F479437

General Info

Members Datasets Scaffolds Average Seq Length
758 290 1516 238

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10005910|Ga0068851_1000591010
Length 271
Sequence MKVIIPVKKILSFGCSNYFMNSHMLYASAILGAMKFRALQENLRKALWERIEEGELTGLRLARETGFKQAHISNFLNRKRGLSVEGMDKVLNVQHLSILDLLDPGEINKRASITPPSDDQFENVLLVQGAVAARQPLIMSMKVKDILKFKKTFLRRLRSEMEGDRERWERFVIIRADGREGMSMYPRLLPGATVLIDRHYNSLKPYRKGESNMYAVARDGGCTVKYVEVAGNHLVLRPHNQAYPVEVMAMEPGKKVHDYLIGRICYVGIET

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
124 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
125 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
190 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 28.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10005910 3300005834 Bacteria 5572
2 MBSR1b_contig_2440585 2162886012 Unclassified 1023
3 LJNas_1000061 3300000546 Bacteria 14680
4 JGI24752J21851_1002601 3300001976 Unclassified 2402
5 JGI24752J21851_1010591 3300001976 Unclassified 1202
6 JGI24737J22298_10035794 3300001990 Unclassified 1535
7 JGI24743J22301_10003615 3300001991 Unclassified 2460
8 JGI24749J21850_1011357 3300002076 Unclassified 1250
9 JGI24034J26672_10002033 3300002239 Unclassified 2744
10 JGI24751J29686_10009293 3300002459 Unclassified 2018
11 rootH1_10241807 3300003323 Bacteria 1486
12 Ga0065704_10212625 3300005289 Unclassified 1103
13 Ga0065712_10103109 3300005290 Bacteria 1992
14 Ga0065715_10002873 3300005293 Bacteria 5095
15 Ga0065715_10042721 3300005293 Unclassified 1022
16 Ga0065715_10167537 3300005293 Bacteria 1574
17 Ga0070658_10032446 3300005327 Unclassified 4198
18 Ga0070658_10050888 3300005327 Unclassified 3358
19 Ga0070658_10484135 3300005327 Bacteria 1068
20 Ga0070676_10022196 3300005328 Unclassified 3558
21 Ga0070676_10033075 3300005328 Bacteria 2965
22 Ga0070683_100003207 3300005329 Bacteria 13205
23 Ga0070683_100020247 3300005329 Bacteria 5919
24 Ga0070683_100265152 3300005329 Bacteria 1634
25 Ga0070690_100006515 3300005330 Bacteria 6624
26 Ga0070690_100025748 3300005330 Unclassified 3623
27 Ga0070670_100098393 3300005331 Bacteria 2517
28 Ga0070670_100161096 3300005331 Unclassified 1944
29 Ga0070677_10004840 3300005333 Bacteria 4418
30 Ga0070666_10022479 3300005335 Bacteria 4094
31 Ga0070680_100022024 3300005336 Bacteria 5069
32 Ga0070682_100008804 3300005337 Bacteria 5697
33 Ga0070682_100020364 3300005337 Unclassified 3902
34 Ga0068868_100015706 3300005338 Bacteria 5608
35 Ga0068868_100022154 3300005338 Unclassified 4792
36 Ga0068868_100264850 3300005338 Bacteria 1451
37 Ga0068868_100523575 3300005338 Unclassified 1041
38 Ga0070660_100007722 3300005339 Bacteria 7500
39 Ga0070660_100010443 3300005339 Bacteria 6562
40 Ga0070660_100011778 3300005339 Bacteria 6228
41 Ga0070689_100021775 3300005340 Unclassified 4777
42 Ga0070661_100013761 3300005344 Bacteria 5682
43 Ga0070668_100011552 3300005347 Bacteria 6573
44 Ga0070668_100012680 3300005347 Bacteria 6274
45 Ga0070668_100722252 3300005347 Unclassified 880
46 Ga0070669_100004020 3300005353 Bacteria 10635
47 Ga0070675_100006644 3300005354 Bacteria 8893
48 Ga0070671_100041823 3300005355 Unclassified 3809
49 Ga0070674_100017358 3300005356 Unclassified 4525
50 Ga0070674_100223904 3300005356 Bacteria 1465
51 Ga0070688_100005503 3300005365 Bacteria 6679
52 Ga0070659_100011195 3300005366 Bacteria 6628
53 Ga0070659_100190079 3300005366 Bacteria 1687
54 Ga0070667_100010376 3300005367 Bacteria 7692
55 Ga0070667_100326021 3300005367 Unclassified 1386
56 Ga0070709_10008347 3300005434 Bacteria 5687
57 Ga0070709_10018507 3300005434 Bacteria 4012
58 Ga0070709_10022109 3300005434 Bacteria 3716
59 Ga0070709_10043382 3300005434 Bacteria 2781
60 Ga0070709_10117888 3300005434 Bacteria 1795
61 Ga0070709_10132346 3300005434 Bacteria 1704
62 Ga0070709_10164883 3300005434 Bacteria 1544
63 Ga0070709_10186990 3300005434 Unclassified 1458
64 Ga0070709_10297268 3300005434 Bacteria 1178
65 Ga0070714_100000299 3300005435 Bacteria 37652
66 Ga0070714_100025638 3300005435 Bacteria 4867
67 Ga0070714_100029479 3300005435 Bacteria 4562
68 Ga0070714_100059308 3300005435 Bacteria 3281
69 Ga0070714_100078534 3300005435 Bacteria 2868
70 Ga0070714_100080357 3300005435 Bacteria 2837
71 Ga0070714_100103193 3300005435 Bacteria 2515
72 Ga0070714_100177061 3300005435 Bacteria 1938
73 Ga0070714_100211748 3300005435 Unclassified 1777
74 Ga0070714_100211907 3300005435 Unclassified 1776
75 Ga0070714_100610376 3300005435 Unclassified 1048
76 Ga0070713_100000060 3300005436 Bacteria 69784
77 Ga0070713_100000108 3300005436 Bacteria 53977
78 Ga0070713_100003414 3300005436 Bacteria 10495
79 Ga0070713_100036661 3300005436 Bacteria 3959
80 Ga0070713_100056150 3300005436 Unclassified 3275
81 Ga0070713_100170424 3300005436 Bacteria 1950
82 Ga0070713_100223188 3300005436 Bacteria 1710
83 Ga0070713_100261661 3300005436 Bacteria 1581
84 Ga0070710_10045241 3300005437 Bacteria 2446
85 Ga0070710_10093711 3300005437 Bacteria 1776
86 Ga0070710_10108807 3300005437 Unclassified 1662
87 Ga0070710_10348798 3300005437 Unclassified 979
88 Ga0070711_100000525 3300005439 Bacteria 19885
89 Ga0070711_100000689 3300005439 Bacteria 17727
90 Ga0070711_100002403 3300005439 Bacteria 10676
91 Ga0070711_100023292 3300005439 Bacteria 4025
92 Ga0070711_100032880 3300005439 Bacteria 3452
93 Ga0070711_100674280 3300005439 Unclassified 869
94 Ga0070705_100088614 3300005440 Unclassified 1921
95 Ga0070705_100474452 3300005440 Bacteria 944
96 Ga0070708_100000347 3300005445 Bacteria 34980
97 Ga0070708_100000500 3300005445 Bacteria 29438
98 Ga0070708_100001815 3300005445 Bacteria 16399
99 Ga0070708_100006972 3300005445 Bacteria 9018
100 Ga0070708_100010270 3300005445 Bacteria 7580
101 Ga0070708_100012796 3300005445 Bacteria 6855
102 Ga0070708_100014353 3300005445 Bacteria 6516
103 Ga0070708_100020138 3300005445 Bacteria 5619
104 Ga0070708_100042149 3300005445 Unclassified 4005
105 Ga0070708_100157258 3300005445 Bacteria 2117
106 Ga0070708_100248526 3300005445 Bacteria 1671
107 Ga0070663_100026061 3300005455 Unclassified 3955
108 Ga0070663_100125183 3300005455 Bacteria 1946
109 Ga0070678_100311334 3300005456 Bacteria 1342
110 Ga0070662_100009117 3300005457 Bacteria 6478
111 Ga0070662_100037286 3300005457 Unclassified 3446
112 Ga0070662_100182433 3300005457 Bacteria 1655
113 Ga0070681_10049656 3300005458 Unclassified 4189
114 Ga0070681_10409687 3300005458 Bacteria 1267
115 Ga0068867_100016049 3300005459 Bacteria 5317
116 Ga0068867_100049758 3300005459 Unclassified 3085
117 Ga0070685_10010306 3300005466 Unclassified 4853
118 Ga0070685_10264472 3300005466 Bacteria 1145
119 Ga0070706_100001585 3300005467 Bacteria 23707
120 Ga0070706_100004125 3300005467 Bacteria 14130
121 Ga0070706_100024440 3300005467 Bacteria 5562
122 Ga0070706_100026294 3300005467 Bacteria 5356
123 Ga0070706_100155352 3300005467 Unclassified 2136
124 Ga0070706_100167799 3300005467 Bacteria 2049
125 Ga0070706_100302393 3300005467 Bacteria 1492
126 Ga0070707_100002300 3300005468 Bacteria 18254
127 Ga0070707_100002700 3300005468 Bacteria 16873
128 Ga0070707_100022750 3300005468 Bacteria 5927
129 Ga0070707_100049851 3300005468 Bacteria 4013
130 Ga0070707_100055888 3300005468 Bacteria 3784
131 Ga0070707_100079034 3300005468 Unclassified 3174
