F479261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 334 | 748 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0167972|Ga0395905_0167972_577_948 |
| Length | 123 |
| Sequence | VNNDKTPNDSLAQLAAVIESRKAGDPDQSYVARLLKMGPDAILKKVGEEAGEVIMAAKDAQYGGDRQRIVSEVADLWFHCMIALSHFGLGPRDVIAELEQRAGTSGIEEKALRKARKREDGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 3 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 4 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 5 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 6 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 235 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 240 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 296 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 297 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 300 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 315 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 316 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 322 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 323 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 334 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.95 |
| Nodule | 0 |
| Rhizoplane | 4.77 |
| Rhizosphere | 77.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10006631 | 3300002077 | Bacteria | 2399 |
| 2 | JGI25152J39213_1001224 | 3300002773 | Bacteria | 11749 |
| 3 | JGI25152J39213_1001251 | 3300002773 | Bacteria | 11566 |
| 4 | JGI25152J39213_1001299 | 3300002773 | Bacteria | 11168 |
| 5 | JGI25150J39212_1005235 | 3300002774 | Bacteria | 2792 |
| 6 | JGI25153J46596_10002653 | 3300003215 | Bacteria | 10222 |
| 7 | JGI25153J46596_10004183 | 3300003215 | Bacteria | 7828 |
| 8 | Ga0006777J48905_1047703 | 3300003308 | Bacteria | 1412 |
| 9 | Ga0055526_1002262 | 3300003771 | Bacteria | 13160 |
| 10 | Ga0055530_10009773 | 3300003791 | Bacteria | 3632 |
| 11 | Ga0065165_1001456 | 3300005262 | Bacteria | 25564 |
| 12 | Ga0065707_10220135 | 3300005295 | Bacteria | 1228 |
| 13 | Ga0070658_10551114 | 3300005327 | Bacteria | 998 |
| 14 | Ga0070658_10678651 | 3300005327 | Bacteria | 894 |
| 15 | Ga0070676_10021332 | 3300005328 | Bacteria | 3626 |
| 16 | Ga0070676_10034097 | 3300005328 | Bacteria | 2922 |
| 17 | Ga0070676_10056576 | 3300005328 | Bacteria | 2318 |
| 18 | Ga0070683_100252217 | 3300005329 | Bacteria | 1678 |
| 19 | Ga0070683_100403035 | 3300005329 | Bacteria | 1304 |
| 20 | Ga0070690_100020420 | 3300005330 | Bacteria | 4035 |
| 21 | Ga0070690_100645339 | 3300005330 | Bacteria | 808 |
| 22 | Ga0070690_100728401 | 3300005330 | Bacteria | 764 |
| 23 | Ga0070670_100001787 | 3300005331 | Bacteria | 17505 |
| 24 | Ga0070670_100096015 | 3300005331 | Bacteria | 2550 |
| 25 | Ga0070670_100168819 | 3300005331 | Bacteria | 1897 |
| 26 | Ga0070670_100655440 | 3300005331 | Bacteria | 942 |
| 27 | Ga0070677_10039217 | 3300005333 | Bacteria | 1858 |
| 28 | Ga0070677_10067530 | 3300005333 | Bacteria | 1494 |
| 29 | Ga0070677_10344192 | 3300005333 | Bacteria | 770 |
| 30 | Ga0068869_100006465 | 3300005334 | Bacteria | 7436 |
| 31 | Ga0068869_100009400 | 3300005334 | Bacteria | 6343 |
| 32 | Ga0068869_100090154 | 3300005334 | Bacteria | 2304 |
| 33 | Ga0068869_100804787 | 3300005334 | Bacteria | 808 |
| 34 | Ga0070666_10006757 | 3300005335 | Bacteria | 7065 |
| 35 | Ga0070666_10197154 | 3300005335 | Bacteria | 1416 |
| 36 | Ga0070666_10486118 | 3300005335 | Bacteria | 894 |
| 37 | Ga0070682_100600912 | 3300005337 | Bacteria | 869 |
| 38 | Ga0070682_101627522 | 3300005337 | Bacteria | 559 |
| 39 | Ga0068868_100000966 | 3300005338 | Bacteria | 19576 |
| 40 | Ga0068868_100032419 | 3300005338 | Bacteria | 4019 |
| 41 | Ga0068868_100073841 | 3300005338 | Bacteria | 2724 |
| 42 | Ga0068868_100229637 | 3300005338 | Bacteria | 1556 |
| 43 | Ga0068868_100361051 | 3300005338 | Bacteria | 1246 |
| 44 | Ga0068868_101568063 | 3300005338 | Bacteria | 618 |
| 45 | Ga0070660_100102149 | 3300005339 | Bacteria | 2272 |
| 46 | Ga0070689_100175898 | 3300005340 | Bacteria | 1736 |
| 47 | Ga0070689_102109219 | 3300005340 | Bacteria | 516 |
| 48 | Ga0070687_100781062 | 3300005343 | Bacteria | 675 |
| 49 | Ga0070687_101207084 | 3300005343 | Bacteria | 558 |
| 50 | Ga0070661_100108802 | 3300005344 | Bacteria | 2068 |
| 51 | Ga0070661_100156321 | 3300005344 | Bacteria | 1725 |
| 52 | Ga0070692_10262472 | 3300005345 | Bacteria | 1039 |
| 53 | Ga0070668_100036969 | 3300005347 | Bacteria | 3727 |
| 54 | Ga0070668_100137109 | 3300005347 | Bacteria | 1969 |
| 55 | Ga0070668_100173369 | 3300005347 | Bacteria | 1757 |
| 56 | Ga0070669_100088090 | 3300005353 | Bacteria | 2323 |
| 57 | Ga0070669_100101683 | 3300005353 | Bacteria | 2169 |
| 58 | Ga0070669_100382001 | 3300005353 | Bacteria | 1149 |
| 59 | Ga0070669_100395680 | 3300005353 | Bacteria | 1129 |
| 60 | Ga0070669_101338456 | 3300005353 | Bacteria | 621 |
| 61 | Ga0070675_100008036 | 3300005354 | Bacteria | 8179 |
| 62 | Ga0070675_100061241 | 3300005354 | Bacteria | 3107 |
| 63 | Ga0070675_100062673 | 3300005354 | Bacteria | 3072 |
| 64 | Ga0070675_100080667 | 3300005354 | Bacteria | 2712 |
| 65 | Ga0070671_100011057 | 3300005355 | Bacteria | 7245 |
| 66 | Ga0070671_100160588 | 3300005355 | Bacteria | 1900 |
| 67 | Ga0070671_100208222 | 3300005355 | Bacteria | 1658 |
| 68 | Ga0070671_100323786 | 3300005355 | Bacteria | 1314 |
| 69 | Ga0070671_102113961 | 3300005355 | Bacteria | 502 |
| 70 | Ga0070674_100094896 | 3300005356 | Bacteria | 2161 |
| 71 | Ga0070674_100102944 | 3300005356 | Bacteria | 2083 |
| 72 | Ga0070674_100348681 | 3300005356 | Bacteria | 1195 |
| 73 | Ga0070674_101050108 | 3300005356 | Bacteria | 717 |
| 74 | Ga0070674_101090703 | 3300005356 | Bacteria | 704 |
| 75 | Ga0070673_100019930 | 3300005364 | Bacteria | 4827 |
| 76 | Ga0070673_100050040 | 3300005364 | Bacteria | 3265 |
| 77 | Ga0070673_100118826 | 3300005364 | Bacteria | 2201 |
| 78 | Ga0070673_100244226 | 3300005364 | Bacteria | 1562 |
| 79 | Ga0070673_100495865 | 3300005364 | Bacteria | 1104 |
| 80 | Ga0070688_100072638 | 3300005365 | Bacteria | 2205 |
| 81 | Ga0070688_101379380 | 3300005365 | Bacteria | 571 |
| 82 | Ga0070659_100043932 | 3300005366 | Bacteria | 3496 |
| 83 | Ga0070659_101312441 | 3300005366 | Bacteria | 642 |
| 84 | Ga0070667_100023158 | 3300005367 | Bacteria | 5151 |
| 85 | Ga0070667_100081424 | 3300005367 | Bacteria | 2770 |
| 86 | Ga0070667_100099658 | 3300005367 | Bacteria | 2508 |
| 87 | Ga0070667_100192145 | 3300005367 | Bacteria | 1809 |
| 88 | Ga0070667_100533439 | 3300005367 | Bacteria | 1078 |
| 89 | Ga0070667_100950070 | 3300005367 | Bacteria | 801 |
| 90 | Ga0070700_100095800 | 3300005441 | Bacteria | 1946 |
| 91 | Ga0070700_100973609 | 3300005441 | Bacteria | 696 |
| 92 | Ga0070663_100001375 | 3300005455 | Bacteria | 13329 |
| 93 | Ga0070663_100273872 | 3300005455 | Bacteria | 1343 |
| 94 | Ga0070663_102104065 | 3300005455 | Bacteria | 509 |
| 95 | Ga0070678_100006239 | 3300005456 | Bacteria | 6975 |
| 96 | Ga0070678_100077866 | 3300005456 | Bacteria | 2502 |
| 97 | Ga0070678_101352439 | 3300005456 | Bacteria | 664 |
| 98 | Ga0070662_100017313 | 3300005457 | Bacteria | 4857 |
| 99 | Ga0070662_100034193 | 3300005457 | Bacteria | 3583 |
| 100 | Ga0070662_100947686 | 3300005457 | Bacteria | 736 |
| 101 | Ga0070662_101424447 | 3300005457 | Bacteria | 597 |
| 102 | Ga0070681_10176293 | 3300005458 | Bacteria | 2060 |
| 103 | Ga0070681_10628428 | 3300005458 | Bacteria | 988 |
| 104 | Ga0068867_100005640 | 3300005459 | Bacteria | 8872 |
| 105 | Ga0068867_100011669 | 3300005459 | Bacteria | 6206 |
| 106 | Ga0068867_100049124 | 3300005459 | Bacteria | 3105 |
| 107 | Ga0070685_10296691 | 3300005466 | Bacteria | 1088 |
| 108 | Ga0070685_10367513 | 3300005466 | Bacteria | 988 |
| 109 | Ga0070707_100985463 | 3300005468 | Bacteria | 808 |
| 110 | Ga0070699_102152406 | 3300005518 | Bacteria | 509 |
| 111 | Ga0070679_100108254 | 3300005530 | Bacteria | 2765 |
| 112 | Ga0070679_101489044 | 3300005530 | Bacteria | 624 |
| 113 | Ga0070684_100031515 | 3300005535 | Bacteria | 4514 |
| 114 | Ga0070684_100468989 | 3300005535 | Bacteria | 1164 |
| 115 | Ga0070684_101008342 | 3300005535 | Bacteria | 781 |
| 116 | Ga0068853_100077580 | 3300005539 | Bacteria | 2902 |
| 117 | Ga0068853_101845419 | 3300005539 | Bacteria | 586 |
| 118 | Ga0070672_100007718 | 3300005543 | Bacteria | 7327 |
| 119 | Ga0070672_100013592 | 3300005543 | Bacteria | 5757 |
| 120 | Ga0070672_100021973 | 3300005543 | Bacteria | 4677 |
| 121 | Ga0070672_100036721 | 3300005543 | Bacteria | 3734 |
| 122 | Ga0070672_100042843 | 3300005543 | Bacteria | 3486 |
| 123 | Ga0070672_100149059 | 3300005543 | Bacteria | 1934 |
| 124 | Ga0070686_100452954 | 3300005544 | Bacteria | 987 |
| 125 | Ga0070686_100702272 | 3300005544 | Bacteria | 807 |
| 126 | Ga0070693_100079478 | 3300005547 | Bacteria | 1952 |
| 127 | Ga0070693_100952951 | 3300005547 | Bacteria | 646 |
| 128 | Ga0070693_100988821 | 3300005547 | Bacteria | 636 |
| 129 | Ga0070665_100015286 | 3300005548 | Bacteria | 7706 |
| 130 | Ga0070665_100163978 | 3300005548 | Bacteria | 2225 |
| 131 | Ga0070665_100523187 | 3300005548 | Bacteria | 1198 |
| 132 | Ga0070665_100656324 | 3300005548 | Bacteria | 1062 |
| 133 | Ga0070704_100581445 | 3300005549 | Bacteria | 982 |
| 134 | Ga0070664_100112711 | 3300005564 | Bacteria | 2375 |
| 135 | Ga0070664_100240697 | 3300005564 | Bacteria | 1624 |
| 136 | Ga0070664_101111116 | 3300005564 | Bacteria | 745 |
| 137 | Ga0068857_100241040 | 3300005577 | Bacteria | 1655 |
| 138 | Ga0068857_100285172 | 3300005577 | Bacteria | 1520 |
| 139 | Ga0068857_100354262 | 3300005577 | Bacteria | 1359 |
| 140 | Ga0068857_101673816 | 3300005577 | Bacteria | 622 |
| 141 | Ga0068854_100436926 | 3300005578 | Bacteria | 1090 |
| 142 | Ga0068854_100499553 | 3300005578 | Bacteria | 1024 |
| 143 | Ga0068856_100007776 | 3300005614 | Bacteria | 10473 |
| 144 | Ga0068856_100200434 | 3300005614 | Bacteria | 2010 |
| 145 | Ga0070702_100261656 | 3300005615 | Bacteria | 1178 |
| 146 | Ga0070702_100410075 | 3300005615 | Bacteria | 972 |
| 147 | Ga0068852_100005075 | 3300005616 | Bacteria | 9367 |
| 148 | Ga0068852_100030245 | 3300005616 | Bacteria | 4456 |
| 149 | Ga0068852_100256445 | 3300005616 | Bacteria | 1677 |
| 150 | Ga0068852_100707440 | 3300005616 | Bacteria | 1018 |
| 151 | Ga0068852_100709170 | 3300005616 | Bacteria | 1016 |
| 152 | Ga0068852_101023768 | 3300005616 | Bacteria | 845 |
| 153 | Ga0068859_100019167 | 3300005617 | Bacteria | 6872 |
| 154 | Ga0068859_100594680 | 3300005617 | Bacteria | 1200 |
| 155 | Ga0068859_101511878 | 3300005617 | Bacteria | 741 |
| 156 | Ga0068864_100002065 | 3300005618 | Bacteria | 16597 |
| 157 | Ga0068864_100013594 | 3300005618 | Bacteria | 6748 |
| 158 | Ga0068864_100035249 | 3300005618 | Bacteria | 4259 |
| 159 | Ga0068864_100072290 | 3300005618 | Bacteria | 3005 |
| 160 | Ga0068866_10003257 | 3300005718 | Bacteria | 6683 |
| 161 | Ga0068866_10569852 | 3300005718 | Bacteria | 760 |
| 162 | Ga0068866_10725864 | 3300005718 | Bacteria | 684 |
| 163 | Ga0068861_100052430 | 3300005719 | Bacteria | 3100 |
| 164 | Ga0068861_100236372 | 3300005719 | Bacteria | 1552 |
| 165 | Ga0068861_100510359 | 3300005719 | Bacteria | 1088 |
| 166 | Ga0068851_10071766 | 3300005834 | Bacteria | 1792 |
| 167 | Ga0068851_10102633 | 3300005834 | Bacteria | 1519 |
| 168 | Ga0068851_10261466 | 3300005834 | Bacteria | 984 |
| 169 | Ga0068851_10489408 | 3300005834 | Bacteria | 736 |
| 170 | Ga0068870_11362289 | 3300005840 | Bacteria | 519 |
| 171 | Ga0068863_100017036 | 3300005841 | Bacteria | 6968 |
| 172 | Ga0068863_100020937 | 3300005841 | Bacteria | 6246 |
| 173 | Ga0068863_100059870 | 3300005841 | Bacteria | 3603 |
| 174 | Ga0068863_100085478 | 3300005841 | Bacteria | 2989 |
| 175 | Ga0068863_100248762 | 3300005841 | Bacteria | 1717 |
| 176 | Ga0068858_100015823 | 3300005842 | Bacteria | 7091 |
| 177 | Ga0068858_100039082 | 3300005842 | Bacteria | 4402 |
| 178 | Ga0068858_100061093 | 3300005842 | Bacteria | 3483 |
| 179 | Ga0068858_100319144 | 3300005842 | Bacteria | 1484 |
| 180 | Ga0068858_100936021 | 3300005842 | Bacteria | 848 |
| 181 | Ga0068858_101711269 | 3300005842 | Bacteria | 621 |
| 182 | Ga0068860_100000823 | 3300005843 | Bacteria | 34706 |
| 183 | Ga0068860_100022795 | 3300005843 | Bacteria | 6055 |
| 184 | Ga0068860_100139445 | 3300005843 | Bacteria | 2330 |
| 185 | Ga0068860_100975716 | 3300005843 | Bacteria | 865 |
| 186 | Ga0068860_101476549 | 3300005843 | Bacteria | 701 |
| 187 | Ga0068860_101949740 | 3300005843 | Bacteria | 609 |
| 188 | Ga0068862_100020457 | 3300005844 | Bacteria | 5529 |
| 189 | Ga0068862_100074012 | 3300005844 | Bacteria | 2944 |
| 190 | Ga0068862_100155446 | 3300005844 | Bacteria | 2038 |
| 191 | Ga0068862_100303293 | 3300005844 | Bacteria | 1470 |
