga0207694_10084492 | Ga0207694_100844922 | 391 |
| 520 | 3300025927 | Ga0207687_10002934 | Ga0207687_100029349 | 391 |
| 521 | 3300025927 | Ga0207687_10027666 | Ga0207687_100276663 | 391 |
| 522 | 3300025928 | Ga0207700_10021436 | Ga0207700_100214362 | 391 |
| 523 | 3300025928 | Ga0207700_10137812 | Ga0207700_101378121 | 391 |
| 524 | 3300025929 | Ga0207664_10062067 | Ga0207664_100620671 | 391 |
| 525 | 3300025939 | Ga0207665_10015038 | Ga0207665_100150383 | 391 |
| 526 | 3300025949 | Ga0207667_10011761 | Ga0207667_100117619 | 391 |
| 527 | 3300025949 | Ga0207667_10151770 | Ga0207667_101517702 | 391 |
| 528 | 3300026078 | Ga0207702_10047255 | Ga0207702_100472552 | 391 |
| 529 | 3300035172 | Ga0373955_0014400 | Ga0373955_0014400_2236_3465 | 391 |
| 530 | 3300035410 | Ga0373924_0003464 | Ga0373924_0003464_2149_3330 | 391 |
| 531 | 3300036401 | Ga0373937_0000026 | Ga0373937_0000026_119789_120970 | 391 |
| 532 | 3300036401 | Ga0373937_0039864 | Ga0373937_0039864_1557_2738 | 391 |
| 533 | 3300046462 | Ga0495651_0071104 | Ga0495651_0071104_1362_2546 | 391 |
| 534 | 3300046529 | Ga0495652_0098395 | Ga0495652_0098395_220_1401 | 391 |
| 535 | 3300046679 | Ga0495623_0016828 | Ga0495623_0016828_481_1662 | 391 |
| 536 | 3300047317 | Ga0495604_0033274 | Ga0495604_0033274_1464_2648 | 391 |
| 537 | 3300047322 | Ga0495680_0153254 | Ga0495680_0153254_398_1582 | 391 |
| 538 | 3300048905 | Ga0496102_0043116 | Ga0496102_0043116_1210_2391 | 391 |
| 539 | 3300048905 | Ga0496102_0053501 | Ga0496102_0053501_1034_2215 | 391 |
| 540 | 3300048908 | Ga0496105_0020835 | Ga0496105_0020835_2327_3508 | 391 |
| 541 | 3300048913 | Ga0496110_0019179 | Ga0496110_0019179_1698_2927 | 391 |
| 542 | 3300048914 | Ga0496111_0006043 | Ga0496111_0006043_3249_4478 | 391 |
| 543 | 3300048915 | Ga0496112_0165147 | Ga0496112_0165147_391_1572 | 391 |
| 544 | 3300048918 | Ga0496115_0040201 | Ga0496115_0040201_1267_2448 | 391 |
| 545 | 3300005436 | Ga0070713_100009940 | Ga0070713_1000099403 | 392 |
| 546 | 3300005458 | Ga0070681_10002482 | Ga0070681_100024823 | 392 |
| 547 | 3300005467 | Ga0070706_100015082 | Ga0070706_1000150824 | 392 |
| 548 | 3300005530 | Ga0070679_100362850 | Ga0070679_1003628502 | 392 |
| 549 | 3300005546 | Ga0070696_100044588 | Ga0070696_1000445883 | 392 |
| 550 | 3300005614 | Ga0068856_100116911 | Ga0068856_1001169112 | 392 |
| 551 | 3300006173 | Ga0070716_100022165 | Ga0070716_1000221654 | 392 |
| 552 | 3300013307 | Ga0157372_10032120 | Ga0157372_100321205 | 392 |
| 553 | 3300013307 | Ga0157372_10034128 | Ga0157372_100341285 | 392 |
| 554 | 3300014969 | Ga0157376_10026382 | Ga0157376_100263824 | 392 |
| 555 | 3300025912 | Ga0207707_10007291 | Ga0207707_100072913 | 392 |