132 Ga0070707_100093610 3300005468 Bacteria 2909
133 Ga0070707_100184787 3300005468 Bacteria 2032
134 Ga0070707_100306070 3300005468 Unclassified 1544
135 Ga0070707_100382667 3300005468 Bacteria 1367
136 Ga0070707_100394397 3300005468 Bacteria 1344
137 Ga0070698_100000547 3300005471 Bacteria 40166
138 Ga0070698_100009673 3300005471 Bacteria 10312
139 Ga0070698_100095364 3300005471 Bacteria 2953
140 Ga0070698_100415171 3300005471 Bacteria 1280
141 Ga0070698_100431350 3300005471 Bacteria 1253
142 Ga0070699_100000343 3300005518 Bacteria 45107
143 Ga0070699_100010416 3300005518 Bacteria 8046
144 Ga0070699_100079592 3300005518 Bacteria 2855
145 Ga0070699_100090096 3300005518 Bacteria 2680
146 Ga0070699_100126879 3300005518 Bacteria 2247
147 Ga0070699_100135513 3300005518 Bacteria 2172
148 Ga0070699_100368411 3300005518 Bacteria 1296
149 Ga0070679_100046636 3300005530 Viruses 4319
150 Ga0070679_100213165 3300005530 Bacteria 1894
151 Ga0070684_100006119 3300005535 Bacteria 9273
152 Ga0070684_100042749 3300005535 Bacteria 3913
153 Ga0070684_100883401 3300005535 Unclassified 837
154 Ga0070697_100000208 3300005536 Bacteria 48156
155 Ga0070697_100000786 3300005536 Bacteria 23847
156 Ga0070697_100000960 3300005536 Bacteria 21769
157 Ga0070697_100002199 3300005536 Bacteria 14971
158 Ga0070697_100002461 3300005536 Bacteria 14253
159 Ga0070697_100028329 3300005536 Bacteria 4485
160 Ga0070697_100034470 3300005536 Bacteria 4081
161 Ga0070697_100232976 3300005536 Bacteria 1571
162 Ga0070697_100338669 3300005536 Bacteria 1298
163 Ga0070697_100411065 3300005536 Bacteria 1175
164 Ga0068853_100004876 3300005539 Bacteria 10436
165 Ga0068853_100075519 3300005539 Unclassified 2941
166 Ga0068853_100164603 3300005539 Bacteria 2003
167 Ga0070672_100175402 3300005543 Unclassified 1784
168 Ga0070686_100542463 3300005544 Unclassified 908
169 Ga0070695_100046775 3300005545 Unclassified 2761
170 Ga0070695_100054368 3300005545 Bacteria 2577
171 Ga0070695_100570208 3300005545 Unclassified 885
172 Ga0070696_100019515 3300005546 Unclassified 4591
173 Ga0070693_100023440 3300005547 Unclassified 3299
174 Ga0070665_100021084 3300005548 Bacteria 6551
175 Ga0070665_100109609 3300005548 Bacteria 2763
176 Ga0070704_100081759 3300005549 Bacteria 2380
177 Ga0068855_100037722 3300005563 Bacteria 5744
178 Ga0068855_100067240 3300005563 Unclassified 4176
179 Ga0068855_100097672 3300005563 Unclassified 3383
180 Ga0068855_100378739 3300005563 Unclassified 1554
181 Ga0068855_100380745 3300005563 Unclassified 1549
182 Ga0068855_100472397 3300005563 Unclassified 1366
183 Ga0070664_100028528 3300005564 Unclassified 4643
184 Ga0070664_100067206 3300005564 Unclassified 3063
185 Ga0068857_100004674 3300005577 Bacteria 11601
186 Ga0068857_100150096 3300005577 Bacteria 2111
187 Ga0068857_100437876 3300005577 Unclassified 1221
188 Ga0068854_100069057 3300005578 Unclassified 2578
189 Ga0068854_100078058 3300005578 Unclassified 2438
190 Ga0068854_100196552 3300005578 Bacteria 1583
191 Ga0068856_100030898 3300005614 Bacteria 5238
192 Ga0068856_100051816 3300005614 Bacteria 4046
193 Ga0068856_100068780 3300005614 Unclassified 3500
194 Ga0068856_100071748 3300005614 Unclassified 3429
195 Ga0070702_100454051 3300005615 Unclassified 930
196 Ga0068852_100019600 3300005616 Bacteria 5358
197 Ga0068852_100046909 3300005616 Bacteria 3683
198 Ga0068852_100592868 3300005616 Unclassified 1112
199 Ga0068859_100028578 3300005617 Bacteria 5591
200 Ga0068859_100033577 3300005617 Bacteria 5153
201 Ga0068864_100012096 3300005618 Bacteria 7129
202 Ga0068866_10042460 3300005718 Unclassified 2263
203 Ga0068861_100341956 3300005719 Unclassified 1310
204 Ga0068863_100041428 3300005841 Unclassified 4379
205 Ga0068863_100056904 3300005841 Bacteria 3702
206 Ga0068858_100022290 3300005842 Bacteria 5914
207 Ga0068858_100037574 3300005842 Bacteria 4491
208 Ga0068860_100101479 3300005843 Bacteria 2745
209 Ga0068862_100014886 3300005844 Bacteria 6461
210 Ga0068862_100064053 3300005844 Unclassified 3164
211 Ga0070717_10000503 3300006028 Bacteria 24750
212 Ga0070717_10001316 3300006028 Bacteria 17016
213 Ga0070717_10004398 3300006028 Bacteria 10171
214 Ga0070717_10016942 3300006028 Bacteria 5660
215 Ga0070717_10023410 3300006028 Bacteria 4893
216 Ga0070717_10039264 3300006028 Bacteria 3851
217 Ga0070717_10098862 3300006028 Bacteria 2474
218 Ga0070717_10112889 3300006028 Unclassified 2320
219 Ga0070717_10117610 3300006028 Bacteria 2274
220 Ga0070717_10142678 3300006028 Bacteria 2067
221 Ga0070717_10288545 3300006028 Bacteria 1456
222 Ga0070717_10385288 3300006028 Unclassified 1257
223 Ga0070717_10426547 3300006028 Bacteria 1193
224 Ga0070717_10490166 3300006028 Bacteria 1110
225 Ga0070717_10573261 3300006028 Bacteria 1023
226 Ga0070717_10659089 3300006028 Unclassified 950
227 Ga0070715_10000405 3300006163 Bacteria 10954
228 Ga0070715_10005691 3300006163 Bacteria 4180
229 Ga0070715_10006368 3300006163 Unclassified 4011
230 Ga0070715_10043926 3300006163 Unclassified 1887
231 Ga0070716_100000064 3300006173 Bacteria 41396
232 Ga0070716_100004991 3300006173 Bacteria 6393
233 Ga0070716_100048249 3300006173 Bacteria 2406
234 Ga0070716_100064277 3300006173 Bacteria 2133
235 Ga0070716_100069966 3300006173 Bacteria 2059
236 Ga0070716_100072529 3300006173 Bacteria 2028
237 Ga0070712_100000179 3300006175 Bacteria 35191
238 Ga0070712_100000196 3300006175 Bacteria 33763
239 Ga0070712_100000780 3300006175 Bacteria 18819
240 Ga0070712_100001325 3300006175 Bacteria 15009
241 Ga0070712_100019136 3300006175 Bacteria 4460
242 Ga0070712_100145593 3300006175 Unclassified 1813
243 Ga0070712_100159898 3300006175 Bacteria 1739
244 Ga0070712_100489881 3300006175 Bacteria 1029
245 Ga0097621_100005110 3300006237 Bacteria 9216
246 Ga0097621_100268955 3300006237 Bacteria 1497
247 Ga0097621_100300224 3300006237 Unclassified 1418
248 Ga0068871_100012682 3300006358 Bacteria 6227
249 Ga0068871_100019808 3300006358 Bacteria 5142
250 Ga0068871_100070708 3300006358 Bacteria 2869
251 Ga0068871_100227202 3300006358 Bacteria 1619
252 Ga0068871_100244332 3300006358 Bacteria 1562
253 Ga0068871_100287301 3300006358 Bacteria 1440
254 Ga0068871_100427056 3300006358 Bacteria 1184
255 Ga0075434_100004944 3300006871 Bacteria 12086
256 Ga0075434_100012876 3300006871 Bacteria 7945
257 Ga0075434_100087387 3300006871 Unclassified 3118
258 Ga0075436_100000301 3300006914 Bacteria 31560
259 Ga0075436_100016833 3300006914 Bacteria 5003
260 Ga0075436_100060072 3300006914 Unclassified 2626
261 Ga0075436_100185470 3300006914 Bacteria 1471
262 Ga0075436_100445499 3300006914 Unclassified 942
263 Ga0097620_100028575 3300006931 Bacteria 5591
264 Ga0097620_100033578 3300006931 Bacteria 5153
265 Ga0075435_100021891 3300007076 Bacteria 4926
266 Ga0075435_100025649 3300007076 Unclassified 4590
267 Ga0075435_100049415 3300007076 Bacteria 3383
268 Ga0075435_100072631 3300007076 Bacteria 2811
269 Ga0075435_100594686 3300007076 Unclassified 959
270 Ga0099794_10077671 3300007265 Bacteria 1634
271 Ga0099794_10093061 3300007265 Bacteria 1498
272 Ga0099795_10027875 3300007788 Unclassified 1915
273 Ga0099795_10033786 3300007788 Bacteria 1779
274 Ga0099795_10041901 3300007788 Bacteria 1632
275 Ga0105250_10027720 3300009092 Unclassified 2283
276 Ga0105240_10012666 3300009093 Bacteria 11625
277 Ga0105240_10037944 3300009093 Bacteria 6186
278 Ga0105240_10053134 3300009093 Bacteria 5088
279 Ga0105240_10053919 3300009093 Bacteria 5043
280 Ga0105240_10077399 3300009093 Bacteria 4097
281 Ga0105240_10111707 3300009093 Unclassified 3305
282 Ga0105240_10143778 3300009093 Bacteria 2849
283 Ga0105240_10217993 3300009093 Bacteria 2225
284 Ga0111539_10659627 3300009094 Unclassified 1218
285 Ga0105245_10017450 3300009098 Bacteria 6262
286 Ga0105245_10055492 3300009098 Bacteria 3558
287 Ga0105245_10071577 3300009098 Unclassified 3149
288 Ga0105245_10138133 3300009098 Bacteria 2292
289 Ga0105247_10003282 3300009101 Bacteria 10600
290 Ga0105247_10004648 3300009101 Bacteria 8750
291 Ga0105247_10158498 3300009101 Unclassified 1497
292 Ga0114129_10060514 3300009147 Bacteria 5295
293 Ga0105243_10122911 3300009148 Bacteria 2191
294 Ga0105243_10273378 3300009148 Unclassified 1518
295 Ga0105241_10005002 3300009174 Bacteria 9784
296 Ga0105241_10016473 3300009174 Bacteria 5422
297 Ga0105241_10168100 3300009174 Unclassified 1809
298 Ga0105242_10034402 3300009176 Unclassified 4061
299 Ga0105242_10387873 3300009176 Bacteria 1300
300 Ga0105248_10010666 3300009177 Bacteria 10135
301 Ga0105248_10565179 3300009177 Unclassified 1283
302 Ga0105248_11262506 3300009177 Unclassified 835
303 Ga0105237_10024915 3300009545 Bacteria 6120
304 Ga0105237_10096786 3300009545 Bacteria 2942
305 Ga0105237_10184669 3300009545 Bacteria 2085
306 Ga0105237_10289037 3300009545 Bacteria 1642
307 Ga0105238_10009704 3300009551 Bacteria 9637
308 Ga0105238_10026525 3300009551 Bacteria 5908
309 Ga0105238_10032651 3300009551 Bacteria 5298
310 Ga0105238_10113335 3300009551 Unclassified 2691
311 Ga0105238_10185734 3300009551 Bacteria 2055
312 Ga0105249_10001809 3300009553 Bacteria 18603
313 Ga0105249_10098320 3300009553 Bacteria 2748
314 Ga0105249_10142880 3300009553 Unclassified 2297
315 Ga0099796_10014462 3300010159 Bacteria 2281
316 Ga0105239_10177821 3300010375 Unclassified 2380
317 Ga0105246_10002192 3300011119 Bacteria 11782
318 Ga0105246_10025587 3300011119 Bacteria 3848
319 Ga0105246_10173335 3300011119 Unclassified 1654
320 Ga0157373_10015692 3300013100 Bacteria 5533
321 Ga0157373_10017869 3300013100 Bacteria 5163
322 Ga0157373_10024229 3300013100 Unclassified 4398
323 Ga0157373_10082091 3300013100 Bacteria 2272
324 Ga0157371_10008238 3300013102 Bacteria 8332
325 Ga0157371_10462070 3300013102 Unclassified 934
326 Ga0157370_10156555 3300013104 Bacteria 2120
327 Ga0157369_10000794 3300013105 Bacteria 40368
328 Ga0157369_10011531 3300013105 Bacteria 10040
329 Ga0157369_10020732 3300013105 Bacteria 7348
330 Ga0157369_10023457 3300013105 Bacteria 6872
331 Ga0157369_10024478 3300013105 Bacteria 6715
332 Ga0157369_10037666 3300013105 Bacteria 5293
333 Ga0157369_10093524 3300013105 Unclassified 3209
334 Ga0157369_10162142 3300013105 Bacteria 2360
335 Ga0157374_10001851 3300013296 Bacteria 17794
336 Ga0157374_10005139 3300013296 Bacteria 10974
337 Ga0157374_10058016 3300013296 Bacteria 3617
338 Ga0157374_10364126 3300013296 Bacteria 1438
339 Ga0157374_10583412 3300013296 Unclassified 1127
340 Ga0157378_10015111 3300013297 Bacteria 6759
341 Ga0157378_10066556 3300013297 Unclassified 3227
342 Ga0157378_10066673 3300013297 Bacteria 3224
343 Ga0157378_10431652 3300013297 Bacteria 1304
344 Ga0157378_10491156 3300013297 Bacteria 1225
345 Ga0157378_10626418 3300013297 Bacteria 1089
346 Ga0163162_10039073 3300013306 Bacteria 4739
347 Ga0163162_10057062 3300013306 Unclassified 3932
348 Ga0163162_10144581 3300013306 Bacteria 2493
349 Ga0163162_10163674 3300013306 Unclassified 2347
350 Ga0163162_10661148 3300013306 Unclassified 1168
351 Ga0157372_10000661 3300013307 Bacteria 37855
352 Ga0157372_10012631 3300013307 Bacteria 8996
353 Ga0157372_10024144 3300013307 Bacteria 6599
354 Ga0157372_10045950 3300013307 Unclassified 4846
355 Ga0157372_10144935 3300013307 Bacteria 2739
356 Ga0157372_10230969 3300013307 Unclassified 2145
357 Ga0157372_10449285 3300013307 Bacteria 1502
358 Ga0157375_10066909 3300013308 Unclassified 3589
359 Ga0163163_10005225 3300014325 Bacteria 11198
360 Ga0163163_10060017 3300014325 Bacteria 3764
361 Ga0163163_10167569 3300014325 Bacteria 2243
362 Ga0157377_10001671 3300014745 Bacteria 9671
363 Ga0157379_10011817 3300014968 Bacteria 7625
364 Ga0157379_10040955 3300014968 Bacteria 4135
365 Ga0157379_10078863 3300014968 Bacteria 2950
366 Ga0157376_10002705 3300014969 Bacteria 12072
367 Ga0157376_10098002 3300014969 Bacteria 2555
368 Ga0157376_10284399 3300014969 Bacteria 1559
369 Ga0182006_1035562 3300015261 Bacteria 1984
370 Ga0182006_1046161 3300015261 Unclassified 1693
371 Ga0182007_10015342 3300015262 Bacteria 2860
372 Ga0182007_10064944 3300015262 Bacteria 1196
373 Ga0182005_1017450 3300015265 Unclassified 1987
374 Ga0163161_10009403 3300017792 Bacteria 6768
375 Ga0224570_100933 3300022730 Bacteria 2324
376 Ga0224569_100376 3300022732 Bacteria 3792
377 Ga0224572_1005365 3300024225 Bacteria 2283
378 Ga0228598_1001637 3300024227 Bacteria 4892
379 Ga0228598_1002092 3300024227 Unclassified 4361
380 Ga0228598_1005914 3300024227 Bacteria 2542
381 Ga0207697_10007237 3300025315 Unclassified 4958
382 Ga0207656_10012495 3300025321 Unclassified 3230
383 Ga0207656_10038570 3300025321 Unclassified 2016
384 Ga0207692_10183753 3300025898 Bacteria 1219
385 Ga0207692_10260393 3300025898 Bacteria 1042
386 Ga0207642_10009967 3300025899 Unclassified 3328
387 Ga0207688_10005213 3300025901 Bacteria 7064
388 Ga0207680_10058928 3300025903 Unclassified 2330
389 Ga0207647_10001373 3300025904 Bacteria 18689
390 Ga0207647_10249763 3300025904 Bacteria 1018
391 Ga0207685_10004100 3300025905 Unclassified 3651
392 Ga0207685_10020208 3300025905 Bacteria 2209
393 Ga0207685_10123423 3300025905 Bacteria 1140
394 Ga0207699_10028522 3300025906 Unclassified 3104
395 Ga0207699_10029803 3300025906 Bacteria 3047
396 Ga0207699_10062011 3300025906 Unclassified 2252
397 Ga0207699_10067282 3300025906 Unclassified 2177
398 Ga0207699_10261019 3300025906 Bacteria 1197
399 Ga0207645_10000011 3300025907 Bacteria 132246
400 Ga0207645_10010651 3300025907 Bacteria 6309
401 Ga0207643_10003295 3300025908 Bacteria 8718
402 Ga0207684_10000081 3300025910 Bacteria 178619
403 Ga0207684_10003969 3300025910 Bacteria 14166
404 Ga0207684_10045476 3300025910 Bacteria 3723
405 Ga0207684_10091608 3300025910 Bacteria 2591
406 Ga0207684_10092418 3300025910 Bacteria 2579
407 Ga0207684_10226285 3300025910 Bacteria 1614
408 Ga0207684_10375435 3300025910 Bacteria 1223
409 Ga0207654_10007606 3300025911 Bacteria 5461
410 Ga0207654_10013233 3300025911 Bacteria 4241
411 Ga0207654_10043545 3300025911 Bacteria 2545
412 Ga0207654_10230504 3300025911 Bacteria 1233
413 Ga0207654_10264618 3300025911 Bacteria 1158
414 Ga0207707_10058109 3300025912 Unclassified 3366
415 Ga0207707_10069742 3300025912 Bacteria 3064
416 Ga0207695_10008921 3300025913 Bacteria 12484
417 Ga0207695_10029851 3300025913 Bacteria 6015
418 Ga0207695_10120246 3300025913 Bacteria 2595
419 Ga0207695_10130145 3300025913 Bacteria 2475
420 Ga0207695_10244959 3300025913 Unclassified 1693
421 Ga0207671_10021152 3300025914 Bacteria 4941
422 Ga0207671_10205210 3300025914 Unclassified 1540
423 Ga0207671_10384270 3300025914 Bacteria 1115
424 Ga0207671_10576780 3300025914 Unclassified 897
425 Ga0207693_10000042 3300025915 Bacteria 104665
426 Ga0207693_10000191 3300025915 Bacteria 56013
427 Ga0207693_10000221 3300025915 Bacteria 51982
428 Ga0207693_10008695 3300025915 Bacteria 8303
429 Ga0207693_10022404 3300025915 Bacteria 5020
430 Ga0207693_10250218 3300025915 Unclassified 1391
431 Ga0207693_10352395 3300025915 Bacteria 1152
432 Ga0207663_10000544 3300025916 Bacteria 16576
433 Ga0207663_10001591 3300025916 Bacteria 10662
434 Ga0207663_10006091 3300025916 Bacteria 6136
435 Ga0207663_10034774 3300025916 Bacteria 3017
436 Ga0207663_10048279 3300025916 Unclassified 2634
437 Ga0207663_10068797 3300025916 Bacteria 2275
438 Ga0207663_10373890 3300025916 Unclassified 1084
439 Ga0207660_10259345 3300025917 Unclassified 1374
440 Ga0207662_10000594 3300025918 Bacteria 16173
441 Ga0207657_10001258 3300025919 Bacteria 27107
442 Ga0207657_10003804 3300025919 Bacteria 16045
443 Ga0207657_10018061 3300025919 Bacteria 6747
444 Ga0207649_10002513 3300025920 Bacteria 10222
445 Ga0207649_10039882 3300025920 Bacteria 2850
446 Ga0207649_10366415 3300025920 Unclassified 1070
447 Ga0207652_10120860 3300025921 Unclassified 2330
448 Ga0207652_10130487 3300025921 Unclassified 2241
449 Ga0207646_10000880 3300025922 Bacteria 38839
450 Ga0207646_10002622 3300025922 Bacteria 21121
451 Ga0207646_10019808 3300025922 Bacteria 6245
452 Ga0207646_10074290 3300025922 Bacteria 3037
453 Ga0207646_10079670 3300025922 Bacteria 2929
454 Ga0207646_10153506 3300025922 Bacteria 2076
455 Ga0207646_10206620 3300025922 Bacteria 1773
456 Ga0207646_10316540 3300025922 Bacteria 1410
457 Ga0207646_10448403 3300025922 Bacteria 1164
458 Ga0207681_10051054 3300025923 Unclassified 2800
459 Ga0207694_10197766 3300025924 Bacteria 1635
460 Ga0207694_10473972 3300025924 Unclassified 1046
461 Ga0207650_10002279 3300025925 Bacteria 13390
462 Ga0207650_10081026 3300025925 Bacteria 2462
463 Ga0207659_10026076 3300025926 Unclassified 3939
464 Ga0207687_10005580 3300025927 Bacteria 8314
465 Ga0207700_10000358 3300025928 Bacteria 26677
466 Ga0207700_10002265 3300025928 Bacteria 11047
467 Ga0207700_10054528 3300025928 Bacteria 3001
468 Ga0207700_10091335 3300025928 Unclassified 2405
469 Ga0207700_10105627 3300025928 Bacteria 2256
470 Ga0207700_10113979 3300025928 Bacteria 2180
471 Ga0207700_10243216 3300025928 Bacteria 1534
472 Ga0207664_10000320 3300025929 Bacteria 35727
473 Ga0207664_10111356 3300025929 Bacteria 2277
474 Ga0207664_10303295 3300025929 Bacteria 1405
475 Ga0207664_10417759 3300025929 Bacteria 1194
476 Ga0207664_10456258 3300025929 Bacteria 1141
477 Ga0207644_10207527 3300025931 Unclassified 1547
478 Ga0207690_10123048 3300025932 Bacteria 1887
479 Ga0207690_10136210 3300025932 Unclassified 1803
480 Ga0207706_10000698 3300025933 Bacteria 35074
481 Ga0207706_10001011 3300025933 Bacteria 28673
482 Ga0207706_10027530 3300025933 Bacteria 5082
483 Ga0207686_10090261 3300025934 Unclassified 2021
484 Ga0207686_10433941 3300025934 Bacteria 1007
485 Ga0207709_10407725 3300025935 Unclassified 1041
486 Ga0207670_10033080 3300025936 Unclassified 3330
487 Ga0207665_10016946 3300025939 Bacteria 4784
488 Ga0207665_10086683 3300025939 Bacteria 2163
489 Ga0207665_10119231 3300025939 Bacteria 1862
490 Ga0207691_10006128 3300025940 Bacteria 11628
491 Ga0207711_10010872 3300025941 Bacteria 7564
492 Ga0207711_10026059 3300025941 Bacteria 4904
493 Ga0207689_10000194 3300025942 Bacteria 53148
494 Ga0207661_10013948 3300025944 Bacteria 5875
495 Ga0207661_10130360 3300025944 Bacteria 2153
496 Ga0207679_10000051 3300025945 Bacteria 111207
497 Ga0207679_10000172 3300025945 Bacteria 53249
498 Ga0207679_10038142 3300025945 Bacteria 3421
499 Ga0207679_10085591 3300025945 Unclassified 2422
500 Ga0207667_10015081 3300025949 Bacteria 8788
501 Ga0207667_10056659 3300025949 Bacteria 4116
502 Ga0207667_10476150 3300025949 Unclassified 1268
503 Ga0207651_10562823 3300025960 Unclassified 992
504 Ga0207712_10028731 3300025961 Bacteria 3722
505 Ga0207712_10033549 3300025961 Unclassified 3471
506 Ga0207668_10063210 3300025972 Unclassified 2610
507 Ga0207640_10120696 3300025981 Unclassified 1877
508 Ga0207658_10035575 3300025986 Bacteria 3567
509 Ga0207658_10539730 3300025986 Bacteria 1042
510 Ga0207677_10205337 3300026023 Bacteria 1569
511 Ga0207677_10205707 3300026023 Bacteria 1568
512 Ga0207677_10231629 3300026023 Unclassified 1488
513 Ga0207703_10092601 3300026035 Bacteria 2544
514 Ga0207703_10115737 3300026035 Bacteria 2294
515 Ga0207639_10046136 3300026041 Bacteria 3286
516 Ga0207639_10148925 3300026041 Bacteria 1958
517 Ga0207678_10001863 3300026067 Bacteria 19249
518 Ga0207678_10003097 3300026067 Bacteria 15057
519 Ga0207702_10010082 3300026078 Bacteria 7919
520 Ga0207702_10026902 3300026078 Unclassified 4776
521 Ga0207702_10051335 3300026078 Unclassified 3485
522 Ga0207702_10057807 3300026078 Bacteria 3298
523 Ga0207702_10058337 3300026078 Bacteria 3285
524 Ga0207702_10125164 3300026078 Bacteria 2306
525 Ga0207641_10000316 3300026088 Bacteria 59952
526 Ga0207641_10045290 3300026088 Bacteria 3704
527 Ga0207648_10009781 3300026089 Bacteria 9162
528 Ga0207676_10000107 3300026095 Bacteria 74255
529 Ga0207674_10000034 3300026116 Bacteria 137337
530 Ga0207674_10018519 3300026116 Bacteria 7566
531 Ga0207674_10187677 3300026116 Bacteria 2017
532 Ga0207674_10234939 3300026116 Unclassified 1781
533 Ga0207675_100037976 3300026118 Bacteria 4494
534 Ga0207683_10002001 3300026121 Bacteria 18033
535 Ga0207698_10047854 3300026142 Unclassified 3243
536 Ga0209998_10012286 3300027717 Bacteria 1778
537 Ga0265356_1000070 3300028017 Bacteria 16853
538 Ga0265356_1003056 3300028017 Bacteria 2144
539 Ga0265355_1000879 3300028036 Bacteria 1778
540 Ga0268266_10008585 3300028379 Bacteria 9074
541 Ga0268265_10017334 3300028380 Unclassified 4966
542 Ga0268265_10019865 3300028380 Unclassified 4679
543 Ga0268264_10084068 3300028381 Bacteria 2728
544 Ga0268264_10243347 3300028381 Unclassified 1667
545 Ga0265338_10005052 3300028800 Bacteria 17408
546 Ga0265338_10047790 3300028800 Bacteria 3903
547 Ga0265762_1000209 3300030760 Bacteria 9385
548 Ga0265762_1005393 3300030760 Bacteria 2292
549 Ga0265762_1027154 3300030760 Unclassified 1073
550 Ga0265770_1015686 3300030878 Bacteria 1155
551 Ga0265760_10002341 3300031090 Bacteria 5535
552 Ga0265760_10002446 3300031090 Bacteria 5418
553 Ga0265760_10015471 3300031090 Bacteria 2187
554 Ga0265760_10022737 3300031090 Bacteria 1818
555 Ga0265760_10060299 3300031090 Bacteria 1152
556 Ga0265325_10017766 3300031241 Bacteria 3951
557 Ga0265325_10026504 3300031241 Archaea 3139
558 Ga0265339_10032388 3300031249 Bacteria 2948
559 Ga0265339_10046710 3300031249 Bacteria 2379
560 Ga0265339_10180841 3300031249 Bacteria 1050
561 Ga0265316_10006191 3300031344 Bacteria 11469
562 Ga0265314_10001772 3300031711 Bacteria 23290
563 Ga0265314_10022004 3300031711 Bacteria 4890
564 Ga0316214_1018849 3300033545 Unclassified 960
565 Ga0373930_0012139 3300034816 Unclassified 1567
566 Ga0373938_0020684 3300034957 Bacteria 1328
567 Ga0373926_0011416 3300035083 Bacteria 2988
568 Ga0373926_0128154 3300035083 Unclassified 960
569 Ga0373929_0054493 3300035085 Bacteria 922
570 Ga0373934_0114046 3300035086 Unclassified 1097
571 Ga0373944_0058534 3300035089 Unclassified 1231
572 Ga0373923_0021809 3300035111 Bacteria 2504
573 Ga0373932_0076078 3300035112 Bacteria 1051
574 Ga0373936_0003768 3300035113 Bacteria 5702
575 Ga0373936_0005288 3300035113 Bacteria 4859
576 Ga0373936_0019428 3300035113 Bacteria 2633
577 Ga0373936_0032182 3300035113 Unclassified 2073
578 Ga0373939_0021977 3300035114 Bacteria 1753
579 Ga0373945_0002946 3300035116 Bacteria 5348
580 Ga0373945_0132977 3300035116 Unclassified 998
581 Ga0373953_0013588 3300035117 Unclassified 2910
582 Ga0373954_0243153 3300035118 Unclassified 886
583 Ga0373956_0021806 3300035119 Bacteria 2734
584 Ga0373957_0173694 3300035120 Unclassified 891
585 Ga0373943_0000212 3300035170 Bacteria 23853
586 Ga0373943_0020588 3300035170 Unclassified 3043
587 Ga0373943_0028162 3300035170 Bacteria 2646
588 Ga0373943_0090781 3300035170 Bacteria 1582
589 Ga0373946_0015272 3300035171 Unclassified 2909
590 Ga0373946_0030197 3300035171 Unclassified 2163
591 Ga0373946_0047233 3300035171 Bacteria 1788
592 Ga0373946_0115381 3300035171 Unclassified 1220
593 Ga0373955_0005674 3300035172 Bacteria 5620
594 Ga0373955_0148842 3300035172 Bacteria 1377
595 Ga0373962_0018136 3300035242 Bacteria 1829
596 Ga0373924_0016409 3300035410 Bacteria 2826
597 Ga0373931_0048077 3300035691 Bacteria 2260
598 Ga0373935_0009901 3300035692 Bacteria 5712
599 Ga0373935_0036775 3300035692 Bacteria 3063
600 Ga0373935_0036890 3300035692 Bacteria 3058
601 Ga0373935_0421516 3300035692 Bacteria 961
602 Ga0373935_0488660 3300035692 Unclassified 893
603 Ga0373927_0000062 3300035695 Bacteria 77303
604 Ga0373927_0054099 3300035695 Unclassified 2596
605 Ga0373927_0057657 3300035695 Bacteria 2511
606 Ga0373927_0062760 3300035695 Bacteria 2403
607 Ga0373927_0104522 3300035695 Bacteria 1844
608 Ga0373933_0025596 3300035724 Unclassified 3384
609 Ga0373933_0198490 3300035724 Unclassified 1283
610 Ga0373947_0001513 3300035725 Bacteria 14265
611 Ga0373947_0005251 3300035725 Bacteria 7568
612 Ga0373947_0005799 3300035725 Bacteria 7200
613 Ga0373947_0100430 3300035725 Bacteria 1818
614 Ga0373947_0161578 3300035725 Bacteria 1449
615 Ga0373937_0041219 3300036401 Bacteria 4212
616 Ga0373937_0042128 3300036401 Unclassified 4165
617 Ga0373937_0068296 3300036401 Unclassified 3277
618 Ga0373937_0094374 3300036401 Bacteria 2774
619 Ga0373937_0146006 3300036401 Unclassified 2214
620 Ga0373925_0001746 3300037068 Bacteria 18185
621 Ga0373925_0006323 3300037068 Bacteria 8726
622 Ga0373925_0010718 3300037068 Bacteria 6648
623 Ga0373925_0015099 3300037068 Bacteria 5582
624 Ga0373925_0050212 3300037068 Bacteria 3111
625 Ga0373925_0588364 3300037068 Bacteria 916
626 Ga0395900_0581743 3300037418 Unclassified 1062
627 Ga0395905_0014052 3300037471 Bacteria 7656
628 Ga0395905_0094282 3300037471 Bacteria 2808
629 Ga0395905_0112238 3300037471 Bacteria 2560
630 Ga0395905_0581691 3300037471 Unclassified 1021
631 Ga0436363_0614911 3300039450 Unclassified 1225
632 Ga0439448_0151762 3300042005 Unclassified 804
633 Ga0451577_0000054 3300042876 Bacteria 278798
634 Ga0451577_0069920 3300042876 Bacteria 3131
635 Ga0466972_0157910 3300044658 Bacteria 1066
636 Ga0453683_0086809 3300044673 Unclassified 1960
637 Ga0453683_0382578 3300044673 Bacteria 906
638 Ga0466966_0361578 3300044684 Unclassified 872
639 Ga0466963_0044386 3300044694 Bacteria 2926
640 Ga0466963_0048387 3300044694 Bacteria 2809
641 Ga0466963_0105669 3300044694 Bacteria 1930
642 Ga0466963_0121453 3300044694 Bacteria 1798
643 Ga0453684_0000289 3300044712 Bacteria 215476
644 Ga0466971_0040010 3300044719 Bacteria 2105
645 Ga0466959_0036840 3300045049 Bacteria 3614
646 Ga0466959_0056451 3300045049 Bacteria 2865
647 Ga0466959_0268582 3300045049 Bacteria 1173
648 Ga0451576_0003856 3300045051 Bacteria 20119
649 Ga0451576_0584097 3300045051 Bacteria 1174
650 Ga0451576_0714993 3300045051 Unclassified 1052
651 Ga0466967_0019520 3300045976 Bacteria 5452
652 Ga0466967_0038296 3300045976 Bacteria 4111
653 Ga0466967_0147160 3300045976 Bacteria 2198
654 Ga0466967_0172888 3300045976 Bacteria 2033
655 Ga0466967_0309241 3300045976 Unclassified 1522
656 Ga0466967_0344500 3300045976 Bacteria 1442
657 Ga0466967_0698912 3300045976 Bacteria 1004
658 Ga0495629_0057079 3300046459 Unclassified 2730
659 Ga0495653_0129523 3300046463 Bacteria 1788
660 Ga0495580_0000339 3300046472 Bacteria 38234
661 Ga0495580_0000866 3300046472 Bacteria 26106
662 Ga0495580_0003206 3300046472 Bacteria 14011
663 Ga0495580_0003263 3300046472 Bacteria 13873
664 Ga0495580_0003856 3300046472 Bacteria 12690
665 Ga0495580_0005674 3300046472 Bacteria 10266
666 Ga0495580_0023059 3300046472 Unclassified 4576
667 Ga0495580_0063252 3300046472 Bacteria 2596
668 Ga0495580_0130412 3300046472 Bacteria 1744
669 Ga0495580_0154129 3300046472 Bacteria 1591
670 Ga0495580_0195749 3300046472 Bacteria 1393
671 Ga0495580_0266572 3300046472 Unclassified 1171
672 Ga0495580_0444427 3300046472 Bacteria 870
673 Ga0495582_0000894 3300046473 Bacteria 16570
674 Ga0495582_0030949 3300046473 Bacteria 2940
675 Ga0495582_0184993 3300046473 Bacteria 1187
676 Ga0495582_0330850 3300046473 Bacteria 877
677 Ga0495639_0037390 3300046475 Unclassified 2176
678 Ga0495664_0004937 3300046477 Bacteria 7300
679 Ga0495584_0199963 3300046491 Bacteria 1016
680 Ga0495594_0013915 3300046499 Bacteria 4210
681 Ga0495608_0152948 3300046511 Unclassified 1470
682 Ga0495630_0024839 3300046517 Bacteria 4430
683 Ga0495630_0133421 3300046517 Bacteria 1886
684 Ga0495630_0143584 3300046517 Bacteria 1815
685 Ga0495630_0422208 3300046517 Unclassified 1022
686 Ga0495666_0054371 3300046526 Bacteria 1920
687 Ga0495665_0029483 3300046531 Bacteria 2939
688 Ga0495645_0099866 3300046543 Bacteria 2065
689 Ga0495667_0252387 3300046559 Bacteria 1123
690 Ga0495659_0009891 3300046664 Unclassified 3050
691 Ga0495659_0029741 3300046664 Bacteria 1898
692 Ga0495623_0037487 3300046679 Bacteria 3102
693 Ga0495623_0241978 3300046679 Unclassified 1019
694 Ga0495658_0033030 3300046683 Bacteria 2831
695 Ga0495613_0254123 3300046689 Bacteria 1226
696 Ga0495581_0026292 3300047315 Bacteria 3375
697 Ga0495674_0009986 3300047319 Bacteria 8995
698 Ga0495674_0013336 3300047319 Bacteria 7728
699 Ga0495674_0028375 3300047319 Bacteria 5103
700 Ga0495674_0180898 3300047319 Bacteria 1756
701 Ga0495675_0089216 3300047444 Bacteria 1936
702 Ga0495684_0214841 3300047471 Bacteria 1412
703 Ga0495602_0045200 3300048088 Bacteria 3987
704 Ga0495602_0081377 3300048088 Unclassified 2723
705 Ga0496100_0036261 3300048903 Unclassified 3109
706 Ga0496100_0150376 3300048903 Bacteria 1660
707 Ga0496101_0027085 3300048904 Bacteria 3988
708 Ga0496101_0133524 3300048904 Bacteria 1887
709 Ga0496102_0020662 3300048905 Bacteria 5818
710 Ga0496102_0067995 3300048905 Bacteria 3268
711 Ga0496102_0084613 3300048905 Unclassified 2927
712 Ga0496102_0116704 3300048905 Unclassified 2491
713 Ga0496102_0645887 3300048905 Bacteria 981
714 Ga0496102_0667091 3300048905 Unclassified 963
715 Ga0496103_0334277 3300048906 Unclassified 974
716 Ga0496104_0078352 3300048907 Unclassified 3149
717 Ga0496104_0116617 3300048907 Unclassified 2563
718 Ga0496104_0550592 3300048907 Unclassified 1064
719 Ga0496105_0107507 3300048908 Unclassified 2303
720 Ga0496106_0008877 3300048909 Bacteria 7429
721 Ga0496106_0135771 3300048909 Unclassified 1932
722 Ga0496107_0106815 3300048910 Unclassified 2056
723 Ga0496107_0371209 3300048910 Unclassified 1064
724 Ga0496108_0000364 3300048911 Bacteria 38115
725 Ga0496108_0026743 3300048911 Unclassified 4762
726 Ga0496108_0190433 3300048911 Unclassified 1778
727 Ga0496109_0000083 3300048912 Bacteria 96495
728 Ga0496109_0115669 3300048912 Unclassified 2496
729 Ga0496109_0206519 3300048912 Unclassified 1847
730 Ga0496110_0001378 3300048913 Bacteria 17513
731 Ga0496111_0053702 3300048914 Unclassified 2911
732 Ga0496112_0000033 3300048915 Bacteria 112312
733 Ga0496112_0011761 3300048915 Bacteria 8014
734 Ga0496112_0076649 3300048915 Bacteria 3307
735 Ga0496112_0397455 3300048915 Bacteria 1318
736 Ga0496113_0000409 3300048916 Bacteria 20747
737 Ga0496113_0029114 3300048916 Unclassified 3983
738 Ga0496113_0101382 3300048916 Unclassified 2232
739 Ga0496114_0021085 3300048917 Bacteria 5297
740 Ga0496114_0423022 3300048917 Unclassified 1180
741 Ga0496115_0042329 3300048918 Unclassified 3628
742 Ga0496115_0117965 3300048918 Unclassified 2183
743 Ga0496115_0210376 3300048918 Unclassified 1606
744 Ga0501257_032966 3300049686 Bacteria 1254
745 nmdc:mga05p37_64476_c1 3300050507 Bacteria 4508
746 nmdc:mga0n895_110481_c1 3300050512 Unclassified 2765
747 nmdc:mga0n895_184151_c1 3300050512 Bacteria 2120
748 nmdc:mga0n895_4256_c1 3300050512 Bacteria 11707
749 nmdc:mga0rr50_1418_c2 3300050513 Bacteria 8335
750 nmdc:mga0rr50_61311_c1 3300050513 Bacteria 2833
751 nmdc:mga08x19_11115_c1 3300050514 Bacteria 5419
752 nmdc:mga08x19_119480_c1 3300050514 Bacteria 1766
753 nmdc:mga08x19_51572_c1 3300050514 Unclassified 2644
754 nmdc:mga08x19_8085_c1 3300050514 Bacteria 6251
755 nmdc:mga08x19_84642_c1 3300050514 Unclassified 2086
756 nmdc:mga0a205_94205_c1 3300050515 Unclassified 2893
757 Ga0495601_0139634 3300053077 Bacteria 1580
758 Ga0466962_0161158 3300061719 Bacteria 1090
759 Ga0068851_10005910
760 MBSR1b_contig_2440585
761 LJNas_1000061
762 JGI24752J21851_1002601
763 JGI24752J21851_1010591
764 JGI24737J22298_10035794
765 JGI24743J22301_10003615
766 JGI24749J21850_1011357
767 JGI24034J26672_10002033
768 JGI24751J29686_10009293
769 rootH1_10241807
770 Ga0065704_10212625
771 Ga0065712_10103109
772 Ga0065715_10002873
773 Ga0065715_10042721
774 Ga0065715_10167537
775 Ga0070658_10032446
776 Ga0070658_10050888
777 Ga0070658_10484135
778 Ga0070676_10022196
779 Ga0070676_10033075
780 Ga0070683_100003207
781 Ga0070683_100020247
782 Ga0070683_100265152
783 Ga0070690_100006515
784 Ga0070690_100025748
785 Ga0070670_100098393
786 Ga0070670_100161096
787 Ga0070677_10004840
788 Ga0070666_10022479
789 Ga0070680_100022024
790 Ga0070682_100008804
791 Ga0070682_100020364
792 Ga0068868_100015706
793 Ga0068868_100022154
794 Ga0068868_100264850
795 Ga0068868_100523575
796 Ga0070660_100007722
797 Ga0070660_100010443
798 Ga0070660_100011778
799 Ga0070689_100021775
800 Ga0070661_100013761
801 Ga0070668_100011552
802 Ga0070668_100012680
803 Ga0070668_100722252
804 Ga0070669_100004020
805 Ga0070675_100006644
806 Ga0070671_100041823
807 Ga0070674_100017358
808 Ga0070674_100223904
809 Ga0070688_100005503
810 Ga0070659_100011195
811 Ga0070659_100190079
812 Ga0070667_100010376
813 Ga0070667_100326021
814 Ga0070709_10008347
815 Ga0070709_10018507
816 Ga0070709_10022109
817 Ga0070709_10043382
818 Ga0070709_10117888
819 Ga0070709_10132346
820 Ga0070709_10164883
821 Ga0070709_10186990
822 Ga0070709_10297268
823 Ga0070714_100000299
824 Ga0070714_100025638
825 Ga0070714_100029479
826 Ga0070714_100059308
827 Ga0070714_100078534
828 Ga0070714_100080357
829 Ga0070714_100103193
830 Ga0070714_100177061
831 Ga0070714_100211748
832 Ga0070714_100211907
833 Ga0070714_100610376
834 Ga0070713_100000060
835 Ga0070713_100000108
836 Ga0070713_100003414
837 Ga0070713_100036661
838 Ga0070713_100056150
839 Ga0070713_100170424
840 Ga0070713_100223188
841 Ga0070713_100261661
842 Ga0070710_10045241
843 Ga0070710_10093711
844 Ga0070710_10108807
845 Ga0070710_10348798
846 Ga0070711_100000525
847 Ga0070711_100000689
848 Ga0070711_100002403
849 Ga0070711_100023292
850 Ga0070711_100032880
851 Ga0070711_100674280
852 Ga0070705_100088614
853 Ga0070705_100474452
854 Ga0070708_100000347
855 Ga0070708_100000500
856 Ga0070708_100001815
857 Ga0070708_100006972
858 Ga0070708_100010270
859 Ga0070708_100012796
860 Ga0070708_100014353
861 Ga0070708_100020138
862 Ga0070708_100042149
863 Ga0070708_100157258
864 Ga0070708_100248526
865 Ga0070663_100026061
866 Ga0070663_100125183
867 Ga0070678_100311334
868 Ga0070662_100009117
869 Ga0070662_100037286
870 Ga0070662_100182433
871 Ga0070681_10049656
872 Ga0070681_10409687
873 Ga0068867_100016049
874 Ga0068867_100049758
875 Ga0070685_10010306
876 Ga0070685_10264472
877 Ga0070706_100001585
878 Ga0070706_100004125
879 Ga0070706_100024440
880 Ga0070706_100026294
881 Ga0070706_100155352
882 Ga0070706_100167799
883 Ga0070706_100302393
884 Ga0070707_100002300
885 Ga0070707_100002700
886 Ga0070707_100022750
887 Ga0070707_100049851
888 Ga0070707_100055888
889 Ga0070707_100079034
890 Ga0070707_100093610
891 Ga0070707_100184787
892 Ga0070707_100306070
893 Ga0070707_100382667
894 Ga0070707_100394397
895 Ga0070698_100000547
896 Ga0070698_100009673
897 Ga0070698_100095364
898 Ga0070698_100415171
899 Ga0070698_100431350
900 Ga0070699_100000343
901 Ga0070699_100010416
902 Ga0070699_100079592
903 Ga0070699_100090096
904 Ga0070699_100126879
905 Ga0070699_100135513
906 Ga0070699_100368411
907 Ga0070679_100046636
908 Ga0070679_100213165
909 Ga0070684_100006119
910 Ga0070684_100042749
911 Ga0070684_100883401
912 Ga0070697_100000208
913 Ga0070697_100000786
914 Ga0070697_100000960
915 Ga0070697_100002199
916 Ga0070697_100002461
917 Ga0070697_100028329
918 Ga0070697_100034470
919 Ga0070697_100232976
920 Ga0070697_100338669
921 Ga0070697_100411065
922 Ga0068853_100004876
923 Ga0068853_100075519
924 Ga0068853_100164603
925 Ga0070672_100175402
926 Ga0070686_100542463
927 Ga0070695_100046775
928 Ga0070695_100054368
929 Ga0070695_100570208
930 Ga0070696_100019515
931 Ga0070693_100023440
932 Ga0070665_100021084
933 Ga0070665_100109609
934 Ga0070704_100081759
935 Ga0068855_100037722
936 Ga0068855_100067240
937 Ga0068855_100097672
938 Ga0068855_100378739
939 Ga0068855_100380745
940 Ga0068855_100472397
941 Ga0070664_100028528
942 Ga0070664_100067206
943 Ga0068857_100004674
944 Ga0068857_100150096
945 Ga0068857_100437876
946 Ga0068854_100069057
947 Ga0068854_100078058
948 Ga0068854_100196552
949 Ga0068856_100030898
950 Ga0068856_100051816
951 Ga0068856_100068780
952 Ga0068856_100071748
953 Ga0070702_100454051
954 Ga0068852_100019600
955 Ga0068852_100046909
956 Ga0068852_100592868
957 Ga0068859_100028578
958 Ga0068859_100033577
959 Ga0068864_100012096
960 Ga0068866_10042460
961 Ga0068861_100341956
962 Ga0068863_100041428
963 Ga0068863_100056904
964 Ga0068858_100022290
965 Ga0068858_100037574
966 Ga0068860_100101479
967 Ga0068862_100014886
968 Ga0068862_100064053
969 Ga0070717_10000503
970 Ga0070717_10001316
971 Ga0070717_10004398
972 Ga0070717_10016942
973 Ga0070717_10023410
974 Ga0070717_10039264
975 Ga0070717_10098862
976 Ga0070717_10112889
977 Ga0070717_10117610
978 Ga0070717_10142678
979 Ga0070717_10288545
980 Ga0070717_10385288
981 Ga0070717_10426547
982 Ga0070717_10490166
983 Ga0070717_10573261
984 Ga0070717_10659089
985 Ga0070715_10000405
986 Ga0070715_10005691
987 Ga0070715_10006368
988 Ga0070715_10043926
989 Ga0070716_100000064
990 Ga0070716_100004991
991 Ga0070716_100048249
992 Ga0070716_100064277
993 Ga0070716_100069966
994 Ga0070716_100072529
995 Ga0070712_100000179
996 Ga0070712_100000196
997 Ga0070712_100000780
998 Ga0070712_100001325
999 Ga0070712_100019136
1000 Ga0070712_100145593
1001 Ga0070712_100159898
1002 Ga0070712_100489881
1003 Ga0097621_100005110
1004 Ga0097621_100268955
1005 Ga0097621_100300224
1006 Ga0068871_100012682
1007 Ga0068871_100019808
1008 Ga0068871_100070708
1009 Ga0068871_100227202
1010 Ga0068871_100244332
1011 Ga0068871_100287301
1012 Ga0068871_100427056
1013 Ga0075434_100004944
1014 Ga0075434_100012876
1015 Ga0075434_100087387
1016 Ga0075436_100000301
1017 Ga0075436_100016833
1018 Ga0075436_100060072
1019 Ga0075436_100185470
1020 Ga0075436_100445499
1021 Ga0097620_100028575
1022 Ga0097620_100033578
1023 Ga0075435_100021891
1024 Ga0075435_100025649
1025 Ga0075435_100049415
1026 Ga0075435_100072631
1027 Ga0075435_100594686
1028 Ga0099794_10077671
1029 Ga0099794_10093061
1030 Ga0099795_10027875
1031 Ga0099795_10033786
1032 Ga0099795_10041901
1033 Ga0105250_10027720
1034 Ga0105240_10012666
1035 Ga0105240_10037944
1036 Ga0105240_10053134
1037 Ga0105240_10053919
1038 Ga0105240_10077399
1039 Ga0105240_10111707
1040 Ga0105240_10143778
1041 Ga0105240_10217993
1042 Ga0111539_10659627
1043 Ga0105245_10017450
1044 Ga0105245_10055492
1045 Ga0105245_10071577
1046 Ga0105245_10138133
1047 Ga0105247_10003282
1048 Ga0105247_10004648
1049 Ga0105247_10158498
1050 Ga0114129_10060514
1051 Ga0105243_10122911
1052 Ga0105243_10273378
1053 Ga0105241_10005002
1054 Ga0105241_10016473
1055 Ga0105241_10168100
1056 Ga0105242_10034402
1057 Ga0105242_10387873
1058 Ga0105248_10010666
1059 Ga0105248_10565179
1060 Ga0105248_11262506
1061 Ga0105237_10024915
1062 Ga0105237_10096786
1063 Ga0105237_10184669
1064 Ga0105237_10289037
1065 Ga0105238_10009704
1066 Ga0105238_10026525
1067 Ga0105238_10032651
1068 Ga0105238_10113335
1069 Ga0105238_10185734
1070 Ga0105249_10001809
1071 Ga0105249_10098320
1072 Ga0105249_10142880
1073 Ga0099796_10014462
1074 Ga0105239_10177821
1075 Ga0105246_10002192
1076 Ga0105246_10025587
1077 Ga0105246_10173335
1078 Ga0157373_10015692
1079 Ga0157373_10017869
1080 Ga0157373_10024229
1081 Ga0157373_10082091
1082 Ga0157371_10008238
1083 Ga0157371_10462070
1084 Ga0157370_10156555
1085 Ga0157369_10000794
1086 Ga0157369_10011531
1087 Ga0157369_10020732
1088 Ga0157369_10023457
1089 Ga0157369_10024478
1090 Ga0157369_10037666
1091 Ga0157369_10093524
1092 Ga0157369_10162142
1093 Ga0157374_10001851
1094 Ga0157374_10005139
1095 Ga0157374_10058016
1096 Ga0157374_10364126
1097 Ga0157374_10583412
1098 Ga0157378_10015111
1099 Ga0157378_10066556
1100 Ga0157378_10066673
1101 Ga0157378_10431652
1102 Ga0157378_10491156
1103 Ga0157378_10626418
1104 Ga0163162_10039073
1105 Ga0163162_10057062
1106 Ga0163162_10144581
1107 Ga0163162_10163674
1108 Ga0163162_10661148
1109 Ga0157372_10000661
1110 Ga0157372_10012631
1111 Ga0157372_10024144
1112 Ga0157372_10045950
1113 Ga0157372_10144935
1114 Ga0157372_10230969
1115 Ga0157372_10449285
1116 Ga0157375_10066909
1117 Ga0163163_10005225
1118 Ga0163163_10060017
1119 Ga0163163_10167569
1120 Ga0157377_10001671
1121 Ga0157379_10011817
1122 Ga0157379_10040955
1123 Ga0157379_10078863
1124 Ga0157376_10002705
1125 Ga0157376_10098002
1126 Ga0157376_10284399
1127 Ga0182006_1035562
1128 Ga0182006_1046161
1129 Ga0182007_10015342
1130 Ga0182007_10064944
1131 Ga0182005_1017450
1132 Ga0163161_10009403
1133 Ga0224570_100933
1134 Ga0224569_100376
1135 Ga0224572_1005365
1136 Ga0228598_1001637
1137 Ga0228598_1002092
1138 Ga0228598_1005914
1139 Ga0207697_10007237
1140 Ga0207656_10012495
1141 Ga0207656_10038570
1142 Ga0207692_10183753
1143 Ga0207692_10260393
1144 Ga0207642_10009967
1145 Ga0207688_10005213
1146 Ga0207680_10058928
1147 Ga0207647_10001373
1148 Ga0207647_10249763
1149 Ga0207685_10004100
1150 Ga0207685_10020208
1151 Ga0207685_10123423
1152 Ga0207699_10028522
1153 Ga0207699_10029803
1154 Ga0207699_10062011
1155 Ga0207699_10067282
1156 Ga0207699_10261019
1157 Ga0207645_10000011
1158 Ga0207645_10010651
1159 Ga0207643_10003295
1160 Ga0207684_10000081
1161 Ga0207684_10003969
1162 Ga0207684_10045476
1163 Ga0207684_10091608
1164 Ga0207684_10092418
1165 Ga0207684_10226285
1166 Ga0207684_10375435
1167 Ga0207654_10007606
1168 Ga0207654_10013233
1169 Ga0207654_10043545
1170 Ga0207654_10230504
1171 Ga0207654_10264618
1172 Ga0207707_10058109
1173 Ga0207707_10069742
1174 Ga0207695_10008921
1175 Ga0207695_10029851
1176 Ga0207695_10120246
1177 Ga0207695_10130145
1178 Ga0207695_10244959
1179 Ga0207671_10021152
1180 Ga0207671_10205210
1181 Ga0207671_10384270
1182 Ga0207671_10576780
1183 Ga0207693_10000042
1184 Ga0207693_10000191
1185 Ga0207693_10000221
1186 Ga0207693_10008695
1187 Ga0207693_10022404
1188 Ga0207693_10250218
1189 Ga0207693_10352395
1190 Ga0207663_10000544
1191 Ga0207663_10001591
1192 Ga0207663_10006091
1193 Ga0207663_10034774
1194 Ga0207663_10048279
1195 Ga0207663_10068797
1196 Ga0207663_10373890
1197 Ga0207660_10259345
1198 Ga0207662_10000594
1199 Ga0207657_10001258
1200 Ga0207657_10003804
1201 Ga0207657_10018061
1202 Ga0207649_10002513
1203 Ga0207649_10039882
1204 Ga0207649_10366415
1205 Ga0207652_10120860
1206 Ga0207652_10130487
1207 Ga0207646_10000880
1208 Ga0207646_10002622
1209 Ga0207646_10019808
1210 Ga0207646_10074290
1211 Ga0207646_10079670
1212 Ga0207646_10153506
1213 Ga0207646_10206620
1214 Ga0207646_10316540
1215 Ga0207646_10448403
1216 Ga0207681_10051054
1217 Ga0207694_10197766
1218 Ga0207694_10473972
1219 Ga0207650_10002279
1220 Ga0207650_10081026
1221 Ga0207659_10026076
1222 Ga0207687_10005580
1223 Ga0207700_10000358
1224 Ga0207700_10002265
1225 Ga0207700_10054528
1226 Ga0207700_10091335
1227 Ga0207700_10105627
1228 Ga0207700_10113979
1229 Ga0207700_10243216
1230 Ga0207664_10000320
1231 Ga0207664_10111356
1232 Ga0207664_10303295
1233 Ga0207664_10417759
1234 Ga0207664_10456258
1235 Ga0207644_10207527
1236 Ga0207690_10123048
1237 Ga0207690_10136210
1238 Ga0207706_10000698
1239 Ga0207706_10001011
1240 Ga0207706_10027530
1241 Ga0207686_10090261
1242 Ga0207686_10433941
1243 Ga0207709_10407725
1244 Ga0207670_10033080
1245 Ga0207665_10016946
1246 Ga0207665_10086683
1247 Ga0207665_10119231
1248 Ga0207691_10006128
1249 Ga0207711_10010872
1250 Ga0207711_10026059
1251 Ga0207689_10000194
1252 Ga0207661_10013948
1253 Ga0207661_10130360
1254 Ga0207679_10000051
1255 Ga0207679_10000172
1256 Ga0207679_10038142
1257 Ga0207679_10085591
1258 Ga0207667_10015081
1259 Ga0207667_10056659
1260 Ga0207667_10476150
1261 Ga0207651_10562823
1262 Ga0207712_10028731
1263 Ga0207712_10033549
1264 Ga0207668_10063210
1265 Ga0207640_10120696
1266 Ga0207658_10035575
1267 Ga0207658_10539730
1268 Ga0207677_10205337
1269 Ga0207677_10205707
1270 Ga0207677_10231629
1271 Ga0207703_10092601
1272 Ga0207703_10115737
1273 Ga0207639_10046136
1274 Ga0207639_10148925
1275 Ga0207678_10001863
1276 Ga0207678_10003097
1277 Ga0207702_10010082
1278 Ga0207702_10026902
1279 Ga0207702_10051335
1280 Ga0207702_10057807
1281 Ga0207702_10058337
1282 Ga0207702_10125164
1283 Ga0207641_10000316
1284 Ga0207641_10045290
1285 Ga0207648_10009781
1286 Ga0207676_10000107
1287 Ga0207674_10000034
1288 Ga0207674_10018519
1289 Ga0207674_10187677
1290 Ga0207674_10234939
1291 Ga0207675_100037976
1292 Ga0207683_10002001
1293 Ga0207698_10047854
1294 Ga0209998_10012286
1295 Ga0265356_1000070
1296 Ga0265356_1003056
1297 Ga0265355_1000879
1298 Ga0268266_10008585
1299 Ga0268265_10017334
1300 Ga0268265_10019865
1301 Ga0268264_10084068
1302 Ga0268264_10243347
1303 Ga0265338_10005052
1304 Ga0265338_10047790
1305 Ga0265762_1000209
1306 Ga0265762_1005393
1307 Ga0265762_1027154
1308 Ga0265770_1015686
1309 Ga0265760_10002341
1310 Ga0265760_10002446
1311 Ga0265760_10015471
1312 Ga0265760_10022737
1313 Ga0265760_10060299
1314 Ga0265325_10017766
1315 Ga0265325_10026504
1316 Ga0265339_10032388
1317 Ga0265339_10046710
1318 Ga0265339_10180841
1319 Ga0265316_10006191
1320 Ga0265314_10001772
1321 Ga0265314_10022004
1322 Ga0316214_1018849
1323 Ga0373930_0012139
1324 Ga0373938_0020684
1325 Ga0373926_0011416
1326 Ga0373926_0128154
1327 Ga0373929_0054493
1328 Ga0373934_0114046
1329 Ga0373944_0058534
1330 Ga0373923_0021809
1331 Ga0373932_0076078
1332 Ga0373936_0003768
1333 Ga0373936_0005288
1334 Ga0373936_0019428
1335 Ga0373936_0032182
1336 Ga0373939_0021977
1337 Ga0373945_0002946
1338 Ga0373945_0132977
1339 Ga0373953_0013588
1340 Ga0373954_0243153
1341 Ga0373956_0021806
1342 Ga0373957_0173694
1343 Ga0373943_0000212
1344 Ga0373943_0020588
1345 Ga0373943_0028162
1346 Ga0373943_0090781
1347 Ga0373946_0015272
1348 Ga0373946_0030197
1349 Ga0373946_0047233
1350 Ga0373946_0115381
1351 Ga0373955_0005674
1352 Ga0373955_0148842
1353 Ga0373962_0018136
1354 Ga0373924_0016409
1355 Ga0373931_0048077
1356 Ga0373935_0009901
1357 Ga0373935_0036775
1358 Ga0373935_0036890
1359 Ga0373935_0421516
1360 Ga0373935_0488660
1361 Ga0373927_0000062
1362 Ga0373927_0054099
1363 Ga0373927_0057657
1364 Ga0373927_0062760
1365 Ga0373927_0104522
1366 Ga0373933_0025596
1367 Ga0373933_0198490
1368 Ga0373947_0001513
1369 Ga0373947_0005251
1370 Ga0373947_0005799
1371 Ga0373947_0100430
1372 Ga0373947_0161578
1373 Ga0373937_0041219
1374 Ga0373937_0042128
1375 Ga0373937_0068296
1376 Ga0373937_0094374
1377 Ga0373937_0146006
1378 Ga0373925_0001746
1379 Ga0373925_0006323
1380 Ga0373925_0010718
1381 Ga0373925_0015099
1382 Ga0373925_0050212
1383 Ga0373925_0588364
1384 Ga0395900_0581743
1385 Ga0395905_0014052
1386 Ga0395905_0094282
1387 Ga0395905_0112238
1388 Ga0395905_0581691
1389 Ga0436363_0614911
1390 Ga0439448_0151762
1391 Ga0451577_0000054
1392 Ga0451577_0069920
1393 Ga0466972_0157910
1394 Ga0453683_0086809
1395 Ga0453683_0382578
1396 Ga0466966_0361578
1397 Ga0466963_0044386
1398 Ga0466963_0048387
1399 Ga0466963_0105669
1400 Ga0466963_0121453
1401 Ga0453684_0000289
1402 Ga0466971_0040010
1403 Ga0466959_0036840
1404 Ga0466959_0056451
1405 Ga0466959_0268582
1406 Ga0451576_0003856
1407 Ga0451576_0584097
1408 Ga0451576_0714993
1409 Ga0466967_0019520
1410 Ga0466967_0038296
1411 Ga0466967_0147160
1412 Ga0466967_0172888
1413 Ga0466967_0309241
1414 Ga0466967_0344500
1415 Ga0466967_0698912
1416 Ga0495629_0057079
1417 Ga0495653_0129523
1418 Ga0495580_0000339
1419 Ga0495580_0000866
1420 Ga0495580_0003206
1421 Ga0495580_0003263
1422 Ga0495580_0003856
1423 Ga0495580_0005674
1424 Ga0495580_0023059
1425 Ga0495580_0063252
1426 Ga0495580_0130412
1427 Ga0495580_0154129
1428 Ga0495580_0195749
1429 Ga0495580_0266572
1430 Ga0495580_0444427
1431 Ga0495582_0000894
1432 Ga0495582_0030949
1433 Ga0495582_0184993
1434 Ga0495582_0330850
1435 Ga0495639_0037390
1436 Ga0495664_0004937
1437 Ga0495584_0199963
1438 Ga0495594_0013915
1439 Ga0495608_0152948
1440 Ga0495630_0024839
1441 Ga0495630_0133421
1442 Ga0495630_0143584
1443 Ga0495630_0422208
1444 Ga0495666_0054371
1445 Ga0495665_0029483
1446 Ga0495645_0099866
1447 Ga0495667_0252387
1448 Ga0495659_0009891
1449 Ga0495659_0029741
1450 Ga0495623_0037487
1451 Ga0495623_0241978
1452 Ga0495658_0033030
1453 Ga0495613_0254123
1454 Ga0495581_0026292
1455 Ga0495674_0009986
1456 Ga0495674_0013336
1457 Ga0495674_0028375
1458 Ga0495674_0180898
1459 Ga0495675_0089216
1460 Ga0495684_0214841
1461 Ga0495602_0045200
1462 Ga0495602_0081377
1463 Ga0496100_0036261
1464 Ga0496100_0150376
1465 Ga0496101_0027085
1466 Ga0496101_0133524
1467 Ga0496102_0020662
1468 Ga0496102_0067995
1469 Ga0496102_0084613
1470 Ga0496102_0116704
1471 Ga0496102_0645887
1472 Ga0496102_0667091
1473 Ga0496103_0334277
1474 Ga0496104_0078352
1475 Ga0496104_0116617
1476 Ga0496104_0550592
1477 Ga0496105_0107507
1478 Ga0496106_0008877
1479 Ga0496106_0135771
1480 Ga0496107_0106815
1481 Ga0496107_0371209
1482 Ga0496108_0000364
1483 Ga0496108_0026743
1484 Ga0496108_0190433
1485 Ga0496109_0000083
1486 Ga0496109_0115669
1487 Ga0496109_0206519
1488 Ga0496110_0001378
1489 Ga0496111_0053702
1490 Ga0496112_0000033
1491 Ga0496112_0011761
1492 Ga0496112_0076649
1493 Ga0496112_0397455
1494 Ga0496113_0000409
1495 Ga0496113_0029114
1496 Ga0496113_0101382
1497 Ga0496114_0021085
1498 Ga0496114_0423022
1499 Ga0496115_0042329
1500 Ga0496115_0117965
1501 Ga0496115_0210376
1502 Ga0501257_032966
1503 nmdc:mga05p37_64476_c1
1504 nmdc:mga0n895_110481_c1
1505 nmdc:mga0n895_184151_c1
1506 nmdc:mga0n895_4256_c1
1507 nmdc:mga0rr50_1418_c2
1508 nmdc:mga0rr50_61311_c1
1509 nmdc:mga08x19_11115_c1
1510 nmdc:mga08x19_119480_c1
1511 nmdc:mga08x19_51572_c1
1512 nmdc:mga08x19_8085_c1
1513 nmdc:mga08x19_84642_c1
1514 nmdc:mga0a205_94205_c1
1515 Ga0495601_0139634
1516 Ga0466962_0161158

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00717

Peptidase_S24

Peptidase S24-like

126

265

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9407 23 62
3kxa-assembly2.cif.gz_D crystal structure of ngo0477 from neisseria gonorrhoeae 0.8678 22 68
6tri-assembly1.cif.gz_B ci-mor repressor-antirepressor complex of the temperate bacteriophage tp901-1 from lactococcus lactis 0.8658 24 73
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.8641 19 67
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.8625 19 67
ID Description Score Start End Superfamily
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9407 23 62 1.10.260.40
3kxaB02 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8661 23 68 1.10.260.40
2ebyB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8602 14 65 1.10.260.40
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8519 14 65 1.10.260.40
3k2zB02 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8226 138 238 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A2V9WUH0-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9866 106 238
AF-A0A2V9WUH0-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9792 106 238
AF-A0A372INR9-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9672 88 238
AF-A0A317JCG8-F1-model_v4 XRE family transcriptional regulator 0.9568 1 70 GO:0003677
AF-A0A317JCG8-F1-model_v4 XRE family transcriptional regulator 0.9439 1 70 GO:0003677

Map