| 192 | Ga0075363_100362819 | 3300006048 | Bacteria | 847 |
| 193 | Ga0075366_10010581 | 3300006195 | Bacteria | 5179 |
| 194 | Ga0075366_10031527 | 3300006195 | Bacteria | 3120 |
| 195 | Ga0075366_10055381 | 3300006195 | Bacteria | 2355 |
| 196 | Ga0075366_10146543 | 3300006195 | Bacteria | 1429 |
| 197 | Ga0075366_10224405 | 3300006195 | Bacteria | 1145 |
| 198 | Ga0075366_10501107 | 3300006195 | Bacteria | 751 |
| 199 | Ga0097621_100047919 | 3300006237 | Bacteria | 3464 |
| 200 | Ga0097621_100081780 | 3300006237 | Bacteria | 2689 |
| 201 | Ga0097621_100144783 | 3300006237 | Bacteria | 2033 |
| 202 | Ga0097621_100205376 | 3300006237 | Bacteria | 1712 |
| 203 | Ga0097621_100501400 | 3300006237 | Bacteria | 1099 |
| 204 | Ga0075370_10028805 | 3300006353 | Bacteria | 3090 |
| 205 | Ga0075370_10040124 | 3300006353 | Bacteria | 2640 |
| 206 | Ga0075370_10195814 | 3300006353 | Bacteria | 1192 |
| 207 | Ga0068871_100041620 | 3300006358 | Bacteria | 3684 |
| 208 | Ga0068871_100071350 | 3300006358 | Bacteria | 2856 |
| 209 | Ga0068871_100143639 | 3300006358 | Bacteria | 2031 |
| 210 | Ga0068871_100582458 | 3300006358 | Bacteria | 1016 |
| 211 | Ga0075434_100203918 | 3300006871 | Bacteria | 1998 |
| 212 | Ga0068865_100027661 | 3300006881 | Bacteria | 3748 |
| 213 | Ga0068865_100141331 | 3300006881 | Bacteria | 1815 |
| 214 | Ga0068865_100241335 | 3300006881 | Bacteria | 1422 |
| 215 | Ga0097620_100019167 | 3300006931 | Bacteria | 6872 |
| 216 | Ga0097620_100594727 | 3300006931 | Bacteria | 1200 |
| 217 | Ga0097620_101512653 | 3300006931 | Bacteria | 741 |
| 218 | Ga0075435_100347657 | 3300007076 | Bacteria | 1271 |
| 219 | Ga0105250_10087916 | 3300009092 | Bacteria | 1262 |
| 220 | Ga0105240_10025030 | 3300009093 | Bacteria | 7857 |
| 221 | Ga0105240_10646029 | 3300009093 | Bacteria | 1160 |
| 222 | Ga0105240_11241366 | 3300009093 | Bacteria | 788 |
| 223 | Ga0111539_12021008 | 3300009094 | Bacteria | 668 |
| 224 | Ga0105245_10085160 | 3300009098 | Bacteria | 2897 |
| 225 | Ga0105245_10290168 | 3300009098 | Bacteria | 1602 |
| 226 | Ga0105245_10381366 | 3300009098 | Bacteria | 1404 |
| 227 | Ga0105247_11386081 | 3300009101 | Bacteria | 568 |
| 228 | Ga0114129_12679103 | 3300009147 | Bacteria | 594 |
| 229 | Ga0105243_10011388 | 3300009148 | Bacteria | 6730 |
| 230 | Ga0105243_10206614 | 3300009148 | Bacteria | 1726 |
| 231 | Ga0105243_10587883 | 3300009148 | Bacteria | 1070 |
| 232 | Ga0105243_10847446 | 3300009148 | Bacteria | 905 |
| 233 | Ga0105243_11192326 | 3300009148 | Bacteria | 774 |
| 234 | Ga0105243_12547590 | 3300009148 | Bacteria | 551 |
| 235 | Ga0105241_10327317 | 3300009174 | Bacteria | 1323 |
| 236 | Ga0105241_11754658 | 3300009174 | Bacteria | 604 |
| 237 | Ga0105242_10260803 | 3300009176 | Bacteria | 1565 |
| 238 | Ga0105248_10040305 | 3300009177 | Bacteria | 5235 |
| 239 | Ga0105248_10074832 | 3300009177 | Bacteria | 3806 |
| 240 | Ga0105248_10360699 | 3300009177 | Bacteria | 1636 |
| 241 | Ga0105248_10388190 | 3300009177 | Bacteria | 1572 |
| 242 | Ga0105248_10423779 | 3300009177 | Bacteria | 1499 |
| 243 | Ga0105237_10007447 | 3300009545 | Bacteria | 11978 |
| 244 | Ga0105237_10098355 | 3300009545 | Bacteria | 2917 |
| 245 | Ga0105237_10191070 | 3300009545 | Bacteria | 2048 |
| 246 | Ga0105237_11401836 | 3300009545 | Bacteria | 705 |
| 247 | Ga0105238_10005477 | 3300009551 | Bacteria | 12552 |
| 248 | Ga0105238_10053451 | 3300009551 | Bacteria | 4059 |
| 249 | Ga0105238_10959206 | 3300009551 | Bacteria | 875 |
| 250 | Ga0105238_11614897 | 3300009551 | Bacteria | 678 |
| 251 | Ga0105249_10023493 | 3300009553 | Bacteria | 5532 |
| 252 | Ga0105249_10315700 | 3300009553 | Bacteria | 1572 |
| 253 | Ga0105249_10636261 | 3300009553 | Bacteria | 1124 |
| 254 | Ga0105249_11483979 | 3300009553 | Bacteria | 750 |
| 255 | Ga0105249_12699000 | 3300009553 | Bacteria | 569 |
| 256 | Ga0105239_10010780 | 3300010375 | Bacteria | 10211 |
| 257 | Ga0105239_10114929 | 3300010375 | Bacteria | 2985 |
| 258 | Ga0105239_12771490 | 3300010375 | Bacteria | 572 |
| 259 | Ga0105246_11004708 | 3300011119 | Bacteria | 755 |
| 260 | Ga0157323_1045220 | 3300012495 | Bacteria | 518 |
| 261 | Ga0157316_1071264 | 3300012510 | Bacteria | 525 |
| 262 | Ga0157327_1003137 | 3300012512 | Bacteria | 1198 |
| 263 | Ga0157373_10108192 | 3300013100 | Bacteria | 1955 |
| 264 | Ga0157371_10107101 | 3300013102 | Bacteria | 1984 |
| 265 | Ga0157369_10083325 | 3300013105 | Bacteria | 3421 |
| 266 | Ga0157369_10243757 | 3300013105 | Bacteria | 1877 |
| 267 | Ga0157374_10047942 | 3300013296 | Bacteria | 3963 |
| 268 | Ga0157374_10084070 | 3300013296 | Bacteria | 3025 |
| 269 | Ga0157374_10570997 | 3300013296 | Bacteria | 1140 |
| 270 | Ga0157374_10733648 | 3300013296 | Bacteria | 1002 |
| 271 | Ga0157374_10903417 | 3300013296 | Bacteria | 901 |
| 272 | Ga0157378_10001703 | 3300013297 | Bacteria | 19776 |
| 273 | Ga0157378_10107143 | 3300013297 | Bacteria | 2557 |
| 274 | Ga0157378_10606877 | 3300013297 | Bacteria | 1106 |
| 275 | Ga0163162_10002252 | 3300013306 | Bacteria | 18114 |
| 276 | Ga0163162_10011131 | 3300013306 | Bacteria | 8762 |
| 277 | Ga0163162_10181411 | 3300013306 | Bacteria | 2231 |
| 278 | Ga0163162_10205553 | 3300013306 | Bacteria | 2098 |
| 279 | Ga0163162_10327514 | 3300013306 | Bacteria | 1664 |
| 280 | Ga0163162_10332792 | 3300013306 | Bacteria | 1651 |
| 281 | Ga0163162_10352505 | 3300013306 | Bacteria | 1604 |
| 282 | Ga0163162_11136810 | 3300013306 | Bacteria | 885 |
| 283 | Ga0157372_10076894 | 3300013307 | Bacteria | 3769 |
| 284 | Ga0157372_10188338 | 3300013307 | Bacteria | 2390 |
| 285 | Ga0157375_10048298 | 3300013308 | Bacteria | 4162 |
| 286 | Ga0157375_10151456 | 3300013308 | Bacteria | 2455 |
| 287 | Ga0157375_10192035 | 3300013308 | Bacteria | 2197 |
| 288 | Ga0157375_10528887 | 3300013308 | Bacteria | 1342 |
| 289 | Ga0157375_10572082 | 3300013308 | Bacteria | 1290 |
| 290 | Ga0157375_10707123 | 3300013308 | Bacteria | 1161 |
| 291 | Ga0157375_11341169 | 3300013308 | Bacteria | 842 |
| 292 | Ga0163163_10009458 | 3300014325 | Bacteria | 8703 |
| 293 | Ga0157380_10040311 | 3300014326 | Bacteria | 3637 |
| 294 | Ga0157380_10258605 | 3300014326 | Bacteria | 1580 |
| 295 | Ga0157380_12906071 | 3300014326 | Bacteria | 545 |
| 296 | Ga0182008_10248962 | 3300014497 | Bacteria | 916 |
| 297 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 298 | Ga0157379_10013272 | 3300014968 | Bacteria | 7215 |
| 299 | Ga0157379_10069128 | 3300014968 | Bacteria | 3158 |
| 300 | Ga0157379_10120153 | 3300014968 | Bacteria | 2363 |
| 301 | Ga0157379_10176376 | 3300014968 | Bacteria | 1930 |
| 302 | Ga0157379_10276440 | 3300014968 | Bacteria | 1528 |
| 303 | Ga0157379_10858909 | 3300014968 | Bacteria | 859 |
| 304 | Ga0157379_11074407 | 3300014968 | Bacteria | 770 |
| 305 | Ga0157376_10098430 | 3300014969 | Bacteria | 2550 |
| 306 | Ga0157376_10115161 | 3300014969 | Bacteria | 2373 |
| 307 | Ga0157376_10115243 | 3300014969 | Bacteria | 2372 |
| 308 | Ga0157376_10176155 | 3300014969 | Bacteria | 1951 |
| 309 | Ga0157376_10543407 | 3300014969 | Bacteria | 1149 |
| 310 | Ga0157376_11459910 | 3300014969 | Bacteria | 716 |
| 311 | Ga0182007_10115543 | 3300015262 | Bacteria | 895 |
| 312 | Ga0163161_10076960 | 3300017792 | Bacteria | 2450 |
| 313 | Ga0163161_10079358 | 3300017792 | Bacteria | 2413 |
| 314 | Ga0163161_10462343 | 3300017792 | Bacteria | 1027 |
| 315 | Ga0213876_10030362 | 3300021384 | Bacteria | 2851 |
| 316 | Ga0209674_113403 | 3300025226 | Bacteria | 763 |
| 317 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 318 | Ga0207425_1001237 | 3300025245 | Bacteria | 11199 |
| 319 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 320 | Ga0209673_1010832 | 3300025273 | Bacteria | 3810 |
| 321 | Ga0209673_1065425 | 3300025273 | Bacteria | 888 |
| 322 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 323 | Ga0209758_1000281 | 3300025297 | Bacteria | 100826 |
| 324 | Ga0209758_1000310 | 3300025297 | Bacteria | 94307 |
| 325 | Ga0209050_1000303 | 3300025298 | Bacteria | 101498 |
| 326 | Ga0209051_1013169 | 3300025303 | Bacteria | 3951 |
| 327 | Ga0209257_1006026 | 3300025304 | Bacteria | 8101 |
| 328 | Ga0209257_1088606 | 3300025304 | Bacteria | 778 |
| 329 | Ga0207697_10145728 | 3300025315 | Bacteria | 1029 |
| 330 | Ga0207697_10163381 | 3300025315 | Bacteria | 972 |
| 331 | Ga0207656_10030997 | 3300025321 | Bacteria | 2212 |
| 332 | Ga0207656_10031008 | 3300025321 | Bacteria | 2211 |
| 333 | Ga0207656_10377168 | 3300025321 | Bacteria | 711 |
| 334 | Ga0207696_1085435 | 3300025711 | Bacteria | 868 |
| 335 | Ga0207682_10023185 | 3300025893 | Bacteria | 2450 |
| 336 | Ga0207682_10111417 | 3300025893 | Bacteria | 1205 |
| 337 | Ga0207682_10114272 | 3300025893 | Bacteria | 1191 |
| 338 | Ga0207642_10012685 | 3300025899 | Bacteria | 3051 |
| 339 | Ga0207680_10002140 | 3300025903 | Bacteria | 9255 |
| 340 | Ga0207647_10136054 | 3300025904 | Bacteria | 1442 |
| 341 | Ga0207645_10023242 | 3300025907 | Bacteria | 4029 |
| 342 | Ga0207645_10063446 | 3300025907 | Bacteria | 2361 |
| 343 | Ga0207645_10113574 | 3300025907 | Bacteria | 1755 |
| 344 | Ga0207643_10837842 | 3300025908 | Bacteria | 596 |
| 345 | Ga0207705_10344261 | 3300025909 | Bacteria | 1148 |
| 346 | Ga0207654_10354674 | 3300025911 | Bacteria | 1011 |
| 347 | Ga0207654_11328800 | 3300025911 | Bacteria | 524 |
| 348 | Ga0207695_10009980 | 3300025913 | Bacteria | 11666 |
| 349 | Ga0207695_10736876 | 3300025913 | Bacteria | 866 |
| 350 | Ga0207671_10008972 | 3300025914 | Bacteria | 8414 |
| 351 | Ga0207671_10113852 | 3300025914 | Bacteria | 2061 |
| 352 | Ga0207671_10153863 | 3300025914 | Bacteria | 1778 |
| 353 | Ga0207660_10145784 | 3300025917 | Bacteria | 1814 |
| 354 | Ga0207662_10721860 | 3300025918 | Bacteria | 699 |
| 355 | Ga0207649_10070050 | 3300025920 | Bacteria | 2235 |
| 356 | Ga0207649_10412864 | 3300025920 | Bacteria | 1012 |
| 357 | Ga0207652_10030048 | 3300025921 | Bacteria | 4548 |
| 358 | Ga0207681_10016930 | 3300025923 | Bacteria | 4570 |
| 359 | Ga0207681_10081625 | 3300025923 | Bacteria | 2283 |
| 360 | Ga0207681_10248638 | 3300025923 | Bacteria | 1387 |
| 361 | Ga0207681_10287302 | 3300025923 | Bacteria | 1297 |
| 362 | Ga0207681_10331005 | 3300025923 | Bacteria | 1214 |
| 363 | Ga0207681_10636469 | 3300025923 | Bacteria | 883 |
| 364 | Ga0207681_11005095 | 3300025923 | Bacteria | 700 |
| 365 | Ga0207694_10149504 | 3300025924 | Bacteria | 1881 |
| 366 | Ga0207694_11149245 | 3300025924 | Bacteria | 657 |
| 367 | Ga0207650_10072993 | 3300025925 | Bacteria | 2584 |
| 368 | Ga0207650_10169482 | 3300025925 | Bacteria | 1735 |
| 369 | Ga0207650_10240084 | 3300025925 | Bacteria | 1464 |
| 370 | Ga0207659_10020943 | 3300025926 | Bacteria | 4331 |
| 371 | Ga0207659_10024900 | 3300025926 | Bacteria | 4016 |
| 372 | Ga0207659_10090445 | 3300025926 | Bacteria | 2285 |
| 373 | Ga0207659_10098365 | 3300025926 | Bacteria | 2200 |
| 374 | Ga0207687_10102368 | 3300025927 | Bacteria | 2110 |
| 375 | Ga0207687_10251793 | 3300025927 | Bacteria | 1404 |
| 376 | Ga0207687_10266526 | 3300025927 | Bacteria | 1367 |
| 377 | Ga0207644_10002654 | 3300025931 | Bacteria | 11522 |
| 378 | Ga0207644_10220439 | 3300025931 | Bacteria | 1503 |
| 379 | Ga0207644_10423984 | 3300025931 | Bacteria | 1090 |
| 380 | Ga0207690_10112138 | 3300025932 | Bacteria | 1966 |
| 381 | Ga0207690_10454509 | 3300025932 | Bacteria | 1030 |
| 382 | Ga0207706_10013493 | 3300025933 | Bacteria | 7425 |
| 383 | Ga0207706_10031863 | 3300025933 | Bacteria | 4696 |
| 384 | Ga0207706_10388948 | 3300025933 | Bacteria | 1210 |
| 385 | Ga0207709_10002313 | 3300025935 | Bacteria | 12063 |
| 386 | Ga0207709_10063317 | 3300025935 | Bacteria | 2318 |
| 387 | Ga0207709_10577994 | 3300025935 | Bacteria | 887 |
| 388 | Ga0207670_10007649 | 3300025936 | Bacteria | 6048 |
| 389 | Ga0207670_11561846 | 3300025936 | Bacteria | 561 |
| 390 | Ga0207669_10259192 | 3300025937 | Bacteria | 1299 |
| 391 | Ga0207669_10715248 | 3300025937 | Bacteria | 824 |
| 392 | Ga0207704_10003689 | 3300025938 | Bacteria | 6966 |
| 393 | Ga0207691_10004404 | 3300025940 | Bacteria | 13651 |
| 394 | Ga0207691_10018804 | 3300025940 | Bacteria | 6544 |
| 395 | Ga0207691_10019002 | 3300025940 | Bacteria | 6509 |
| 396 | Ga0207691_10031019 | 3300025940 | Bacteria | 4992 |
| 397 | Ga0207691_10039159 | 3300025940 | Bacteria | 4385 |
| 398 | Ga0207691_10395526 | 3300025940 | Bacteria | 1179 |
| 399 | Ga0207711_10048589 | 3300025941 | Bacteria | 3630 |
| 400 | Ga0207711_10087324 | 3300025941 | Bacteria | 2736 |
| 401 | Ga0207711_10195222 | 3300025941 | Bacteria | 1846 |
| 402 | Ga0207711_10239440 | 3300025941 | Bacteria | 1664 |
| 403 | Ga0207689_10014107 | 3300025942 | Bacteria | 6801 |
| 404 | Ga0207689_10060014 | 3300025942 | Bacteria | 3128 |