| 556 | 3300025915 | Ga0207693_10095344 | Ga0207693_100953442 | 392 |
| 557 | 3300025939 | Ga0207665_10022030 | Ga0207665_100220304 | 392 |
| 558 | 3300028800 | Ga0265338_10138839 | Ga0265338_101388392 | 392 |
| 559 | 3300030760 | Ga0265762_1001427 | Ga0265762_10014274 | 392 |
| 560 | 3300031241 | Ga0265325_10080949 | Ga0265325_100809491 | 392 |
| 561 | 3300031247 | Ga0265340_10017929 | Ga0265340_100179292 | 392 |
| 562 | 3300031249 | Ga0265339_10030492 | Ga0265339_100304924 | 392 |
| 563 | 3300031344 | Ga0265316_10037065 | Ga0265316_100370653 | 392 |
| 564 | 3300031711 | Ga0265314_10027560 | Ga0265314_100275605 | 392 |
| 565 | 3300035111 | Ga0373923_0000400 | Ga0373923_0000400_4140_5333 | 392 |
| 566 | 3300035170 | Ga0373943_0002431 | Ga0373943_0002431_2262_3455 | 392 |
| 567 | 3300035171 | Ga0373946_0008745 | Ga0373946_0008745_1023_2216 | 392 |
| 568 | 3300035692 | Ga0373935_0003446 | Ga0373935_0003446_3122_4315 | 392 |
| 569 | 3300035695 | Ga0373927_0001136 | Ga0373927_0001136_13926_15119 | 392 |
| 570 | 3300035725 | Ga0373947_0001191 | Ga0373947_0001191_5159_6352 | 392 |
| 571 | 3300037068 | Ga0373925_0002873 | Ga0373925_0002873_6919_8112 | 392 |
| 572 | 3300046477 | Ga0495664_0049978 | Ga0495664_0049978_696_1889 | 392 |
| 573 | 3300048088 | Ga0495602_0110587 | Ga0495602_0110587_255_1448 | 392 |
| 574 | 3300005329 | Ga0070683_100016484 | Ga0070683_1000164847 | 393 |
| 575 | 3300005330 | Ga0070690_100179765 | Ga0070690_1001797651 | 393 |
| 576 | 3300005334 | Ga0068869_100000542 | Ga0068869_10000054212 | 393 |
| 577 | 3300005335 | Ga0070666_10030360 | Ga0070666_100303603 | 393 |
| 578 | 3300005337 | Ga0070682_100004949 | Ga0070682_1000049499 | 393 |
| 579 | 3300005338 | Ga0068868_100022813 | Ga0068868_1000228133 | 393 |
| 580 | 3300005338 | Ga0068868_100033347 | Ga0068868_1000333473 | 393 |
| 581 | 3300005339 | Ga0070660_100165607 | Ga0070660_1001656072 | 393 |
| 582 | 3300005347 | Ga0070668_100013597 | Ga0070668_1000135972 | 393 |
| 583 | 3300005353 | Ga0070669_100018825 | Ga0070669_1000188253 | 393 |
| 584 | 3300005365 | Ga0070688_100042224 | Ga0070688_1000422244 | 393 |
| 585 | 3300005367 | Ga0070667_100003372 | Ga0070667_1000033722 | 393 |
| 586 | 3300005434 | Ga0070709_10007651 | Ga0070709_100076513 | 393 |
| 587 | 3300005434 | Ga0070709_10046108 | Ga0070709_100461082 | 393 |
| 588 | 3300005436 | Ga0070713_100139726 | Ga0070713_1001397262 | 393 |
| 589 | 3300005437 | Ga0070710_10079688 | Ga0070710_100796882 | 393 |
| 590 | 3300005439 | Ga0070711_100000329 | Ga0070711_10000032914 | 393 |
| 591 | 3300005439 | Ga0070711_100013406 | Ga0070711_1000134064 | 393 |
| 592 | 3300005444 | Ga0070694_100071292 | Ga0070694_1000712922 | 393 |
| 593 | 3300005445 | Ga0070708_100016619 | Ga0070708_1000166196 | 393 |
| 594 | 3300005457 | Ga0070662_100004573 | Ga0070662_1000045735 | 393 |
| 595 | 3300005467 | Ga0070706_100000812 | Ga0070706_1000008129 | 393 |
| 596 | 3300005530 | Ga0070679_100125739 | Ga0070679_1001257393 | 393 |
| 597 | 3300005535 | Ga0070684_100093793 | Ga0070684_1000937931 | 393 |
| 598 | 3300005536 | Ga0070697_100000249 | Ga0070697_10000024938 | 393 |
| 599 | 3300005539 | Ga0068853_100092034 | Ga0068853_1000920342 | 393 |
| 600 | 3300005546 | Ga0070696_100072974 | Ga0070696_1000729742 | 393 |
| 601 | 3300005547 | Ga0070693_100005275 | Ga0070693_1000052753 | 393 |
| 602 | 3300005548 | Ga0070665_100093520 | Ga0070665_1000935203 | 393 |
| 603 | 3300005564 | Ga0070664_100154047 | Ga0070664_1001540472 | 393 |
| 604 | 3300005578 | Ga0068854_100011881 | Ga0068854_1000118816 | 393 |
| 605 | 3300005614 | Ga0068856_100016810 | Ga0068856_1000168101 | 393 |
| 606 | 3300005617 | Ga0068859_100009906 | Ga0068859_1000099064 | 393 |
| 607 | 3300005718 | Ga0068866_10009206 | Ga0068866_100092063 | 393 |
| 608 | 3300005718 | Ga0068866_10018591 | Ga0068866_100185911 | 393 |
| 609 | 3300005834 | Ga0068851_10044337 | Ga0068851_100443371 | 393 |
| 610 | 3300005841 | Ga0068863_100127776 | Ga0068863_1001277763 | 393 |
| 611 | 3300005841 | Ga0068863_100139679 | Ga0068863_1001396792 | 393 |
| 612 | 3300005842 | Ga0068858_100003511 | Ga0068858_10000351114 | 393 |
| 613 | 3300005842 | Ga0068858_100022048 | Ga0068858_1000220488 | 393 |
| 614 | 3300005842 | Ga0068858_100061276 | Ga0068858_1000612764 | 393 |
| 615 | 3300005843 | Ga0068860_100204042 | Ga0068860_1002040422 | 393 |
| 616 | 3300005843 | Ga0068860_100207077 | Ga0068860_1002070772 | 393 |
| 617 | 3300006175 | Ga0070712_100000542 | Ga0070712_10000054211 | 393 |
| 618 | 3300006175 | Ga0070712_100004232 | Ga0070712_1000042325 | 393 |
| 619 | 3300006175 | Ga0070712_100190118 | Ga0070712_1001901182 | 393 |
| 620 | 3300006237 | Ga0097621_100000506 | Ga0097621_1000005069 | 393 |
| 621 | 3300006237 | Ga0097621_100064758 | Ga0097621_1000647583 | 393 |
| 622 | 3300006358 | Ga0068871_100000685 | Ga0068871_10000068524 | 393 |
| 623 | 3300006871 | Ga0075434_100000462 | Ga0075434_10000046212 | 393 |
| 624 | 3300006881 | Ga0068865_100018799 | Ga0068865_1000187991 | 393 |
| 625 | 3300006931 | Ga0097620_100009906 | Ga0097620_10000990611 | 393 |
| 626 | 3300009098 | Ga0105245_10001352 | Ga0105245_1000135218 | 393 |
| 627 | 3300009176 | Ga0105242_10015637 | Ga0105242_100156378 | 393 |
| 628 | 3300009176 | Ga0105242_10025092 | Ga0105242_100250927 | 393 |
| 629 | 3300009177 | Ga0105248_10013722 | Ga0105248_1001372210 | 393 |
| 630 | 3300009177 | Ga0105248_10015854 | Ga0105248_100158542 | 393 |
| 631 | 3300009177 | Ga0105248_10084006 | Ga0105248_100840062 | 393 |
| 632 | 3300009545 | Ga0105237_10057694 | Ga0105237_100576944 | 393 |
| 633 | 3300010375 | Ga0105239_10027569 | Ga0105239_100275698 | 393 |
| 634 | 3300010375 | Ga0105239_10128150 | Ga0105239_101281503 | 393 |
| 635 | 3300013102 | Ga0157371_10014469 | Ga0157371_100144692 | 393 |
| 636 | 3300013105 | Ga0157369_10344464 | Ga0157369_103444642 | 393 |
| 637 | 3300013296 | Ga0157374_10013713 | Ga0157374_100137133 | 393 |
| 638 | 3300013296 | Ga0157374_10068623 | Ga0157374_100686234 | 393 |
| 639 | 3300013297 | Ga0157378_10001393 | Ga0157378_1000139313 | 393 |
| 640 | 3300013306 | Ga0163162_10012200 | Ga0163162_100122009 | 393 |
| 641 | 3300013306 | Ga0163162_10055621 | Ga0163162_100556216 | 393 |
| 642 | 3300013306 | Ga0163162_10101803 | Ga0163162_101018033 | 393 |
| 643 | 3300013308 | Ga0157375_10028952 | Ga0157375_100289523 | 393 |
| 644 | 3300013308 | Ga0157375_10086717 | Ga0157375_100867173 | 393 |
| 645 | 3300014968 | Ga0157379_10003129 | Ga0157379_1000312913 | 393 |
| 646 | 3300014968 | Ga0157379_10016355 | Ga0157379_100163551 | 393 |
| 647 | 3300014969 | Ga0157376_10121320 | Ga0157376_101213202 | 393 |
| 648 | 3300025899 | Ga0207642_10004067 | Ga0207642_100040674 | 393 |
| 649 | 3300025904 | Ga0207647_10052836 | Ga0207647_100528362 | 393 |
| 650 | 3300025906 | Ga0207699_10031017 | Ga0207699_100310173 | 393 |
| 651 | 3300025907 | Ga0207645_10004353 | Ga0207645_1000435312 | 393 |
| 652 | 3300025910 | Ga0207684_10003231 | Ga0207684_100032313 | 393 |
| 653 | 3300025911 | Ga0207654_10023847 | Ga0207654_100238472 | 393 |
| 654 | 3300025912 | Ga0207707_10035364 | Ga0207707_100353641 | 393 |
| 655 | 3300025913 | Ga0207695_10007527 | Ga0207695_100075277 | 393 |
| 656 | 3300025915 | Ga0207693_10002043 | Ga0207693_1000204318 | 393 |
| 657 | 3300025915 | Ga0207693_10002423 | Ga0207693_1000242311 | 393 |
| 658 | 3300025915 | Ga0207693_10013373 | Ga0207693_100133732 | 393 |
| 659 | 3300025916 | Ga0207663_10002606 | Ga0207663_100026064 | 393 |
| 660 | 3300025919 | Ga0207657_10013367 | Ga0207657_100133674 | 393 |
| 661 | 3300025920 | Ga0207649_10008695 | Ga0207649_100086954 | 393 |
| 662 | 3300025923 | Ga0207681_10014471 | Ga0207681_100144713 | 393 |
| 663 | 3300025927 | Ga0207687_10014922 | Ga0207687_100149224 | 393 |
| 664 | 3300025928 | Ga0207700_10097129 | Ga0207700_100971291 | 393 |
| 665 | 3300025933 | Ga0207706_10002992 | Ga0207706_100029924 | 393 |
| 666 | 3300025934 | Ga0207686_10086697 | Ga0207686_100866972 | 393 |
| 667 | 3300025936 | Ga0207670_10197072 | Ga0207670_101970721 | 393 |
| 668 | 3300025939 | Ga0207665_10001047 | Ga0207665_100010479 | 393 |
| 669 | 3300025939 | Ga0207665_10019410 | Ga0207665_100194104 | 393 |
| 670 | 3300025939 | Ga0207665_10019955 | Ga0207665_100199554 | 393 |
| 671 | 3300025941 | Ga0207711_10002201 | Ga0207711_100022017 | 393 |
| 672 | 3300025941 | Ga0207711_10008188 | Ga0207711_100081882 | 393 |
| 673 | 3300025942 | Ga0207689_10003567 | Ga0207689_1000356710 | 393 |
| 674 | 3300025942 | Ga0207689_10173260 | Ga0207689_101732601 | 393 |
| 675 | 3300025972 | Ga0207668_10115605 | Ga0207668_101156053 | 393 |
| 676 | 3300026023 | Ga0207677_10136446 | Ga0207677_101364462 | 393 |
| 677 | 3300026035 | Ga0207703_10004444 | Ga0207703_100044446 | 393 |
| 678 | 3300026067 | Ga0207678_10140921 | Ga0207678_101409211 | 393 |
| 679 | 3300026075 | Ga0207708_10042782 | Ga0207708_100427822 | 393 |
| 680 | 3300026078 | Ga0207702_10202213 | Ga0207702_102022132 | 393 |
| 681 | 3300026089 | Ga0207648_10028723 | Ga0207648_100287237 | 393 |
| 682 | 3300026095 | Ga0207676_10171322 | Ga0207676_101713223 | 393 |
| 683 | 3300026116 | Ga0207674_10063620 | Ga0207674_100636202 | 393 |
| 684 | 3300026121 | Ga0207683_10108455 | Ga0207683_101084553 | 393 |
| 685 | 3300026142 | Ga0207698_10277198 | Ga0207698_102771981 | 393 |
| 686 | 3300028381 | Ga0268264_10025603 | Ga0268264_100256032 | 393 |
| 687 | 3300028800 | Ga0265338_10143980 | Ga0265338_101439801 | 393 |
| 688 | 3300035691 | Ga0373931_0036652 | Ga0373931_0036652_659_1855 | 393 |
| 689 | 3300035691 | Ga0373931_0107634 | Ga0373931_0107634_62_1327 | 393 |
| 690 | 3300046472 | Ga0495580_0003126 | Ga0495580_0003126_2381_3571 | 393 |
| 691 | 3300046491 | Ga0495584_0072575 | Ga0495584_0072575_323_1513 | 393 |
| 692 | 3300048903 | Ga0496100_0105718 | Ga0496100_0105718_519_1784 | 393 |
| 693 | 3300048905 | Ga0496102_0001003 | Ga0496102_0001003_17297_18562 | 393 |
| 694 | 3300048905 | Ga0496102_0331617 | Ga0496102_0331617_153_1349 | 393 |
| 695 | 3300048906 | Ga0496103_0012752 | Ga0496103_0012752_1759_3024 | 393 |
| 696 | 3300048907 | Ga0496104_0002870 | Ga0496104_0002870_3968_5233 | 393 |
| 697 | 3300048908 | Ga0496105_0067449 | Ga0496105_0067449_148_1413 | 393 |
| 698 | 3300048909 | Ga0496106_0036829 | Ga0496106_0036829_195_1460 | 393 |
| 699 | 3300048910 | Ga0496107_0088373 | Ga0496107_0088373_14_1279 | 393 |
| 700 | 3300048910 | Ga0496107_0209514 | Ga0496107_0209514_115_1311 | 393 |
| 701 | 3300048912 | Ga0496109_0258142 | Ga0496109_0258142_333_1529 | 393 |
| 702 | 3300048915 | Ga0496112_0077201 | Ga0496112_0077201_1644_2843 | 393 |
| 703 | 3300048915 | Ga0496112_0095614 | Ga0496112_0095614_128_1327 | 393 |
| 704 | 3300050512 | nmdc:mga0n895_1746_c1 | nmdc:mga0n895_1746_c1_6241_7431 | 393 |
| 705 | 3300005445 | Ga0070708_100000517 | Ga0070708_1000005173 | 394 |
| 706 | 3300005467 | Ga0070706_100001116 | Ga0070706_10000111623 | 394 |
| 707 | 3300005468 | Ga0070707_100001183 | Ga0070707_10000118318 | 394 |
| 708 | 3300005471 | Ga0070698_100002344 | Ga0070698_10000234419 | 394 |
| 709 | 3300005518 | Ga0070699_100011614 | Ga0070699_1000116148 | 394 |
| 710 | 3300005536 | Ga0070697_100000427 | Ga0070697_10000042729 | 394 |
| 711 | 3300005536 | Ga0070697_100012885 | Ga0070697_1000128853 | 394 |
| 712 | 3300025910 | Ga0207684_10001380 | Ga0207684_100013802 | 394 |
| 713 | 3300025922 | Ga0207646_10001576 | Ga0207646_1000157613 | 394 |
| 714 | 3300025922 | Ga0207646_10140424 | Ga0207646_101404243 | 394 |
| 715 | 3300030878 | Ga0265770_1002352 | Ga0265770_10023522 | 394 |
| 716 | 3300031090 | Ga0265760_10000557 | Ga0265760_100005574 | 394 |
| 717 | 3300049744 | Ga0501083_0132819 | Ga0501083_0132819_39_1229 | 394 |
| 718 | 3300005468 | Ga0070707_100078536 | Ga0070707_1000785362 | 395 |
| 719 | 3300005536 | Ga0070697_100000742 | Ga0070697_10000074217 | 395 |
| 720 | 3300025922 | Ga0207646_10055989 | Ga0207646_100559891 | 395 |
| 721 | 3300009148 | Ga0105243_10100540 | Ga0105243_101005402 | 398 |
| 722 | 3300009177 | Ga0105248_10000007 | Ga0105248_10000007334 | 398 |
| 723 | 3300013104 | Ga0157370_10112141 | Ga0157370_101121412 | 398 |
| 724 | 3300013105 | Ga0157369_10103066 | Ga0157369_101030661 | 398 |
| 725 | 3300014969 | Ga0157376_10034553 | Ga0157376_100345532 | 398 |
| 726 | 3300021361 | Ga0213872_10002468 | Ga0213872_100024686 | 398 |
| 727 | 3300021361 | Ga0213872_10010255 | Ga0213872_100102554 | 398 |
| 728 | 3300025941 | Ga0207711_10000014 | Ga0207711_1000001480 | 398 |
| 729 | 3300028379 | Ga0268266_10104052 | Ga0268266_101040523 | 398 |
| 730 | 3300028379 | Ga0268266_10124935 | Ga0268266_101249352 | 398 |
| 731 | 3300039447 | Ga0436361_0224127 | Ga0436361_0224127_68_1282 | 398 |
| 732 | 3300039447 | Ga0436361_0608005 | Ga0436361_0608005_9233_10447 | 398 |
| 733 | 3300039447 | Ga0436361_0652690 | Ga0436361_0652690_10540_11754 | 398 |
| 734 | 3300039447 | Ga0436361_1068732 | Ga0436361_1068732_2293_3507 | 398 |
| 735 | 3300053088 | Ga0500644_0044987 | Ga0500644_0044987_104_1357 | 398 |
| 736 | 3300009545 | Ga0105237_10115554 | Ga0105237_101155543 | 399 |
| 737 | 3300009551 | Ga0105238_10108641 | Ga0105238_101086412 | 399 |
| 738 | 3300025924 | Ga0207694_10022226 | Ga0207694_100222265 | 399 |
| 739 | 3300025929 | Ga0207664_10020299 | Ga0207664_100202992 | 399 |
| 740 | 3300026035 | Ga0207703_10089156 | Ga0207703_100891562 | 399 |
| 741 | 3300000546 | LJNas_1000825 | LJNas_10008255 | 400 |
| 742 | 3300003320 | rootH2_10044833 | rootH2_100448332 | 400 |
| 743 | 3300005548 | Ga0070665_100166554 | Ga0070665_1001665542 | 400 |
| 744 | 3300005563 | Ga0068855_100007405 | Ga0068855_10000740510 | 400 |
| 745 | 3300005563 | Ga0068855_100221912 | Ga0068855_1002219122 | 400 |
| 746 | 3300005577 | Ga0068857_100309096 | Ga0068857_1003090961 | 400 |
| 747 | 3300005616 | Ga0068852_100024794 | Ga0068852_1000247943 | 400 |
| 748 | 3300005834 | Ga0068851_10058756 | Ga0068851_100587562 | 400 |
| 749 | 3300013104 | Ga0157370_10284069 | Ga0157370_102840691 | 400 |
| 750 | 3300013105 | Ga0157369_10104359 | Ga0157369_101043592 | 400 |
| 751 | 3300013307 | Ga0157372_10016926 | Ga0157372_100169265 | 400 |
| 752 | 3300025904 | Ga0207647_10001991 | Ga0207647_100019919 | 400 |
| 753 | 3300025909 | Ga0207705_10052030 | Ga0207705_100520302 | 400 |
| 754 | 3300025919 | Ga0207657_10073616 | Ga0207657_100736162 | 400 |
| 755 | 3300025932 | Ga0207690_10086668 | Ga0207690_100866682 | 400 |
| 756 | 3300025949 | Ga0207667_10003145 | Ga0207667_100031457 | 400 |
| 757 | 3300026142 | Ga0207698_10012627 | Ga0207698_100126273 | 400 |
| 758 | 3300028379 | Ga0268266_10248366 | Ga0268266_102483662 | 400 |
| 759 | 3300048929 | Ga0496126_0009231 | Ga0496126_0009231_3065_4267 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.9518 | 6 | 365 |
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.9412 | 6 | 365 |
| 3f0h-assembly1.cif.gz_A-2 | crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution | 0.9382 | 5 | 367 |
| 2dr1-assembly1.cif.gz_B | crystal structure of the ph1308 protein from pyrococcus horikoshii ot3 | 0.9372 | 4 | 371 |
| 3f0h-assembly1.cif.gz_A-2 | crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution | 0.9208 | 5 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXK2_10_249_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9623 | 10 | 244 | 3.40.640.10 |
| af_A0A1D6KIG3_10_230_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9619 | 19 | 225 | 3.40.640.10 |
| af_Q58369_38_263_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9576 | 36 | 254 | 3.40.640.10 |
| af_B6T171_24_270_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9569 | 19 | 254 | 3.40.640.10 |
| 2dr1B02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9506 | 16 | 258 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N9GKV6-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.982 | 10 | 112 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A1D2UES3-F1-model_v4 | L-aspartate aminotransferase / phosphoserine aminotransferase | 0.9805 | 1 | 394 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A1D2UES3-F1-model_v4 | L-aspartate aminotransferase / phosphoserine aminotransferase | 0.9708 | 1 | 394 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A804LT04-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9706 | 8 | 225 |
GO:0008483
|
| AF-A0A7C2KHR0-F1-model_v4 | Alanine--glyoxylate aminotransferase family protein | 0.9683 | 4 | 214 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar