F479437
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 758 | 290 | 1516 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300005834|Ga0068851_10005910|Ga0068851_1000591010 |
| Length | 271 |
| Sequence | MKVIIPVKKILSFGCSNYFMNSHMLYASAILGAMKFRALQENLRKALWERIEEGELTGLRLARETGFKQAHISNFLNRKRGLSVEGMDKVLNVQHLSILDLLDPGEINKRASITPPSDDQFENVLLVQGAVAARQPLIMSMKVKDILKFKKTFLRRLRSEMEGDRERWERFVIIRADGREGMSMYPRLLPGATVLIDRHYNSLKPYRKGESNMYAVARDGGCTVKYVEVAGNHLVLRPHNQAYPVEVMAMEPGKKVHDYLIGRICYVGIET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 124 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 125 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 190 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 1.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.15 |
| Rhizosphere | 94.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068851_10005910 | 3300005834 | Bacteria | 5572 |
| 2 | MBSR1b_contig_2440585 | 2162886012 | Unclassified | 1023 |
| 3 | LJNas_1000061 | 3300000546 | Bacteria | 14680 |
| 4 | JGI24752J21851_1002601 | 3300001976 | Unclassified | 2402 |
| 5 | JGI24752J21851_1010591 | 3300001976 | Unclassified | 1202 |
| 6 | JGI24737J22298_10035794 | 3300001990 | Unclassified | 1535 |
| 7 | JGI24743J22301_10003615 | 3300001991 | Unclassified | 2460 |
| 8 | JGI24749J21850_1011357 | 3300002076 | Unclassified | 1250 |
| 9 | JGI24034J26672_10002033 | 3300002239 | Unclassified | 2744 |
| 10 | JGI24751J29686_10009293 | 3300002459 | Unclassified | 2018 |
| 11 | rootH1_10241807 | 3300003323 | Bacteria | 1486 |
| 12 | Ga0065704_10212625 | 3300005289 | Unclassified | 1103 |
| 13 | Ga0065712_10103109 | 3300005290 | Bacteria | 1992 |
| 14 | Ga0065715_10002873 | 3300005293 | Bacteria | 5095 |
| 15 | Ga0065715_10042721 | 3300005293 | Unclassified | 1022 |
| 16 | Ga0065715_10167537 | 3300005293 | Bacteria | 1574 |
| 17 | Ga0070658_10032446 | 3300005327 | Unclassified | 4198 |
| 18 | Ga0070658_10050888 | 3300005327 | Unclassified | 3358 |
| 19 | Ga0070658_10484135 | 3300005327 | Bacteria | 1068 |
| 20 | Ga0070676_10022196 | 3300005328 | Unclassified | 3558 |
| 21 | Ga0070676_10033075 | 3300005328 | Bacteria | 2965 |
| 22 | Ga0070683_100003207 | 3300005329 | Bacteria | 13205 |
| 23 | Ga0070683_100020247 | 3300005329 | Bacteria | 5919 |
| 24 | Ga0070683_100265152 | 3300005329 | Bacteria | 1634 |
| 25 | Ga0070690_100006515 | 3300005330 | Bacteria | 6624 |
| 26 | Ga0070690_100025748 | 3300005330 | Unclassified | 3623 |
| 27 | Ga0070670_100098393 | 3300005331 | Bacteria | 2517 |
| 28 | Ga0070670_100161096 | 3300005331 | Unclassified | 1944 |
| 29 | Ga0070677_10004840 | 3300005333 | Bacteria | 4418 |
| 30 | Ga0070666_10022479 | 3300005335 | Bacteria | 4094 |
| 31 | Ga0070680_100022024 | 3300005336 | Bacteria | 5069 |
| 32 | Ga0070682_100008804 | 3300005337 | Bacteria | 5697 |
| 33 | Ga0070682_100020364 | 3300005337 | Unclassified | 3902 |
| 34 | Ga0068868_100015706 | 3300005338 | Bacteria | 5608 |
| 35 | Ga0068868_100022154 | 3300005338 | Unclassified | 4792 |
| 36 | Ga0068868_100264850 | 3300005338 | Bacteria | 1451 |
| 37 | Ga0068868_100523575 | 3300005338 | Unclassified | 1041 |
| 38 | Ga0070660_100007722 | 3300005339 | Bacteria | 7500 |
| 39 | Ga0070660_100010443 | 3300005339 | Bacteria | 6562 |
| 40 | Ga0070660_100011778 | 3300005339 | Bacteria | 6228 |
| 41 | Ga0070689_100021775 | 3300005340 | Unclassified | 4777 |
| 42 | Ga0070661_100013761 | 3300005344 | Bacteria | 5682 |
| 43 | Ga0070668_100011552 | 3300005347 | Bacteria | 6573 |
| 44 | Ga0070668_100012680 | 3300005347 | Bacteria | 6274 |
| 45 | Ga0070668_100722252 | 3300005347 | Unclassified | 880 |
| 46 | Ga0070669_100004020 | 3300005353 | Bacteria | 10635 |
| 47 | Ga0070675_100006644 | 3300005354 | Bacteria | 8893 |
| 48 | Ga0070671_100041823 | 3300005355 | Unclassified | 3809 |
| 49 | Ga0070674_100017358 | 3300005356 | Unclassified | 4525 |
| 50 | Ga0070674_100223904 | 3300005356 | Bacteria | 1465 |
| 51 | Ga0070688_100005503 | 3300005365 | Bacteria | 6679 |
| 52 | Ga0070659_100011195 | 3300005366 | Bacteria | 6628 |
| 53 | Ga0070659_100190079 | 3300005366 | Bacteria | 1687 |
| 54 | Ga0070667_100010376 | 3300005367 | Bacteria | 7692 |
| 55 | Ga0070667_100326021 | 3300005367 | Unclassified | 1386 |
| 56 | Ga0070709_10008347 | 3300005434 | Bacteria | 5687 |
| 57 | Ga0070709_10018507 | 3300005434 | Bacteria | 4012 |
| 58 | Ga0070709_10022109 | 3300005434 | Bacteria | 3716 |
| 59 | Ga0070709_10043382 | 3300005434 | Bacteria | 2781 |
| 60 | Ga0070709_10117888 | 3300005434 | Bacteria | 1795 |
| 61 | Ga0070709_10132346 | 3300005434 | Bacteria | 1704 |
| 62 | Ga0070709_10164883 | 3300005434 | Bacteria | 1544 |
| 63 | Ga0070709_10186990 | 3300005434 | Unclassified | 1458 |
| 64 | Ga0070709_10297268 | 3300005434 | Bacteria | 1178 |
| 65 | Ga0070714_100000299 | 3300005435 | Bacteria | 37652 |
| 66 | Ga0070714_100025638 | 3300005435 | Bacteria | 4867 |
| 67 | Ga0070714_100029479 | 3300005435 | Bacteria | 4562 |
| 68 | Ga0070714_100059308 | 3300005435 | Bacteria | 3281 |
| 69 | Ga0070714_100078534 | 3300005435 | Bacteria | 2868 |
| 70 | Ga0070714_100080357 | 3300005435 | Bacteria | 2837 |
| 71 | Ga0070714_100103193 | 3300005435 | Bacteria | 2515 |
| 72 | Ga0070714_100177061 | 3300005435 | Bacteria | 1938 |
| 73 | Ga0070714_100211748 | 3300005435 | Unclassified | 1777 |
| 74 | Ga0070714_100211907 | 3300005435 | Unclassified | 1776 |
| 75 | Ga0070714_100610376 | 3300005435 | Unclassified | 1048 |
| 76 | Ga0070713_100000060 | 3300005436 | Bacteria | 69784 |
| 77 | Ga0070713_100000108 | 3300005436 | Bacteria | 53977 |
| 78 | Ga0070713_100003414 | 3300005436 | Bacteria | 10495 |
| 79 | Ga0070713_100036661 | 3300005436 | Bacteria | 3959 |
| 80 | Ga0070713_100056150 | 3300005436 | Unclassified | 3275 |
| 81 | Ga0070713_100170424 | 3300005436 | Bacteria | 1950 |
| 82 | Ga0070713_100223188 | 3300005436 | Bacteria | 1710 |
| 83 | Ga0070713_100261661 | 3300005436 | Bacteria | 1581 |
| 84 | Ga0070710_10045241 | 3300005437 | Bacteria | 2446 |
| 85 | Ga0070710_10093711 | 3300005437 | Bacteria | 1776 |
| 86 | Ga0070710_10108807 | 3300005437 | Unclassified | 1662 |
| 87 | Ga0070710_10348798 | 3300005437 | Unclassified | 979 |
| 88 | Ga0070711_100000525 | 3300005439 | Bacteria | 19885 |
| 89 | Ga0070711_100000689 | 3300005439 | Bacteria | 17727 |
| 90 | Ga0070711_100002403 | 3300005439 | Bacteria | 10676 |
| 91 | Ga0070711_100023292 | 3300005439 | Bacteria | 4025 |
| 92 | Ga0070711_100032880 | 3300005439 | Bacteria | 3452 |
| 93 | Ga0070711_100674280 | 3300005439 | Unclassified | 869 |
| 94 | Ga0070705_100088614 | 3300005440 | Unclassified | 1921 |
| 95 | Ga0070705_100474452 | 3300005440 | Bacteria | 944 |
| 96 | Ga0070708_100000347 | 3300005445 | Bacteria | 34980 |
| 97 | Ga0070708_100000500 | 3300005445 | Bacteria | 29438 |
| 98 | Ga0070708_100001815 | 3300005445 | Bacteria | 16399 |
| 99 | Ga0070708_100006972 | 3300005445 | Bacteria | 9018 |
| 100 | Ga0070708_100010270 | 3300005445 | Bacteria | 7580 |
| 101 | Ga0070708_100012796 | 3300005445 | Bacteria | 6855 |
| 102 | Ga0070708_100014353 | 3300005445 | Bacteria | 6516 |
| 103 | Ga0070708_100020138 | 3300005445 | Bacteria | 5619 |
| 104 | Ga0070708_100042149 | 3300005445 | Unclassified | 4005 |
| 105 | Ga0070708_100157258 | 3300005445 | Bacteria | 2117 |
| 106 | Ga0070708_100248526 | 3300005445 | Bacteria | 1671 |
| 107 | Ga0070663_100026061 | 3300005455 | Unclassified | 3955 |
| 108 | Ga0070663_100125183 | 3300005455 | Bacteria | 1946 |
| 109 | Ga0070678_100311334 | 3300005456 | Bacteria | 1342 |
| 110 | Ga0070662_100009117 | 3300005457 | Bacteria | 6478 |
| 111 | Ga0070662_100037286 | 3300005457 | Unclassified | 3446 |
| 112 | Ga0070662_100182433 | 3300005457 | Bacteria | 1655 |
| 113 | Ga0070681_10049656 | 3300005458 | Unclassified | 4189 |
| 114 | Ga0070681_10409687 | 3300005458 | Bacteria | 1267 |
| 115 | Ga0068867_100016049 | 3300005459 | Bacteria | 5317 |
| 116 | Ga0068867_100049758 | 3300005459 | Unclassified | 3085 |
| 117 | Ga0070685_10010306 | 3300005466 | Unclassified | 4853 |
| 118 | Ga0070685_10264472 | 3300005466 | Bacteria | 1145 |
| 119 | Ga0070706_100001585 | 3300005467 | Bacteria | 23707 |
| 120 | Ga0070706_100004125 | 3300005467 | Bacteria | 14130 |
| 121 | Ga0070706_100024440 | 3300005467 | Bacteria | 5562 |
| 122 | Ga0070706_100026294 | 3300005467 | Bacteria | 5356 |
| 123 | Ga0070706_100155352 | 3300005467 | Unclassified | 2136 |
| 124 | Ga0070706_100167799 | 3300005467 | Bacteria | 2049 |
| 125 | Ga0070706_100302393 | 3300005467 | Bacteria | 1492 |
| 126 | Ga0070707_100002300 | 3300005468 | Bacteria | 18254 |
| 127 | Ga0070707_100002700 | 3300005468 | Bacteria | 16873 |
| 128 | Ga0070707_100022750 | 3300005468 | Bacteria | 5927 |
| 129 | Ga0070707_100049851 | 3300005468 | Bacteria | 4013 |
| 130 | Ga0070707_100055888 | 3300005468 | Bacteria | 3784 |
| 131 | Ga0070707_100079034 | 3300005468 | Unclassified | 3174 |
| 132 | Ga0070707_100093610 | 3300005468 | Bacteria | 2909 |
| 133 | Ga0070707_100184787 | 3300005468 | Bacteria | 2032 |
| 134 | Ga0070707_100306070 | 3300005468 | Unclassified | 1544 |
| 135 | Ga0070707_100382667 | 3300005468 | Bacteria | 1367 |
| 136 | Ga0070707_100394397 | 3300005468 | Bacteria | 1344 |
| 137 | Ga0070698_100000547 | 3300005471 | Bacteria | 40166 |
| 138 | Ga0070698_100009673 | 3300005471 | Bacteria | 10312 |
| 139 | Ga0070698_100095364 | 3300005471 | Bacteria | 2953 |
| 140 | Ga0070698_100415171 | 3300005471 | Bacteria | 1280 |
| 141 | Ga0070698_100431350 | 3300005471 | Bacteria | 1253 |
| 142 | Ga0070699_100000343 | 3300005518 | Bacteria | 45107 |
| 143 | Ga0070699_100010416 | 3300005518 | Bacteria | 8046 |
| 144 | Ga0070699_100079592 | 3300005518 | Bacteria | 2855 |
| 145 | Ga0070699_100090096 | 3300005518 | Bacteria | 2680 |
| 146 | Ga0070699_100126879 | 3300005518 | Bacteria | 2247 |
| 147 | Ga0070699_100135513 | 3300005518 | Bacteria | 2172 |
| 148 | Ga0070699_100368411 | 3300005518 | Bacteria | 1296 |
| 149 | Ga0070679_100046636 | 3300005530 | Viruses | 4319 |
| 150 | Ga0070679_100213165 | 3300005530 | Bacteria | 1894 |
| 151 | Ga0070684_100006119 | 3300005535 | Bacteria | 9273 |
| 152 | Ga0070684_100042749 | 3300005535 | Bacteria | 3913 |
| 153 | Ga0070684_100883401 | 3300005535 | Unclassified | 837 |
| 154 | Ga0070697_100000208 | 3300005536 | Bacteria | 48156 |
| 155 | Ga0070697_100000786 | 3300005536 | Bacteria | 23847 |
| 156 | Ga0070697_100000960 | 3300005536 | Bacteria | 21769 |
| 157 | Ga0070697_100002199 | 3300005536 | Bacteria | 14971 |
| 158 | Ga0070697_100002461 | 3300005536 | Bacteria | 14253 |
| 159 | Ga0070697_100028329 | 3300005536 | Bacteria | 4485 |
| 160 | Ga0070697_100034470 | 3300005536 | Bacteria | 4081 |
| 161 | Ga0070697_100232976 | 3300005536 | Bacteria | 1571 |
| 162 | Ga0070697_100338669 | 3300005536 | Bacteria | 1298 |
| 163 | Ga0070697_100411065 | 3300005536 | Bacteria | 1175 |
| 164 | Ga0068853_100004876 | 3300005539 | Bacteria | 10436 |
| 165 | Ga0068853_100075519 | 3300005539 | Unclassified | 2941 |
| 166 | Ga0068853_100164603 | 3300005539 | Bacteria | 2003 |
| 167 | Ga0070672_100175402 | 3300005543 | Unclassified | 1784 |
| 168 | Ga0070686_100542463 | 3300005544 | Unclassified | 908 |
| 169 | Ga0070695_100046775 | 3300005545 | Unclassified | 2761 |
| 170 | Ga0070695_100054368 | 3300005545 | Bacteria | 2577 |
| 171 | Ga0070695_100570208 | 3300005545 | Unclassified | 885 |
| 172 | Ga0070696_100019515 | 3300005546 | Unclassified | 4591 |
| 173 | Ga0070693_100023440 | 3300005547 | Unclassified | 3299 |
| 174 | Ga0070665_100021084 | 3300005548 | Bacteria | 6551 |
| 175 | Ga0070665_100109609 | 3300005548 | Bacteria | 2763 |
| 176 | Ga0070704_100081759 | 3300005549 | Bacteria | 2380 |
| 177 | Ga0068855_100037722 | 3300005563 | Bacteria | 5744 |
| 178 | Ga0068855_100067240 | 3300005563 | Unclassified | 4176 |
| 179 | Ga0068855_100097672 | 3300005563 | Unclassified | 3383 |
| 180 | Ga0068855_100378739 | 3300005563 | Unclassified | 1554 |
| 181 | Ga0068855_100380745 | 3300005563 | Unclassified | 1549 |
| 182 | Ga0068855_100472397 | 3300005563 | Unclassified | 1366 |
| 183 | Ga0070664_100028528 | 3300005564 | Unclassified | 4643 |
| 184 | Ga0070664_100067206 | 3300005564 | Unclassified | 3063 |
| 185 | Ga0068857_100004674 | 3300005577 | Bacteria | 11601 |
| 186 | Ga0068857_100150096 | 3300005577 | Bacteria | 2111 |
| 187 | Ga0068857_100437876 | 3300005577 | Unclassified | 1221 |
| 188 | Ga0068854_100069057 | 3300005578 | Unclassified | 2578 |
| 189 | Ga0068854_100078058 | 3300005578 | Unclassified | 2438 |
| 190 | Ga0068854_100196552 | 3300005578 | Bacteria | 1583 |
| 191 | Ga0068856_100030898 | 3300005614 | Bacteria | 5238 |
| 192 | Ga0068856_100051816 | 3300005614 | Bacteria | 4046 |
| 193 | Ga0068856_100068780 | 3300005614 | Unclassified | 3500 |
| 194 | Ga0068856_100071748 | 3300005614 | Unclassified | 3429 |
| 195 | Ga0070702_100454051 | 3300005615 | Unclassified | 930 |
| 196 | Ga0068852_100019600 | 3300005616 | Bacteria | 5358 |
| 197 | Ga0068852_100046909 | 3300005616 | Bacteria | 3683 |
| 198 | Ga0068852_100592868 | 3300005616 | Unclassified | 1112 |
| 199 | Ga0068859_100028578 | 3300005617 | Bacteria | 5591 |
| 200 | Ga0068859_100033577 | 3300005617 | Bacteria | 5153 |
| 201 | Ga0068864_100012096 | 3300005618 | Bacteria | 7129 |
| 202 | Ga0068866_10042460 | 3300005718 | Unclassified | 2263 |
| 203 | Ga0068861_100341956 | 3300005719 | Unclassified | 1310 |
| 204 | Ga0068863_100041428 | 3300005841 | Unclassified | 4379 |
| 205 | Ga0068863_100056904 | 3300005841 | Bacteria | 3702 |
| 206 | Ga0068858_100022290 | 3300005842 | Bacteria | 5914 |
| 207 | Ga0068858_100037574 | 3300005842 | Bacteria | 4491 |
| 208 | Ga0068860_100101479 | 3300005843 | Bacteria | 2745 |
| 209 | Ga0068862_100014886 | 3300005844 | Bacteria | 6461 |
| 210 | Ga0068862_100064053 | 3300005844 | Unclassified | 3164 |
| 211 | Ga0070717_10000503 | 3300006028 | Bacteria | 24750 |
| 212 | Ga0070717_10001316 | 3300006028 | Bacteria | 17016 |
| 213 | Ga0070717_10004398 | 3300006028 | Bacteria | 10171 |
| 214 | Ga0070717_10016942 | 3300006028 | Bacteria | 5660 |
| 215 | Ga0070717_10023410 | 3300006028 | Bacteria | 4893 |
| 216 | Ga0070717_10039264 | 3300006028 | Bacteria | 3851 |
| 217 | Ga0070717_10098862 | 3300006028 | Bacteria | 2474 |
| 218 | Ga0070717_10112889 | 3300006028 | Unclassified | 2320 |
| 219 | Ga0070717_10117610 | 3300006028 | Bacteria | 2274 |
| 220 | Ga0070717_10142678 | 3300006028 | Bacteria | 2067 |
| 221 | Ga0070717_10288545 | 3300006028 | Bacteria | 1456 |
| 222 | Ga0070717_10385288 | 3300006028 | Unclassified | 1257 |
| 223 | Ga0070717_10426547 | 3300006028 | Bacteria | 1193 |
| 224 | Ga0070717_10490166 | 3300006028 | Bacteria | 1110 |
| 225 | Ga0070717_10573261 | 3300006028 | Bacteria | 1023 |
| 226 | Ga0070717_10659089 | 3300006028 | Unclassified | 950 |
| 227 | Ga0070715_10000405 | 3300006163 | Bacteria | 10954 |
| 228 | Ga0070715_10005691 | 3300006163 | Bacteria | 4180 |
| 229 | Ga0070715_10006368 | 3300006163 | Unclassified | 4011 |
| 230 | Ga0070715_10043926 | 3300006163 | Unclassified | 1887 |
| 231 | Ga0070716_100000064 | 3300006173 | Bacteria | 41396 |
| 232 | Ga0070716_100004991 | 3300006173 | Bacteria | 6393 |
| 233 | Ga0070716_100048249 | 3300006173 | Bacteria | 2406 |
| 234 | Ga0070716_100064277 | 3300006173 | Bacteria | 2133 |
| 235 | Ga0070716_100069966 | 3300006173 | Bacteria | 2059 |
| 236 | Ga0070716_100072529 | 3300006173 | Bacteria | 2028 |
| 237 | Ga0070712_100000179 | 3300006175 | Bacteria | 35191 |
| 238 | Ga0070712_100000196 | 3300006175 | Bacteria | 33763 |
| 239 | Ga0070712_100000780 | 3300006175 | Bacteria | 18819 |
| 240 | Ga0070712_100001325 | 3300006175 | Bacteria | 15009 |
| 241 | Ga0070712_100019136 | 3300006175 | Bacteria | 4460 |
| 242 | Ga0070712_100145593 | 3300006175 | Unclassified | 1813 |
| 243 | Ga0070712_100159898 | 3300006175 | Bacteria | 1739 |
| 244 | Ga0070712_100489881 | 3300006175 | Bacteria | 1029 |
| 245 | Ga0097621_100005110 | 3300006237 | Bacteria | 9216 |
| 246 | Ga0097621_100268955 | 3300006237 | Bacteria | 1497 |
| 247 | Ga0097621_100300224 | 3300006237 | Unclassified | 1418 |
| 248 | Ga0068871_100012682 | 3300006358 | Bacteria | 6227 |
| 249 | Ga0068871_100019808 | 3300006358 | Bacteria | 5142 |
| 250 | Ga0068871_100070708 | 3300006358 | Bacteria | 2869 |
| 251 | Ga0068871_100227202 | 3300006358 | Bacteria | 1619 |
| 252 | Ga0068871_100244332 | 3300006358 | Bacteria | 1562 |
| 253 | Ga0068871_100287301 | 3300006358 | Bacteria | 1440 |
| 254 | Ga0068871_100427056 | 3300006358 | Bacteria | 1184 |
| 255 | Ga0075434_100004944 | 3300006871 | Bacteria | 12086 |
| 256 | Ga0075434_100012876 | 3300006871 | Bacteria | 7945 |
| 257 | Ga0075434_100087387 | 3300006871 | Unclassified | 3118 |
| 258 | Ga0075436_100000301 | 3300006914 | Bacteria | 31560 |
| 259 | Ga0075436_100016833 | 3300006914 | Bacteria | 5003 |
| 260 | Ga0075436_100060072 | 3300006914 | Unclassified | 2626 |
| 261 | Ga0075436_100185470 | 3300006914 | Bacteria | 1471 |
| 262 | Ga0075436_100445499 | 3300006914 | Unclassified | 942 |
| 263 | Ga0097620_100028575 | 3300006931 | Bacteria | 5591 |
| 264 | Ga0097620_100033578 | 3300006931 | Bacteria | 5153 |
| 265 | Ga0075435_100021891 | 3300007076 | Bacteria | 4926 |
| 266 | Ga0075435_100025649 | 3300007076 | Unclassified | 4590 |
| 267 | Ga0075435_100049415 | 3300007076 | Bacteria | 3383 |
| 268 | Ga0075435_100072631 | 3300007076 | Bacteria | 2811 |
| 269 | Ga0075435_100594686 | 3300007076 | Unclassified | 959 |
| 270 | Ga0099794_10077671 | 3300007265 | Bacteria | 1634 |
| 271 | Ga0099794_10093061 | 3300007265 | Bacteria | 1498 |
| 272 | Ga0099795_10027875 | 3300007788 | Unclassified | 1915 |
| 273 | Ga0099795_10033786 | 3300007788 | Bacteria | 1779 |
| 274 | Ga0099795_10041901 | 3300007788 | Bacteria | 1632 |
| 275 | Ga0105250_10027720 | 3300009092 | Unclassified | 2283 |
| 276 | Ga0105240_10012666 | 3300009093 | Bacteria | 11625 |
| 277 | Ga0105240_10037944 | 3300009093 | Bacteria | 6186 |
| 278 | Ga0105240_10053134 | 3300009093 | Bacteria | 5088 |
| 279 | Ga0105240_10053919 | 3300009093 | Bacteria | 5043 |
| 280 | Ga0105240_10077399 | 3300009093 | Bacteria | 4097 |
| 281 | Ga0105240_10111707 | 3300009093 | Unclassified | 3305 |
| 282 | Ga0105240_10143778 | 3300009093 | Bacteria | 2849 |
| 283 | Ga0105240_10217993 | 3300009093 | Bacteria | 2225 |
| 284 | Ga0111539_10659627 | 3300009094 | Unclassified | 1218 |
| 285 | Ga0105245_10017450 | 3300009098 | Bacteria | 6262 |
| 286 | Ga0105245_10055492 | 3300009098 | Bacteria | 3558 |
| 287 | Ga0105245_10071577 | 3300009098 | Unclassified | 3149 |
| 288 | Ga0105245_10138133 | 3300009098 | Bacteria | 2292 |
| 289 | Ga0105247_10003282 | 3300009101 | Bacteria | 10600 |
| 290 | Ga0105247_10004648 | 3300009101 | Bacteria | 8750 |
| 291 | Ga0105247_10158498 | 3300009101 | Unclassified | 1497 |
| 292 | Ga0114129_10060514 | 3300009147 | Bacteria | 5295 |
| 293 | Ga0105243_10122911 | 3300009148 | Bacteria | 2191 |
| 294 | Ga0105243_10273378 | 3300009148 | Unclassified | 1518 |
| 295 | Ga0105241_10005002 | 3300009174 | Bacteria | 9784 |
| 296 | Ga0105241_10016473 | 3300009174 | Bacteria | 5422 |
| 297 | Ga0105241_10168100 | 3300009174 | Unclassified | 1809 |
| 298 | Ga0105242_10034402 | 3300009176 | Unclassified | 4061 |
| 299 | Ga0105242_10387873 | 3300009176 | Bacteria | 1300 |
| 300 | Ga0105248_10010666 | 3300009177 | Bacteria | 10135 |
| 301 | Ga0105248_10565179 | 3300009177 | Unclassified | 1283 |
| 302 | Ga0105248_11262506 | 3300009177 | Unclassified | 835 |
| 303 | Ga0105237_10024915 | 3300009545 | Bacteria | 6120 |
| 304 | Ga0105237_10096786 | 3300009545 | Bacteria | 2942 |
| 305 | Ga0105237_10184669 | 3300009545 | Bacteria | 2085 |
| 306 | Ga0105237_10289037 | 3300009545 | Bacteria | 1642 |
| 307 | Ga0105238_10009704 | 3300009551 | Bacteria | 9637 |
| 308 | Ga0105238_10026525 | 3300009551 | Bacteria | 5908 |
| 309 | Ga0105238_10032651 | 3300009551 | Bacteria | 5298 |
| 310 | Ga0105238_10113335 | 3300009551 | Unclassified | 2691 |
| 311 | Ga0105238_10185734 | 3300009551 | Bacteria | 2055 |
| 312 | Ga0105249_10001809 | 3300009553 | Bacteria | 18603 |
| 313 | Ga0105249_10098320 | 3300009553 | Bacteria | 2748 |
| 314 | Ga0105249_10142880 | 3300009553 | Unclassified | 2297 |
| 315 | Ga0099796_10014462 | 3300010159 | Bacteria | 2281 |
| 316 | Ga0105239_10177821 | 3300010375 | Unclassified | 2380 |
| 317 | Ga0105246_10002192 | 3300011119 | Bacteria | 11782 |
| 318 | Ga0105246_10025587 | 3300011119 | Bacteria | 3848 |
| 319 | Ga0105246_10173335 | 3300011119 | Unclassified | 1654 |
| 320 | Ga0157373_10015692 | 3300013100 | Bacteria | 5533 |
| 321 | Ga0157373_10017869 | 3300013100 | Bacteria | 5163 |
| 322 | Ga0157373_10024229 | 3300013100 | Unclassified | 4398 |
| 323 | Ga0157373_10082091 | 3300013100 | Bacteria | 2272 |
| 324 | Ga0157371_10008238 | 3300013102 | Bacteria | 8332 |
| 325 | Ga0157371_10462070 | 3300013102 | Unclassified | 934 |
| 326 | Ga0157370_10156555 | 3300013104 | Bacteria | 2120 |
| 327 | Ga0157369_10000794 | 3300013105 | Bacteria | 40368 |
| 328 | Ga0157369_10011531 | 3300013105 | Bacteria | 10040 |
| 329 | Ga0157369_10020732 | 3300013105 | Bacteria | 7348 |
| 330 | Ga0157369_10023457 | 3300013105 | Bacteria | 6872 |
| 331 | Ga0157369_10024478 | 3300013105 | Bacteria | 6715 |
| 332 | Ga0157369_10037666 | 3300013105 | Bacteria | 5293 |
| 333 | Ga0157369_10093524 | 3300013105 | Unclassified | 3209 |
| 334 | Ga0157369_10162142 | 3300013105 | Bacteria | 2360 |
| 335 | Ga0157374_10001851 | 3300013296 | Bacteria | 17794 |
| 336 | Ga0157374_10005139 | 3300013296 | Bacteria | 10974 |
| 337 | Ga0157374_10058016 | 3300013296 | Bacteria | 3617 |
| 338 | Ga0157374_10364126 | 3300013296 | Bacteria | 1438 |
| 339 | Ga0157374_10583412 | 3300013296 | Unclassified | 1127 |
| 340 | Ga0157378_10015111 | 3300013297 | Bacteria | 6759 |
| 341 | Ga0157378_10066556 | 3300013297 | Unclassified | 3227 |
| 342 | Ga0157378_10066673 | 3300013297 | Bacteria | 3224 |
| 343 | Ga0157378_10431652 | 3300013297 | Bacteria | 1304 |
| 344 | Ga0157378_10491156 | 3300013297 | Bacteria | 1225 |
| 345 | Ga0157378_10626418 | 3300013297 | Bacteria | 1089 |
| 346 | Ga0163162_10039073 | 3300013306 | Bacteria | 4739 |
| 347 | Ga0163162_10057062 | 3300013306 | Unclassified | 3932 |
| 348 | Ga0163162_10144581 | 3300013306 | Bacteria | 2493 |
| 349 | Ga0163162_10163674 | 3300013306 | Unclassified | 2347 |
| 350 | Ga0163162_10661148 | 3300013306 | Unclassified | 1168 |
| 351 | Ga0157372_10000661 | 3300013307 | Bacteria | 37855 |
| 352 | Ga0157372_10012631 | 3300013307 | Bacteria | 8996 |
| 353 | Ga0157372_10024144 | 3300013307 | Bacteria | 6599 |
| 354 | Ga0157372_10045950 | 3300013307 | Unclassified | 4846 |
| 355 | Ga0157372_10144935 | 3300013307 | Bacteria | 2739 |
| 356 | Ga0157372_10230969 | 3300013307 | Unclassified | 2145 |
| 357 | Ga0157372_10449285 | 3300013307 | Bacteria | 1502 |
| 358 | Ga0157375_10066909 | 3300013308 | Unclassified | 3589 |
| 359 | Ga0163163_10005225 | 3300014325 | Bacteria | 11198 |
| 360 | Ga0163163_10060017 | 3300014325 | Bacteria | 3764 |
| 361 | Ga0163163_10167569 | 3300014325 | Bacteria | 2243 |
| 362 | Ga0157377_10001671 | 3300014745 | Bacteria | 9671 |
| 363 | Ga0157379_10011817 | 3300014968 | Bacteria | 7625 |
| 364 | Ga0157379_10040955 | 3300014968 | Bacteria | 4135 |
| 365 | Ga0157379_10078863 | 3300014968 | Bacteria | 2950 |
| 366 | Ga0157376_10002705 | 3300014969 | Bacteria | 12072 |
| 367 | Ga0157376_10098002 | 3300014969 | Bacteria | 2555 |
| 368 | Ga0157376_10284399 | 3300014969 | Bacteria | 1559 |
| 369 | Ga0182006_1035562 | 3300015261 | Bacteria | 1984 |
| 370 | Ga0182006_1046161 | 3300015261 | Unclassified | 1693 |
| 371 | Ga0182007_10015342 | 3300015262 | Bacteria | 2860 |
| 372 | Ga0182007_10064944 | 3300015262 | Bacteria | 1196 |
| 373 | Ga0182005_1017450 | 3300015265 | Unclassified | 1987 |
| 374 | Ga0163161_10009403 | 3300017792 | Bacteria | 6768 |
| 375 | Ga0224570_100933 | 3300022730 | Bacteria | 2324 |
| 376 | Ga0224569_100376 | 3300022732 | Bacteria | 3792 |
| 377 | Ga0224572_1005365 | 3300024225 | Bacteria | 2283 |
| 378 | Ga0228598_1001637 | 3300024227 | Bacteria | 4892 |
| 379 | Ga0228598_1002092 | 3300024227 | Unclassified | 4361 |
| 380 | Ga0228598_1005914 | 3300024227 | Bacteria | 2542 |
| 381 | Ga0207697_10007237 | 3300025315 | Unclassified | 4958 |
| 382 | Ga0207656_10012495 | 3300025321 | Unclassified | 3230 |
| 383 | Ga0207656_10038570 | 3300025321 | Unclassified | 2016 |
| 384 | Ga0207692_10183753 | 3300025898 | Bacteria | 1219 |
| 385 | Ga0207692_10260393 | 3300025898 | Bacteria | 1042 |
| 386 | Ga0207642_10009967 | 3300025899 | Unclassified | 3328 |
| 387 | Ga0207688_10005213 | 3300025901 | Bacteria | 7064 |
| 388 | Ga0207680_10058928 | 3300025903 | Unclassified | 2330 |
| 389 | Ga0207647_10001373 | 3300025904 | Bacteria | 18689 |
| 390 | Ga0207647_10249763 | 3300025904 | Bacteria | 1018 |
| 391 | Ga0207685_10004100 | 3300025905 | Unclassified | 3651 |
| 392 | Ga0207685_10020208 | 3300025905 | Bacteria | 2209 |
| 393 | Ga0207685_10123423 | 3300025905 | Bacteria | 1140 |
| 394 | Ga0207699_10028522 | 3300025906 | Unclassified | 3104 |
| 395 | Ga0207699_10029803 | 3300025906 | Bacteria | 3047 |
| 396 | Ga0207699_10062011 | 3300025906 | Unclassified | 2252 |
| 397 | Ga0207699_10067282 | 3300025906 | Unclassified | 2177 |
| 398 | Ga0207699_10261019 | 3300025906 | Bacteria | 1197 |
| 399 | Ga0207645_10000011 | 3300025907 | Bacteria | 132246 |
| 400 | Ga0207645_10010651 | 3300025907 | Bacteria | 6309 |
| 401 | Ga0207643_10003295 | 3300025908 | Bacteria | 8718 |
| 402 | Ga0207684_10000081 | 3300025910 | Bacteria | 178619 |
| 403 | Ga0207684_10003969 | 3300025910 | Bacteria | 14166 |
| 404 | Ga0207684_10045476 | 3300025910 | Bacteria | 3723 |
| 405 | Ga0207684_10091608 | 3300025910 | Bacteria | 2591 |
| 406 | Ga0207684_10092418 | 3300025910 | Bacteria | 2579 |
| 407 | Ga0207684_10226285 | 3300025910 | Bacteria | 1614 |
| 408 | Ga0207684_10375435 | 3300025910 | Bacteria | 1223 |
| 409 | Ga0207654_10007606 | 3300025911 | Bacteria | 5461 |
| 410 | Ga0207654_10013233 | 3300025911 | Bacteria | 4241 |
| 411 | Ga0207654_10043545 | 3300025911 | Bacteria | 2545 |
| 412 | Ga0207654_10230504 | 3300025911 | Bacteria | 1233 |
| 413 | Ga0207654_10264618 | 3300025911 | Bacteria | 1158 |
| 414 | Ga0207707_10058109 | 3300025912 | Unclassified | 3366 |
| 415 | Ga0207707_10069742 | 3300025912 | Bacteria | 3064 |
| 416 | Ga0207695_10008921 | 3300025913 | Bacteria | 12484 |
| 417 | Ga0207695_10029851 | 3300025913 | Bacteria | 6015 |
| 418 | Ga0207695_10120246 | 3300025913 | Bacteria | 2595 |
| 419 | Ga0207695_10130145 | 3300025913 | Bacteria | 2475 |
| 420 | Ga0207695_10244959 | 3300025913 | Unclassified | 1693 |
| 421 | Ga0207671_10021152 | 3300025914 | Bacteria | 4941 |
| 422 | Ga0207671_10205210 | 3300025914 | Unclassified | 1540 |
| 423 | Ga0207671_10384270 | 3300025914 | Bacteria | 1115 |
| 424 | Ga0207671_10576780 | 3300025914 | Unclassified | 897 |
| 425 | Ga0207693_10000042 | 3300025915 | Bacteria | 104665 |
| 426 | Ga0207693_10000191 | 3300025915 | Bacteria | 56013 |
| 427 | Ga0207693_10000221 | 3300025915 | Bacteria | 51982 |
| 428 | Ga0207693_10008695 | 3300025915 | Bacteria | 8303 |
| 429 | Ga0207693_10022404 | 3300025915 | Bacteria | 5020 |
| 430 | Ga0207693_10250218 | 3300025915 | Unclassified | 1391 |
| 431 | Ga0207693_10352395 | 3300025915 | Bacteria | 1152 |
| 432 | Ga0207663_10000544 | 3300025916 | Bacteria | 16576 |
| 433 | Ga0207663_10001591 | 3300025916 | Bacteria | 10662 |
| 434 | Ga0207663_10006091 | 3300025916 | Bacteria | 6136 |
| 435 | Ga0207663_10034774 | 3300025916 | Bacteria | 3017 |
| 436 | Ga0207663_10048279 | 3300025916 | Unclassified | 2634 |
| 437 | Ga0207663_10068797 | 3300025916 | Bacteria | 2275 |
| 438 | Ga0207663_10373890 | 3300025916 | Unclassified | 1084 |
| 439 | Ga0207660_10259345 | 3300025917 | Unclassified | 1374 |
| 440 | Ga0207662_10000594 | 3300025918 | Bacteria | 16173 |
| 441 | Ga0207657_10001258 | 3300025919 | Bacteria | 27107 |
| 442 | Ga0207657_10003804 | 3300025919 | Bacteria | 16045 |
| 443 | Ga0207657_10018061 | 3300025919 | Bacteria | 6747 |
| 444 | Ga0207649_10002513 | 3300025920 | Bacteria | 10222 |
| 445 | Ga0207649_10039882 | 3300025920 | Bacteria | 2850 |
| 446 | Ga0207649_10366415 | 3300025920 | Unclassified | 1070 |
| 447 | Ga0207652_10120860 | 3300025921 | Unclassified | 2330 |
| 448 | Ga0207652_10130487 | 3300025921 | Unclassified | 2241 |
| 449 | Ga0207646_10000880 | 3300025922 | Bacteria | 38839 |
| 450 | Ga0207646_10002622 | 3300025922 | Bacteria | 21121 |
| 451 | Ga0207646_10019808 | 3300025922 | Bacteria | 6245 |
| 452 | Ga0207646_10074290 | 3300025922 | Bacteria | 3037 |
| 453 | Ga0207646_10079670 | 3300025922 | Bacteria | 2929 |
| 454 | Ga0207646_10153506 | 3300025922 | Bacteria | 2076 |
| 455 | Ga0207646_10206620 | 3300025922 | Bacteria | 1773 |
| 456 | Ga0207646_10316540 | 3300025922 | Bacteria | 1410 |
| 457 | Ga0207646_10448403 | 3300025922 | Bacteria | 1164 |
| 458 | Ga0207681_10051054 | 3300025923 | Unclassified | 2800 |
| 459 | Ga0207694_10197766 | 3300025924 | Bacteria | 1635 |
| 460 | Ga0207694_10473972 | 3300025924 | Unclassified | 1046 |
| 461 | Ga0207650_10002279 | 3300025925 | Bacteria | 13390 |
| 462 | Ga0207650_10081026 | 3300025925 | Bacteria | 2462 |
| 463 | Ga0207659_10026076 | 3300025926 | Unclassified | 3939 |
| 464 | Ga0207687_10005580 | 3300025927 | Bacteria | 8314 |
| 465 | Ga0207700_10000358 | 3300025928 | Bacteria | 26677 |
| 466 | Ga0207700_10002265 | 3300025928 | Bacteria | 11047 |
| 467 | Ga0207700_10054528 | 3300025928 | Bacteria | 3001 |
| 468 | Ga0207700_10091335 | 3300025928 | Unclassified | 2405 |
| 469 | Ga0207700_10105627 | 3300025928 | Bacteria | 2256 |
| 470 | Ga0207700_10113979 | 3300025928 | Bacteria | 2180 |
| 471 | Ga0207700_10243216 | 3300025928 | Bacteria | 1534 |
| 472 | Ga0207664_10000320 | 3300025929 | Bacteria | 35727 |
| 473 | Ga0207664_10111356 | 3300025929 | Bacteria | 2277 |
| 474 | Ga0207664_10303295 | 3300025929 | Bacteria | 1405 |
| 475 | Ga0207664_10417759 | 3300025929 | Bacteria | 1194 |
| 476 | Ga0207664_10456258 | 3300025929 | Bacteria | 1141 |
| 477 | Ga0207644_10207527 | 3300025931 | Unclassified | 1547 |
| 478 | Ga0207690_10123048 | 3300025932 | Bacteria | 1887 |
| 479 | Ga0207690_10136210 | 3300025932 | Unclassified | 1803 |
| 480 | Ga0207706_10000698 | 3300025933 | Bacteria | 35074 |
| 481 | Ga0207706_10001011 | 3300025933 | Bacteria | 28673 |
| 482 | Ga0207706_10027530 | 3300025933 | Bacteria | 5082 |
| 483 | Ga0207686_10090261 | 3300025934 | Unclassified | 2021 |
| 484 | Ga0207686_10433941 | 3300025934 | Bacteria | 1007 |
| 485 | Ga0207709_10407725 | 3300025935 | Unclassified | 1041 |
| 486 | Ga0207670_10033080 | 3300025936 | Unclassified | 3330 |
| 487 | Ga0207665_10016946 | 3300025939 | Bacteria | 4784 |
| 488 | Ga0207665_10086683 | 3300025939 | Bacteria | 2163 |
| 489 | Ga0207665_10119231 | 3300025939 | Bacteria | 1862 |
| 490 | Ga0207691_10006128 | 3300025940 | Bacteria | 11628 |
| 491 | Ga0207711_10010872 | 3300025941 | Bacteria | 7564 |
| 492 | Ga0207711_10026059 | 3300025941 | Bacteria | 4904 |
| 493 | Ga0207689_10000194 | 3300025942 | Bacteria | 53148 |
| 494 | Ga0207661_10013948 | 3300025944 | Bacteria | 5875 |
| 495 | Ga0207661_10130360 | 3300025944 | Bacteria | 2153 |
| 496 | Ga0207679_10000051 | 3300025945 | Bacteria | 111207 |
| 497 | Ga0207679_10000172 | 3300025945 | Bacteria | 53249 |
| 498 | Ga0207679_10038142 | 3300025945 | Bacteria | 3421 |
| 499 | Ga0207679_10085591 | 3300025945 | Unclassified | 2422 |
| 500 | Ga0207667_10015081 | 3300025949 | Bacteria | 8788 |
| 501 | Ga0207667_10056659 | 3300025949 | Bacteria | 4116 |
| 502 | Ga0207667_10476150 | 3300025949 | Unclassified | 1268 |
| 503 | Ga0207651_10562823 | 3300025960 | Unclassified | 992 |
| 504 | Ga0207712_10028731 | 3300025961 | Bacteria | 3722 |
| 505 | Ga0207712_10033549 | 3300025961 | Unclassified | 3471 |
| 506 | Ga0207668_10063210 | 3300025972 | Unclassified | 2610 |
| 507 | Ga0207640_10120696 | 3300025981 | Unclassified | 1877 |
| 508 | Ga0207658_10035575 | 3300025986 | Bacteria | 3567 |
| 509 | Ga0207658_10539730 | 3300025986 | Bacteria | 1042 |
| 510 | Ga0207677_10205337 | 3300026023 | Bacteria | 1569 |
| 511 | Ga0207677_10205707 | 3300026023 | Bacteria | 1568 |
| 512 | Ga0207677_10231629 | 3300026023 | Unclassified | 1488 |
| 513 | Ga0207703_10092601 | 3300026035 | Bacteria | 2544 |
| 514 | Ga0207703_10115737 | 3300026035 | Bacteria | 2294 |
| 515 | Ga0207639_10046136 | 3300026041 | Bacteria | 3286 |
| 516 | Ga0207639_10148925 | 3300026041 | Bacteria | 1958 |
| 517 | Ga0207678_10001863 | 3300026067 | Bacteria | 19249 |
| 518 | Ga0207678_10003097 | 3300026067 | Bacteria | 15057 |
| 519 | Ga0207702_10010082 | 3300026078 | Bacteria | 7919 |
| 520 | Ga0207702_10026902 | 3300026078 | Unclassified | 4776 |
| 521 | Ga0207702_10051335 | 3300026078 | Unclassified | 3485 |
| 522 | Ga0207702_10057807 | 3300026078 | Bacteria | 3298 |
| 523 | Ga0207702_10058337 | 3300026078 | Bacteria | 3285 |
| 524 | Ga0207702_10125164 | 3300026078 | Bacteria | 2306 |
| 525 | Ga0207641_10000316 | 3300026088 | Bacteria | 59952 |
| 526 | Ga0207641_10045290 | 3300026088 | Bacteria | 3704 |
| 527 | Ga0207648_10009781 | 3300026089 | Bacteria | 9162 |
| 528 | Ga0207676_10000107 | 3300026095 | Bacteria | 74255 |
| 529 | Ga0207674_10000034 | 3300026116 | Bacteria | 137337 |
| 530 | Ga0207674_10018519 | 3300026116 | Bacteria | 7566 |
| 531 | Ga0207674_10187677 | 3300026116 | Bacteria | 2017 |
| 532 | Ga0207674_10234939 | 3300026116 | Unclassified | 1781 |
| 533 | Ga0207675_100037976 | 3300026118 | Bacteria | 4494 |
| 534 | Ga0207683_10002001 | 3300026121 | Bacteria | 18033 |
| 535 | Ga0207698_10047854 | 3300026142 | Unclassified | 3243 |
| 536 | Ga0209998_10012286 | 3300027717 | Bacteria | 1778 |
| 537 | Ga0265356_1000070 | 3300028017 | Bacteria | 16853 |
| 538 | Ga0265356_1003056 | 3300028017 | Bacteria | 2144 |
| 539 | Ga0265355_1000879 | 3300028036 | Bacteria | 1778 |
| 540 | Ga0268266_10008585 | 3300028379 | Bacteria | 9074 |
| 541 | Ga0268265_10017334 | 3300028380 | Unclassified | 4966 |
| 542 | Ga0268265_10019865 | 3300028380 | Unclassified | 4679 |
| 543 | Ga0268264_10084068 | 3300028381 | Bacteria | 2728 |
| 544 | Ga0268264_10243347 | 3300028381 | Unclassified | 1667 |
| 545 | Ga0265338_10005052 | 3300028800 | Bacteria | 17408 |
| 546 | Ga0265338_10047790 | 3300028800 | Bacteria | 3903 |
| 547 | Ga0265762_1000209 | 3300030760 | Bacteria | 9385 |
| 548 | Ga0265762_1005393 | 3300030760 | Bacteria | 2292 |
| 549 | Ga0265762_1027154 | 3300030760 | Unclassified | 1073 |
| 550 | Ga0265770_1015686 | 3300030878 | Bacteria | 1155 |
| 551 | Ga0265760_10002341 | 3300031090 | Bacteria | 5535 |
| 552 | Ga0265760_10002446 | 3300031090 | Bacteria | 5418 |
| 553 | Ga0265760_10015471 | 3300031090 | Bacteria | 2187 |
| 554 | Ga0265760_10022737 | 3300031090 | Bacteria | 1818 |
| 555 | Ga0265760_10060299 | 3300031090 | Bacteria | 1152 |
| 556 | Ga0265325_10017766 | 3300031241 | Bacteria | 3951 |
| 557 | Ga0265325_10026504 | 3300031241 | Archaea | 3139 |
| 558 | Ga0265339_10032388 | 3300031249 | Bacteria | 2948 |
| 559 | Ga0265339_10046710 | 3300031249 | Bacteria | 2379 |
| 560 | Ga0265339_10180841 | 3300031249 | Bacteria | 1050 |
| 561 | Ga0265316_10006191 | 3300031344 | Bacteria | 11469 |
| 562 | Ga0265314_10001772 | 3300031711 | Bacteria | 23290 |
| 563 | Ga0265314_10022004 | 3300031711 | Bacteria | 4890 |
| 564 | Ga0316214_1018849 | 3300033545 | Unclassified | 960 |
| 565 | Ga0373930_0012139 | 3300034816 | Unclassified | 1567 |
| 566 | Ga0373938_0020684 | 3300034957 | Bacteria | 1328 |
| 567 | Ga0373926_0011416 | 3300035083 | Bacteria | 2988 |
| 568 | Ga0373926_0128154 | 3300035083 | Unclassified | 960 |
| 569 | Ga0373929_0054493 | 3300035085 | Bacteria | 922 |
| 570 | Ga0373934_0114046 | 3300035086 | Unclassified | 1097 |
| 571 | Ga0373944_0058534 | 3300035089 | Unclassified | 1231 |
| 572 | Ga0373923_0021809 | 3300035111 | Bacteria | 2504 |
| 573 | Ga0373932_0076078 | 3300035112 | Bacteria | 1051 |
| 574 | Ga0373936_0003768 | 3300035113 | Bacteria | 5702 |
| 575 | Ga0373936_0005288 | 3300035113 | Bacteria | 4859 |
| 576 | Ga0373936_0019428 | 3300035113 | Bacteria | 2633 |
| 577 | Ga0373936_0032182 | 3300035113 | Unclassified | 2073 |
| 578 | Ga0373939_0021977 | 3300035114 | Bacteria | 1753 |
| 579 | Ga0373945_0002946 | 3300035116 | Bacteria | 5348 |
| 580 | Ga0373945_0132977 | 3300035116 | Unclassified | 998 |
| 581 | Ga0373953_0013588 | 3300035117 | Unclassified | 2910 |
| 582 | Ga0373954_0243153 | 3300035118 | Unclassified | 886 |
| 583 | Ga0373956_0021806 | 3300035119 | Bacteria | 2734 |
| 584 | Ga0373957_0173694 | 3300035120 | Unclassified | 891 |
| 585 | Ga0373943_0000212 | 3300035170 | Bacteria | 23853 |
| 586 | Ga0373943_0020588 | 3300035170 | Unclassified | 3043 |
| 587 | Ga0373943_0028162 | 3300035170 | Bacteria | 2646 |
| 588 | Ga0373943_0090781 | 3300035170 | Bacteria | 1582 |
| 589 | Ga0373946_0015272 | 3300035171 | Unclassified | 2909 |
| 590 | Ga0373946_0030197 | 3300035171 | Unclassified | 2163 |
| 591 | Ga0373946_0047233 | 3300035171 | Bacteria | 1788 |
| 592 | Ga0373946_0115381 | 3300035171 | Unclassified | 1220 |
| 593 | Ga0373955_0005674 | 3300035172 | Bacteria | 5620 |
| 594 | Ga0373955_0148842 | 3300035172 | Bacteria | 1377 |
| 595 | Ga0373962_0018136 | 3300035242 | Bacteria | 1829 |
| 596 | Ga0373924_0016409 | 3300035410 | Bacteria | 2826 |
| 597 | Ga0373931_0048077 | 3300035691 | Bacteria | 2260 |
| 598 | Ga0373935_0009901 | 3300035692 | Bacteria | 5712 |
| 599 | Ga0373935_0036775 | 3300035692 | Bacteria | 3063 |
| 600 | Ga0373935_0036890 | 3300035692 | Bacteria | 3058 |
| 601 | Ga0373935_0421516 | 3300035692 | Bacteria | 961 |
| 602 | Ga0373935_0488660 | 3300035692 | Unclassified | 893 |
| 603 | Ga0373927_0000062 | 3300035695 | Bacteria | 77303 |
| 604 | Ga0373927_0054099 | 3300035695 | Unclassified | 2596 |
| 605 | Ga0373927_0057657 | 3300035695 | Bacteria | 2511 |
| 606 | Ga0373927_0062760 | 3300035695 | Bacteria | 2403 |
| 607 | Ga0373927_0104522 | 3300035695 | Bacteria | 1844 |
| 608 | Ga0373933_0025596 | 3300035724 | Unclassified | 3384 |
| 609 | Ga0373933_0198490 | 3300035724 | Unclassified | 1283 |
| 610 | Ga0373947_0001513 | 3300035725 | Bacteria | 14265 |
| 611 | Ga0373947_0005251 | 3300035725 | Bacteria | 7568 |
| 612 | Ga0373947_0005799 | 3300035725 | Bacteria | 7200 |
| 613 | Ga0373947_0100430 | 3300035725 | Bacteria | 1818 |
| 614 | Ga0373947_0161578 | 3300035725 | Bacteria | 1449 |
| 615 | Ga0373937_0041219 | 3300036401 | Bacteria | 4212 |
| 616 | Ga0373937_0042128 | 3300036401 | Unclassified | 4165 |
| 617 | Ga0373937_0068296 | 3300036401 | Unclassified | 3277 |
| 618 | Ga0373937_0094374 | 3300036401 | Bacteria | 2774 |
| 619 | Ga0373937_0146006 | 3300036401 | Unclassified | 2214 |
| 620 | Ga0373925_0001746 | 3300037068 | Bacteria | 18185 |
| 621 | Ga0373925_0006323 | 3300037068 | Bacteria | 8726 |
| 622 | Ga0373925_0010718 | 3300037068 | Bacteria | 6648 |
| 623 | Ga0373925_0015099 | 3300037068 | Bacteria | 5582 |
| 624 | Ga0373925_0050212 | 3300037068 | Bacteria | 3111 |
| 625 | Ga0373925_0588364 | 3300037068 | Bacteria | 916 |
| 626 | Ga0395900_0581743 | 3300037418 | Unclassified | 1062 |
| 627 | Ga0395905_0014052 | 3300037471 | Bacteria | 7656 |
| 628 | Ga0395905_0094282 | 3300037471 | Bacteria | 2808 |
| 629 | Ga0395905_0112238 | 3300037471 | Bacteria | 2560 |
| 630 | Ga0395905_0581691 | 3300037471 | Unclassified | 1021 |
| 631 | Ga0436363_0614911 | 3300039450 | Unclassified | 1225 |
| 632 | Ga0439448_0151762 | 3300042005 | Unclassified | 804 |
| 633 | Ga0451577_0000054 | 3300042876 | Bacteria | 278798 |
| 634 | Ga0451577_0069920 | 3300042876 | Bacteria | 3131 |
| 635 | Ga0466972_0157910 | 3300044658 | Bacteria | 1066 |
| 636 | Ga0453683_0086809 | 3300044673 | Unclassified | 1960 |
| 637 | Ga0453683_0382578 | 3300044673 | Bacteria | 906 |
| 638 | Ga0466966_0361578 | 3300044684 | Unclassified | 872 |
| 639 | Ga0466963_0044386 | 3300044694 | Bacteria | 2926 |
| 640 | Ga0466963_0048387 | 3300044694 | Bacteria | 2809 |
| 641 | Ga0466963_0105669 | 3300044694 | Bacteria | 1930 |
| 642 | Ga0466963_0121453 | 3300044694 | Bacteria | 1798 |
| 643 | Ga0453684_0000289 | 3300044712 | Bacteria | 215476 |
| 644 | Ga0466971_0040010 | 3300044719 | Bacteria | 2105 |
| 645 | Ga0466959_0036840 | 3300045049 | Bacteria | 3614 |
| 646 | Ga0466959_0056451 | 3300045049 | Bacteria | 2865 |
| 647 | Ga0466959_0268582 | 3300045049 | Bacteria | 1173 |
| 648 | Ga0451576_0003856 | 3300045051 | Bacteria | 20119 |
| 649 | Ga0451576_0584097 | 3300045051 | Bacteria | 1174 |
| 650 | Ga0451576_0714993 | 3300045051 | Unclassified | 1052 |
| 651 | Ga0466967_0019520 | 3300045976 | Bacteria | 5452 |
| 652 | Ga0466967_0038296 | 3300045976 | Bacteria | 4111 |
| 653 | Ga0466967_0147160 | 3300045976 | Bacteria | 2198 |
| 654 | Ga0466967_0172888 | 3300045976 | Bacteria | 2033 |
| 655 | Ga0466967_0309241 | 3300045976 | Unclassified | 1522 |
| 656 | Ga0466967_0344500 | 3300045976 | Bacteria | 1442 |
| 657 | Ga0466967_0698912 | 3300045976 | Bacteria | 1004 |
| 658 | Ga0495629_0057079 | 3300046459 | Unclassified | 2730 |
| 659 | Ga0495653_0129523 | 3300046463 | Bacteria | 1788 |
| 660 | Ga0495580_0000339 | 3300046472 | Bacteria | 38234 |
| 661 | Ga0495580_0000866 | 3300046472 | Bacteria | 26106 |
| 662 | Ga0495580_0003206 | 3300046472 | Bacteria | 14011 |
| 663 | Ga0495580_0003263 | 3300046472 | Bacteria | 13873 |
| 664 | Ga0495580_0003856 | 3300046472 | Bacteria | 12690 |
| 665 | Ga0495580_0005674 | 3300046472 | Bacteria | 10266 |
| 666 | Ga0495580_0023059 | 3300046472 | Unclassified | 4576 |
| 667 | Ga0495580_0063252 | 3300046472 | Bacteria | 2596 |
| 668 | Ga0495580_0130412 | 3300046472 | Bacteria | 1744 |
| 669 | Ga0495580_0154129 | 3300046472 | Bacteria | 1591 |
| 670 | Ga0495580_0195749 | 3300046472 | Bacteria | 1393 |
| 671 | Ga0495580_0266572 | 3300046472 | Unclassified | 1171 |
| 672 | Ga0495580_0444427 | 3300046472 | Bacteria | 870 |
| 673 | Ga0495582_0000894 | 3300046473 | Bacteria | 16570 |
| 674 | Ga0495582_0030949 | 3300046473 | Bacteria | 2940 |
| 675 | Ga0495582_0184993 | 3300046473 | Bacteria | 1187 |
| 676 | Ga0495582_0330850 | 3300046473 | Bacteria | 877 |
| 677 | Ga0495639_0037390 | 3300046475 | Unclassified | 2176 |
| 678 | Ga0495664_0004937 | 3300046477 | Bacteria | 7300 |
| 679 | Ga0495584_0199963 | 3300046491 | Bacteria | 1016 |
| 680 | Ga0495594_0013915 | 3300046499 | Bacteria | 4210 |
| 681 | Ga0495608_0152948 | 3300046511 | Unclassified | 1470 |
| 682 | Ga0495630_0024839 | 3300046517 | Bacteria | 4430 |
| 683 | Ga0495630_0133421 | 3300046517 | Bacteria | 1886 |
| 684 | Ga0495630_0143584 | 3300046517 | Bacteria | 1815 |
| 685 | Ga0495630_0422208 | 3300046517 | Unclassified | 1022 |
| 686 | Ga0495666_0054371 | 3300046526 | Bacteria | 1920 |
| 687 | Ga0495665_0029483 | 3300046531 | Bacteria | 2939 |
| 688 | Ga0495645_0099866 | 3300046543 | Bacteria | 2065 |
| 689 | Ga0495667_0252387 | 3300046559 | Bacteria | 1123 |
| 690 | Ga0495659_0009891 | 3300046664 | Unclassified | 3050 |
| 691 | Ga0495659_0029741 | 3300046664 | Bacteria | 1898 |
| 692 | Ga0495623_0037487 | 3300046679 | Bacteria | 3102 |
| 693 | Ga0495623_0241978 | 3300046679 | Unclassified | 1019 |
| 694 | Ga0495658_0033030 | 3300046683 | Bacteria | 2831 |
| 695 | Ga0495613_0254123 | 3300046689 | Bacteria | 1226 |
| 696 | Ga0495581_0026292 | 3300047315 | Bacteria | 3375 |
| 697 | Ga0495674_0009986 | 3300047319 | Bacteria | 8995 |
| 698 | Ga0495674_0013336 | 3300047319 | Bacteria | 7728 |
| 699 | Ga0495674_0028375 | 3300047319 | Bacteria | 5103 |
| 700 | Ga0495674_0180898 | 3300047319 | Bacteria | 1756 |
| 701 | Ga0495675_0089216 | 3300047444 | Bacteria | 1936 |
| 702 | Ga0495684_0214841 | 3300047471 | Bacteria | 1412 |
| 703 | Ga0495602_0045200 | 3300048088 | Bacteria | 3987 |
| 704 | Ga0495602_0081377 | 3300048088 | Unclassified | 2723 |
| 705 | Ga0496100_0036261 | 3300048903 | Unclassified | 3109 |
| 706 | Ga0496100_0150376 | 3300048903 | Bacteria | 1660 |
| 707 | Ga0496101_0027085 | 3300048904 | Bacteria | 3988 |
| 708 | Ga0496101_0133524 | 3300048904 | Bacteria | 1887 |
| 709 | Ga0496102_0020662 | 3300048905 | Bacteria | 5818 |
| 710 | Ga0496102_0067995 | 3300048905 | Bacteria | 3268 |
| 711 | Ga0496102_0084613 | 3300048905 | Unclassified | 2927 |
| 712 | Ga0496102_0116704 | 3300048905 | Unclassified | 2491 |
| 713 | Ga0496102_0645887 | 3300048905 | Bacteria | 981 |
| 714 | Ga0496102_0667091 | 3300048905 | Unclassified | 963 |
| 715 | Ga0496103_0334277 | 3300048906 | Unclassified | 974 |
| 716 | Ga0496104_0078352 | 3300048907 | Unclassified | 3149 |
| 717 | Ga0496104_0116617 | 3300048907 | Unclassified | 2563 |
| 718 | Ga0496104_0550592 | 3300048907 | Unclassified | 1064 |
| 719 | Ga0496105_0107507 | 3300048908 | Unclassified | 2303 |
| 720 | Ga0496106_0008877 | 3300048909 | Bacteria | 7429 |
| 721 | Ga0496106_0135771 | 3300048909 | Unclassified | 1932 |
| 722 | Ga0496107_0106815 | 3300048910 | Unclassified | 2056 |
| 723 | Ga0496107_0371209 | 3300048910 | Unclassified | 1064 |
| 724 | Ga0496108_0000364 | 3300048911 | Bacteria | 38115 |
| 725 | Ga0496108_0026743 | 3300048911 | Unclassified | 4762 |
| 726 | Ga0496108_0190433 | 3300048911 | Unclassified | 1778 |
| 727 | Ga0496109_0000083 | 3300048912 | Bacteria | 96495 |
| 728 | Ga0496109_0115669 | 3300048912 | Unclassified | 2496 |
| 729 | Ga0496109_0206519 | 3300048912 | Unclassified | 1847 |
| 730 | Ga0496110_0001378 | 3300048913 | Bacteria | 17513 |
| 731 | Ga0496111_0053702 | 3300048914 | Unclassified | 2911 |
| 732 | Ga0496112_0000033 | 3300048915 | Bacteria | 112312 |
| 733 | Ga0496112_0011761 | 3300048915 | Bacteria | 8014 |
| 734 | Ga0496112_0076649 | 3300048915 | Bacteria | 3307 |
| 735 | Ga0496112_0397455 | 3300048915 | Bacteria | 1318 |
| 736 | Ga0496113_0000409 | 3300048916 | Bacteria | 20747 |
| 737 | Ga0496113_0029114 | 3300048916 | Unclassified | 3983 |
| 738 | Ga0496113_0101382 | 3300048916 | Unclassified | 2232 |
| 739 | Ga0496114_0021085 | 3300048917 | Bacteria | 5297 |
| 740 | Ga0496114_0423022 | 3300048917 | Unclassified | 1180 |
| 741 | Ga0496115_0042329 | 3300048918 | Unclassified | 3628 |
| 742 | Ga0496115_0117965 | 3300048918 | Unclassified | 2183 |
| 743 | Ga0496115_0210376 | 3300048918 | Unclassified | 1606 |
| 744 | Ga0501257_032966 | 3300049686 | Bacteria | 1254 |
| 745 | nmdc:mga05p37_64476_c1 | 3300050507 | Bacteria | 4508 |
| 746 | nmdc:mga0n895_110481_c1 | 3300050512 | Unclassified | 2765 |
| 747 | nmdc:mga0n895_184151_c1 | 3300050512 | Bacteria | 2120 |
| 748 | nmdc:mga0n895_4256_c1 | 3300050512 | Bacteria | 11707 |
| 749 | nmdc:mga0rr50_1418_c2 | 3300050513 | Bacteria | 8335 |
| 750 | nmdc:mga0rr50_61311_c1 | 3300050513 | Bacteria | 2833 |
| 751 | nmdc:mga08x19_11115_c1 | 3300050514 | Bacteria | 5419 |
| 752 | nmdc:mga08x19_119480_c1 | 3300050514 | Bacteria | 1766 |
| 753 | nmdc:mga08x19_51572_c1 | 3300050514 | Unclassified | 2644 |
| 754 | nmdc:mga08x19_8085_c1 | 3300050514 | Bacteria | 6251 |
| 755 | nmdc:mga08x19_84642_c1 | 3300050514 | Unclassified | 2086 |
| 756 | nmdc:mga0a205_94205_c1 | 3300050515 | Unclassified | 2893 |
| 757 | Ga0495601_0139634 | 3300053077 | Bacteria | 1580 |
| 758 | Ga0466962_0161158 | 3300061719 | Bacteria | 1090 |
| 759 | Ga0068851_10005910 | |||
| 760 | MBSR1b_contig_2440585 | |||
| 761 | LJNas_1000061 | |||
| 762 | JGI24752J21851_1002601 | |||
| 763 | JGI24752J21851_1010591 | |||
| 764 | JGI24737J22298_10035794 | |||
| 765 | JGI24743J22301_10003615 | |||
| 766 | JGI24749J21850_1011357 | |||
| 767 | JGI24034J26672_10002033 | |||
| 768 | JGI24751J29686_10009293 | |||
| 769 | rootH1_10241807 | |||
| 770 | Ga0065704_10212625 | |||
| 771 | Ga0065712_10103109 | |||
| 772 | Ga0065715_10002873 | |||
| 773 | Ga0065715_10042721 | |||
| 774 | Ga0065715_10167537 | |||
| 775 | Ga0070658_10032446 | |||
| 776 | Ga0070658_10050888 | |||
| 777 | Ga0070658_10484135 | |||
| 778 | Ga0070676_10022196 | |||
| 779 | Ga0070676_10033075 | |||
| 780 | Ga0070683_100003207 | |||
| 781 | Ga0070683_100020247 | |||
| 782 | Ga0070683_100265152 | |||
| 783 | Ga0070690_100006515 | |||
| 784 | Ga0070690_100025748 | |||
| 785 | Ga0070670_100098393 | |||
| 786 | Ga0070670_100161096 | |||
| 787 | Ga0070677_10004840 | |||
| 788 | Ga0070666_10022479 | |||
| 789 | Ga0070680_100022024 | |||
| 790 | Ga0070682_100008804 | |||
| 791 | Ga0070682_100020364 | |||
| 792 | Ga0068868_100015706 | |||
| 793 | Ga0068868_100022154 | |||
| 794 | Ga0068868_100264850 | |||
| 795 | Ga0068868_100523575 | |||
| 796 | Ga0070660_100007722 | |||
| 797 | Ga0070660_100010443 | |||
| 798 | Ga0070660_100011778 | |||
| 799 | Ga0070689_100021775 | |||
| 800 | Ga0070661_100013761 | |||
| 801 | Ga0070668_100011552 | |||
| 802 | Ga0070668_100012680 | |||
| 803 | Ga0070668_100722252 | |||
| 804 | Ga0070669_100004020 | |||
| 805 | Ga0070675_100006644 | |||
| 806 | Ga0070671_100041823 | |||
| 807 | Ga0070674_100017358 | |||
| 808 | Ga0070674_100223904 | |||
| 809 | Ga0070688_100005503 | |||
| 810 | Ga0070659_100011195 | |||
| 811 | Ga0070659_100190079 | |||
| 812 | Ga0070667_100010376 | |||
| 813 | Ga0070667_100326021 | |||
| 814 | Ga0070709_10008347 | |||
| 815 | Ga0070709_10018507 | |||
| 816 | Ga0070709_10022109 | |||
| 817 | Ga0070709_10043382 | |||
| 818 | Ga0070709_10117888 | |||
| 819 | Ga0070709_10132346 | |||
| 820 | Ga0070709_10164883 | |||
| 821 | Ga0070709_10186990 | |||
| 822 | Ga0070709_10297268 | |||
| 823 | Ga0070714_100000299 | |||
| 824 | Ga0070714_100025638 | |||
| 825 | Ga0070714_100029479 | |||
| 826 | Ga0070714_100059308 | |||
| 827 | Ga0070714_100078534 | |||
| 828 | Ga0070714_100080357 | |||
| 829 | Ga0070714_100103193 | |||
| 830 | Ga0070714_100177061 | |||
| 831 | Ga0070714_100211748 | |||
| 832 | Ga0070714_100211907 | |||
| 833 | Ga0070714_100610376 | |||
| 834 | Ga0070713_100000060 | |||
| 835 | Ga0070713_100000108 | |||
| 836 | Ga0070713_100003414 | |||
| 837 | Ga0070713_100036661 | |||
| 838 | Ga0070713_100056150 | |||
| 839 | Ga0070713_100170424 | |||
| 840 | Ga0070713_100223188 | |||
| 841 | Ga0070713_100261661 | |||
| 842 | Ga0070710_10045241 | |||
| 843 | Ga0070710_10093711 | |||
| 844 | Ga0070710_10108807 | |||
| 845 | Ga0070710_10348798 | |||
| 846 | Ga0070711_100000525 | |||
| 847 | Ga0070711_100000689 | |||
| 848 | Ga0070711_100002403 | |||
| 849 | Ga0070711_100023292 | |||
| 850 | Ga0070711_100032880 | |||
| 851 | Ga0070711_100674280 | |||
| 852 | Ga0070705_100088614 | |||
| 853 | Ga0070705_100474452 | |||
| 854 | Ga0070708_100000347 | |||
| 855 | Ga0070708_100000500 | |||
| 856 | Ga0070708_100001815 | |||
| 857 | Ga0070708_100006972 | |||
| 858 | Ga0070708_100010270 | |||
| 859 | Ga0070708_100012796 | |||
| 860 | Ga0070708_100014353 | |||
| 861 | Ga0070708_100020138 | |||
| 862 | Ga0070708_100042149 | |||
| 863 | Ga0070708_100157258 | |||
| 864 | Ga0070708_100248526 | |||
| 865 | Ga0070663_100026061 | |||
| 866 | Ga0070663_100125183 | |||
| 867 | Ga0070678_100311334 | |||
| 868 | Ga0070662_100009117 | |||
| 869 | Ga0070662_100037286 | |||
| 870 | Ga0070662_100182433 | |||
| 871 | Ga0070681_10049656 | |||
| 872 | Ga0070681_10409687 | |||
| 873 | Ga0068867_100016049 | |||
| 874 | Ga0068867_100049758 | |||
| 875 | Ga0070685_10010306 | |||
| 876 | Ga0070685_10264472 | |||
| 877 | Ga0070706_100001585 | |||
| 878 | Ga0070706_100004125 | |||
| 879 | Ga0070706_100024440 | |||
| 880 | Ga0070706_100026294 | |||
| 881 | Ga0070706_100155352 | |||
| 882 | Ga0070706_100167799 | |||
| 883 | Ga0070706_100302393 | |||
| 884 | Ga0070707_100002300 | |||
| 885 | Ga0070707_100002700 | |||
| 886 | Ga0070707_100022750 | |||
| 887 | Ga0070707_100049851 | |||
| 888 | Ga0070707_100055888 | |||
| 889 | Ga0070707_100079034 | |||
| 890 | Ga0070707_100093610 | |||
| 891 | Ga0070707_100184787 | |||
| 892 | Ga0070707_100306070 | |||
| 893 | Ga0070707_100382667 | |||
| 894 | Ga0070707_100394397 | |||
| 895 | Ga0070698_100000547 | |||
| 896 | Ga0070698_100009673 | |||
| 897 | Ga0070698_100095364 | |||
| 898 | Ga0070698_100415171 | |||
| 899 | Ga0070698_100431350 | |||
| 900 | Ga0070699_100000343 | |||
| 901 | Ga0070699_100010416 | |||
| 902 | Ga0070699_100079592 | |||
| 903 | Ga0070699_100090096 | |||
| 904 | Ga0070699_100126879 | |||
| 905 | Ga0070699_100135513 | |||
| 906 | Ga0070699_100368411 | |||
| 907 | Ga0070679_100046636 | |||
| 908 | Ga0070679_100213165 | |||
| 909 | Ga0070684_100006119 | |||
| 910 | Ga0070684_100042749 | |||
| 911 | Ga0070684_100883401 | |||
| 912 | Ga0070697_100000208 | |||
| 913 | Ga0070697_100000786 | |||
| 914 | Ga0070697_100000960 | |||
| 915 | Ga0070697_100002199 | |||
| 916 | Ga0070697_100002461 | |||
| 917 | Ga0070697_100028329 | |||
| 918 | Ga0070697_100034470 | |||
| 919 | Ga0070697_100232976 | |||
| 920 | Ga0070697_100338669 | |||
| 921 | Ga0070697_100411065 | |||
| 922 | Ga0068853_100004876 | |||
| 923 | Ga0068853_100075519 | |||
| 924 | Ga0068853_100164603 | |||
| 925 | Ga0070672_100175402 | |||
| 926 | Ga0070686_100542463 | |||
| 927 | Ga0070695_100046775 | |||
| 928 | Ga0070695_100054368 | |||
| 929 | Ga0070695_100570208 | |||
| 930 | Ga0070696_100019515 | |||
| 931 | Ga0070693_100023440 | |||
| 932 | Ga0070665_100021084 | |||
| 933 | Ga0070665_100109609 | |||
| 934 | Ga0070704_100081759 | |||
| 935 | Ga0068855_100037722 | |||
| 936 | Ga0068855_100067240 | |||
| 937 | Ga0068855_100097672 | |||
| 938 | Ga0068855_100378739 | |||
| 939 | Ga0068855_100380745 | |||
| 940 | Ga0068855_100472397 | |||
| 941 | Ga0070664_100028528 | |||
| 942 | Ga0070664_100067206 | |||
| 943 | Ga0068857_100004674 | |||
| 944 | Ga0068857_100150096 | |||
| 945 | Ga0068857_100437876 | |||
| 946 | Ga0068854_100069057 | |||
| 947 | Ga0068854_100078058 | |||
| 948 | Ga0068854_100196552 | |||
| 949 | Ga0068856_100030898 | |||
| 950 | Ga0068856_100051816 | |||
| 951 | Ga0068856_100068780 | |||
| 952 | Ga0068856_100071748 | |||
| 953 | Ga0070702_100454051 | |||
| 954 | Ga0068852_100019600 | |||
| 955 | Ga0068852_100046909 | |||
| 956 | Ga0068852_100592868 | |||
| 957 | Ga0068859_100028578 | |||
| 958 | Ga0068859_100033577 | |||
| 959 | Ga0068864_100012096 | |||
| 960 | Ga0068866_10042460 | |||
| 961 | Ga0068861_100341956 | |||
| 962 | Ga0068863_100041428 | |||
| 963 | Ga0068863_100056904 | |||
| 964 | Ga0068858_100022290 | |||
| 965 | Ga0068858_100037574 | |||
| 966 | Ga0068860_100101479 | |||
| 967 | Ga0068862_100014886 | |||
| 968 | Ga0068862_100064053 | |||
| 969 | Ga0070717_10000503 | |||
| 970 | Ga0070717_10001316 | |||
| 971 | Ga0070717_10004398 | |||
| 972 | Ga0070717_10016942 | |||
| 973 | Ga0070717_10023410 | |||
| 974 | Ga0070717_10039264 | |||
| 975 | Ga0070717_10098862 | |||
| 976 | Ga0070717_10112889 | |||
| 977 | Ga0070717_10117610 | |||
| 978 | Ga0070717_10142678 | |||
| 979 | Ga0070717_10288545 | |||
| 980 | Ga0070717_10385288 | |||
| 981 | Ga0070717_10426547 | |||
| 982 | Ga0070717_10490166 | |||
| 983 | Ga0070717_10573261 | |||
| 984 | Ga0070717_10659089 | |||
| 985 | Ga0070715_10000405 | |||
| 986 | Ga0070715_10005691 | |||
| 987 | Ga0070715_10006368 | |||
| 988 | Ga0070715_10043926 | |||
| 989 | Ga0070716_100000064 | |||
| 990 | Ga0070716_100004991 | |||
| 991 | Ga0070716_100048249 | |||
| 992 | Ga0070716_100064277 | |||
| 993 | Ga0070716_100069966 | |||
| 994 | Ga0070716_100072529 | |||
| 995 | Ga0070712_100000179 | |||
| 996 | Ga0070712_100000196 | |||
| 997 | Ga0070712_100000780 | |||
| 998 | Ga0070712_100001325 | |||
| 999 | Ga0070712_100019136 | |||
| 1000 | Ga0070712_100145593 | |||
| 1001 | Ga0070712_100159898 | |||
| 1002 | Ga0070712_100489881 | |||
| 1003 | Ga0097621_100005110 | |||
| 1004 | Ga0097621_100268955 | |||
| 1005 | Ga0097621_100300224 | |||
| 1006 | Ga0068871_100012682 | |||
| 1007 | Ga0068871_100019808 | |||
| 1008 | Ga0068871_100070708 | |||
| 1009 | Ga0068871_100227202 | |||
| 1010 | Ga0068871_100244332 | |||
| 1011 | Ga0068871_100287301 | |||
| 1012 | Ga0068871_100427056 | |||
| 1013 | Ga0075434_100004944 | |||
| 1014 | Ga0075434_100012876 | |||
| 1015 | Ga0075434_100087387 | |||
| 1016 | Ga0075436_100000301 | |||
| 1017 | Ga0075436_100016833 | |||
| 1018 | Ga0075436_100060072 | |||
| 1019 | Ga0075436_100185470 | |||
| 1020 | Ga0075436_100445499 | |||
| 1021 | Ga0097620_100028575 | |||
| 1022 | Ga0097620_100033578 | |||
| 1023 | Ga0075435_100021891 | |||
| 1024 | Ga0075435_100025649 | |||
| 1025 | Ga0075435_100049415 | |||
| 1026 | Ga0075435_100072631 | |||
| 1027 | Ga0075435_100594686 | |||
| 1028 | Ga0099794_10077671 | |||
| 1029 | Ga0099794_10093061 | |||
| 1030 | Ga0099795_10027875 | |||
| 1031 | Ga0099795_10033786 | |||
| 1032 | Ga0099795_10041901 | |||
| 1033 | Ga0105250_10027720 | |||
| 1034 | Ga0105240_10012666 | |||
| 1035 | Ga0105240_10037944 | |||
| 1036 | Ga0105240_10053134 | |||
| 1037 | Ga0105240_10053919 | |||
| 1038 | Ga0105240_10077399 | |||
| 1039 | Ga0105240_10111707 | |||
| 1040 | Ga0105240_10143778 | |||
| 1041 | Ga0105240_10217993 | |||
| 1042 | Ga0111539_10659627 | |||
| 1043 | Ga0105245_10017450 | |||
| 1044 | Ga0105245_10055492 | |||
| 1045 | Ga0105245_10071577 | |||
| 1046 | Ga0105245_10138133 | |||
| 1047 | Ga0105247_10003282 | |||
| 1048 | Ga0105247_10004648 | |||
| 1049 | Ga0105247_10158498 | |||
| 1050 | Ga0114129_10060514 | |||
| 1051 | Ga0105243_10122911 | |||
| 1052 | Ga0105243_10273378 | |||
| 1053 | Ga0105241_10005002 | |||
| 1054 | Ga0105241_10016473 | |||
| 1055 | Ga0105241_10168100 | |||
| 1056 | Ga0105242_10034402 | |||
| 1057 | Ga0105242_10387873 | |||
| 1058 | Ga0105248_10010666 | |||
| 1059 | Ga0105248_10565179 | |||
| 1060 | Ga0105248_11262506 | |||
| 1061 | Ga0105237_10024915 | |||
| 1062 | Ga0105237_10096786 | |||
| 1063 | Ga0105237_10184669 | |||
| 1064 | Ga0105237_10289037 | |||
| 1065 | Ga0105238_10009704 | |||
| 1066 | Ga0105238_10026525 | |||
| 1067 | Ga0105238_10032651 | |||
| 1068 | Ga0105238_10113335 | |||
| 1069 | Ga0105238_10185734 | |||
| 1070 | Ga0105249_10001809 | |||
| 1071 | Ga0105249_10098320 | |||
| 1072 | Ga0105249_10142880 | |||
| 1073 | Ga0099796_10014462 | |||
| 1074 | Ga0105239_10177821 | |||
| 1075 | Ga0105246_10002192 | |||
| 1076 | Ga0105246_10025587 | |||
| 1077 | Ga0105246_10173335 | |||
| 1078 | Ga0157373_10015692 | |||
| 1079 | Ga0157373_10017869 | |||
| 1080 | Ga0157373_10024229 | |||
| 1081 | Ga0157373_10082091 | |||
| 1082 | Ga0157371_10008238 | |||
| 1083 | Ga0157371_10462070 | |||
| 1084 | Ga0157370_10156555 | |||
| 1085 | Ga0157369_10000794 | |||
| 1086 | Ga0157369_10011531 | |||
| 1087 | Ga0157369_10020732 | |||
| 1088 | Ga0157369_10023457 | |||
| 1089 | Ga0157369_10024478 | |||
| 1090 | Ga0157369_10037666 | |||
| 1091 | Ga0157369_10093524 | |||
| 1092 | Ga0157369_10162142 | |||
| 1093 | Ga0157374_10001851 | |||
| 1094 | Ga0157374_10005139 | |||
| 1095 | Ga0157374_10058016 | |||
| 1096 | Ga0157374_10364126 | |||
| 1097 | Ga0157374_10583412 | |||
| 1098 | Ga0157378_10015111 | |||
| 1099 | Ga0157378_10066556 | |||
| 1100 | Ga0157378_10066673 | |||
| 1101 | Ga0157378_10431652 | |||
| 1102 | Ga0157378_10491156 | |||
| 1103 | Ga0157378_10626418 | |||
| 1104 | Ga0163162_10039073 | |||
| 1105 | Ga0163162_10057062 | |||
| 1106 | Ga0163162_10144581 | |||
| 1107 | Ga0163162_10163674 | |||
| 1108 | Ga0163162_10661148 | |||
| 1109 | Ga0157372_10000661 | |||
| 1110 | Ga0157372_10012631 | |||
| 1111 | Ga0157372_10024144 | |||
| 1112 | Ga0157372_10045950 | |||
| 1113 | Ga0157372_10144935 | |||
| 1114 | Ga0157372_10230969 | |||
| 1115 | Ga0157372_10449285 | |||
| 1116 | Ga0157375_10066909 | |||
| 1117 | Ga0163163_10005225 | |||
| 1118 | Ga0163163_10060017 | |||
| 1119 | Ga0163163_10167569 | |||
| 1120 | Ga0157377_10001671 | |||
| 1121 | Ga0157379_10011817 | |||
| 1122 | Ga0157379_10040955 | |||
| 1123 | Ga0157379_10078863 | |||
| 1124 | Ga0157376_10002705 | |||
| 1125 | Ga0157376_10098002 | |||
| 1126 | Ga0157376_10284399 | |||
| 1127 | Ga0182006_1035562 | |||
| 1128 | Ga0182006_1046161 | |||
| 1129 | Ga0182007_10015342 | |||
| 1130 | Ga0182007_10064944 | |||
| 1131 | Ga0182005_1017450 | |||
| 1132 | Ga0163161_10009403 | |||
| 1133 | Ga0224570_100933 | |||
| 1134 | Ga0224569_100376 | |||
| 1135 | Ga0224572_1005365 | |||
| 1136 | Ga0228598_1001637 | |||
| 1137 | Ga0228598_1002092 | |||
| 1138 | Ga0228598_1005914 | |||
| 1139 | Ga0207697_10007237 | |||
| 1140 | Ga0207656_10012495 | |||
| 1141 | Ga0207656_10038570 | |||
| 1142 | Ga0207692_10183753 | |||
| 1143 | Ga0207692_10260393 | |||
| 1144 | Ga0207642_10009967 | |||
| 1145 | Ga0207688_10005213 | |||
| 1146 | Ga0207680_10058928 | |||
| 1147 | Ga0207647_10001373 | |||
| 1148 | Ga0207647_10249763 | |||
| 1149 | Ga0207685_10004100 | |||
| 1150 | Ga0207685_10020208 | |||
| 1151 | Ga0207685_10123423 | |||
| 1152 | Ga0207699_10028522 | |||
| 1153 | Ga0207699_10029803 | |||
| 1154 | Ga0207699_10062011 | |||
| 1155 | Ga0207699_10067282 | |||
| 1156 | Ga0207699_10261019 | |||
| 1157 | Ga0207645_10000011 | |||
| 1158 | Ga0207645_10010651 | |||
| 1159 | Ga0207643_10003295 | |||
| 1160 | Ga0207684_10000081 | |||
| 1161 | Ga0207684_10003969 | |||
| 1162 | Ga0207684_10045476 | |||
| 1163 | Ga0207684_10091608 | |||
| 1164 | Ga0207684_10092418 | |||
| 1165 | Ga0207684_10226285 | |||
| 1166 | Ga0207684_10375435 | |||
| 1167 | Ga0207654_10007606 | |||
| 1168 | Ga0207654_10013233 | |||
| 1169 | Ga0207654_10043545 | |||
| 1170 | Ga0207654_10230504 | |||
| 1171 | Ga0207654_10264618 | |||
| 1172 | Ga0207707_10058109 | |||
| 1173 | Ga0207707_10069742 | |||
| 1174 | Ga0207695_10008921 | |||
| 1175 | Ga0207695_10029851 | |||
| 1176 | Ga0207695_10120246 | |||
| 1177 | Ga0207695_10130145 | |||
| 1178 | Ga0207695_10244959 | |||
| 1179 | Ga0207671_10021152 | |||
| 1180 | Ga0207671_10205210 | |||
| 1181 | Ga0207671_10384270 | |||
| 1182 | Ga0207671_10576780 | |||
| 1183 | Ga0207693_10000042 | |||
| 1184 | Ga0207693_10000191 | |||
| 1185 | Ga0207693_10000221 | |||
| 1186 | Ga0207693_10008695 | |||
| 1187 | Ga0207693_10022404 | |||
| 1188 | Ga0207693_10250218 | |||
| 1189 | Ga0207693_10352395 | |||
| 1190 | Ga0207663_10000544 | |||
| 1191 | Ga0207663_10001591 | |||
| 1192 | Ga0207663_10006091 | |||
| 1193 | Ga0207663_10034774 | |||
| 1194 | Ga0207663_10048279 | |||
| 1195 | Ga0207663_10068797 | |||
| 1196 | Ga0207663_10373890 | |||
| 1197 | Ga0207660_10259345 | |||
| 1198 | Ga0207662_10000594 | |||
| 1199 | Ga0207657_10001258 | |||
| 1200 | Ga0207657_10003804 | |||
| 1201 | Ga0207657_10018061 | |||
| 1202 | Ga0207649_10002513 | |||
| 1203 | Ga0207649_10039882 | |||
| 1204 | Ga0207649_10366415 | |||
| 1205 | Ga0207652_10120860 | |||
| 1206 | Ga0207652_10130487 | |||
| 1207 | Ga0207646_10000880 | |||
| 1208 | Ga0207646_10002622 | |||
| 1209 | Ga0207646_10019808 | |||
| 1210 | Ga0207646_10074290 | |||
| 1211 | Ga0207646_10079670 | |||
| 1212 | Ga0207646_10153506 | |||
| 1213 | Ga0207646_10206620 | |||
| 1214 | Ga0207646_10316540 | |||
| 1215 | Ga0207646_10448403 | |||
| 1216 | Ga0207681_10051054 | |||
| 1217 | Ga0207694_10197766 | |||
| 1218 | Ga0207694_10473972 | |||
| 1219 | Ga0207650_10002279 | |||
| 1220 | Ga0207650_10081026 | |||
| 1221 | Ga0207659_10026076 | |||
| 1222 | Ga0207687_10005580 | |||
| 1223 | Ga0207700_10000358 | |||
| 1224 | Ga0207700_10002265 | |||
| 1225 | Ga0207700_10054528 | |||
| 1226 | Ga0207700_10091335 | |||
| 1227 | Ga0207700_10105627 | |||
| 1228 | Ga0207700_10113979 | |||
| 1229 | Ga0207700_10243216 | |||
| 1230 | Ga0207664_10000320 | |||
| 1231 | Ga0207664_10111356 | |||
| 1232 | Ga0207664_10303295 | |||
| 1233 | Ga0207664_10417759 | |||
| 1234 | Ga0207664_10456258 | |||
| 1235 | Ga0207644_10207527 | |||
| 1236 | Ga0207690_10123048 | |||
| 1237 | Ga0207690_10136210 | |||
| 1238 | Ga0207706_10000698 | |||
| 1239 | Ga0207706_10001011 | |||
| 1240 | Ga0207706_10027530 | |||
| 1241 | Ga0207686_10090261 | |||
| 1242 | Ga0207686_10433941 | |||
| 1243 | Ga0207709_10407725 | |||
| 1244 | Ga0207670_10033080 | |||
| 1245 | Ga0207665_10016946 | |||
| 1246 | Ga0207665_10086683 | |||
| 1247 | Ga0207665_10119231 | |||
| 1248 | Ga0207691_10006128 | |||
| 1249 | Ga0207711_10010872 | |||
| 1250 | Ga0207711_10026059 | |||
| 1251 | Ga0207689_10000194 | |||
| 1252 | Ga0207661_10013948 | |||
| 1253 | Ga0207661_10130360 | |||
| 1254 | Ga0207679_10000051 | |||
| 1255 | Ga0207679_10000172 | |||
| 1256 | Ga0207679_10038142 | |||
| 1257 | Ga0207679_10085591 | |||
| 1258 | Ga0207667_10015081 | |||
| 1259 | Ga0207667_10056659 | |||
| 1260 | Ga0207667_10476150 | |||
| 1261 | Ga0207651_10562823 | |||
| 1262 | Ga0207712_10028731 | |||
| 1263 | Ga0207712_10033549 | |||
| 1264 | Ga0207668_10063210 | |||
| 1265 | Ga0207640_10120696 | |||
| 1266 | Ga0207658_10035575 | |||
| 1267 | Ga0207658_10539730 | |||
| 1268 | Ga0207677_10205337 | |||
| 1269 | Ga0207677_10205707 | |||
| 1270 | Ga0207677_10231629 | |||
| 1271 | Ga0207703_10092601 | |||
| 1272 | Ga0207703_10115737 | |||
| 1273 | Ga0207639_10046136 | |||
| 1274 | Ga0207639_10148925 | |||
| 1275 | Ga0207678_10001863 | |||
| 1276 | Ga0207678_10003097 | |||
| 1277 | Ga0207702_10010082 | |||
| 1278 | Ga0207702_10026902 | |||
| 1279 | Ga0207702_10051335 | |||
| 1280 | Ga0207702_10057807 | |||
| 1281 | Ga0207702_10058337 | |||
| 1282 | Ga0207702_10125164 | |||
| 1283 | Ga0207641_10000316 | |||
| 1284 | Ga0207641_10045290 | |||
| 1285 | Ga0207648_10009781 | |||
| 1286 | Ga0207676_10000107 | |||
| 1287 | Ga0207674_10000034 | |||
| 1288 | Ga0207674_10018519 | |||
| 1289 | Ga0207674_10187677 | |||
| 1290 | Ga0207674_10234939 | |||
| 1291 | Ga0207675_100037976 | |||
| 1292 | Ga0207683_10002001 | |||
| 1293 | Ga0207698_10047854 | |||
| 1294 | Ga0209998_10012286 | |||
| 1295 | Ga0265356_1000070 | |||
| 1296 | Ga0265356_1003056 | |||
| 1297 | Ga0265355_1000879 | |||
| 1298 | Ga0268266_10008585 | |||
| 1299 | Ga0268265_10017334 | |||
| 1300 | Ga0268265_10019865 | |||
| 1301 | Ga0268264_10084068 | |||
| 1302 | Ga0268264_10243347 | |||
| 1303 | Ga0265338_10005052 | |||
| 1304 | Ga0265338_10047790 | |||
| 1305 | Ga0265762_1000209 | |||
| 1306 | Ga0265762_1005393 | |||
| 1307 | Ga0265762_1027154 | |||
| 1308 | Ga0265770_1015686 | |||
| 1309 | Ga0265760_10002341 | |||
| 1310 | Ga0265760_10002446 | |||
| 1311 | Ga0265760_10015471 | |||
| 1312 | Ga0265760_10022737 | |||
| 1313 | Ga0265760_10060299 | |||
| 1314 | Ga0265325_10017766 | |||
| 1315 | Ga0265325_10026504 | |||
| 1316 | Ga0265339_10032388 | |||
| 1317 | Ga0265339_10046710 | |||
| 1318 | Ga0265339_10180841 | |||
| 1319 | Ga0265316_10006191 | |||
| 1320 | Ga0265314_10001772 | |||
| 1321 | Ga0265314_10022004 | |||
| 1322 | Ga0316214_1018849 | |||
| 1323 | Ga0373930_0012139 | |||
| 1324 | Ga0373938_0020684 | |||
| 1325 | Ga0373926_0011416 | |||
| 1326 | Ga0373926_0128154 | |||
| 1327 | Ga0373929_0054493 | |||
| 1328 | Ga0373934_0114046 | |||
| 1329 | Ga0373944_0058534 | |||
| 1330 | Ga0373923_0021809 | |||
| 1331 | Ga0373932_0076078 | |||
| 1332 | Ga0373936_0003768 | |||
| 1333 | Ga0373936_0005288 | |||
| 1334 | Ga0373936_0019428 | |||
| 1335 | Ga0373936_0032182 | |||
| 1336 | Ga0373939_0021977 | |||
| 1337 | Ga0373945_0002946 | |||
| 1338 | Ga0373945_0132977 | |||
| 1339 | Ga0373953_0013588 | |||
| 1340 | Ga0373954_0243153 | |||
| 1341 | Ga0373956_0021806 | |||
| 1342 | Ga0373957_0173694 | |||
| 1343 | Ga0373943_0000212 | |||
| 1344 | Ga0373943_0020588 | |||
| 1345 | Ga0373943_0028162 | |||
| 1346 | Ga0373943_0090781 | |||
| 1347 | Ga0373946_0015272 | |||
| 1348 | Ga0373946_0030197 | |||
| 1349 | Ga0373946_0047233 | |||
| 1350 | Ga0373946_0115381 | |||
| 1351 | Ga0373955_0005674 | |||
| 1352 | Ga0373955_0148842 | |||
| 1353 | Ga0373962_0018136 | |||
| 1354 | Ga0373924_0016409 | |||
| 1355 | Ga0373931_0048077 | |||
| 1356 | Ga0373935_0009901 | |||
| 1357 | Ga0373935_0036775 | |||
| 1358 | Ga0373935_0036890 | |||
| 1359 | Ga0373935_0421516 | |||
| 1360 | Ga0373935_0488660 | |||
| 1361 | Ga0373927_0000062 | |||
| 1362 | Ga0373927_0054099 | |||
| 1363 | Ga0373927_0057657 | |||
| 1364 | Ga0373927_0062760 | |||
| 1365 | Ga0373927_0104522 | |||
| 1366 | Ga0373933_0025596 | |||
| 1367 | Ga0373933_0198490 | |||
| 1368 | Ga0373947_0001513 | |||
| 1369 | Ga0373947_0005251 | |||
| 1370 | Ga0373947_0005799 | |||
| 1371 | Ga0373947_0100430 | |||
| 1372 | Ga0373947_0161578 | |||
| 1373 | Ga0373937_0041219 | |||
| 1374 | Ga0373937_0042128 | |||
| 1375 | Ga0373937_0068296 | |||
| 1376 | Ga0373937_0094374 | |||
| 1377 | Ga0373937_0146006 | |||
| 1378 | Ga0373925_0001746 | |||
| 1379 | Ga0373925_0006323 | |||
| 1380 | Ga0373925_0010718 | |||
| 1381 | Ga0373925_0015099 | |||
| 1382 | Ga0373925_0050212 | |||
| 1383 | Ga0373925_0588364 | |||
| 1384 | Ga0395900_0581743 | |||
| 1385 | Ga0395905_0014052 | |||
| 1386 | Ga0395905_0094282 | |||
| 1387 | Ga0395905_0112238 | |||
| 1388 | Ga0395905_0581691 | |||
| 1389 | Ga0436363_0614911 | |||
| 1390 | Ga0439448_0151762 | |||
| 1391 | Ga0451577_0000054 | |||
| 1392 | Ga0451577_0069920 | |||
| 1393 | Ga0466972_0157910 | |||
| 1394 | Ga0453683_0086809 | |||
| 1395 | Ga0453683_0382578 | |||
| 1396 | Ga0466966_0361578 | |||
| 1397 | Ga0466963_0044386 | |||
| 1398 | Ga0466963_0048387 | |||
| 1399 | Ga0466963_0105669 | |||
| 1400 | Ga0466963_0121453 | |||
| 1401 | Ga0453684_0000289 | |||
| 1402 | Ga0466971_0040010 | |||
| 1403 | Ga0466959_0036840 | |||
| 1404 | Ga0466959_0056451 | |||
| 1405 | Ga0466959_0268582 | |||
| 1406 | Ga0451576_0003856 | |||
| 1407 | Ga0451576_0584097 | |||
| 1408 | Ga0451576_0714993 | |||
| 1409 | Ga0466967_0019520 | |||
| 1410 | Ga0466967_0038296 | |||
| 1411 | Ga0466967_0147160 | |||
| 1412 | Ga0466967_0172888 | |||
| 1413 | Ga0466967_0309241 | |||
| 1414 | Ga0466967_0344500 | |||
| 1415 | Ga0466967_0698912 | |||
| 1416 | Ga0495629_0057079 | |||
| 1417 | Ga0495653_0129523 | |||
| 1418 | Ga0495580_0000339 | |||
| 1419 | Ga0495580_0000866 | |||
| 1420 | Ga0495580_0003206 | |||
| 1421 | Ga0495580_0003263 | |||
| 1422 | Ga0495580_0003856 | |||
| 1423 | Ga0495580_0005674 | |||
| 1424 | Ga0495580_0023059 | |||
| 1425 | Ga0495580_0063252 | |||
| 1426 | Ga0495580_0130412 | |||
| 1427 | Ga0495580_0154129 | |||
| 1428 | Ga0495580_0195749 | |||
| 1429 | Ga0495580_0266572 | |||
| 1430 | Ga0495580_0444427 | |||
| 1431 | Ga0495582_0000894 | |||
| 1432 | Ga0495582_0030949 | |||
| 1433 | Ga0495582_0184993 | |||
| 1434 | Ga0495582_0330850 | |||
| 1435 | Ga0495639_0037390 | |||
| 1436 | Ga0495664_0004937 | |||
| 1437 | Ga0495584_0199963 | |||
| 1438 | Ga0495594_0013915 | |||
| 1439 | Ga0495608_0152948 | |||
| 1440 | Ga0495630_0024839 | |||
| 1441 | Ga0495630_0133421 | |||
| 1442 | Ga0495630_0143584 | |||
| 1443 | Ga0495630_0422208 | |||
| 1444 | Ga0495666_0054371 | |||
| 1445 | Ga0495665_0029483 | |||
| 1446 | Ga0495645_0099866 | |||
| 1447 | Ga0495667_0252387 | |||
| 1448 | Ga0495659_0009891 | |||
| 1449 | Ga0495659_0029741 | |||
| 1450 | Ga0495623_0037487 | |||
| 1451 | Ga0495623_0241978 | |||
| 1452 | Ga0495658_0033030 | |||
| 1453 | Ga0495613_0254123 | |||
| 1454 | Ga0495581_0026292 | |||
| 1455 | Ga0495674_0009986 | |||
| 1456 | Ga0495674_0013336 | |||
| 1457 | Ga0495674_0028375 | |||
| 1458 | Ga0495674_0180898 | |||
| 1459 | Ga0495675_0089216 | |||
| 1460 | Ga0495684_0214841 | |||
| 1461 | Ga0495602_0045200 | |||
| 1462 | Ga0495602_0081377 | |||
| 1463 | Ga0496100_0036261 | |||
| 1464 | Ga0496100_0150376 | |||
| 1465 | Ga0496101_0027085 | |||
| 1466 | Ga0496101_0133524 | |||
| 1467 | Ga0496102_0020662 | |||
| 1468 | Ga0496102_0067995 | |||
| 1469 | Ga0496102_0084613 | |||
| 1470 | Ga0496102_0116704 | |||
| 1471 | Ga0496102_0645887 | |||
| 1472 | Ga0496102_0667091 | |||
| 1473 | Ga0496103_0334277 | |||
| 1474 | Ga0496104_0078352 | |||
| 1475 | Ga0496104_0116617 | |||
| 1476 | Ga0496104_0550592 | |||
| 1477 | Ga0496105_0107507 | |||
| 1478 | Ga0496106_0008877 | |||
| 1479 | Ga0496106_0135771 | |||
| 1480 | Ga0496107_0106815 | |||
| 1481 | Ga0496107_0371209 | |||
| 1482 | Ga0496108_0000364 | |||
| 1483 | Ga0496108_0026743 | |||
| 1484 | Ga0496108_0190433 | |||
| 1485 | Ga0496109_0000083 | |||
| 1486 | Ga0496109_0115669 | |||
| 1487 | Ga0496109_0206519 | |||
| 1488 | Ga0496110_0001378 | |||
| 1489 | Ga0496111_0053702 | |||
| 1490 | Ga0496112_0000033 | |||
| 1491 | Ga0496112_0011761 | |||
| 1492 | Ga0496112_0076649 | |||
| 1493 | Ga0496112_0397455 | |||
| 1494 | Ga0496113_0000409 | |||
| 1495 | Ga0496113_0029114 | |||
| 1496 | Ga0496113_0101382 | |||
| 1497 | Ga0496114_0021085 | |||
| 1498 | Ga0496114_0423022 | |||
| 1499 | Ga0496115_0042329 | |||
| 1500 | Ga0496115_0117965 | |||
| 1501 | Ga0496115_0210376 | |||
| 1502 | Ga0501257_032966 | |||
| 1503 | nmdc:mga05p37_64476_c1 | |||
| 1504 | nmdc:mga0n895_110481_c1 | |||
| 1505 | nmdc:mga0n895_184151_c1 | |||
| 1506 | nmdc:mga0n895_4256_c1 | |||
| 1507 | nmdc:mga0rr50_1418_c2 | |||
| 1508 | nmdc:mga0rr50_61311_c1 | |||
| 1509 | nmdc:mga08x19_11115_c1 | |||
| 1510 | nmdc:mga08x19_119480_c1 | |||
| 1511 | nmdc:mga08x19_51572_c1 | |||
| 1512 | nmdc:mga08x19_8085_c1 | |||
| 1513 | nmdc:mga08x19_84642_c1 | |||
| 1514 | nmdc:mga0a205_94205_c1 | |||
| 1515 | Ga0495601_0139634 | |||
| 1516 | Ga0466962_0161158 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yba-assembly1.cif.gz_A | the structure of the c.kpn2i controller protein | 0.9407 | 23 | 62 |
| 3kxa-assembly2.cif.gz_D | crystal structure of ngo0477 from neisseria gonorrhoeae | 0.8678 | 22 | 68 |
| 6tri-assembly1.cif.gz_B | ci-mor repressor-antirepressor complex of the temperate bacteriophage tp901-1 from lactococcus lactis | 0.8658 | 24 | 73 |
| 2xj3-assembly1.cif.gz_A | high resolution structure of the t55c mutant of cylr2. | 0.8641 | 19 | 67 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.8625 | 19 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9407 | 23 | 62 | 1.10.260.40 |
| 3kxaB02 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8661 | 23 | 68 | 1.10.260.40 |
| 2ebyB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8602 | 14 | 65 | 1.10.260.40 |
| 2ebyA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8519 | 14 | 65 | 1.10.260.40 |
| 3k2zB02 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8226 | 138 | 238 | 2.10.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9WUH0-F1-model_v4 | Peptidase S24/S26A/S26B/S26C domain-containing protein | 0.9866 | 106 | 238 |
|
| AF-A0A2V9WUH0-F1-model_v4 | Peptidase S24/S26A/S26B/S26C domain-containing protein | 0.9792 | 106 | 238 |
|
| AF-A0A372INR9-F1-model_v4 | Peptidase S24/S26A/S26B/S26C domain-containing protein | 0.9672 | 88 | 238 |
|
| AF-A0A317JCG8-F1-model_v4 | XRE family transcriptional regulator | 0.9568 | 1 | 70 |
GO:0003677
|
| AF-A0A317JCG8-F1-model_v4 | XRE family transcriptional regulator | 0.9439 | 1 | 70 |
GO:0003677
|