| 405 | Ga0207689_10116843 | 3300025942 | Bacteria | 2193 |
| 406 | Ga0207661_10500212 | 3300025944 | Bacteria | 1110 |
| 407 | Ga0207679_10008471 | 3300025945 | Bacteria | 6549 |
| 408 | Ga0207679_11061976 | 3300025945 | Bacteria | 743 |
| 409 | Ga0207667_10514752 | 3300025949 | Bacteria | 1213 |
| 410 | Ga0207651_10004672 | 3300025960 | Bacteria | 6942 |
| 411 | Ga0207651_10013837 | 3300025960 | Bacteria | 4634 |
| 412 | Ga0207651_10032262 | 3300025960 | Bacteria | 3362 |
| 413 | Ga0207712_10043080 | 3300025961 | Bacteria | 3112 |
| 414 | Ga0207712_10284197 | 3300025961 | Bacteria | 1351 |
| 415 | Ga0207668_10024415 | 3300025972 | Bacteria | 3901 |
| 416 | Ga0207668_10121965 | 3300025972 | Bacteria | 1975 |
| 417 | Ga0207668_10275890 | 3300025972 | Bacteria | 1376 |
| 418 | Ga0207668_10570713 | 3300025972 | Bacteria | 982 |
| 419 | Ga0207668_10971850 | 3300025972 | Bacteria | 758 |
| 420 | Ga0207640_10155351 | 3300025981 | Bacteria | 1686 |
| 421 | Ga0207640_10158498 | 3300025981 | Bacteria | 1671 |
| 422 | Ga0207640_10443593 | 3300025981 | Bacteria | 1068 |
| 423 | Ga0207640_11481529 | 3300025981 | Bacteria | 609 |
| 424 | Ga0207658_10010175 | 3300025986 | Bacteria | 6393 |
| 425 | Ga0207658_10020095 | 3300025986 | Bacteria | 4624 |
| 426 | Ga0207658_10051018 | 3300025986 | Bacteria | 3047 |
| 427 | Ga0207658_10062467 | 3300025986 | Bacteria | 2787 |
| 428 | Ga0207658_10084433 | 3300025986 | Bacteria | 2443 |
| 429 | Ga0207658_10223334 | 3300025986 | Bacteria | 1586 |
| 430 | Ga0207658_10252241 | 3300025986 | Bacteria | 1500 |
| 431 | Ga0207658_11639547 | 3300025986 | Bacteria | 588 |
| 432 | Ga0207677_10001522 | 3300026023 | Bacteria | 12255 |
| 433 | Ga0207677_10018664 | 3300026023 | Bacteria | 4167 |
| 434 | Ga0207677_10156774 | 3300026023 | Bacteria | 1764 |
| 435 | Ga0207677_10158317 | 3300026023 | Bacteria | 1756 |
| 436 | Ga0207677_10336598 | 3300026023 | Bacteria | 1259 |
| 437 | Ga0207703_10006009 | 3300026035 | Bacteria | 9719 |
| 438 | Ga0207703_10026459 | 3300026035 | Bacteria | 4567 |
| 439 | Ga0207703_10032964 | 3300026035 | Bacteria | 4103 |
| 440 | Ga0207703_11171630 | 3300026035 | Bacteria | 739 |
| 441 | Ga0207703_11290075 | 3300026035 | Bacteria | 702 |
| 442 | Ga0207639_10099598 | 3300026041 | Bacteria | 2345 |
| 443 | Ga0207639_10141624 | 3300026041 | Bacteria | 2004 |
| 444 | Ga0207639_11765660 | 3300026041 | Bacteria | 579 |
| 445 | Ga0207678_10016216 | 3300026067 | Bacteria | 6538 |
| 446 | Ga0207678_10083543 | 3300026067 | Bacteria | 2731 |
| 447 | Ga0207708_10153438 | 3300026075 | Bacteria | 1815 |
| 448 | Ga0207708_10699366 | 3300026075 | Bacteria | 866 |
| 449 | Ga0207702_10004429 | 3300026078 | Bacteria | 12481 |
| 450 | Ga0207702_10335077 | 3300026078 | Bacteria | 1444 |
| 451 | Ga0207641_10003329 | 3300026088 | Bacteria | 14294 |
| 452 | Ga0207641_10079161 | 3300026088 | Bacteria | 2848 |
| 453 | Ga0207641_10137677 | 3300026088 | Bacteria | 2199 |
| 454 | Ga0207641_10452533 | 3300026088 | Bacteria | 1241 |
| 455 | Ga0207641_10639320 | 3300026088 | Bacteria | 1044 |
| 456 | Ga0207641_10715550 | 3300026088 | Bacteria | 987 |
| 457 | Ga0207648_10000179 | 3300026089 | Bacteria | 66602 |
| 458 | Ga0207648_10001296 | 3300026089 | Bacteria | 27908 |
| 459 | Ga0207648_10010028 | 3300026089 | Bacteria | 9011 |
| 460 | Ga0207648_10101337 | 3300026089 | Bacteria | 2524 |
| 461 | Ga0207648_10325133 | 3300026089 | Bacteria | 1383 |
| 462 | Ga0207648_10449942 | 3300026089 | Bacteria | 1173 |
| 463 | Ga0207648_11271580 | 3300026089 | Bacteria | 691 |
| 464 | Ga0207676_10002741 | 3300026095 | Bacteria | 12542 |
| 465 | Ga0207676_10003295 | 3300026095 | Bacteria | 11473 |
| 466 | Ga0207676_10044642 | 3300026095 | Bacteria | 3420 |
| 467 | Ga0207676_10073876 | 3300026095 | Bacteria | 2745 |
| 468 | Ga0207676_10904337 | 3300026095 | Bacteria | 866 |
| 469 | Ga0207674_10008627 | 3300026116 | Bacteria | 11748 |
| 470 | Ga0207674_10332208 | 3300026116 | Bacteria | 1470 |
| 471 | Ga0207674_10446401 | 3300026116 | Bacteria | 1250 |
| 472 | Ga0207675_100005391 | 3300026118 | Bacteria | 12258 |
| 473 | Ga0207675_100060714 | 3300026118 | Bacteria | 3529 |
| 474 | Ga0207675_100088572 | 3300026118 | Bacteria | 2908 |
| 475 | Ga0207683_10148626 | 3300026121 | Bacteria | 2114 |
| 476 | Ga0207683_10365924 | 3300026121 | Bacteria | 1324 |
| 477 | Ga0207683_10673289 | 3300026121 | Bacteria | 959 |
| 478 | Ga0207698_10009766 | 3300026142 | Bacteria | 6129 |
| 479 | Ga0207698_10021332 | 3300026142 | Bacteria | 4477 |
| 480 | Ga0207698_10051692 | 3300026142 | Bacteria | 3143 |
| 481 | Ga0207698_10603936 | 3300026142 | Bacteria | 1082 |
| 482 | Ga0207698_10687655 | 3300026142 | Bacteria | 1017 |
| 483 | Ga0207698_10748657 | 3300026142 | Bacteria | 976 |
| 484 | Ga0207698_11223306 | 3300026142 | Bacteria | 765 |
| 485 | Ga0209179_1001677 | 3300027512 | Bacteria | 2800 |
| 486 | Ga0268266_10045732 | 3300028379 | Bacteria | 3745 |
| 487 | Ga0268266_10350275 | 3300028379 | Bacteria | 1388 |
| 488 | Ga0268266_10368943 | 3300028379 | Bacteria | 1352 |
| 489 | Ga0268265_10011328 | 3300028380 | Bacteria | 6031 |
| 490 | Ga0268265_10026717 | 3300028380 | Bacteria | 4109 |
| 491 | Ga0268265_10201146 | 3300028380 | Bacteria | 1728 |
| 492 | Ga0268264_10000613 | 3300028381 | Bacteria | 42687 |
| 493 | Ga0268264_10024923 | 3300028381 | Bacteria | 4888 |
| 494 | Ga0268264_10572287 | 3300028381 | Bacteria | 1110 |
| 495 | Ga0307517_10076041 | 3300028786 | Bacteria | 2937 |
| 496 | Ga0307517_10184301 | 3300028786 | Bacteria | 1340 |
| 497 | Ga0307517_10189474 | 3300028786 | Bacteria | 1309 |
| 498 | Ga0307515_10000609 | 3300028794 | Bacteria | 83557 |
| 499 | Ga0307515_10001693 | 3300028794 | Bacteria | 49203 |
| 500 | Ga0307515_10003934 | 3300028794 | Bacteria | 31018 |
| 501 | Ga0307515_10018282 | 3300028794 | Bacteria | 12704 |
| 502 | Ga0307515_10044072 | 3300028794 | Bacteria | 6908 |
| 503 | Ga0307515_10260267 | 3300028794 | Bacteria | 1472 |
| 504 | Ga0307515_10472368 | 3300028794 | Bacteria | 867 |
| 505 | Ga0307512_10121681 | 3300030522 | Bacteria | 1673 |
| 506 | Ga0307512_10385555 | 3300030522 | Bacteria | 597 |
| 507 | Ga0265330_10031672 | 3300031235 | Bacteria | 2370 |
| 508 | Ga0265332_10076988 | 3300031238 | Bacteria | 1417 |
| 509 | Ga0265328_10385106 | 3300031239 | Bacteria | 549 |
| 510 | Ga0265339_10238007 | 3300031249 | Bacteria | 885 |
| 511 | Ga0265316_10103655 | 3300031344 | Bacteria | 2160 |
| 512 | Ga0307513_10114170 | 3300031456 | Bacteria | 2687 |
| 513 | Ga0307513_10378910 | 3300031456 | Bacteria | 1155 |
| 514 | Ga0307513_10392129 | 3300031456 | Bacteria | 1125 |
| 515 | Ga0307513_10424194 | 3300031456 | Bacteria | 1059 |
| 516 | Ga0307509_10000991 | 3300031507 | Bacteria | 48763 |
| 517 | Ga0307509_10040089 | 3300031507 | Bacteria | 5095 |
| 518 | Ga0307509_10058903 | 3300031507 | Bacteria | 4065 |
| 519 | Ga0307509_10106381 | 3300031507 | Bacteria | 2824 |
| 520 | Ga0307509_10142847 | 3300031507 | Bacteria | 2325 |
| 521 | Ga0307509_10212595 | 3300031507 | Bacteria | 1757 |
| 522 | Ga0307509_10420658 | 3300031507 | Bacteria | 1037 |
| 523 | Ga0307509_10646017 | 3300031507 | Bacteria | 727 |
| 524 | Ga0307509_10689182 | 3300031507 | Bacteria | 689 |
| 525 | Ga0307509_10780701 | 3300031507 | Bacteria | 620 |
| 526 | Ga0307509_10891337 | 3300031507 | Bacteria | 554 |
| 527 | Ga0307509_11007268 | 3300031507 | Bacteria | 500 |
| 528 | Ga0307408_100046772 | 3300031548 | Bacteria | 3096 |
| 529 | Ga0307408_100311467 | 3300031548 | Bacteria | 1323 |
| 530 | Ga0307408_101356986 | 3300031548 | Bacteria | 668 |
| 531 | Ga0307508_10000404 | 3300031616 | Bacteria | 51734 |
| 532 | Ga0307508_10005736 | 3300031616 | Bacteria | 11754 |
| 533 | Ga0307508_10011564 | 3300031616 | Bacteria | 8064 |
| 534 | Ga0307508_10349404 | 3300031616 | Bacteria | 1070 |
| 535 | Ga0307514_10053594 | 3300031649 | Bacteria | 3112 |
| 536 | Ga0307514_10058422 | 3300031649 | Bacteria | 2950 |
| 537 | Ga0307514_10149542 | 3300031649 | Bacteria | 1570 |
| 538 | Ga0307514_10394112 | 3300031649 | Bacteria | 711 |
| 539 | Ga0265314_10006203 | 3300031711 | Bacteria | 10617 |
| 540 | Ga0265342_10060778 | 3300031712 | Bacteria | 2227 |
| 541 | Ga0307516_10009071 | 3300031730 | Bacteria | 11141 |
| 542 | Ga0307516_10237732 | 3300031730 | Bacteria | 1522 |
| 543 | Ga0307516_10370119 | 3300031730 | Bacteria | 1096 |
| 544 | Ga0307405_10006962 | 3300031731 | Bacteria | 5616 |
| 545 | Ga0307413_10263992 | 3300031824 | Bacteria | 1285 |
| 546 | Ga0307518_10047827 | 3300031838 | Bacteria | 3110 |
| 547 | Ga0307410_10916573 | 3300031852 | Bacteria | 751 |
| 548 | Ga0307406_10114919 | 3300031901 | Bacteria | 1860 |
| 549 | Ga0307406_10712935 | 3300031901 | Bacteria | 839 |
| 550 | Ga0307407_10907830 | 3300031903 | Bacteria | 676 |
| 551 | Ga0307412_10024007 | 3300031911 | Bacteria | 3760 |
| 552 | Ga0307412_10277509 | 3300031911 | Bacteria | 1314 |
| 553 | Ga0307409_100000580 | 3300031995 | Bacteria | 15944 |
| 554 | Ga0307409_102811226 | 3300031995 | Bacteria | 514 |
| 555 | Ga0307416_100014097 | 3300032002 | Bacteria | 5460 |
| 556 | Ga0307416_100236784 | 3300032002 | Bacteria | 1765 |
| 557 | Ga0307416_100291949 | 3300032002 | Bacteria | 1615 |
| 558 | Ga0307416_101955761 | 3300032002 | Bacteria | 689 |
| 559 | Ga0307411_10351244 | 3300032005 | Bacteria | 1202 |
| 560 | Ga0307411_10521007 | 3300032005 | Bacteria | 1009 |
| 561 | Ga0307411_10738275 | 3300032005 | Bacteria | 861 |
| 562 | Ga0307415_100002051 | 3300032126 | Bacteria | 9953 |
| 563 | Ga0307507_10038483 | 3300033179 | Bacteria | 4847 |
| 564 | Ga0307507_10050992 | 3300033179 | Bacteria | 3988 |
| 565 | Ga0307507_10161529 | 3300033179 | Bacteria | 1654 |
| 566 | Ga0307510_10003212 | 3300033180 | Bacteria | 19002 |
| 567 | Ga0307510_10059995 | 3300033180 | Bacteria | 3920 |
| 568 | Ga0307510_10131040 | 3300033180 | Bacteria | 2180 |
| 569 | Ga0307510_10135291 | 3300033180 | Bacteria | 2124 |
| 570 | Ga0373944_0194926 | 3300035089 | Bacteria | 731 |
| 571 | Ga0373932_0019983 | 3300035112 | Bacteria | 1751 |
| 572 | Ga0373955_0309537 | 3300035172 | Bacteria | 953 |
| 573 | Ga0373961_0378091 | 3300035241 | Bacteria | 539 |
| 574 | Ga0373924_0172895 | 3300035410 | Bacteria | 950 |
| 575 | Ga0373931_0001378 | 3300035691 | Bacteria | 10389 |
| 576 | Ga0373927_0064689 | 3300035695 | Bacteria | 2366 |
| 577 | Ga0373937_0321803 | 3300036401 | Bacteria | 1463 |
| 578 | Ga0373937_1086171 | 3300036401 | Bacteria | 749 |
| 579 | Ga0373925_0132974 | 3300037068 | Bacteria | 1941 |
| 580 | Ga0373925_0552801 | 3300037068 | Bacteria | 947 |
| 581 | Ga0395905_0023956 | 3300037471 | Bacteria | 5763 |
| 582 | Ga0395905_0167972 | 3300037471 | Bacteria | 2061 |
| 583 | Ga0395905_0601971 | 3300037471 | Bacteria | 1001 |
| 584 | Ga0436365_1640203 | 3300039437 | Bacteria | 3024 |
| 585 | Ga0436361_1177655 | 3300039447 | Bacteria | 803 |
| 586 | Ga0436363_1475448 | 3300039450 | Bacteria | 1005 |
| 587 | Ga0451787_580127 | 3300041441 | Bacteria | 930 |
| 588 | Ga0451789_0198671 | 3300041443 | Bacteria | 1635 |
| 589 | Ga0451793_0018596 | 3300041452 | Bacteria | 1636 |
| 590 | Ga0451793_1009547 | 3300041452 | Bacteria | 541 |
| 591 | Ga0451797_0220704 | 3300041453 | Bacteria | 630 |
| 592 | Ga0451800_1641012 | 3300041459 | Bacteria | 605 |
| 593 | Ga0451802_2074907 | 3300041460 | Bacteria | 554 |
| 594 | Ga0451807_1825296 | 3300041486 | Bacteria | 950 |
| 595 | Ga0451833_1469414 | 3300041491 | Bacteria | 633 |
| 596 | Ga0451845_0977099 | 3300041501 | Bacteria | 660 |
| 597 | Ga0451843_0870225 | 3300041509 | Bacteria | 508 |
| 598 | Ga0451853_0327863 | 3300041512 | Bacteria | 611 |
| 599 | Ga0451853_0350852 | 3300041512 | Bacteria | 1424 |
| 600 | Ga0451853_3674141 | 3300041512 | Bacteria | 873 |
| 601 | Ga0439449_0343875 | 3300042007 | Bacteria | 564 |
| 602 | Ga0439456_144950 | 3300042013 | Bacteria | 552 |
| 603 | Ga0450896_022249 | 3300042133 | Bacteria | 934 |
| 604 | Ga0439459_0014586 | 3300042438 | Bacteria | 1430 |
| 605 | Ga0439460_0175468 | 3300042461 | Bacteria | 723 |
| 606 | Ga0450893_0034880 | 3300042532 | Bacteria | 907 |
| 607 | Ga0451577_0004221 | 3300042876 | Bacteria | 15320 |
| 608 | Ga0451577_0004741 | 3300042876 | Bacteria | 14236 |
| 609 | Ga0451577_0020267 | 3300042876 | Bacteria | 6105 |
| 610 | Ga0451577_0057615 | 3300042876 | Bacteria | 3463 |
| 611 | Ga0451577_0186853 | 3300042876 | Bacteria | 1869 |
| 612 | Ga0451577_0401658 | 3300042876 | Bacteria | 1244 |
| 613 | Ga0451577_0733135 | 3300042876 | Bacteria | 894 |
| 614 | Ga0453683_0092672 | 3300044673 | Bacteria | 1894 |
| 615 | Ga0453683_0134334 | 3300044673 | Bacteria | 1560 |
| 616 | Ga0453684_0005216 | 3300044712 | Bacteria | 26063 |
| 617 | Ga0453684_0244278 | 3300044712 | Bacteria | 2065 |
| 618 | Ga0453684_0251708 | 3300044712 | Bacteria | 2028 |
| 619 | Ga0453684_0384845 | 3300044712 | Bacteria | 1574 |
| 620 | Ga0451576_0017940 | 3300045051 | Bacteria | 7769 |
| 621 | Ga0451576_0062948 | 3300045051 | Bacteria | 3867 |
| 622 | Ga0451576_2164302 | 3300045051 | Bacteria | 571 |
| 623 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 624 | Ga0495629_0311784 | 3300046459 | Bacteria | 1076 |
| 625 | Ga0495629_0365673 | 3300046459 | Bacteria | 983 |
| 626 | Ga0495638_0111579 | 3300046460 | Bacteria | 1624 |
| 627 | Ga0495650_0145821 | 3300046471 | Bacteria | 853 |
| 628 | Ga0495580_0018628 | 3300046472 | Bacteria | 5167 |
| 629 | Ga0495639_0142511 | 3300046475 | Bacteria | 1153 |
| 630 | Ga0495606_0461145 | 3300046507 | Bacteria | 649 |
| 631 | Ga0495618_0656644 | 3300046514 | Bacteria | 620 |
| 632 | Ga0495631_0051252 | 3300046518 | Bacteria | 1804 |
| 633 | Ga0495632_0168428 | 3300046519 | Bacteria | 1007 |
| 634 | Ga0495632_0283575 | 3300046519 | Bacteria | 737 |
| 635 | Ga0495648_0139642 | 3300046524 | Bacteria | 1277 |
| 636 | Ga0495648_0271303 | 3300046524 | Bacteria | 809 |
| 637 | Ga0495648_0283877 | 3300046524 | Bacteria | 783 |
| 638 | Ga0495598_0072198 | 3300046537 | Bacteria | 1089 |
| 639 | Ga0495621_0024915 | 3300046539 | Bacteria | 2004 |
| 640 | Ga0495645_0538572 | 3300046543 | Bacteria | 725 |
| 641 | Ga0495668_0087108 | 3300046616 | Bacteria | 1713 |
| 642 | Ga0495625_0009747 | 3300046660 | Bacteria | 7995 |
| 643 | Ga0495625_0108748 | 3300046660 | Bacteria | 1897 |
| 644 | Ga0495646_0064363 | 3300046680 | Bacteria | 2174 |
| 645 | Ga0495658_0178716 | 3300046683 | Bacteria | 1316 |
| 646 | Ga0495658_0347228 | 3300046683 | Bacteria | 943 |
| 647 | Ga0495613_0386887 | 3300046689 | Bacteria | 956 |
| 648 | Ga0495624_0016323 | 3300046690 | Bacteria | 4998 |
| 649 | Ga0495670_0045101 | 3300046691 | Bacteria | 2201 |
| 650 | Ga0495671_0028003 | 3300046692 | Bacteria | 2906 |
| 651 | Ga0495671_0118049 | 3300046692 | Bacteria | 1295 |
| 652 | Ga0495600_0706943 | 3300046809 | Bacteria | 606 |
| 653 | Ga0495581_0455107 | 3300047315 | Bacteria | 745 |
| 654 | Ga0495604_0254180 | 3300047317 | Bacteria | 1197 |
| 655 | Ga0495674_1236223 | 3300047319 | Bacteria | 563 |
| 656 | Ga0495676_0392362 | 3300047321 | Bacteria | 922 |
| 657 | Ga0495673_0152346 | 3300047469 | Bacteria | 893 |
| 658 | Ga0495686_0030754 | 3300047472 | Bacteria | 3486 |
| 659 | Ga0495686_0215174 | 3300047472 | Bacteria | 1096 |
| 660 | Ga0495593_0059628 | 3300047673 | Bacteria | 1999 |
| 661 | Ga0495602_0316539 | 3300048088 | Bacteria | 1137 |
| 662 | Ga0495614_0056011 | 3300048089 | Bacteria | 1692 |
| 663 | Ga0495614_0098532 | 3300048089 | Bacteria | 1276 |
| 664 | Ga0496100_0091111 | 3300048903 | Bacteria | 2080 |
| 665 | Ga0496100_0112887 | 3300048903 | Bacteria | 1891 |
| 666 | Ga0496101_0008293 | 3300048904 | Bacteria | 6789 |
| 667 | Ga0496101_0303590 | 3300048904 | Bacteria | 1251 |
| 668 | Ga0496102_0018445 | 3300048905 | Bacteria | 6133 |
| 669 | Ga0496102_0272326 | 3300048905 | Bacteria | 1596 |
| 670 | Ga0496102_0503763 | 3300048905 | Bacteria | 1133 |
| 671 | Ga0496104_0032470 | 3300048907 | Bacteria | 4859 |
| 672 | Ga0496104_0055646 | 3300048907 | Bacteria | 3741 |
| 673 | Ga0496104_0753854 | 3300048907 | Bacteria | 880 |
| 674 | Ga0496104_1245281 | 3300048907 | Bacteria | 647 |
| 675 | Ga0496105_0073192 | 3300048908 | Bacteria | 2831 |
| 676 | Ga0496105_0167701 | 3300048908 | Bacteria | 1801 |
| 677 | Ga0496106_0008934 | 3300048909 | Bacteria | 7406 |
| 678 | Ga0496106_0294814 | 3300048909 | Bacteria | 1300 |
| 679 | Ga0496107_0256318 | 3300048910 | Bacteria | 1302 |
| 680 | Ga0496108_0011606 | 3300048911 | Bacteria | 7167 |
| 681 | Ga0496108_0023125 | 3300048911 | Bacteria | 5112 |
| 682 | Ga0496108_1030897 | 3300048911 | Bacteria | 702 |
| 683 | Ga0496109_0082364 | 3300048912 | Bacteria | 2965 |
| 684 | Ga0496109_0082794 | 3300048912 | Bacteria | 2958 |
| 685 | Ga0496110_0118474 | 3300048913 | Bacteria | 2384 |
| 686 | Ga0496111_0275498 | 3300048914 | Bacteria | 1248 |
| 687 | Ga0496112_0193243 | 3300048915 | Bacteria | 1996 |
| 688 | Ga0496113_0067776 | 3300048916 | Bacteria | 2707 |
| 689 | Ga0496113_0068982 | 3300048916 | Bacteria | 2684 |
| 690 | Ga0496114_0126437 | 3300048917 | Bacteria | 2204 |
| 691 | Ga0496114_0559505 | 3300048917 | Bacteria | 1010 |
| 692 | Ga0496122_0207922 | 3300048925 | Bacteria | 1137 |
| 693 | Ga0496125_0423925 | 3300048928 | Bacteria | 770 |
| 694 | Ga0501198_037180 | 3300049649 | Bacteria | 833 |
| 695 | Ga0501206_007243 | 3300049653 | Bacteria | 1452 |
| 696 | Ga0501209_276053 | 3300049656 | Bacteria | 527 |
| 697 | Ga0501252_000122 | 3300049682 | Bacteria | 4551 |
| 698 | Ga0501264_024709 | 3300049761 | Bacteria | 659 |
| 699 | Ga0501226_010804 | 3300049853 | Bacteria | 1012 |
| 700 | nmdc:mga03683_199333_c1 | 3300050489 | Bacteria | 918 |
| 701 | nmdc:mga0k408_119019_c1 | 3300050493 | Bacteria | 1563 |
| 702 | nmdc:mga0k408_16652_c1 | 3300050493 | Bacteria | 4083 |
| 703 | nmdc:mga0k408_267305_c1 | 3300050493 | Bacteria | 1021 |
| 704 | nmdc:mga0k408_33581_c1 | 3300050493 | Bacteria | 2935 |
| 705 | nmdc:mga0k408_590424_c1 | 3300050493 | Bacteria | 655 |
| 706 | nmdc:mga07m45_103137_c1 | 3300050496 | Bacteria | 1639 |
| 707 | nmdc:mga07m45_147621_c1 | 3300050496 | Bacteria | 1363 |
| 708 | nmdc:mga07m45_48382_c1 | 3300050496 | Bacteria | 2391 |
| 709 | nmdc:mga07m45_517306_c1 | 3300050496 | Bacteria | 691 |
| 710 | nmdc:mga07m45_71714_c1 | 3300050496 | Bacteria | 1971 |
| 711 | nmdc:mga05p37_2022283_c1 | 3300050507 | Bacteria | 544 |
| 712 | nmdc:mga08y16_114587_c1 | 3300050511 | Bacteria | 2806 |
| 713 | nmdc:mga0n895_44649_c1 | 3300050512 | Bacteria | 4321 |
| 714 | nmdc:mga0rr50_182035_c1 | 3300050513 | Bacteria | 1718 |
| 715 | Ga0500635_0204951 | 3300053080 | Bacteria | 767 |
| 716 | Ga0495619_0908110 | 3300053085 | Bacteria | 592 |
| 717 | Ga0500578_0000363 | 3300053086 | Bacteria | 55670 |
| 718 | Ga0500578_0068943 | 3300053086 | Bacteria | 2254 |
| 719 | Ga0500644_0010849 | 3300053088 | Bacteria | 2474 |
| 720 | Ga0500581_301149 | 3300053089 | Bacteria | 638 |
| 721 | Ga0500647_0386792 | 3300053091 | Bacteria | 571 |
| 722 | Ga0500651_0045174 | 3300053093 | Bacteria | 2772 |
| 723 | Ga0500651_0319672 | 3300053093 | Bacteria | 887 |
| 724 | Ga0500648_120659 | 3300053097 | Bacteria | 1436 |
| 725 | Ga0500650_0199384 | 3300053098 | Bacteria | 912 |
| 726 | Ga0500562_033273 | 3300053108 | Bacteria | 1362 |
| 727 | Ga0500593_000526 | 3300053117 | Bacteria | 15083 |
| 728 | Ga0500594_0004214 | 3300053118 | Bacteria | 3169 |
| 729 | Ga0500594_0318097 | 3300053118 | Bacteria | 523 |
| 730 | Ga0500597_335690 | 3300053120 | Bacteria | 593 |
| 731 | Ga0500655_018956 | 3300053133 | Bacteria | 1279 |
| 732 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 733 | Ga0500564_199644 | 3300053138 | Bacteria | 822 |
| 734 | Ga0500568_0064970 | 3300053139 | Bacteria | 1405 |
| 735 | Ga0500568_0185956 | 3300053139 | Bacteria | 763 |
| 736 | Ga0500604_0018787 | 3300053151 | Bacteria | 1930 |
| 737 | Ga0500604_0028615 | 3300053151 | Bacteria | 1619 |
| 738 | Ga0500616_0264849 | 3300053153 | Bacteria | 728 |
| 739 | Ga0500619_000171 | 3300053154 | Bacteria | 15684 |
| 740 | Ga0500619_048118 | 3300053154 | Bacteria | 1372 |
| 741 | Ga0500622_0003170 | 3300053156 | Bacteria | 11250 |
| 742 | Ga0500622_0206699 | 3300053156 | Bacteria | 889 |
| 743 | Ga0500633_0246116 | 3300053160 | Bacteria | 665 |
| 744 | Ga0500636_0250282 | 3300053177 | Bacteria | 904 |
| 745 | Ga0500645_001960 | 3300053730 | Bacteria | 9727 |
| 746 | Ga0500599_054603 | 3300053736 | Bacteria | 639 |
| 747 | Ga0500587_006746 | 3300053739 | Bacteria | 1513 |
| 748 | Ga0590077_062339 | 3300059426 | Bacteria | 846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_101050108 | Ga0070674_1010501082 | 105 |
| 2 | 3300014326 | Ga0157380_10258605 | Ga0157380_102586052 | 105 |
| 3 | 3300005338 | Ga0068868_101568063 | Ga0068868_1015680631 | 107 |
| 4 | 3300025226 | Ga0209674_113403 | Ga0209674_1134032 | 108 |
| 5 | 3300025230 | Ga0209563_100013 | Ga0209563_100013209 | 108 |
| 6 | 3300048925 | Ga0496122_0207922 | Ga0496122_0207922_657_1061 | 108 |
| 7 | iso_pu_bacteria | 2886848708 | 2886850375 | 109 |
| 8 | 3300027512 | Ga0209179_1001677 | Ga0209179_10016774 | 110 |
| 9 | 3300005340 | Ga0070689_102109219 | Ga0070689_1021092192 | 111 |
| 10 | 3300005353 | Ga0070669_101338456 | Ga0070669_1013384561 | 111 |
| 11 | 3300005457 | Ga0070662_101424447 | Ga0070662_1014244471 | 111 |
| 12 | 3300005543 | Ga0070672_100021973 | Ga0070672_1000219738 | 111 |
| 13 | 3300025923 | Ga0207681_10287302 | Ga0207681_102873023 | 111 |
| 14 | 3300025940 | Ga0207691_10039159 | Ga0207691_100391595 | 111 |
| 15 | 3300028794 | Ga0307515_10001693 | Ga0307515_1000169346 | 111 |
| 16 | 3300031235 | Ga0265330_10031672 | Ga0265330_100316723 | 111 |
| 17 | 3300031238 | Ga0265332_10076988 | Ga0265332_100769883 | 111 |
| 18 | 3300031239 | Ga0265328_10385106 | Ga0265328_103851062 | 111 |
| 19 | 3300031249 | Ga0265339_10238007 | Ga0265339_102380072 | 111 |
| 20 | 3300031344 | Ga0265316_10103655 | Ga0265316_101036552 | 111 |
| 21 | 3300031456 | Ga0307513_10392129 | Ga0307513_103921292 | 111 |
| 22 | 3300031548 | Ga0307408_101356986 | Ga0307408_1013569862 | 111 |
| 23 | 3300031711 | Ga0265314_10006203 | Ga0265314_100062038 | 111 |
| 24 | 3300031712 | Ga0265342_10060778 | Ga0265342_100607786 | 111 |
| 25 | 3300031995 | Ga0307409_102811226 | Ga0307409_1028112261 | 111 |
| 26 | 3300039447 | Ga0436361_1177655 | Ga0436361_1177655_140_535 | 111 |
| 27 | 3300041459 | Ga0451800_1641012 | Ga0451800_1641012_168_524 | 111 |
| 28 | 3300042876 | Ga0451577_0057615 | Ga0451577_0057615_168_515 | 111 |
| 29 | 3300044673 | Ga0453683_0092672 | Ga0453683_0092672_880_1227 | 111 |
| 30 | 3300047472 | Ga0495686_0030754 | Ga0495686_0030754_1412_1759 | 111 |
| 31 | 3300048909 | Ga0496106_0294814 | Ga0496106_0294814_754_1101 | 111 |
| 32 | 3300053086 | Ga0500578_0068943 | Ga0500578_0068943_1699_2046 | 111 |
| 33 | 3300053730 | Ga0500645_001960 | Ga0500645_001960_8224_8571 | 111 |
| 34 | 3300002773 | JGI25152J39213_1001224 | JGI25152J39213_10012244 | 112 |
| 35 | 3300002773 | JGI25152J39213_1001251 | JGI25152J39213_10012514 | 112 |
| 36 | 3300002773 | JGI25152J39213_1001299 | JGI25152J39213_100129910 | 112 |
| 37 | 3300002774 | JGI25150J39212_1005235 | JGI25150J39212_10052353 | 112 |
| 38 | 3300003215 | JGI25153J46596_10002653 | JGI25153J46596_1000265313 | 112 |
| 39 | 3300003771 | Ga0055526_1002262 | Ga0055526_100226213 | 112 |
| 40 | 3300005327 | Ga0070658_10678651 | Ga0070658_106786512 | 112 |
| 41 | 3300005548 | Ga0070665_100163978 | Ga0070665_1001639784 | 112 |
| 42 | 3300005578 | Ga0068854_100436926 | Ga0068854_1004369262 | 112 |
| 43 | 3300005617 | Ga0068859_101511878 | Ga0068859_1015118782 | 112 |
| 44 | 3300005843 | Ga0068860_101476549 | Ga0068860_1014765492 | 112 |
| 45 | 3300006195 | Ga0075366_10055381 | Ga0075366_100553814 | 112 |
| 46 | 3300006195 | Ga0075366_10146543 | Ga0075366_101465433 | 112 |
| 47 | 3300006358 | Ga0068871_100582458 | Ga0068871_1005824582 | 112 |
| 48 | 3300006881 | Ga0068865_100241335 | Ga0068865_1002413352 | 112 |
| 49 | 3300006931 | Ga0097620_101512653 | Ga0097620_1015126532 | 112 |
| 50 | 3300009098 | Ga0105245_10290168 | Ga0105245_102901682 | 112 |
| 51 | 3300009553 | Ga0105249_11483979 | Ga0105249_114839791 | 112 |
| 52 | 3300013306 | Ga0163162_10332792 | Ga0163162_103327924 | 112 |
| 53 | 3300013306 | Ga0163162_11136810 | Ga0163162_111368102 | 112 |
| 54 | 3300013308 | Ga0157375_10572082 | Ga0157375_105720822 | 112 |
| 55 | 3300014968 | Ga0157379_10120153 | Ga0157379_101201534 | 112 |
| 56 | 3300014968 | Ga0157379_10176376 | Ga0157379_101763765 | 112 |
| 57 | 3300014968 | Ga0157379_11074407 | Ga0157379_110744072 | 112 |
| 58 | 3300025245 | Ga0207425_1001237 | Ga0207425_100123712 | 112 |
| 59 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027142 | 112 |
| 60 | 3300025273 | Ga0209673_1010832 | Ga0209673_10108324 | 112 |
| 61 | 3300025295 | Ga0209564_1000139 | Ga0209564_1000139133 | 112 |
| 62 | 3300025297 | Ga0209758_1000310 | Ga0209758_100031072 | 112 |
| 63 | 3300025304 | Ga0209257_1088606 | Ga0209257_10886062 | 112 |
| 64 | 3300025927 | Ga0207687_10266526 | Ga0207687_102665261 | 112 |
| 65 | 3300025986 | Ga0207658_10010175 | Ga0207658_100101758 | 112 |
| 66 | 3300031507 | Ga0307509_10212595 | Ga0307509_102125952 | 112 |
| 67 | 3300031507 | Ga0307509_11007268 | Ga0307509_110072681 | 112 |
| 68 | 3300032002 | Ga0307416_100291949 | Ga0307416_1002919492 | 112 |
| 69 | 3300035172 | Ga0373955_0309537 | Ga0373955_0309537_187_534 | 112 |
| 70 | 3300035410 | Ga0373924_0172895 | Ga0373924_0172895_122_469 | 112 |
| 71 | 3300036401 | Ga0373937_0321803 | Ga0373937_0321803_708_1067 | 112 |
| 72 | 3300036401 | Ga0373937_1086171 | Ga0373937_1086171_335_682 | 112 |
| 73 | 3300037068 | Ga0373925_0132974 | Ga0373925_0132974_1257_1610 | 112 |
| 74 | 3300037471 | Ga0395905_0167972 | Ga0395905_0167972_577_948 | 112 |
| 75 | 3300037471 | Ga0395905_0601971 | Ga0395905_0601971_35_403 | 112 |
| 76 | 3300041453 | Ga0451797_0220704 | Ga0451797_0220704_135_473 | 112 |
| 77 | 3300042438 | Ga0439459_0014586 | Ga0439459_0014586_240_578 | 112 |
| 78 | 3300042876 | Ga0451577_0004741 | Ga0451577_0004741_636_992 | 112 |
| 79 | 3300042876 | Ga0451577_0401658 | Ga0451577_0401658_848_1201 | 112 |
| 80 | 3300042876 | Ga0451577_0733135 | Ga0451577_0733135_432_785 | 112 |
| 81 | 3300044712 | Ga0453684_0244278 | Ga0453684_0244278_1194_1547 | 112 |
| 82 | 3300046514 | Ga0495618_0656644 | Ga0495618_0656644_144_491 | 112 |
| 83 | 3300046524 | Ga0495648_0271303 | Ga0495648_0271303_378_731 | 112 |
| 84 | 3300046543 | Ga0495645_0538572 | Ga0495645_0538572_339_686 | 112 |
| 85 | 3300046689 | Ga0495613_0386887 | Ga0495613_0386887_48_395 | 112 |
| 86 | 3300046692 | Ga0495671_0118049 | Ga0495671_0118049_903_1256 | 112 |
| 87 | 3300049653 | Ga0501206_007243 | Ga0501206_007243_771_1121 | 112 |
| 88 | 3300053085 | Ga0495619_0908110 | Ga0495619_0908110_138_485 | 112 |
| 89 | 3300003215 | JGI25153J46596_10004183 | JGI25153J46596_100041835 | 113 |
| 90 | 3300003308 | Ga0006777J48905_1047703 | Ga0006777J48905_10477032 | 113 |
| 91 | 3300003791 | Ga0055530_10009773 | Ga0055530_100097737 | 113 |
| 92 | 3300005262 | Ga0065165_1001456 | Ga0065165_100145611 | 113 |
| 93 | 3300005295 | Ga0065707_10220135 | Ga0065707_102201353 | 113 |
| 94 | 3300005327 | Ga0070658_10551114 | Ga0070658_105511142 | 113 |
| 95 | 3300005328 | Ga0070676_10021332 | Ga0070676_100213324 | 113 |
| 96 | 3300005328 | Ga0070676_10034097 | Ga0070676_100340975 | 113 |
| 97 | 3300005328 | Ga0070676_10056576 | Ga0070676_100565762 | 113 |
| 98 | 3300005329 | Ga0070683_100252217 | Ga0070683_1002522173 | 113 |
| 99 | 3300005329 | Ga0070683_100403035 | Ga0070683_1004030353 | 113 |
| 100 | 3300005330 | Ga0070690_100020420 | Ga0070690_1000204207 | 113 |
| 101 | 3300005330 | Ga0070690_100645339 | Ga0070690_1006453392 | 113 |
| 102 | 3300005330 | Ga0070690_100728401 | Ga0070690_1007284011 | 113 |
| 103 | 3300005331 | Ga0070670_100001787 | Ga0070670_10000178717 | 113 |
| 104 | 3300005331 | Ga0070670_100096015 | Ga0070670_1000960153 | 113 |
| 105 | 3300005331 | Ga0070670_100168819 | Ga0070670_1001688193 | 113 |
| 106 | 3300005331 | Ga0070670_100655440 | Ga0070670_1006554402 | 113 |
| 107 | 3300005333 | Ga0070677_10039217 | Ga0070677_100392175 | 113 |
| 108 | 3300005333 | Ga0070677_10067530 | Ga0070677_100675302 | 113 |
| 109 | 3300005333 | Ga0070677_10344192 | Ga0070677_103441921 | 113 |
| 110 | 3300005334 | Ga0068869_100006465 | Ga0068869_1000064656 | 113 |
| 111 | 3300005334 | Ga0068869_100009400 | Ga0068869_1000094007 | 113 |
| 112 | 3300005334 | Ga0068869_100090154 | Ga0068869_1000901542 | 113 |
| 113 | 3300005334 | Ga0068869_100804787 | Ga0068869_1008047872 | 113 |
| 114 | 3300005335 | Ga0070666_10006757 | Ga0070666_100067577 | 113 |
| 115 | 3300005335 | Ga0070666_10197154 | Ga0070666_101971542 | 113 |
| 116 | 3300005335 | Ga0070666_10486118 | Ga0070666_104861183 | 113 |
| 117 | 3300005337 | Ga0070682_100600912 | Ga0070682_1006009122 | 113 |
| 118 | 3300005337 | Ga0070682_101627522 | Ga0070682_1016275221 | 113 |
| 119 | 3300005338 | Ga0068868_100000966 | Ga0068868_10000096612 | 113 |
| 120 | 3300005338 | Ga0068868_100032419 | Ga0068868_1000324196 | 113 |
| 121 | 3300005338 | Ga0068868_100073841 | Ga0068868_1000738413 | 113 |
| 122 | 3300005338 | Ga0068868_100229637 | Ga0068868_1002296372 | 113 |
| 123 | 3300005338 | Ga0068868_100361051 | Ga0068868_1003610513 | 113 |
| 124 | 3300005339 | Ga0070660_100102149 | Ga0070660_1001021494 | 113 |
| 125 | 3300005340 | Ga0070689_100175898 | Ga0070689_1001758983 | 113 |
| 126 | 3300005343 | Ga0070687_100781062 | Ga0070687_1007810622 | 113 |
| 127 | 3300005343 | Ga0070687_101207084 | Ga0070687_1012070841 | 113 |
| 128 | 3300005344 | Ga0070661_100108802 | Ga0070661_1001088023 | 113 |
| 129 | 3300005344 | Ga0070661_100156321 | Ga0070661_1001563213 | 113 |
| 130 | 3300005345 | Ga0070692_10262472 | Ga0070692_102624723 | 113 |
| 131 | 3300005347 | Ga0070668_100036969 | Ga0070668_1000369697 | 113 |
| 132 | 3300005347 | Ga0070668_100137109 | Ga0070668_1001371093 | 113 |
| 133 | 3300005347 | Ga0070668_100173369 | Ga0070668_1001733693 | 113 |
| 134 | 3300005353 | Ga0070669_100088090 | Ga0070669_1000880904 | 113 |
| 135 | 3300005353 | Ga0070669_100101683 | Ga0070669_1001016833 | 113 |
| 136 | 3300005353 | Ga0070669_100382001 | Ga0070669_1003820013 | 113 |
| 137 | 3300005353 | Ga0070669_100395680 | Ga0070669_1003956803 | 113 |
| 138 | 3300005354 | Ga0070675_100008036 | Ga0070675_1000080367 | 113 |
| 139 | 3300005354 | Ga0070675_100061241 | Ga0070675_1000612415 | 113 |
| 140 | 3300005354 | Ga0070675_100062673 | Ga0070675_1000626732 | 113 |
| 141 | 3300005354 | Ga0070675_100080667 | Ga0070675_1000806675 | 113 |
| 142 | 3300005355 | Ga0070671_100011057 | Ga0070671_1000110576 | 113 |
| 143 | 3300005355 | Ga0070671_100160588 | Ga0070671_1001605882 | 113 |
| 144 | 3300005355 | Ga0070671_100208222 | Ga0070671_1002082223 | 113 |
| 145 | 3300005355 | Ga0070671_100323786 | Ga0070671_1003237863 | 113 |
| 146 | 3300005355 | Ga0070671_102113961 | Ga0070671_1021139611 | 113 |
| 147 | 3300005356 | Ga0070674_100094896 | Ga0070674_1000948964 | 113 |
| 148 | 3300005356 | Ga0070674_100102944 | Ga0070674_1001029445 | 113 |
| 149 | 3300005356 | Ga0070674_100348681 | Ga0070674_1003486812 | 113 |
| 150 | 3300005356 | Ga0070674_101090703 | Ga0070674_1010907032 | 113 |
| 151 | 3300005364 | Ga0070673_100019930 | Ga0070673_1000199305 | 113 |
| 152 | 3300005364 | Ga0070673_100050040 | Ga0070673_1000500404 | 113 |
| 153 | 3300005364 | Ga0070673_100118826 | Ga0070673_1001188263 | 113 |
| 154 | 3300005364 | Ga0070673_100244226 | Ga0070673_1002442264 | 113 |
| 155 | 3300005364 | Ga0070673_100495865 | Ga0070673_1004958653 | 113 |
| 156 | 3300005365 | Ga0070688_100072638 | Ga0070688_1000726382 | 113 |
| 157 | 3300005365 | Ga0070688_101379380 | Ga0070688_1013793801 | 113 |
| 158 | 3300005366 | Ga0070659_100043932 | Ga0070659_1000439325 | 113 |
| 159 | 3300005366 | Ga0070659_101312441 | Ga0070659_1013124411 | 113 |
| 160 | 3300005367 | Ga0070667_100023158 | Ga0070667_1000231586 | 113 |
| 161 | 3300005367 | Ga0070667_100081424 | Ga0070667_1000814242 | 113 |
| 162 | 3300005367 | Ga0070667_100099658 | Ga0070667_1000996582 | 113 |
| 163 | 3300005367 | Ga0070667_100192145 | Ga0070667_1001921453 | 113 |
| 164 | 3300005367 | Ga0070667_100533439 | Ga0070667_1005334393 | 113 |
| 165 | 3300005367 | Ga0070667_100950070 | Ga0070667_1009500702 | 113 |
| 166 | 3300005441 | Ga0070700_100095800 | Ga0070700_1000958001 | 113 |
| 167 | 3300005441 | Ga0070700_100973609 | Ga0070700_1009736092 | 113 |
| 168 | 3300005455 | Ga0070663_100001375 | Ga0070663_1000013752 | 113 |
| 169 | 3300005455 | Ga0070663_100273872 | Ga0070663_1002738721 | 113 |
| 170 | 3300005455 | Ga0070663_102104065 | Ga0070663_1021040651 | 113 |
| 171 | 3300005456 | Ga0070678_100006239 | Ga0070678_1000062396 | 113 |
| 172 | 3300005456 | Ga0070678_100077866 | Ga0070678_1000778662 | 113 |
| 173 | 3300005456 | Ga0070678_101352439 | Ga0070678_1013524392 | 113 |
| 174 | 3300005457 | Ga0070662_100017313 | Ga0070662_1000173135 | 113 |
| 175 | 3300005457 | Ga0070662_100034193 | Ga0070662_1000341934 | 113 |
| 176 | 3300005457 | Ga0070662_100947686 | Ga0070662_1009476862 | 113 |
| 177 | 3300005458 | Ga0070681_10176293 | Ga0070681_101762935 | 113 |
| 178 | 3300005458 | Ga0070681_10628428 | Ga0070681_106284283 | 113 |
| 179 | 3300005459 | Ga0068867_100005640 | Ga0068867_1000056407 | 113 |
| 180 | 3300005459 | Ga0068867_100011669 | Ga0068867_1000116694 | 113 |
| 181 | 3300005459 | Ga0068867_100049124 | Ga0068867_1000491245 | 113 |
| 182 | 3300005466 | Ga0070685_10296691 | Ga0070685_102966912 | 113 |
| 183 | 3300005466 | Ga0070685_10367513 | Ga0070685_103675132 | 113 |
| 184 | 3300005468 | Ga0070707_100985463 | Ga0070707_1009854631 | 113 |
| 185 | 3300005518 | Ga0070699_102152406 | Ga0070699_1021524061 | 113 |
| 186 | 3300005530 | Ga0070679_100108254 | Ga0070679_1001082541 | 113 |
| 187 | 3300005530 | Ga0070679_101489044 | Ga0070679_1014890442 | 113 |
| 188 | 3300005535 | Ga0070684_100031515 | Ga0070684_1000315156 | 113 |
| 189 | 3300005535 | Ga0070684_100468989 | Ga0070684_1004689891 | 113 |
| 190 | 3300005535 | Ga0070684_101008342 | Ga0070684_1010083422 | 113 |
| 191 | 3300005539 | Ga0068853_100077580 | Ga0068853_1000775803 | 113 |
| 192 | 3300005539 | Ga0068853_101845419 | Ga0068853_1018454191 | 113 |
| 193 | 3300005543 | Ga0070672_100007718 | Ga0070672_1000077187 | 113 |
| 194 | 3300005543 | Ga0070672_100013592 | Ga0070672_1000135922 | 113 |
| 195 | 3300005543 | Ga0070672_100036721 | Ga0070672_1000367214 | 113 |
| 196 | 3300005543 | Ga0070672_100042843 | Ga0070672_1000428435 | 113 |
| 197 | 3300005543 | Ga0070672_100149059 | Ga0070672_1001490592 | 113 |
| 198 | 3300005544 | Ga0070686_100452954 | Ga0070686_1004529542 | 113 |
| 199 | 3300005544 | Ga0070686_100702272 | Ga0070686_1007022722 | 113 |
| 200 | 3300005547 | Ga0070693_100079478 | Ga0070693_1000794782 | 113 |
| 201 | 3300005547 | Ga0070693_100952951 | Ga0070693_1009529512 | 113 |
| 202 | 3300005547 | Ga0070693_100988821 | Ga0070693_1009888212 | 113 |
| 203 | 3300005548 | Ga0070665_100015286 | Ga0070665_1000152864 | 113 |
| 204 | 3300005548 | Ga0070665_100523187 | Ga0070665_1005231873 | 113 |
| 205 | 3300005548 | Ga0070665_100656324 | Ga0070665_1006563243 | 113 |
| 206 | 3300005549 | Ga0070704_100581445 | Ga0070704_1005814451 | 113 |
| 207 | 3300005564 | Ga0070664_100112711 | Ga0070664_1001127114 | 113 |
| 208 | 3300005564 | Ga0070664_100240697 | Ga0070664_1002406973 | 113 |
| 209 | 3300005564 | Ga0070664_101111116 | Ga0070664_1011111162 | 113 |
| 210 | 3300005577 | Ga0068857_100241040 | Ga0068857_1002410404 | 113 |
| 211 | 3300005577 | Ga0068857_100285172 | Ga0068857_1002851722 | 113 |
| 212 | 3300005577 | Ga0068857_100354262 | Ga0068857_1003542621 | 113 |
| 213 | 3300005577 | Ga0068857_101673816 | Ga0068857_1016738162 | 113 |
| 214 | 3300005578 | Ga0068854_100499553 | Ga0068854_1004995532 | 113 |
| 215 | 3300005614 | Ga0068856_100007776 | Ga0068856_1000077764 | 113 |
| 216 | 3300005614 | Ga0068856_100200434 | Ga0068856_1002004342 | 113 |
| 217 | 3300005615 | Ga0070702_100261656 | Ga0070702_1002616563 | 113 |
| 218 | 3300005615 | Ga0070702_100410075 | Ga0070702_1004100752 | 113 |
| 219 | 3300005616 | Ga0068852_100005075 | Ga0068852_1000050759 | 113 |
| 220 | 3300005616 | Ga0068852_100030245 | Ga0068852_1000302455 | 113 |
| 221 | 3300005616 | Ga0068852_100256445 | Ga0068852_1002564453 | 113 |
| 222 | 3300005616 | Ga0068852_100707440 | Ga0068852_1007074401 | 113 |
| 223 | 3300005616 | Ga0068852_100709170 | Ga0068852_1007091703 | 113 |
| 224 | 3300005616 | Ga0068852_101023768 | Ga0068852_1010237682 | 113 |
| 225 | 3300005617 | Ga0068859_100019167 | Ga0068859_1000191678 | 113 |
| 226 | 3300005617 | Ga0068859_100594680 | Ga0068859_1005946802 | 113 |
| 227 | 3300005618 | Ga0068864_100002065 | Ga0068864_10000206514 | 113 |
| 228 | 3300005618 | Ga0068864_100013594 | Ga0068864_1000135944 | 113 |
| 229 | 3300005618 | Ga0068864_100035249 | Ga0068864_1000352496 | 113 |
| 230 | 3300005618 | Ga0068864_100072290 | Ga0068864_1000722904 | 113 |
| 231 | 3300005718 | Ga0068866_10003257 | Ga0068866_100032577 | 113 |
| 232 | 3300005718 | Ga0068866_10569852 | Ga0068866_105698522 | 113 |
| 233 | 3300005718 | Ga0068866_10725864 | Ga0068866_107258642 | 113 |
| 234 | 3300005719 | Ga0068861_100052430 | Ga0068861_1000524304 | 113 |
| 235 | 3300005719 | Ga0068861_100236372 | Ga0068861_1002363724 | 113 |
| 236 | 3300005719 | Ga0068861_100510359 | Ga0068861_1005103593 | 113 |
| 237 | 3300005834 | Ga0068851_10071766 | Ga0068851_100717662 | 113 |
| 238 | 3300005834 | Ga0068851_10102633 | Ga0068851_101026332 | 113 |
| 239 | 3300005834 | Ga0068851_10261466 | Ga0068851_102614662 | 113 |
| 240 | 3300005834 | Ga0068851_10489408 | Ga0068851_104894082 | 113 |
| 241 | 3300005840 | Ga0068870_11362289 | Ga0068870_113622891 | 113 |
| 242 | 3300005841 | Ga0068863_100017036 | Ga0068863_1000170365 | 113 |
| 243 | 3300005841 | Ga0068863_100020937 | Ga0068863_1000209378 | 113 |
| 244 | 3300005841 | Ga0068863_100059870 | Ga0068863_1000598706 | 113 |
| 245 | 3300005841 | Ga0068863_100085478 | Ga0068863_1000854786 | 113 |
| 246 | 3300005841 | Ga0068863_100248762 | Ga0068863_1002487625 | 113 |
| 247 | 3300005842 | Ga0068858_100015823 | Ga0068858_1000158238 | 113 |
| 248 | 3300005842 | Ga0068858_100039082 | Ga0068858_1000390827 | 113 |
| 249 | 3300005842 | Ga0068858_100061093 | Ga0068858_1000610934 | 113 |
| 250 | 3300005842 | Ga0068858_100319144 | Ga0068858_1003191442 | 113 |
| 251 | 3300005842 | Ga0068858_100936021 | Ga0068858_1009360212 | 113 |
| 252 | 3300005842 | Ga0068858_101711269 | Ga0068858_1017112692 | 113 |
| 253 | 3300005843 | Ga0068860_100000823 | Ga0068860_10000082320 | 113 |
| 254 | 3300005843 | Ga0068860_100022795 | Ga0068860_1000227957 | 113 |
| 255 | 3300005843 | Ga0068860_100139445 | Ga0068860_1001394453 | 113 |
| 256 | 3300005843 | Ga0068860_100975716 | Ga0068860_1009757162 | 113 |
| 257 | 3300005843 | Ga0068860_101949740 | Ga0068860_1019497402 | 113 |
| 258 | 3300005844 | Ga0068862_100020457 | Ga0068862_1000204574 | 113 |
| 259 | 3300005844 | Ga0068862_100074012 | Ga0068862_1000740123 | 113 |
| 260 | 3300005844 | Ga0068862_100155446 | Ga0068862_1001554465 | 113 |
| 261 | 3300005844 | Ga0068862_100303293 | Ga0068862_1003032932 | 113 |
| 262 | 3300006048 | Ga0075363_100362819 | Ga0075363_1003628192 | 113 |
| 263 | 3300006195 | Ga0075366_10010581 | Ga0075366_100105814 | 113 |
| 264 | 3300006195 | Ga0075366_10031527 | Ga0075366_100315273 | 113 |
| 265 | 3300006195 | Ga0075366_10224405 | Ga0075366_102244052 | 113 |
| 266 | 3300006195 | Ga0075366_10501107 | Ga0075366_105011072 | 113 |
| 267 | 3300006237 | Ga0097621_100047919 | Ga0097621_1000479193 | 113 |
| 268 | 3300006237 | Ga0097621_100081780 | Ga0097621_1000817805 | 113 |
| 269 | 3300006237 | Ga0097621_100144783 | Ga0097621_1001447832 | 113 |
| 270 | 3300006237 | Ga0097621_100205376 | Ga0097621_1002053762 | 113 |
| 271 | 3300006237 | Ga0097621_100501400 | Ga0097621_1005014003 | 113 |
| 272 | 3300006353 | Ga0075370_10028805 | Ga0075370_100288052 | 113 |
| 273 | 3300006353 | Ga0075370_10040124 | Ga0075370_100401246 | 113 |
| 274 | 3300006353 | Ga0075370_10195814 | Ga0075370_101958142 | 113 |
| 275 | 3300006358 | Ga0068871_100041620 | Ga0068871_1000416205 | 113 |
| 276 | 3300006358 | Ga0068871_100071350 | Ga0068871_1000713506 | 113 |
| 277 | 3300006358 | Ga0068871_100143639 | Ga0068871_1001436395 | 113 |
| 278 | 3300006871 | Ga0075434_100203918 | Ga0075434_1002039182 | 113 |
| 279 | 3300006881 | Ga0068865_100027661 | Ga0068865_1000276617 | 113 |
| 280 | 3300006881 | Ga0068865_100141331 | Ga0068865_1001413312 | 113 |
| 281 | 3300006931 | Ga0097620_100019167 | Ga0097620_1000191678 | 113 |
| 282 | 3300006931 | Ga0097620_100594727 | Ga0097620_1005947273 | 113 |
| 283 | 3300007076 | Ga0075435_100347657 | Ga0075435_1003476572 | 113 |
| 284 | 3300009092 | Ga0105250_10087916 | Ga0105250_100879162 | 113 |
| 285 | 3300009093 | Ga0105240_10025030 | Ga0105240_100250307 | 113 |
| 286 | 3300009093 | Ga0105240_10646029 | Ga0105240_106460293 | 113 |
| 287 | 3300009093 | Ga0105240_11241366 | Ga0105240_112413662 | 113 |
| 288 | 3300009094 | Ga0111539_12021008 | Ga0111539_120210082 | 113 |
| 289 | 3300009098 | Ga0105245_10085160 | Ga0105245_100851605 | 113 |
| 290 | 3300009098 | Ga0105245_10381366 | Ga0105245_103813663 | 113 |
| 291 | 3300009101 | Ga0105247_11386081 | Ga0105247_113860812 | 113 |
| 292 | 3300009147 | Ga0114129_12679103 | Ga0114129_126791032 | 113 |
| 293 | 3300009148 | Ga0105243_10011388 | Ga0105243_100113889 | 113 |
| 294 | 3300009148 | Ga0105243_10206614 | Ga0105243_102066143 | 113 |
| 295 | 3300009148 | Ga0105243_10587883 | Ga0105243_105878832 | 113 |
| 296 | 3300009148 | Ga0105243_10847446 | Ga0105243_108474462 | 113 |
| 297 | 3300009148 | Ga0105243_11192326 | Ga0105243_111923262 | 113 |
| 298 | 3300009148 | Ga0105243_12547590 | Ga0105243_125475902 | 113 |
| 299 | 3300009174 | Ga0105241_10327317 | Ga0105241_103273173 | 113 |
| 300 | 3300009174 | Ga0105241_11754658 | Ga0105241_117546582 | 113 |
| 301 | 3300009176 | Ga0105242_10260803 | Ga0105242_102608032 | 113 |
| 302 | 3300009177 | Ga0105248_10040305 | Ga0105248_100403056 | 113 |
| 303 | 3300009177 | Ga0105248_10074832 | Ga0105248_100748323 | 113 |
| 304 | 3300009177 | Ga0105248_10360699 | Ga0105248_103606993 | 113 |
| 305 | 3300009177 | Ga0105248_10388190 | Ga0105248_103881905 | 113 |
| 306 | 3300009177 | Ga0105248_10423779 | Ga0105248_104237793 | 113 |
| 307 | 3300009545 | Ga0105237_10007447 | Ga0105237_1000744713 | 113 |
| 308 | 3300009545 | Ga0105237_10098355 | Ga0105237_100983553 | 113 |
| 309 | 3300009545 | Ga0105237_10191070 | Ga0105237_101910705 | 113 |
| 310 | 3300009545 | Ga0105237_11401836 | Ga0105237_114018362 | 113 |
| 311 | 3300009551 | Ga0105238_10005477 | Ga0105238_1000547713 | 113 |
| 312 | 3300009551 | Ga0105238_10053451 | Ga0105238_100534517 | 113 |
| 313 | 3300009551 | Ga0105238_10959206 | Ga0105238_109592062 | 113 |
| 314 | 3300009551 | Ga0105238_11614897 | Ga0105238_116148972 | 113 |
| 315 | 3300009553 | Ga0105249_10023493 | Ga0105249_100234932 | 113 |
| 316 | 3300009553 | Ga0105249_10315700 | Ga0105249_103157002 | 113 |
| 317 | 3300009553 | Ga0105249_10636261 | Ga0105249_106362613 | 113 |
| 318 | 3300009553 | Ga0105249_12699000 | Ga0105249_126990002 | 113 |
| 319 | 3300010375 | Ga0105239_10010780 | Ga0105239_1001078012 | 113 |
| 320 | 3300010375 | Ga0105239_10114929 | Ga0105239_101149294 | 113 |
| 321 | 3300010375 | Ga0105239_12771490 | Ga0105239_127714902 | 113 |
| 322 | 3300011119 | Ga0105246_11004708 | Ga0105246_110047082 | 113 |
| 323 | 3300012495 | Ga0157323_1045220 | Ga0157323_10452202 | 113 |
| 324 | 3300012510 | Ga0157316_1071264 | Ga0157316_10712642 | 113 |
| 325 | 3300012512 | Ga0157327_1003137 | Ga0157327_10031373 | 113 |
| 326 | 3300013100 | Ga0157373_10108192 | Ga0157373_101081923 | 113 |
| 327 | 3300013102 | Ga0157371_10107101 | Ga0157371_101071014 | 113 |
| 328 | 3300013105 | Ga0157369_10083325 | Ga0157369_100833253 | 113 |
| 329 | 3300013105 | Ga0157369_10243757 | Ga0157369_102437573 | 113 |
| 330 | 3300013296 | Ga0157374_10047942 | Ga0157374_100479424 | 113 |
| 331 | 3300013296 | Ga0157374_10084070 | Ga0157374_100840704 | 113 |
| 332 | 3300013296 | Ga0157374_10570997 | Ga0157374_105709972 | 113 |
| 333 | 3300013296 | Ga0157374_10733648 | Ga0157374_107336482 | 113 |
| 334 | 3300013296 | Ga0157374_10903417 | Ga0157374_109034172 | 113 |
| 335 | 3300013297 | Ga0157378_10001703 | Ga0157378_1000170319 | 113 |
| 336 | 3300013297 | Ga0157378_10107143 | Ga0157378_101071433 | 113 |
| 337 | 3300013297 | Ga0157378_10606877 | Ga0157378_106068771 | 113 |
| 338 | 3300013306 | Ga0163162_10002252 | Ga0163162_1000225212 | 113 |
| 339 | 3300013306 | Ga0163162_10011131 | Ga0163162_1001113111 | 113 |
| 340 | 3300013306 | Ga0163162_10181411 | Ga0163162_101814113 | 113 |
| 341 | 3300013306 | Ga0163162_10205553 | Ga0163162_102055534 | 113 |
| 342 | 3300013306 | Ga0163162_10327514 | Ga0163162_103275144 | 113 |
| 343 | 3300013306 | Ga0163162_10352505 | Ga0163162_103525054 | 113 |
| 344 | 3300013307 | Ga0157372_10076894 | Ga0157372_100768944 | 113 |
| 345 | 3300013307 | Ga0157372_10188338 | Ga0157372_101883383 | 113 |
| 346 | 3300013308 | Ga0157375_10048298 | Ga0157375_100482986 | 113 |
| 347 | 3300013308 | Ga0157375_10151456 | Ga0157375_101514563 | 113 |
| 348 | 3300013308 | Ga0157375_10192035 | Ga0157375_101920354 | 113 |
| 349 | 3300013308 | Ga0157375_10528887 | Ga0157375_105288872 | 113 |
| 350 | 3300013308 | Ga0157375_10707123 | Ga0157375_107071232 | 113 |
| 351 | 3300013308 | Ga0157375_11341169 | Ga0157375_113411692 | 113 |
| 352 | 3300014325 | Ga0163163_10009458 | Ga0163163_100094586 | 113 |
| 353 | 3300014326 | Ga0157380_10040311 | Ga0157380_100403113 | 113 |
| 354 | 3300014326 | Ga0157380_12906071 | Ga0157380_129060712 | 113 |
| 355 | 3300014497 | Ga0182008_10248962 | Ga0182008_102489622 | 113 |
| 356 | 3300014745 | Ga0157377_10000032 | Ga0157377_10000032112 | 113 |
| 357 | 3300014968 | Ga0157379_10013272 | Ga0157379_100132729 | 113 |
| 358 | 3300014968 | Ga0157379_10069128 | Ga0157379_100691285 | 113 |
| 359 | 3300014968 | Ga0157379_10276440 | Ga0157379_102764403 | 113 |
| 360 | 3300014968 | Ga0157379_10858909 | Ga0157379_108589092 | 113 |
| 361 | 3300014969 | Ga0157376_10098430 | Ga0157376_100984303 | 113 |
| 362 | 3300014969 | Ga0157376_10115161 | Ga0157376_101151615 | 113 |
| 363 | 3300014969 | Ga0157376_10115243 | Ga0157376_101152433 | 113 |
| 364 | 3300014969 | Ga0157376_10176155 | Ga0157376_101761552 | 113 |
| 365 | 3300014969 | Ga0157376_10543407 | Ga0157376_105434072 | 113 |
| 366 | 3300014969 | Ga0157376_11459910 | Ga0157376_114599102 | 113 |
| 367 | 3300015262 | Ga0182007_10115543 | Ga0182007_101155432 | 113 |
| 368 | 3300017792 | Ga0163161_10076960 | Ga0163161_100769603 | 113 |
| 369 | 3300017792 | Ga0163161_10079358 | Ga0163161_100793583 | 113 |
| 370 | 3300017792 | Ga0163161_10462343 | Ga0163161_104623432 | 113 |
| 371 | 3300021384 | Ga0213876_10030362 | Ga0213876_100303624 | 113 |
| 372 | 3300025273 | Ga0209673_1065425 | Ga0209673_10654252 | 113 |
| 373 | 3300025297 | Ga0209758_1000281 | Ga0209758_100028123 | 113 |
| 374 | 3300025298 | Ga0209050_1000303 | Ga0209050_100030331 | 113 |
| 375 | 3300025303 | Ga0209051_1013169 | Ga0209051_10131694 | 113 |
| 376 | 3300025304 | Ga0209257_1006026 | Ga0209257_100602610 | 113 |
| 377 | 3300025315 | Ga0207697_10145728 | Ga0207697_101457282 | 113 |
| 378 | 3300025315 | Ga0207697_10163381 | Ga0207697_101633812 | 113 |
| 379 | 3300025321 | Ga0207656_10030997 | Ga0207656_100309972 | 113 |
| 380 | 3300025321 | Ga0207656_10031008 | Ga0207656_100310084 | 113 |
| 381 | 3300025321 | Ga0207656_10377168 | Ga0207656_103771682 | 113 |
| 382 | 3300025711 | Ga0207696_1085435 | Ga0207696_10854352 | 113 |
| 383 | 3300025893 | Ga0207682_10023185 | Ga0207682_100231852 | 113 |
| 384 | 3300025893 | Ga0207682_10111417 | Ga0207682_101114172 | 113 |
| 385 | 3300025893 | Ga0207682_10114272 | Ga0207682_101142723 | 113 |
| 386 | 3300025899 | Ga0207642_10012685 | Ga0207642_100126852 | 113 |
| 387 | 3300025903 | Ga0207680_10002140 | Ga0207680_100021409 | 113 |
| 388 | 3300025904 | Ga0207647_10136054 | Ga0207647_101360543 | 113 |
| 389 | 3300025907 | Ga0207645_10023242 | Ga0207645_100232427 | 113 |
| 390 | 3300025907 | Ga0207645_10063446 | Ga0207645_100634464 | 113 |
| 391 | 3300025907 | Ga0207645_10113574 | Ga0207645_101135744 | 113 |
| 392 | 3300025908 | Ga0207643_10837842 | Ga0207643_108378422 | 113 |
| 393 | 3300025909 | Ga0207705_10344261 | Ga0207705_103442612 | 113 |
| 394 | 3300025911 | Ga0207654_10354674 | Ga0207654_103546743 | 113 |
| 395 | 3300025911 | Ga0207654_11328800 | Ga0207654_113288002 | 113 |
| 396 | 3300025913 | Ga0207695_10009980 | Ga0207695_100099808 | 113 |
| 397 | 3300025913 | Ga0207695_10736876 | Ga0207695_107368762 | 113 |
| 398 | 3300025914 | Ga0207671_10008972 | Ga0207671_100089723 | 113 |
| 399 | 3300025914 | Ga0207671_10113852 | Ga0207671_101138523 | 113 |
| 400 | 3300025914 | Ga0207671_10153863 | Ga0207671_101538632 | 113 |
| 401 | 3300025917 | Ga0207660_10145784 | Ga0207660_101457843 | 113 |
| 402 | 3300025918 | Ga0207662_10721860 | Ga0207662_107218601 | 113 |
| 403 | 3300025920 | Ga0207649_10070050 | Ga0207649_100700503 | 113 |
| 404 | 3300025920 | Ga0207649_10412864 | Ga0207649_104128642 | 113 |
| 405 | 3300025921 | Ga0207652_10030048 | Ga0207652_100300486 | 113 |
| 406 | 3300025923 | Ga0207681_10016930 | Ga0207681_100169307 | 113 |
| 407 | 3300025923 | Ga0207681_10081625 | Ga0207681_100816254 | 113 |
| 408 | 3300025923 | Ga0207681_10248638 | Ga0207681_102486382 | 113 |
| 409 | 3300025923 | Ga0207681_10331005 | Ga0207681_103310052 | 113 |
| 410 | 3300025923 | Ga0207681_10636469 | Ga0207681_106364693 | 113 |
| 411 | 3300025923 | Ga0207681_11005095 | Ga0207681_110050952 | 113 |
| 412 | 3300025924 | Ga0207694_10149504 | Ga0207694_101495042 | 113 |
| 413 | 3300025924 | Ga0207694_11149245 | Ga0207694_111492452 | 113 |
| 414 | 3300025925 | Ga0207650_10072993 | Ga0207650_100729934 | 113 |
| 415 | 3300025925 | Ga0207650_10169482 | Ga0207650_101694823 | 113 |
| 416 | 3300025925 | Ga0207650_10240084 | Ga0207650_102400842 | 113 |
| 417 | 3300025926 | Ga0207659_10020943 | Ga0207659_100209434 | 113 |
| 418 | 3300025926 | Ga0207659_10024900 | Ga0207659_100249007 | 113 |
| 419 | 3300025926 | Ga0207659_10090445 | Ga0207659_100904452 | 113 |
| 420 | 3300025926 | Ga0207659_10098365 | Ga0207659_100983654 | 113 |
| 421 | 3300025927 | Ga0207687_10102368 | Ga0207687_101023686 | 113 |
| 422 | 3300025927 | Ga0207687_10251793 | Ga0207687_102517932 | 113 |
| 423 | 3300025931 | Ga0207644_10002654 | Ga0207644_100026547 | 113 |
| 424 | 3300025931 | Ga0207644_10220439 | Ga0207644_102204392 | 113 |
| 425 | 3300025931 | Ga0207644_10423984 | Ga0207644_104239842 | 113 |
| 426 | 3300025932 | Ga0207690_10112138 | Ga0207690_101121383 | 113 |
| 427 | 3300025932 | Ga0207690_10454509 | Ga0207690_104545092 | 113 |
| 428 | 3300025933 | Ga0207706_10013493 | Ga0207706_100134939 | 113 |
| 429 | 3300025933 | Ga0207706_10031863 | Ga0207706_100318636 | 113 |
| 430 | 3300025933 | Ga0207706_10388948 | Ga0207706_103889483 | 113 |
| 431 | 3300025935 | Ga0207709_10002313 | Ga0207709_100023136 | 113 |
| 432 | 3300025935 | Ga0207709_10063317 | Ga0207709_100633174 | 113 |
| 433 | 3300025935 | Ga0207709_10577994 | Ga0207709_105779942 | 113 |
| 434 | 3300025936 | Ga0207670_10007649 | Ga0207670_100076497 | 113 |
| 435 | 3300025936 | Ga0207670_11561846 | Ga0207670_115618462 | 113 |
| 436 | 3300025937 | Ga0207669_10259192 | Ga0207669_102591924 | 113 |
| 437 | 3300025937 | Ga0207669_10715248 | Ga0207669_107152482 | 113 |
| 438 | 3300025938 | Ga0207704_10003689 | Ga0207704_100036897 | 113 |
| 439 | 3300025940 | Ga0207691_10004404 | Ga0207691_1000440412 | 113 |
| 440 | 3300025940 | Ga0207691_10018804 | Ga0207691_100188047 | 113 |
| 441 | 3300025940 | Ga0207691_10019002 | Ga0207691_1001900210 | 113 |
| 442 | 3300025940 | Ga0207691_10031019 | Ga0207691_100310196 | 113 |
| 443 | 3300025940 | Ga0207691_10395526 | Ga0207691_103955262 | 113 |
| 444 | 3300025941 | Ga0207711_10048589 | Ga0207711_100485896 | 113 |
| 445 | 3300025941 | Ga0207711_10087324 | Ga0207711_100873244 | 113 |
| 446 | 3300025941 | Ga0207711_10195222 | Ga0207711_101952222 | 113 |
| 447 | 3300025941 | Ga0207711_10239440 | Ga0207711_102394403 | 113 |
| 448 | 3300025942 | Ga0207689_10014107 | Ga0207689_100141079 | 113 |
| 449 | 3300025942 | Ga0207689_10060014 | Ga0207689_100600143 | 113 |
| 450 | 3300025942 | Ga0207689_10116843 | Ga0207689_101168435 | 113 |
| 451 | 3300025944 | Ga0207661_10500212 | Ga0207661_105002121 | 113 |
| 452 | 3300025945 | Ga0207679_10008471 | Ga0207679_100084718 | 113 |
| 453 | 3300025945 | Ga0207679_11061976 | Ga0207679_110619762 | 113 |
| 454 | 3300025949 | Ga0207667_10514752 | Ga0207667_105147523 | 113 |
| 455 | 3300025960 | Ga0207651_10004672 | Ga0207651_100046728 | 113 |
| 456 | 3300025960 | Ga0207651_10013837 | Ga0207651_100138374 | 113 |
| 457 | 3300025960 | Ga0207651_10032262 | Ga0207651_100322625 | 113 |
| 458 | 3300025961 | Ga0207712_10043080 | Ga0207712_100430805 | 113 |
| 459 | 3300025961 | Ga0207712_10284197 | Ga0207712_102841972 | 113 |
| 460 | 3300025972 | Ga0207668_10024415 | Ga0207668_100244154 | 113 |
| 461 | 3300025972 | Ga0207668_10121965 | Ga0207668_101219654 | 113 |
| 462 | 3300025972 | Ga0207668_10275890 | Ga0207668_102758903 | 113 |
| 463 | 3300025972 | Ga0207668_10570713 | Ga0207668_105707132 | 113 |
| 464 | 3300025972 | Ga0207668_10971850 | Ga0207668_109718502 | 113 |
| 465 | 3300025981 | Ga0207640_10155351 | Ga0207640_101553513 | 113 |
| 466 | 3300025981 | Ga0207640_10158498 | Ga0207640_101584983 | 113 |
| 467 | 3300025981 | Ga0207640_10443593 | Ga0207640_104435932 | 113 |
| 468 | 3300025981 | Ga0207640_11481529 | Ga0207640_114815292 | 113 |
| 469 | 3300025986 | Ga0207658_10020095 | Ga0207658_100200956 | 113 |
| 470 | 3300025986 | Ga0207658_10051018 | Ga0207658_100510185 | 113 |
| 471 | 3300025986 | Ga0207658_10062467 | Ga0207658_100624675 | 113 |
| 472 | 3300025986 | Ga0207658_10084433 | Ga0207658_100844332 | 113 |
| 473 | 3300025986 | Ga0207658_10223334 | Ga0207658_102233342 | 113 |
| 474 | 3300025986 | Ga0207658_10252241 | Ga0207658_102522414 | 113 |
| 475 | 3300025986 | Ga0207658_11639547 | Ga0207658_116395472 | 113 |
| 476 | 3300026023 | Ga0207677_10001522 | Ga0207677_100015225 | 113 |
| 477 | 3300026023 | Ga0207677_10018664 | Ga0207677_100186646 | 113 |
| 478 | 3300026023 | Ga0207677_10156774 | Ga0207677_101567742 | 113 |
| 479 | 3300026023 | Ga0207677_10158317 | Ga0207677_101583173 | 113 |
| 480 | 3300026023 | Ga0207677_10336598 | Ga0207677_103365984 | 113 |
| 481 | 3300026035 | Ga0207703_10006009 | Ga0207703_1000600910 | 113 |
| 482 | 3300026035 | Ga0207703_10026459 | Ga0207703_100264597 | 113 |
| 483 | 3300026035 | Ga0207703_10032964 | Ga0207703_100329647 | 113 |
| 484 | 3300026035 | Ga0207703_11171630 | Ga0207703_111716302 | 113 |
| 485 | 3300026035 | Ga0207703_11290075 | Ga0207703_112900752 | 113 |
| 486 | 3300026041 | Ga0207639_10099598 | Ga0207639_100995984 | 113 |
| 487 | 3300026041 | Ga0207639_10141624 | Ga0207639_101416242 | 113 |
| 488 | 3300026041 | Ga0207639_11765660 | Ga0207639_117656602 | 113 |
| 489 | 3300026067 | Ga0207678_10016216 | Ga0207678_1001621610 | 113 |
| 490 | 3300026067 | Ga0207678_10083543 | Ga0207678_100835435 | 113 |
| 491 | 3300026075 | Ga0207708_10153438 | Ga0207708_101534384 | 113 |
| 492 | 3300026075 | Ga0207708_10699366 | Ga0207708_106993662 | 113 |
| 493 | 3300026078 | Ga0207702_10004429 | Ga0207702_100044297 | 113 |
| 494 | 3300026078 | Ga0207702_10335077 | Ga0207702_103350773 | 113 |
| 495 | 3300026088 | Ga0207641_10003329 | Ga0207641_1000332911 | 113 |
| 496 | 3300026088 | Ga0207641_10079161 | Ga0207641_100791615 | 113 |
| 497 | 3300026088 | Ga0207641_10137677 | Ga0207641_101376775 | 113 |
| 498 | 3300026088 | Ga0207641_10452533 | Ga0207641_104525332 | 113 |
| 499 | 3300026088 | Ga0207641_10639320 | Ga0207641_106393202 | 113 |
| 500 | 3300026088 | Ga0207641_10715550 | Ga0207641_107155501 | 113 |
| 501 | 3300026089 | Ga0207648_10000179 | Ga0207648_1000017954 | 113 |
| 502 | 3300026089 | Ga0207648_10001296 | Ga0207648_1000129614 | 113 |
| 503 | 3300026089 | Ga0207648_10010028 | Ga0207648_100100287 | 113 |
| 504 | 3300026089 | Ga0207648_10101337 | Ga0207648_101013375 | 113 |
| 505 | 3300026089 | Ga0207648_10325133 | Ga0207648_103251333 | 113 |
| 506 | 3300026089 | Ga0207648_10449942 | Ga0207648_104499422 | 113 |
| 507 | 3300026089 | Ga0207648_11271580 | Ga0207648_112715801 | 113 |
| 508 | 3300026095 | Ga0207676_10002741 | Ga0207676_1000274114 | 113 |
| 509 | 3300026095 | Ga0207676_10003295 | Ga0207676_100032959 | 113 |
| 510 | 3300026095 | Ga0207676_10044642 | Ga0207676_100446424 | 113 |
| 511 | 3300026095 | Ga0207676_10073876 | Ga0207676_100738762 | 113 |
| 512 | 3300026095 | Ga0207676_10904337 | Ga0207676_109043372 | 113 |
| 513 | 3300026116 | Ga0207674_10008627 | Ga0207674_1000862712 | 113 |
| 514 | 3300026116 | Ga0207674_10332208 | Ga0207674_103322082 | 113 |
| 515 | 3300026116 | Ga0207674_10446401 | Ga0207674_104464011 | 113 |
| 516 | 3300026118 | Ga0207675_100005391 | Ga0207675_10000539113 | 113 |
| 517 | 3300026118 | Ga0207675_100060714 | Ga0207675_1000607146 | 113 |
| 518 | 3300026118 | Ga0207675_100088572 | Ga0207675_1000885724 | 113 |
| 519 | 3300026121 | Ga0207683_10148626 | Ga0207683_101486262 | 113 |
| 520 | 3300026121 | Ga0207683_10365924 | Ga0207683_103659241 | 113 |
| 521 | 3300026121 | Ga0207683_10673289 | Ga0207683_106732892 | 113 |
| 522 | 3300026142 | Ga0207698_10009766 | Ga0207698_1000976610 | 113 |
| 523 | 3300026142 | Ga0207698_10021332 | Ga0207698_100213326 | 113 |
| 524 | 3300026142 | Ga0207698_10051692 | Ga0207698_100516926 | 113 |
| 525 | 3300026142 | Ga0207698_10603936 | Ga0207698_106039362 | 113 |
| 526 | 3300026142 | Ga0207698_10687655 | Ga0207698_106876551 | 113 |
| 527 | 3300026142 | Ga0207698_10748657 | Ga0207698_107486572 | 113 |
| 528 | 3300026142 | Ga0207698_11223306 | Ga0207698_112233062 | 113 |
| 529 | 3300028379 | Ga0268266_10045732 | Ga0268266_100457323 | 113 |
| 530 | 3300028379 | Ga0268266_10350275 | Ga0268266_103502753 | 113 |
| 531 | 3300028379 | Ga0268266_10368943 | Ga0268266_103689433 | 113 |
| 532 | 3300028380 | Ga0268265_10011328 | Ga0268265_100113288 | 113 |
| 533 | 3300028380 | Ga0268265_10026717 | Ga0268265_100267173 | 113 |
| 534 | 3300028380 | Ga0268265_10201146 | Ga0268265_102011464 | 113 |
| 535 | 3300028381 | Ga0268264_10000613 | Ga0268264_1000061315 | 113 |
| 536 | 3300028381 | Ga0268264_10024923 | Ga0268264_100249236 | 113 |
| 537 | 3300028381 | Ga0268264_10572287 | Ga0268264_105722872 | 113 |
| 538 | 3300028786 | Ga0307517_10076041 | Ga0307517_100760415 | 113 |
| 539 | 3300028786 | Ga0307517_10184301 | Ga0307517_101843013 | 113 |
| 540 | 3300028786 | Ga0307517_10189474 | Ga0307517_101894743 | 113 |
| 541 | 3300028794 | Ga0307515_10000609 | Ga0307515_1000060928 | 113 |
| 542 | 3300028794 | Ga0307515_10003934 | Ga0307515_1000393410 | 113 |
| 543 | 3300028794 | Ga0307515_10018282 | Ga0307515_1001828215 | 113 |
| 544 | 3300028794 | Ga0307515_10044072 | Ga0307515_100440729 | 113 |
| 545 | 3300028794 | Ga0307515_10260267 | Ga0307515_102602672 | 113 |
| 546 | 3300028794 | Ga0307515_10472368 | Ga0307515_104723682 | 113 |
| 547 | 3300030522 | Ga0307512_10121681 | Ga0307512_101216814 | 113 |
| 548 | 3300030522 | Ga0307512_10385555 | Ga0307512_103855552 | 113 |
| 549 | 3300031456 | Ga0307513_10114170 | Ga0307513_101141705 | 113 |
| 550 | 3300031456 | Ga0307513_10378910 | Ga0307513_103789102 | 113 |
| 551 | 3300031456 | Ga0307513_10424194 | Ga0307513_104241942 | 113 |
| 552 | 3300031507 | Ga0307509_10000991 | Ga0307509_1000099121 | 113 |
| 553 | 3300031507 | Ga0307509_10040089 | Ga0307509_100400895 | 113 |
| 554 | 3300031507 | Ga0307509_10058903 | Ga0307509_100589036 | 113 |
| 555 | 3300031507 | Ga0307509_10106381 | Ga0307509_101063813 | 113 |
| 556 | 3300031507 | Ga0307509_10142847 | Ga0307509_101428475 | 113 |
| 557 | 3300031507 | Ga0307509_10420658 | Ga0307509_104206582 | 113 |
| 558 | 3300031507 | Ga0307509_10646017 | Ga0307509_106460171 | 113 |
| 559 | 3300031507 | Ga0307509_10689182 | Ga0307509_106891822 | 113 |
| 560 | 3300031507 | Ga0307509_10780701 | Ga0307509_107807011 | 113 |
| 561 | 3300031507 | Ga0307509_10891337 | Ga0307509_108913372 | 113 |
| 562 | 3300031548 | Ga0307408_100046772 | Ga0307408_1000467726 | 113 |
| 563 | 3300031548 | Ga0307408_100311467 | Ga0307408_1003114673 | 113 |
| 564 | 3300031616 | Ga0307508_10000404 | Ga0307508_1000040441 | 113 |
| 565 | 3300031616 | Ga0307508_10005736 | Ga0307508_1000573613 | 113 |
| 566 | 3300031616 | Ga0307508_10011564 | Ga0307508_100115645 | 113 |
| 567 | 3300031616 | Ga0307508_10349404 | Ga0307508_103494043 | 113 |
| 568 | 3300031649 | Ga0307514_10053594 | Ga0307514_100535946 | 113 |
| 569 | 3300031649 | Ga0307514_10058422 | Ga0307514_100584223 | 113 |
| 570 | 3300031649 | Ga0307514_10149542 | Ga0307514_101495422 | 113 |
| 571 | 3300031649 | Ga0307514_10394112 | Ga0307514_103941122 | 113 |
| 572 | 3300031730 | Ga0307516_10009071 | Ga0307516_100090719 | 113 |
| 573 | 3300031730 | Ga0307516_10237732 | Ga0307516_102377323 | 113 |
| 574 | 3300031730 | Ga0307516_10370119 | Ga0307516_103701192 | 113 |
| 575 | 3300031731 | Ga0307405_10006962 | Ga0307405_100069626 | 113 |
| 576 | 3300031824 | Ga0307413_10263992 | Ga0307413_102639923 | 113 |
| 577 | 3300031838 | Ga0307518_10047827 | Ga0307518_100478276 | 113 |
| 578 | 3300031852 | Ga0307410_10916573 | Ga0307410_109165732 | 113 |
| 579 | 3300031901 | Ga0307406_10114919 | Ga0307406_101149193 | 113 |
| 580 | 3300031901 | Ga0307406_10712935 | Ga0307406_107129352 | 113 |
| 581 | 3300031903 | Ga0307407_10907830 | Ga0307407_109078302 | 113 |
| 582 | 3300031911 | Ga0307412_10024007 | Ga0307412_100240073 | 113 |
| 583 | 3300031911 | Ga0307412_10277509 | Ga0307412_102775092 | 113 |
| 584 | 3300031995 | Ga0307409_100000580 | Ga0307409_10000058010 | 113 |
| 585 | 3300032002 | Ga0307416_100014097 | Ga0307416_1000140976 | 113 |
| 586 | 3300032002 | Ga0307416_100236784 | Ga0307416_1002367843 | 113 |
| 587 | 3300032002 | Ga0307416_101955761 | Ga0307416_1019557612 | 113 |
| 588 | 3300032005 | Ga0307411_10351244 | Ga0307411_103512442 | 113 |
| 589 | 3300032005 | Ga0307411_10521007 | Ga0307411_105210071 | 113 |
| 590 | 3300032005 | Ga0307411_10738275 | Ga0307411_107382752 | 113 |
| 591 | 3300032126 | Ga0307415_100002051 | Ga0307415_1000020517 | 113 |
| 592 | 3300033179 | Ga0307507_10038483 | Ga0307507_100384836 | 113 |
| 593 | 3300033179 | Ga0307507_10050992 | Ga0307507_100509926 | 113 |
| 594 | 3300033179 | Ga0307507_10161529 | Ga0307507_101615294 | 113 |
| 595 | 3300033180 | Ga0307510_10003212 | Ga0307510_1000321213 | 113 |
| 596 | 3300033180 | Ga0307510_10059995 | Ga0307510_100599956 | 113 |
| 597 | 3300033180 | Ga0307510_10131040 | Ga0307510_101310405 | 113 |
| 598 | 3300033180 | Ga0307510_10135291 | Ga0307510_101352912 | 113 |
| 599 | 3300035089 | Ga0373944_0194926 | Ga0373944_0194926_220_579 | 113 |
| 600 | 3300035112 | Ga0373932_0019983 | Ga0373932_0019983_760_1119 | 113 |
| 601 | 3300035241 | Ga0373961_0378091 | Ga0373961_0378091_101_463 | 113 |
| 602 | 3300035691 | Ga0373931_0001378 | Ga0373931_0001378_5423_5785 | 113 |
| 603 | 3300035695 | Ga0373927_0064689 | Ga0373927_0064689_1094_1459 | 113 |
| 604 | 3300037068 | Ga0373925_0552801 | Ga0373925_0552801_125_496 | 113 |
| 605 | 3300037471 | Ga0395905_0023956 | Ga0395905_0023956_4588_4968 | 113 |
| 606 | 3300039437 | Ga0436365_1640203 | Ga0436365_1640203_1871_2233 | 113 |
| 607 | 3300039450 | Ga0436363_1475448 | Ga0436363_1475448_623_985 | 113 |
| 608 | 3300041441 | Ga0451787_580127 | Ga0451787_580127_117_467 | 113 |
| 609 | 3300041443 | Ga0451789_0198671 | Ga0451789_0198671_250_600 | 113 |
| 610 | 3300041452 | Ga0451793_0018596 | Ga0451793_0018596_481_831 | 113 |
| 611 | 3300041452 | Ga0451793_1009547 | Ga0451793_1009547_101_466 | 113 |
| 612 | 3300041460 | Ga0451802_2074907 | Ga0451802_2074907_33_383 | 113 |
| 613 | 3300041486 | Ga0451807_1825296 | Ga0451807_1825296_53_403 | 113 |
| 614 | 3300041491 | Ga0451833_1469414 | Ga0451833_1469414_195_545 | 113 |
| 615 | 3300041501 | Ga0451845_0977099 | Ga0451845_0977099_282_647 | 113 |
| 616 | 3300041509 | Ga0451843_0870225 | Ga0451843_0870225_111_491 | 113 |
| 617 | 3300041512 | Ga0451853_0327863 | Ga0451853_0327863_233_598 | 113 |
| 618 | 3300041512 | Ga0451853_0350852 | Ga0451853_0350852_1017_1376 | 113 |
| 619 | 3300041512 | Ga0451853_3674141 | Ga0451853_3674141_229_579 | 113 |
| 620 | 3300042007 | Ga0439449_0343875 | Ga0439449_0343875_54_416 | 113 |
| 621 | 3300042013 | Ga0439456_144950 | Ga0439456_144950_42_407 | 113 |
| 622 | 3300042133 | Ga0450896_022249 | Ga0450896_022249_457_822 | 113 |
| 623 | 3300042461 | Ga0439460_0175468 | Ga0439460_0175468_343_705 | 113 |
| 624 | 3300042532 | Ga0450893_0034880 | Ga0450893_0034880_122_493 | 113 |
| 625 | 3300042876 | Ga0451577_0004221 | Ga0451577_0004221_7660_8031 | 113 |
| 626 | 3300042876 | Ga0451577_0020267 | Ga0451577_0020267_1729_2082 | 113 |
| 627 | 3300042876 | Ga0451577_0186853 | Ga0451577_0186853_581_937 | 113 |
| 628 | 3300044673 | Ga0453683_0134334 | Ga0453683_0134334_860_1216 | 113 |
| 629 | 3300044712 | Ga0453684_0005216 | Ga0453684_0005216_15702_16049 | 113 |
| 630 | 3300044712 | Ga0453684_0251708 | Ga0453684_0251708_74_427 | 113 |
| 631 | 3300044712 | Ga0453684_0384845 | Ga0453684_0384845_888_1244 | 113 |
| 632 | 3300045051 | Ga0451576_0017940 | Ga0451576_0017940_4799_5155 | 113 |
| 633 | 3300045051 | Ga0451576_0062948 | Ga0451576_0062948_1537_1899 | 113 |
| 634 | 3300045051 | Ga0451576_2164302 | Ga0451576_2164302_29_376 | 113 |
| 635 | 3300046454 | Ga0495592_0000083 | Ga0495592_0000083_46204_46554 | 113 |
| 636 | 3300046459 | Ga0495629_0311784 | Ga0495629_0311784_661_1020 | 113 |
| 637 | 3300046459 | Ga0495629_0365673 | Ga0495629_0365673_118_483 | 113 |
| 638 | 3300046460 | Ga0495638_0111579 | Ga0495638_0111579_377_742 | 113 |
| 639 | 3300046471 | Ga0495650_0145821 | Ga0495650_0145821_491_841 | 113 |
| 640 | 3300046472 | Ga0495580_0018628 | Ga0495580_0018628_1109_1471 | 113 |
| 641 | 3300046475 | Ga0495639_0142511 | Ga0495639_0142511_663_1028 | 113 |
| 642 | 3300046507 | Ga0495606_0461145 | Ga0495606_0461145_193_543 | 113 |
| 643 | 3300046518 | Ga0495631_0051252 | Ga0495631_0051252_1139_1498 | 113 |
| 644 | 3300046519 | Ga0495632_0168428 | Ga0495632_0168428_464_829 | 113 |
| 645 | 3300046519 | Ga0495632_0283575 | Ga0495632_0283575_235_594 | 113 |
| 646 | 3300046524 | Ga0495648_0139642 | Ga0495648_0139642_730_1089 | 113 |
| 647 | 3300046524 | Ga0495648_0283877 | Ga0495648_0283877_84_434 | 113 |
| 648 | 3300046537 | Ga0495598_0072198 | Ga0495598_0072198_300_665 | 113 |
| 649 | 3300046539 | Ga0495621_0024915 | Ga0495621_0024915_1601_1966 | 113 |
| 650 | 3300046616 | Ga0495668_0087108 | Ga0495668_0087108_917_1276 | 113 |
| 651 | 3300046660 | Ga0495625_0009747 | Ga0495625_0009747_2435_2794 | 113 |
| 652 | 3300046660 | Ga0495625_0108748 | Ga0495625_0108748_739_1104 | 113 |
| 653 | 3300046680 | Ga0495646_0064363 | Ga0495646_0064363_539_889 | 113 |
| 654 | 3300046683 | Ga0495658_0178716 | Ga0495658_0178716_891_1256 | 113 |
| 655 | 3300046683 | Ga0495658_0347228 | Ga0495658_0347228_196_558 | 113 |
| 656 | 3300046690 | Ga0495624_0016323 | Ga0495624_0016323_2008_2367 | 113 |
| 657 | 3300046691 | Ga0495670_0045101 | Ga0495670_0045101_703_1068 | 113 |
| 658 | 3300046692 | Ga0495671_0028003 | Ga0495671_0028003_2123_2479 | 113 |
| 659 | 3300046809 | Ga0495600_0706943 | Ga0495600_0706943_80_439 | 113 |
| 660 | 3300047315 | Ga0495581_0455107 | Ga0495581_0455107_149_508 | 113 |
| 661 | 3300047317 | Ga0495604_0254180 | Ga0495604_0254180_585_944 | 113 |
| 662 | 3300047319 | Ga0495674_1236223 | Ga0495674_1236223_116_475 | 113 |
| 663 | 3300047321 | Ga0495676_0392362 | Ga0495676_0392362_312_671 | 113 |
| 664 | 3300047469 | Ga0495673_0152346 | Ga0495673_0152346_482_847 | 113 |
| 665 | 3300047472 | Ga0495686_0215174 | Ga0495686_0215174_16_366 | 113 |
| 666 | 3300047673 | Ga0495593_0059628 | Ga0495593_0059628_501_860 | 113 |
| 667 | 3300048088 | Ga0495602_0316539 | Ga0495602_0316539_741_1100 | 113 |
| 668 | 3300048089 | Ga0495614_0056011 | Ga0495614_0056011_401_760 | 113 |
| 669 | 3300048089 | Ga0495614_0098532 | Ga0495614_0098532_657_1016 | 113 |
| 670 | 3300048903 | Ga0496100_0091111 | Ga0496100_0091111_1115_1477 | 113 |
| 671 | 3300048903 | Ga0496100_0112887 | Ga0496100_0112887_364_729 | 113 |
| 672 | 3300048904 | Ga0496101_0008293 | Ga0496101_0008293_1110_1472 | 113 |
| 673 | 3300048904 | Ga0496101_0303590 | Ga0496101_0303590_806_1171 | 113 |
| 674 | 3300048905 | Ga0496102_0018445 | Ga0496102_0018445_1309_1677 | 113 |
| 675 | 3300048905 | Ga0496102_0272326 | Ga0496102_0272326_201_563 | 113 |
| 676 | 3300048905 | Ga0496102_0503763 | Ga0496102_0503763_599_967 | 113 |
| 677 | 3300048907 | Ga0496104_0032470 | Ga0496104_0032470_3269_3634 | 113 |
| 678 | 3300048907 | Ga0496104_0055646 | Ga0496104_0055646_465_827 | 113 |
| 679 | 3300048907 | Ga0496104_0753854 | Ga0496104_0753854_72_437 | 113 |
| 680 | 3300048907 | Ga0496104_1245281 | Ga0496104_1245281_215_580 | 113 |
| 681 | 3300048908 | Ga0496105_0073192 | Ga0496105_0073192_153_518 | 113 |
| 682 | 3300048908 | Ga0496105_0167701 | Ga0496105_0167701_247_612 | 113 |
| 683 | 3300048909 | Ga0496106_0008934 | Ga0496106_0008934_1227_1589 | 113 |
| 684 | 3300048910 | Ga0496107_0256318 | Ga0496107_0256318_139_504 | 113 |
| 685 | 3300048911 | Ga0496108_0011606 | Ga0496108_0011606_5950_6312 | 113 |
| 686 | 3300048911 | Ga0496108_0023125 | Ga0496108_0023125_1388_1753 | 113 |
| 687 | 3300048911 | Ga0496108_1030897 | Ga0496108_1030897_310_678 | 113 |
| 688 | 3300048912 | Ga0496109_0082364 | Ga0496109_0082364_1598_1960 | 113 |
| 689 | 3300048912 | Ga0496109_0082794 | Ga0496109_0082794_1912_2277 | 113 |
| 690 | 3300048913 | Ga0496110_0118474 | Ga0496110_0118474_1944_2306 | 113 |
| 691 | 3300048914 | Ga0496111_0275498 | Ga0496111_0275498_548_910 | 113 |
| 692 | 3300048915 | Ga0496112_0193243 | Ga0496112_0193243_460_822 | 113 |
| 693 | 3300048916 | Ga0496113_0067776 | Ga0496113_0067776_1886_2254 | 113 |
| 694 | 3300048916 | Ga0496113_0068982 | Ga0496113_0068982_1584_1946 | 113 |
| 695 | 3300048917 | Ga0496114_0126437 | Ga0496114_0126437_1025_1387 | 113 |
| 696 | 3300048917 | Ga0496114_0559505 | Ga0496114_0559505_126_491 | 113 |
| 697 | 3300048928 | Ga0496125_0423925 | Ga0496125_0423925_152_499 | 113 |
| 698 | 3300049649 | Ga0501198_037180 | Ga0501198_037180_397_747 | 113 |
| 699 | 3300049656 | Ga0501209_276053 | Ga0501209_276053_99_449 | 113 |
| 700 | 3300049682 | Ga0501252_000122 | Ga0501252_000122_1757_2113 | 113 |
| 701 | 3300049761 | Ga0501264_024709 | Ga0501264_024709_233_601 | 113 |
| 702 | 3300049853 | Ga0501226_010804 | Ga0501226_010804_180_536 | 113 |
| 703 | 3300050489 | nmdc:mga03683_199333_c1 | nmdc:mga03683_199333_c1_433_813 | 113 |
| 704 | 3300050493 | nmdc:mga0k408_119019_c1 | nmdc:mga0k408_119019_c1_61_441 | 113 |
| 705 | 3300050493 | nmdc:mga0k408_16652_c1 | nmdc:mga0k408_16652_c1_1903_2250 | 113 |
| 706 | 3300050493 | nmdc:mga0k408_267305_c1 | nmdc:mga0k408_267305_c1_180_536 | 113 |
| 707 | 3300050493 | nmdc:mga0k408_33581_c1 | nmdc:mga0k408_33581_c1_1546_1893 | 113 |
| 708 | 3300050493 | nmdc:mga0k408_590424_c1 | nmdc:mga0k408_590424_c1_273_626 | 113 |
| 709 | 3300050496 | nmdc:mga07m45_103137_c1 | nmdc:mga07m45_103137_c1_49_405 | 113 |
| 710 | 3300050496 | nmdc:mga07m45_147621_c1 | nmdc:mga07m45_147621_c1_147_494 | 113 |
| 711 | 3300050496 | nmdc:mga07m45_48382_c1 | nmdc:mga07m45_48382_c1_163_513 | 113 |
| 712 | 3300050496 | nmdc:mga07m45_517306_c1 | nmdc:mga07m45_517306_c1_28_387 | 113 |
| 713 | 3300050496 | nmdc:mga07m45_71714_c1 | nmdc:mga07m45_71714_c1_360_740 | 113 |
| 714 | 3300050507 | nmdc:mga05p37_2022283_c1 | nmdc:mga05p37_2022283_c1_28_390 | 113 |
| 715 | 3300050511 | nmdc:mga08y16_114587_c1 | nmdc:mga08y16_114587_c1_680_1042 | 113 |
| 716 | 3300050512 | nmdc:mga0n895_44649_c1 | nmdc:mga0n895_44649_c1_2543_2905 | 113 |
| 717 | 3300050513 | nmdc:mga0rr50_182035_c1 | nmdc:mga0rr50_182035_c1_865_1227 | 113 |
| 718 | 3300053080 | Ga0500635_0204951 | Ga0500635_0204951_142_519 | 113 |
| 719 | 3300053086 | Ga0500578_0000363 | Ga0500578_0000363_22094_22459 | 113 |
| 720 | 3300053088 | Ga0500644_0010849 | Ga0500644_0010849_1204_1554 | 113 |
| 721 | 3300053089 | Ga0500581_301149 | Ga0500581_301149_255_605 | 113 |
| 722 | 3300053091 | Ga0500647_0386792 | Ga0500647_0386792_133_498 | 113 |
| 723 | 3300053093 | Ga0500651_0045174 | Ga0500651_0045174_638_988 | 113 |
| 724 | 3300053093 | Ga0500651_0319672 | Ga0500651_0319672_154_513 | 113 |
| 725 | 3300053097 | Ga0500648_120659 | Ga0500648_120659_485_847 | 113 |
| 726 | 3300053098 | Ga0500650_0199384 | Ga0500650_0199384_518_883 | 113 |
| 727 | 3300053108 | Ga0500562_033273 | Ga0500562_033273_598_978 | 113 |
| 728 | 3300053117 | Ga0500593_000526 | Ga0500593_000526_10116_10478 | 113 |
| 729 | 3300053118 | Ga0500594_0004214 | Ga0500594_0004214_35_385 | 113 |
| 730 | 3300053118 | Ga0500594_0318097 | Ga0500594_0318097_132_512 | 113 |
| 731 | 3300053120 | Ga0500597_335690 | Ga0500597_335690_161_541 | 113 |
| 732 | 3300053133 | Ga0500655_018956 | Ga0500655_018956_376_726 | 113 |
| 733 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_98518_98868 | 113 |
| 734 | 3300053138 | Ga0500564_199644 | Ga0500564_199644_216_566 | 113 |
| 735 | 3300053139 | Ga0500568_0064970 | Ga0500568_0064970_511_891 | 113 |
| 736 | 3300053139 | Ga0500568_0185956 | Ga0500568_0185956_107_457 | 113 |
| 737 | 3300053151 | Ga0500604_0018787 | Ga0500604_0018787_529_879 | 113 |
| 738 | 3300053151 | Ga0500604_0028615 | Ga0500604_0028615_823_1200 | 113 |
| 739 | 3300053153 | Ga0500616_0264849 | Ga0500616_0264849_367_717 | 113 |
| 740 | 3300053154 | Ga0500619_000171 | Ga0500619_000171_9895_10266 | 113 |
| 741 | 3300053154 | Ga0500619_048118 | Ga0500619_048118_28_378 | 113 |
| 742 | 3300053156 | Ga0500622_0003170 | Ga0500622_0003170_2763_3113 | 113 |
| 743 | 3300053156 | Ga0500622_0206699 | Ga0500622_0206699_126_506 | 113 |
| 744 | 3300053160 | Ga0500633_0246116 | Ga0500633_0246116_288_638 | 113 |
| 745 | 3300053177 | Ga0500636_0250282 | Ga0500636_0250282_19_399 | 113 |
| 746 | 3300053736 | Ga0500599_054603 | Ga0500599_054603_243_593 | 113 |
| 747 | 3300053739 | Ga0500587_006746 | Ga0500587_006746_432_782 | 113 |
| 748 | 3300059426 | Ga0590077_062339 | Ga0590077_062339_114_494 | 113 |
| 749 | iso_pu_bacteria | 2585428057 | 2587724929 | 113 |
| 750 | iso_pu_bacteria | 2588253510 | 2588292431 | 113 |
| 751 | iso_pu_bacteria | 2643221592 | 2643968189 | 113 |
| 752 | iso_pu_bacteria | 2643221625 | 2644142455 | 113 |
| 753 | iso_pu_bacteria | 2643221648 | 2644277046 | 113 |
| 754 | 3300002077 | JGI24744J21845_10006631 | JGI24744J21845_100066314 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cpq-assembly1.cif.gz_A | cytochrome c' from rhodopseudomonas capsulata | 0.9796 | 35 | 77 |
| 4ulv-assembly1.cif.gz_B | cytochrome c prime from shewanella frigidimarina | 0.968 | 35 | 76 |
| 3vrc-assembly1.cif.gz_B | crystal structure of cytochrome c' from thermochromatium tepidum | 0.9664 | 37 | 76 |
| 2a7w-assembly1.cif.gz_A | crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7 | 0.9663 | 5 | 93 |
| 1bbh-assembly1.cif.gz_A | atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution | 0.9552 | 37 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MSJ4_110_274_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.9764 | 37 | 78 | 3.90.1600.10 |
| 2a7wA00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like | 0.9595 | 5 | 93 | 1.10.287.1080 |
| af_Q54P12_52_173_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.9558 | 37 | 74 | 1.20.120.230 |
| 1bbhA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9552 | 37 | 77 | 1.20.120.10 |
| 1z0jB00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9503 | 35 | 79 | 4.10.860.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536V468-F1-model_v4 | phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.9941 | 1 | 95 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A536WTV4-F1-model_v4 | phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) | 0.985 | 6 | 102 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A126R805-F1-model_v4 | Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) | 0.9827 | 2 | 102 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A7Y5DLF5-F1-model_v4 | Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) | 0.9814 | 5 | 102 |
GO:0000105
GO:0004636 GO:0005524 GO:0005737 |
| AF-A0A2D6H5Q3-F1-model_v4 | deleted | 0.9804 | 5 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar