F479261

General Info

Members Datasets Scaffolds Average Seq Length
754 334 748 119

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0167972|Ga0395905_0167972_577_948
Length 123
Sequence VNNDKTPNDSLAQLAAVIESRKAGDPDQSYVARLLKMGPDAILKKVGEEAGEVIMAAKDAQYGGDRQRIVSEVADLWFHCMIALSHFGLGPRDVIAELEQRAGTSGIEEKALRKARKREDGGA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
4 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
5 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
6 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
98 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
229 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
296 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
297 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
298 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
299 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
300 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
316 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
317 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
320 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
321 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
333 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.13
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0
Rhizoplane 4.77
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10006631 3300002077 Bacteria 2399
2 JGI25152J39213_1001224 3300002773 Bacteria 11749
3 JGI25152J39213_1001251 3300002773 Bacteria 11566
4 JGI25152J39213_1001299 3300002773 Bacteria 11168
5 JGI25150J39212_1005235 3300002774 Bacteria 2792
6 JGI25153J46596_10002653 3300003215 Bacteria 10222
7 JGI25153J46596_10004183 3300003215 Bacteria 7828
8 Ga0006777J48905_1047703 3300003308 Bacteria 1412
9 Ga0055526_1002262 3300003771 Bacteria 13160
10 Ga0055530_10009773 3300003791 Bacteria 3632
11 Ga0065165_1001456 3300005262 Bacteria 25564
12 Ga0065707_10220135 3300005295 Bacteria 1228
13 Ga0070658_10551114 3300005327 Bacteria 998
14 Ga0070658_10678651 3300005327 Bacteria 894
15 Ga0070676_10021332 3300005328 Bacteria 3626
16 Ga0070676_10034097 3300005328 Bacteria 2922
17 Ga0070676_10056576 3300005328 Bacteria 2318
18 Ga0070683_100252217 3300005329 Bacteria 1678
19 Ga0070683_100403035 3300005329 Bacteria 1304
20 Ga0070690_100020420 3300005330 Bacteria 4035
21 Ga0070690_100645339 3300005330 Bacteria 808
22 Ga0070690_100728401 3300005330 Bacteria 764
23 Ga0070670_100001787 3300005331 Bacteria 17505
24 Ga0070670_100096015 3300005331 Bacteria 2550
25 Ga0070670_100168819 3300005331 Bacteria 1897
26 Ga0070670_100655440 3300005331 Bacteria 942
27 Ga0070677_10039217 3300005333 Bacteria 1858
28 Ga0070677_10067530 3300005333 Bacteria 1494
29 Ga0070677_10344192 3300005333 Bacteria 770
30 Ga0068869_100006465 3300005334 Bacteria 7436
31 Ga0068869_100009400 3300005334 Bacteria 6343
32 Ga0068869_100090154 3300005334 Bacteria 2304
33 Ga0068869_100804787 3300005334 Bacteria 808
34 Ga0070666_10006757 3300005335 Bacteria 7065
35 Ga0070666_10197154 3300005335 Bacteria 1416
36 Ga0070666_10486118 3300005335 Bacteria 894
37 Ga0070682_100600912 3300005337 Bacteria 869
38 Ga0070682_101627522 3300005337 Bacteria 559
39 Ga0068868_100000966 3300005338 Bacteria 19576
40 Ga0068868_100032419 3300005338 Bacteria 4019
41 Ga0068868_100073841 3300005338 Bacteria 2724
42 Ga0068868_100229637 3300005338 Bacteria 1556
43 Ga0068868_100361051 3300005338 Bacteria 1246
44 Ga0068868_101568063 3300005338 Bacteria 618
45 Ga0070660_100102149 3300005339 Bacteria 2272
46 Ga0070689_100175898 3300005340 Bacteria 1736
47 Ga0070689_102109219 3300005340 Bacteria 516
48 Ga0070687_100781062 3300005343 Bacteria 675
49 Ga0070687_101207084 3300005343 Bacteria 558
50 Ga0070661_100108802 3300005344 Bacteria 2068
51 Ga0070661_100156321 3300005344 Bacteria 1725
52 Ga0070692_10262472 3300005345 Bacteria 1039
53 Ga0070668_100036969 3300005347 Bacteria 3727
54 Ga0070668_100137109 3300005347 Bacteria 1969
55 Ga0070668_100173369 3300005347 Bacteria 1757
56 Ga0070669_100088090 3300005353 Bacteria 2323
57 Ga0070669_100101683 3300005353 Bacteria 2169
58 Ga0070669_100382001 3300005353 Bacteria 1149
59 Ga0070669_100395680 3300005353 Bacteria 1129
60 Ga0070669_101338456 3300005353 Bacteria 621
61 Ga0070675_100008036 3300005354 Bacteria 8179
62 Ga0070675_100061241 3300005354 Bacteria 3107
63 Ga0070675_100062673 3300005354 Bacteria 3072
64 Ga0070675_100080667 3300005354 Bacteria 2712
65 Ga0070671_100011057 3300005355 Bacteria 7245
66 Ga0070671_100160588 3300005355 Bacteria 1900
67 Ga0070671_100208222 3300005355 Bacteria 1658
68 Ga0070671_100323786 3300005355 Bacteria 1314
69 Ga0070671_102113961 3300005355 Bacteria 502
70 Ga0070674_100094896 3300005356 Bacteria 2161
71 Ga0070674_100102944 3300005356 Bacteria 2083
72 Ga0070674_100348681 3300005356 Bacteria 1195
73 Ga0070674_101050108 3300005356 Bacteria 717
74 Ga0070674_101090703 3300005356 Bacteria 704
75 Ga0070673_100019930 3300005364 Bacteria 4827
76 Ga0070673_100050040 3300005364 Bacteria 3265
77 Ga0070673_100118826 3300005364 Bacteria 2201
78 Ga0070673_100244226 3300005364 Bacteria 1562
79 Ga0070673_100495865 3300005364 Bacteria 1104
80 Ga0070688_100072638 3300005365 Bacteria 2205
81 Ga0070688_101379380 3300005365 Bacteria 571
82 Ga0070659_100043932 3300005366 Bacteria 3496
83 Ga0070659_101312441 3300005366 Bacteria 642
84 Ga0070667_100023158 3300005367 Bacteria 5151
85 Ga0070667_100081424 3300005367 Bacteria 2770
86 Ga0070667_100099658 3300005367 Bacteria 2508
87 Ga0070667_100192145 3300005367 Bacteria 1809
88 Ga0070667_100533439 3300005367 Bacteria 1078
89 Ga0070667_100950070 3300005367 Bacteria 801
90 Ga0070700_100095800 3300005441 Bacteria 1946
91 Ga0070700_100973609 3300005441 Bacteria 696
92 Ga0070663_100001375 3300005455 Bacteria 13329
93 Ga0070663_100273872 3300005455 Bacteria 1343
94 Ga0070663_102104065 3300005455 Bacteria 509
95 Ga0070678_100006239 3300005456 Bacteria 6975
96 Ga0070678_100077866 3300005456 Bacteria 2502
97 Ga0070678_101352439 3300005456 Bacteria 664
98 Ga0070662_100017313 3300005457 Bacteria 4857
99 Ga0070662_100034193 3300005457 Bacteria 3583
100 Ga0070662_100947686 3300005457 Bacteria 736
101 Ga0070662_101424447 3300005457 Bacteria 597
102 Ga0070681_10176293 3300005458 Bacteria 2060
103 Ga0070681_10628428 3300005458 Bacteria 988
104 Ga0068867_100005640 3300005459 Bacteria 8872
105 Ga0068867_100011669 3300005459 Bacteria 6206
106 Ga0068867_100049124 3300005459 Bacteria 3105
107 Ga0070685_10296691 3300005466 Bacteria 1088
108 Ga0070685_10367513 3300005466 Bacteria 988
109 Ga0070707_100985463 3300005468 Bacteria 808
110 Ga0070699_102152406 3300005518 Bacteria 509
111 Ga0070679_100108254 3300005530 Bacteria 2765
112 Ga0070679_101489044 3300005530 Bacteria 624
113 Ga0070684_100031515 3300005535 Bacteria 4514
114 Ga0070684_100468989 3300005535 Bacteria 1164
115 Ga0070684_101008342 3300005535 Bacteria 781
116 Ga0068853_100077580 3300005539 Bacteria 2902
117 Ga0068853_101845419 3300005539 Bacteria 586
118 Ga0070672_100007718 3300005543 Bacteria 7327
119 Ga0070672_100013592 3300005543 Bacteria 5757
120 Ga0070672_100021973 3300005543 Bacteria 4677
121 Ga0070672_100036721 3300005543 Bacteria 3734
122 Ga0070672_100042843 3300005543 Bacteria 3486
123 Ga0070672_100149059 3300005543 Bacteria 1934
124 Ga0070686_100452954 3300005544 Bacteria 987
125 Ga0070686_100702272 3300005544 Bacteria 807
126 Ga0070693_100079478 3300005547 Bacteria 1952
127 Ga0070693_100952951 3300005547 Bacteria 646
128 Ga0070693_100988821 3300005547 Bacteria 636
129 Ga0070665_100015286 3300005548 Bacteria 7706
130 Ga0070665_100163978 3300005548 Bacteria 2225
131 Ga0070665_100523187 3300005548 Bacteria 1198
132 Ga0070665_100656324 3300005548 Bacteria 1062
133 Ga0070704_100581445 3300005549 Bacteria 982
134 Ga0070664_100112711 3300005564 Bacteria 2375
135 Ga0070664_100240697 3300005564 Bacteria 1624
136 Ga0070664_101111116 3300005564 Bacteria 745
137 Ga0068857_100241040 3300005577 Bacteria 1655
138 Ga0068857_100285172 3300005577 Bacteria 1520
139 Ga0068857_100354262 3300005577 Bacteria 1359
140 Ga0068857_101673816 3300005577 Bacteria 622
141 Ga0068854_100436926 3300005578 Bacteria 1090
142 Ga0068854_100499553 3300005578 Bacteria 1024
143 Ga0068856_100007776 3300005614 Bacteria 10473
144 Ga0068856_100200434 3300005614 Bacteria 2010
145 Ga0070702_100261656 3300005615 Bacteria 1178
146 Ga0070702_100410075 3300005615 Bacteria 972
147 Ga0068852_100005075 3300005616 Bacteria 9367
148 Ga0068852_100030245 3300005616 Bacteria 4456
149 Ga0068852_100256445 3300005616 Bacteria 1677
150 Ga0068852_100707440 3300005616 Bacteria 1018
151 Ga0068852_100709170 3300005616 Bacteria 1016
152 Ga0068852_101023768 3300005616 Bacteria 845
153 Ga0068859_100019167 3300005617 Bacteria 6872
154 Ga0068859_100594680 3300005617 Bacteria 1200
155 Ga0068859_101511878 3300005617 Bacteria 741
156 Ga0068864_100002065 3300005618 Bacteria 16597
157 Ga0068864_100013594 3300005618 Bacteria 6748
158 Ga0068864_100035249 3300005618 Bacteria 4259
159 Ga0068864_100072290 3300005618 Bacteria 3005
160 Ga0068866_10003257 3300005718 Bacteria 6683
161 Ga0068866_10569852 3300005718 Bacteria 760
162 Ga0068866_10725864 3300005718 Bacteria 684
163 Ga0068861_100052430 3300005719 Bacteria 3100
164 Ga0068861_100236372 3300005719 Bacteria 1552
165 Ga0068861_100510359 3300005719 Bacteria 1088
166 Ga0068851_10071766 3300005834 Bacteria 1792
167 Ga0068851_10102633 3300005834 Bacteria 1519
168 Ga0068851_10261466 3300005834 Bacteria 984
169 Ga0068851_10489408 3300005834 Bacteria 736
170 Ga0068870_11362289 3300005840 Bacteria 519
171 Ga0068863_100017036 3300005841 Bacteria 6968
172 Ga0068863_100020937 3300005841 Bacteria 6246
173 Ga0068863_100059870 3300005841 Bacteria 3603
174 Ga0068863_100085478 3300005841 Bacteria 2989
175 Ga0068863_100248762 3300005841 Bacteria 1717
176 Ga0068858_100015823 3300005842 Bacteria 7091
177 Ga0068858_100039082 3300005842 Bacteria 4402
178 Ga0068858_100061093 3300005842 Bacteria 3483
179 Ga0068858_100319144 3300005842 Bacteria 1484
180 Ga0068858_100936021 3300005842 Bacteria 848
181 Ga0068858_101711269 3300005842 Bacteria 621
182 Ga0068860_100000823 3300005843 Bacteria 34706
183 Ga0068860_100022795 3300005843 Bacteria 6055
184 Ga0068860_100139445 3300005843 Bacteria 2330
185 Ga0068860_100975716 3300005843 Bacteria 865
186 Ga0068860_101476549 3300005843 Bacteria 701
187 Ga0068860_101949740 3300005843 Bacteria 609
188 Ga0068862_100020457 3300005844 Bacteria 5529
189 Ga0068862_100074012 3300005844 Bacteria 2944
190 Ga0068862_100155446 3300005844 Bacteria 2038
191 Ga0068862_100303293 3300005844 Bacteria 1470
192 Ga0075363_100362819 3300006048 Bacteria 847
193 Ga0075366_10010581 3300006195 Bacteria 5179
194 Ga0075366_10031527 3300006195 Bacteria 3120
195 Ga0075366_10055381 3300006195 Bacteria 2355
196 Ga0075366_10146543 3300006195 Bacteria 1429
197 Ga0075366_10224405 3300006195 Bacteria 1145
198 Ga0075366_10501107 3300006195 Bacteria 751
199 Ga0097621_100047919 3300006237 Bacteria 3464
200 Ga0097621_100081780 3300006237 Bacteria 2689
201 Ga0097621_100144783 3300006237 Bacteria 2033
202 Ga0097621_100205376 3300006237 Bacteria 1712
203 Ga0097621_100501400 3300006237 Bacteria 1099
204 Ga0075370_10028805 3300006353 Bacteria 3090
205 Ga0075370_10040124 3300006353 Bacteria 2640
206 Ga0075370_10195814 3300006353 Bacteria 1192
207 Ga0068871_100041620 3300006358 Bacteria 3684
208 Ga0068871_100071350 3300006358 Bacteria 2856
209 Ga0068871_100143639 3300006358 Bacteria 2031
210 Ga0068871_100582458 3300006358 Bacteria 1016
211 Ga0075434_100203918 3300006871 Bacteria 1998
212 Ga0068865_100027661 3300006881 Bacteria 3748
213 Ga0068865_100141331 3300006881 Bacteria 1815
214 Ga0068865_100241335 3300006881 Bacteria 1422
215 Ga0097620_100019167 3300006931 Bacteria 6872
216 Ga0097620_100594727 3300006931 Bacteria 1200
217 Ga0097620_101512653 3300006931 Bacteria 741
218 Ga0075435_100347657 3300007076 Bacteria 1271
219 Ga0105250_10087916 3300009092 Bacteria 1262
220 Ga0105240_10025030 3300009093 Bacteria 7857
221 Ga0105240_10646029 3300009093 Bacteria 1160
222 Ga0105240_11241366 3300009093 Bacteria 788
223 Ga0111539_12021008 3300009094 Bacteria 668
224 Ga0105245_10085160 3300009098 Bacteria 2897
225 Ga0105245_10290168 3300009098 Bacteria 1602
226 Ga0105245_10381366 3300009098 Bacteria 1404
227 Ga0105247_11386081 3300009101 Bacteria 568
228 Ga0114129_12679103 3300009147 Bacteria 594
229 Ga0105243_10011388 3300009148 Bacteria 6730
230 Ga0105243_10206614 3300009148 Bacteria 1726
231 Ga0105243_10587883 3300009148 Bacteria 1070
232 Ga0105243_10847446 3300009148 Bacteria 905
233 Ga0105243_11192326 3300009148 Bacteria 774
234 Ga0105243_12547590 3300009148 Bacteria 551
235 Ga0105241_10327317 3300009174 Bacteria 1323
236 Ga0105241_11754658 3300009174 Bacteria 604
237 Ga0105242_10260803 3300009176 Bacteria 1565
238 Ga0105248_10040305 3300009177 Bacteria 5235
239 Ga0105248_10074832 3300009177 Bacteria 3806
240 Ga0105248_10360699 3300009177 Bacteria 1636
241 Ga0105248_10388190 3300009177 Bacteria 1572
242 Ga0105248_10423779 3300009177 Bacteria 1499
243 Ga0105237_10007447 3300009545 Bacteria 11978
244 Ga0105237_10098355 3300009545 Bacteria 2917
245 Ga0105237_10191070 3300009545 Bacteria 2048
246 Ga0105237_11401836 3300009545 Bacteria 705
247 Ga0105238_10005477 3300009551 Bacteria 12552
248 Ga0105238_10053451 3300009551 Bacteria 4059
249 Ga0105238_10959206 3300009551 Bacteria 875
250 Ga0105238_11614897 3300009551 Bacteria 678
251 Ga0105249_10023493 3300009553 Bacteria 5532
252 Ga0105249_10315700 3300009553 Bacteria 1572
253 Ga0105249_10636261 3300009553 Bacteria 1124
254 Ga0105249_11483979 3300009553 Bacteria 750
255 Ga0105249_12699000 3300009553 Bacteria 569
256 Ga0105239_10010780 3300010375 Bacteria 10211
257 Ga0105239_10114929 3300010375 Bacteria 2985
258 Ga0105239_12771490 3300010375 Bacteria 572
259 Ga0105246_11004708 3300011119 Bacteria 755
260 Ga0157323_1045220 3300012495 Bacteria 518
261 Ga0157316_1071264 3300012510 Bacteria 525
262 Ga0157327_1003137 3300012512 Bacteria 1198
263 Ga0157373_10108192 3300013100 Bacteria 1955
264 Ga0157371_10107101 3300013102 Bacteria 1984
265 Ga0157369_10083325 3300013105 Bacteria 3421
266 Ga0157369_10243757 3300013105 Bacteria 1877
267 Ga0157374_10047942 3300013296 Bacteria 3963
268 Ga0157374_10084070 3300013296 Bacteria 3025
269 Ga0157374_10570997 3300013296 Bacteria 1140
270 Ga0157374_10733648 3300013296 Bacteria 1002
271 Ga0157374_10903417 3300013296 Bacteria 901
272 Ga0157378_10001703 3300013297 Bacteria 19776
273 Ga0157378_10107143 3300013297 Bacteria 2557
274 Ga0157378_10606877 3300013297 Bacteria 1106
275 Ga0163162_10002252 3300013306 Bacteria 18114
276 Ga0163162_10011131 3300013306 Bacteria 8762
277 Ga0163162_10181411 3300013306 Bacteria 2231
278 Ga0163162_10205553 3300013306 Bacteria 2098
279 Ga0163162_10327514 3300013306 Bacteria 1664
280 Ga0163162_10332792 3300013306 Bacteria 1651
281 Ga0163162_10352505 3300013306 Bacteria 1604
282 Ga0163162_11136810 3300013306 Bacteria 885
283 Ga0157372_10076894 3300013307 Bacteria 3769
284 Ga0157372_10188338 3300013307 Bacteria 2390
285 Ga0157375_10048298 3300013308 Bacteria 4162
286 Ga0157375_10151456 3300013308 Bacteria 2455
287 Ga0157375_10192035 3300013308 Bacteria 2197
288 Ga0157375_10528887 3300013308 Bacteria 1342
289 Ga0157375_10572082 3300013308 Bacteria 1290
290 Ga0157375_10707123 3300013308 Bacteria 1161
291 Ga0157375_11341169 3300013308 Bacteria 842
292 Ga0163163_10009458 3300014325 Bacteria 8703
293 Ga0157380_10040311 3300014326 Bacteria 3637
294 Ga0157380_10258605 3300014326 Bacteria 1580
295 Ga0157380_12906071 3300014326 Bacteria 545
296 Ga0182008_10248962 3300014497 Bacteria 916
297 Ga0157377_10000032 3300014745 Bacteria 121003
298 Ga0157379_10013272 3300014968 Bacteria 7215
299 Ga0157379_10069128 3300014968 Bacteria 3158
300 Ga0157379_10120153 3300014968 Bacteria 2363
301 Ga0157379_10176376 3300014968 Bacteria 1930
302 Ga0157379_10276440 3300014968 Bacteria 1528
303 Ga0157379_10858909 3300014968 Bacteria 859
304 Ga0157379_11074407 3300014968 Bacteria 770
305 Ga0157376_10098430 3300014969 Bacteria 2550
306 Ga0157376_10115161 3300014969 Bacteria 2373
307 Ga0157376_10115243 3300014969 Bacteria 2372
308 Ga0157376_10176155 3300014969 Bacteria 1951
309 Ga0157376_10543407 3300014969 Bacteria 1149
310 Ga0157376_11459910 3300014969 Bacteria 716
311 Ga0182007_10115543 3300015262 Bacteria 895
312 Ga0163161_10076960 3300017792 Bacteria 2450
313 Ga0163161_10079358 3300017792 Bacteria 2413
314 Ga0163161_10462343 3300017792 Bacteria 1027
315 Ga0213876_10030362 3300021384 Bacteria 2851
316 Ga0209674_113403 3300025226 Bacteria 763
317 Ga0209563_100013 3300025230 Bacteria 941463
318 Ga0207425_1001237 3300025245 Bacteria 11199
319 Ga0209129_1000027 3300025258 Bacteria 409587
320 Ga0209673_1010832 3300025273 Bacteria 3810
321 Ga0209673_1065425 3300025273 Bacteria 888
322 Ga0209564_1000139 3300025295 Bacteria 180328
323 Ga0209758_1000281 3300025297 Bacteria 100826
324 Ga0209758_1000310 3300025297 Bacteria 94307
325 Ga0209050_1000303 3300025298 Bacteria 101498
326 Ga0209051_1013169 3300025303 Bacteria 3951
327 Ga0209257_1006026 3300025304 Bacteria 8101
328 Ga0209257_1088606 3300025304 Bacteria 778
329 Ga0207697_10145728 3300025315 Bacteria 1029
330 Ga0207697_10163381 3300025315 Bacteria 972
331 Ga0207656_10030997 3300025321 Bacteria 2212
332 Ga0207656_10031008 3300025321 Bacteria 2211
333 Ga0207656_10377168 3300025321 Bacteria 711
334 Ga0207696_1085435 3300025711 Bacteria 868
335 Ga0207682_10023185 3300025893 Bacteria 2450
336 Ga0207682_10111417 3300025893 Bacteria 1205
337 Ga0207682_10114272 3300025893 Bacteria 1191
338 Ga0207642_10012685 3300025899 Bacteria 3051
339 Ga0207680_10002140 3300025903 Bacteria 9255
340 Ga0207647_10136054 3300025904 Bacteria 1442
341 Ga0207645_10023242 3300025907 Bacteria 4029
342 Ga0207645_10063446 3300025907 Bacteria 2361
343 Ga0207645_10113574 3300025907 Bacteria 1755
344 Ga0207643_10837842 3300025908 Bacteria 596
345 Ga0207705_10344261 3300025909 Bacteria 1148
346 Ga0207654_10354674 3300025911 Bacteria 1011
347 Ga0207654_11328800 3300025911 Bacteria 524
348 Ga0207695_10009980 3300025913 Bacteria 11666
349 Ga0207695_10736876 3300025913 Bacteria 866
350 Ga0207671_10008972 3300025914 Bacteria 8414
351 Ga0207671_10113852 3300025914 Bacteria 2061
352 Ga0207671_10153863 3300025914 Bacteria 1778
353 Ga0207660_10145784 3300025917 Bacteria 1814
354 Ga0207662_10721860 3300025918 Bacteria 699
355 Ga0207649_10070050 3300025920 Bacteria 2235
356 Ga0207649_10412864 3300025920 Bacteria 1012
357 Ga0207652_10030048 3300025921 Bacteria 4548
358 Ga0207681_10016930 3300025923 Bacteria 4570
359 Ga0207681_10081625 3300025923 Bacteria 2283
360 Ga0207681_10248638 3300025923 Bacteria 1387
361 Ga0207681_10287302 3300025923 Bacteria 1297
362 Ga0207681_10331005 3300025923 Bacteria 1214
363 Ga0207681_10636469 3300025923 Bacteria 883
364 Ga0207681_11005095 3300025923 Bacteria 700
365 Ga0207694_10149504 3300025924 Bacteria 1881
366 Ga0207694_11149245 3300025924 Bacteria 657
367 Ga0207650_10072993 3300025925 Bacteria 2584
368 Ga0207650_10169482 3300025925 Bacteria 1735
369 Ga0207650_10240084 3300025925 Bacteria 1464
370 Ga0207659_10020943 3300025926 Bacteria 4331
371 Ga0207659_10024900 3300025926 Bacteria 4016
372 Ga0207659_10090445 3300025926 Bacteria 2285
373 Ga0207659_10098365 3300025926 Bacteria 2200
374 Ga0207687_10102368 3300025927 Bacteria 2110
375 Ga0207687_10251793 3300025927 Bacteria 1404
376 Ga0207687_10266526 3300025927 Bacteria 1367
377 Ga0207644_10002654 3300025931 Bacteria 11522
378 Ga0207644_10220439 3300025931 Bacteria 1503
379 Ga0207644_10423984 3300025931 Bacteria 1090
380 Ga0207690_10112138 3300025932 Bacteria 1966
381 Ga0207690_10454509 3300025932 Bacteria 1030
382 Ga0207706_10013493 3300025933 Bacteria 7425
383 Ga0207706_10031863 3300025933 Bacteria 4696
384 Ga0207706_10388948 3300025933 Bacteria 1210
385 Ga0207709_10002313 3300025935 Bacteria 12063
386 Ga0207709_10063317 3300025935 Bacteria 2318
387 Ga0207709_10577994 3300025935 Bacteria 887
388 Ga0207670_10007649 3300025936 Bacteria 6048
389 Ga0207670_11561846 3300025936 Bacteria 561
390 Ga0207669_10259192 3300025937 Bacteria 1299
391 Ga0207669_10715248 3300025937 Bacteria 824
392 Ga0207704_10003689 3300025938 Bacteria 6966
393 Ga0207691_10004404 3300025940 Bacteria 13651
394 Ga0207691_10018804 3300025940 Bacteria 6544
395 Ga0207691_10019002 3300025940 Bacteria 6509
396 Ga0207691_10031019 3300025940 Bacteria 4992
397 Ga0207691_10039159 3300025940 Bacteria 4385
398 Ga0207691_10395526 3300025940 Bacteria 1179
399 Ga0207711_10048589 3300025941 Bacteria 3630
400 Ga0207711_10087324 3300025941 Bacteria 2736
401 Ga0207711_10195222 3300025941 Bacteria 1846
402 Ga0207711_10239440 3300025941 Bacteria 1664
403 Ga0207689_10014107 3300025942 Bacteria 6801
404 Ga0207689_10060014 3300025942 Bacteria 3128
405 Ga0207689_10116843 3300025942 Bacteria 2193
406 Ga0207661_10500212 3300025944 Bacteria 1110
407 Ga0207679_10008471 3300025945 Bacteria 6549
408 Ga0207679_11061976 3300025945 Bacteria 743
409 Ga0207667_10514752 3300025949 Bacteria 1213
410 Ga0207651_10004672 3300025960 Bacteria 6942
411 Ga0207651_10013837 3300025960 Bacteria 4634
412 Ga0207651_10032262 3300025960 Bacteria 3362
413 Ga0207712_10043080 3300025961 Bacteria 3112
414 Ga0207712_10284197 3300025961 Bacteria 1351
415 Ga0207668_10024415 3300025972 Bacteria 3901
416 Ga0207668_10121965 3300025972 Bacteria 1975
417 Ga0207668_10275890 3300025972 Bacteria 1376
418 Ga0207668_10570713 3300025972 Bacteria 982
419 Ga0207668_10971850 3300025972 Bacteria 758
420 Ga0207640_10155351 3300025981 Bacteria 1686
421 Ga0207640_10158498 3300025981 Bacteria 1671
422 Ga0207640_10443593 3300025981 Bacteria 1068
423 Ga0207640_11481529 3300025981 Bacteria 609
424 Ga0207658_10010175 3300025986 Bacteria 6393
425 Ga0207658_10020095 3300025986 Bacteria 4624
426 Ga0207658_10051018 3300025986 Bacteria 3047
427 Ga0207658_10062467 3300025986 Bacteria 2787
428 Ga0207658_10084433 3300025986 Bacteria 2443
429 Ga0207658_10223334 3300025986 Bacteria 1586
430 Ga0207658_10252241 3300025986 Bacteria 1500
431 Ga0207658_11639547 3300025986 Bacteria 588
432 Ga0207677_10001522 3300026023 Bacteria 12255
433 Ga0207677_10018664 3300026023 Bacteria 4167
434 Ga0207677_10156774 3300026023 Bacteria 1764
435 Ga0207677_10158317 3300026023 Bacteria 1756
436 Ga0207677_10336598 3300026023 Bacteria 1259
437 Ga0207703_10006009 3300026035 Bacteria 9719
438 Ga0207703_10026459 3300026035 Bacteria 4567
439 Ga0207703_10032964 3300026035 Bacteria 4103
440 Ga0207703_11171630 3300026035 Bacteria 739
441 Ga0207703_11290075 3300026035 Bacteria 702
442 Ga0207639_10099598 3300026041 Bacteria 2345
443 Ga0207639_10141624 3300026041 Bacteria 2004
444 Ga0207639_11765660 3300026041 Bacteria 579
445 Ga0207678_10016216 3300026067 Bacteria 6538
446 Ga0207678_10083543 3300026067 Bacteria 2731
447 Ga0207708_10153438 3300026075 Bacteria 1815
448 Ga0207708_10699366 3300026075 Bacteria 866
449 Ga0207702_10004429 3300026078 Bacteria 12481
450 Ga0207702_10335077 3300026078 Bacteria 1444
451 Ga0207641_10003329 3300026088 Bacteria 14294
452 Ga0207641_10079161 3300026088 Bacteria 2848
453 Ga0207641_10137677 3300026088 Bacteria 2199
454 Ga0207641_10452533 3300026088 Bacteria 1241
455 Ga0207641_10639320 3300026088 Bacteria 1044
456 Ga0207641_10715550 3300026088 Bacteria 987
457 Ga0207648_10000179 3300026089 Bacteria 66602
458 Ga0207648_10001296 3300026089 Bacteria 27908
459 Ga0207648_10010028 3300026089 Bacteria 9011
460 Ga0207648_10101337 3300026089 Bacteria 2524
461 Ga0207648_10325133 3300026089 Bacteria 1383
462 Ga0207648_10449942 3300026089 Bacteria 1173
463 Ga0207648_11271580 3300026089 Bacteria 691
464 Ga0207676_10002741 3300026095 Bacteria 12542
465 Ga0207676_10003295 3300026095 Bacteria 11473
466 Ga0207676_10044642 3300026095 Bacteria 3420
467 Ga0207676_10073876 3300026095 Bacteria 2745
468 Ga0207676_10904337 3300026095 Bacteria 866
469 Ga0207674_10008627 3300026116 Bacteria 11748
470 Ga0207674_10332208 3300026116 Bacteria 1470
471 Ga0207674_10446401 3300026116 Bacteria 1250
472 Ga0207675_100005391 3300026118 Bacteria 12258
473 Ga0207675_100060714 3300026118 Bacteria 3529
474 Ga0207675_100088572 3300026118 Bacteria 2908
475 Ga0207683_10148626 3300026121 Bacteria 2114
476 Ga0207683_10365924 3300026121 Bacteria 1324
477 Ga0207683_10673289 3300026121 Bacteria 959
478 Ga0207698_10009766 3300026142 Bacteria 6129
479 Ga0207698_10021332 3300026142 Bacteria 4477
480 Ga0207698_10051692 3300026142 Bacteria 3143
481 Ga0207698_10603936 3300026142 Bacteria 1082
482 Ga0207698_10687655 3300026142 Bacteria 1017
483 Ga0207698_10748657 3300026142 Bacteria 976
484 Ga0207698_11223306 3300026142 Bacteria 765
485 Ga0209179_1001677 3300027512 Bacteria 2800
486 Ga0268266_10045732 3300028379 Bacteria 3745
487 Ga0268266_10350275 3300028379 Bacteria 1388
488 Ga0268266_10368943 3300028379 Bacteria 1352
489 Ga0268265_10011328 3300028380 Bacteria 6031
490 Ga0268265_10026717 3300028380 Bacteria 4109
491 Ga0268265_10201146 3300028380 Bacteria 1728
492 Ga0268264_10000613 3300028381 Bacteria 42687
493 Ga0268264_10024923 3300028381 Bacteria 4888
494 Ga0268264_10572287 3300028381 Bacteria 1110
495 Ga0307517_10076041 3300028786 Bacteria 2937
496 Ga0307517_10184301 3300028786 Bacteria 1340
497 Ga0307517_10189474 3300028786 Bacteria 1309
498 Ga0307515_10000609 3300028794 Bacteria 83557
499 Ga0307515_10001693 3300028794 Bacteria 49203
500 Ga0307515_10003934 3300028794 Bacteria 31018
501 Ga0307515_10018282 3300028794 Bacteria 12704
502 Ga0307515_10044072 3300028794 Bacteria 6908
503 Ga0307515_10260267 3300028794 Bacteria 1472
504 Ga0307515_10472368 3300028794 Bacteria 867
505 Ga0307512_10121681 3300030522 Bacteria 1673
506 Ga0307512_10385555 3300030522 Bacteria 597
507 Ga0265330_10031672 3300031235 Bacteria 2370
508 Ga0265332_10076988 3300031238 Bacteria 1417
509 Ga0265328_10385106 3300031239 Bacteria 549
510 Ga0265339_10238007 3300031249 Bacteria 885
511 Ga0265316_10103655 3300031344 Bacteria 2160
512 Ga0307513_10114170 3300031456 Bacteria 2687
513 Ga0307513_10378910 3300031456 Bacteria 1155
514 Ga0307513_10392129 3300031456 Bacteria 1125
515 Ga0307513_10424194 3300031456 Bacteria 1059
516 Ga0307509_10000991 3300031507 Bacteria 48763
517 Ga0307509_10040089 3300031507 Bacteria 5095
518 Ga0307509_10058903 3300031507 Bacteria 4065
519 Ga0307509_10106381 3300031507 Bacteria 2824
520 Ga0307509_10142847 3300031507 Bacteria 2325
521 Ga0307509_10212595 3300031507 Bacteria 1757
522 Ga0307509_10420658 3300031507 Bacteria 1037
523 Ga0307509_10646017 3300031507 Bacteria 727
524 Ga0307509_10689182 3300031507 Bacteria 689
525 Ga0307509_10780701 3300031507 Bacteria 620
526 Ga0307509_10891337 3300031507 Bacteria 554
527 Ga0307509_11007268 3300031507 Bacteria 500
528 Ga0307408_100046772 3300031548 Bacteria 3096
529 Ga0307408_100311467 3300031548 Bacteria 1323
530 Ga0307408_101356986 3300031548 Bacteria 668
531 Ga0307508_10000404 3300031616 Bacteria 51734
532 Ga0307508_10005736 3300031616 Bacteria 11754
533 Ga0307508_10011564 3300031616 Bacteria 8064
534 Ga0307508_10349404 3300031616 Bacteria 1070
535 Ga0307514_10053594 3300031649 Bacteria 3112
536 Ga0307514_10058422 3300031649 Bacteria 2950
537 Ga0307514_10149542 3300031649 Bacteria 1570
538 Ga0307514_10394112 3300031649 Bacteria 711
539 Ga0265314_10006203 3300031711 Bacteria 10617
540 Ga0265342_10060778 3300031712 Bacteria 2227
541 Ga0307516_10009071 3300031730 Bacteria 11141
542 Ga0307516_10237732 3300031730 Bacteria 1522
543 Ga0307516_10370119 3300031730 Bacteria 1096
544 Ga0307405_10006962 3300031731 Bacteria 5616
545 Ga0307413_10263992 3300031824 Bacteria 1285
546 Ga0307518_10047827 3300031838 Bacteria 3110
547 Ga0307410_10916573 3300031852 Bacteria 751
548 Ga0307406_10114919 3300031901 Bacteria 1860
549 Ga0307406_10712935 3300031901 Bacteria 839
550 Ga0307407_10907830 3300031903 Bacteria 676
551 Ga0307412_10024007 3300031911 Bacteria 3760
552 Ga0307412_10277509 3300031911 Bacteria 1314
553 Ga0307409_100000580 3300031995 Bacteria 15944
554 Ga0307409_102811226 3300031995 Bacteria 514
555 Ga0307416_100014097 3300032002 Bacteria 5460
556 Ga0307416_100236784 3300032002 Bacteria 1765
557 Ga0307416_100291949 3300032002 Bacteria 1615
558 Ga0307416_101955761 3300032002 Bacteria 689
559 Ga0307411_10351244 3300032005 Bacteria 1202
560 Ga0307411_10521007 3300032005 Bacteria 1009
561 Ga0307411_10738275 3300032005 Bacteria 861
562 Ga0307415_100002051 3300032126 Bacteria 9953
563 Ga0307507_10038483 3300033179 Bacteria 4847
564 Ga0307507_10050992 3300033179 Bacteria 3988
565 Ga0307507_10161529 3300033179 Bacteria 1654
566 Ga0307510_10003212 3300033180 Bacteria 19002
567 Ga0307510_10059995 3300033180 Bacteria 3920
568 Ga0307510_10131040 3300033180 Bacteria 2180
569 Ga0307510_10135291 3300033180 Bacteria 2124
570 Ga0373944_0194926 3300035089 Bacteria 731
571 Ga0373932_0019983 3300035112 Bacteria 1751
572 Ga0373955_0309537 3300035172 Bacteria 953
573 Ga0373961_0378091 3300035241 Bacteria 539
574 Ga0373924_0172895 3300035410 Bacteria 950
575 Ga0373931_0001378 3300035691 Bacteria 10389
576 Ga0373927_0064689 3300035695 Bacteria 2366
577 Ga0373937_0321803 3300036401 Bacteria 1463
578 Ga0373937_1086171 3300036401 Bacteria 749
579 Ga0373925_0132974 3300037068 Bacteria 1941
580 Ga0373925_0552801 3300037068 Bacteria 947
581 Ga0395905_0023956 3300037471 Bacteria 5763
582 Ga0395905_0167972 3300037471 Bacteria 2061
583 Ga0395905_0601971 3300037471 Bacteria 1001
584 Ga0436365_1640203 3300039437 Bacteria 3024
585 Ga0436361_1177655 3300039447 Bacteria 803
586 Ga0436363_1475448 3300039450 Bacteria 1005
587 Ga0451787_580127 3300041441 Bacteria 930
588 Ga0451789_0198671 3300041443 Bacteria 1635
589 Ga0451793_0018596 3300041452 Bacteria 1636
590 Ga0451793_1009547 3300041452 Bacteria 541
591 Ga0451797_0220704 3300041453 Bacteria 630
592 Ga0451800_1641012 3300041459 Bacteria 605
593 Ga0451802_2074907 3300041460 Bacteria 554
594 Ga0451807_1825296 3300041486 Bacteria 950
595 Ga0451833_1469414 3300041491 Bacteria 633
596 Ga0451845_0977099 3300041501 Bacteria 660
597 Ga0451843_0870225 3300041509 Bacteria 508
598 Ga0451853_0327863 3300041512 Bacteria 611
599 Ga0451853_0350852 3300041512 Bacteria 1424
600 Ga0451853_3674141 3300041512 Bacteria 873
601 Ga0439449_0343875 3300042007 Bacteria 564
602 Ga0439456_144950 3300042013 Bacteria 552
603 Ga0450896_022249 3300042133 Bacteria 934
604 Ga0439459_0014586 3300042438 Bacteria 1430
605 Ga0439460_0175468 3300042461 Bacteria 723
606 Ga0450893_0034880 3300042532 Bacteria 907
607 Ga0451577_0004221 3300042876 Bacteria 15320
608 Ga0451577_0004741 3300042876 Bacteria 14236
609 Ga0451577_0020267 3300042876 Bacteria 6105
610 Ga0451577_0057615 3300042876 Bacteria 3463
611 Ga0451577_0186853 3300042876 Bacteria 1869
612 Ga0451577_0401658 3300042876 Bacteria 1244
613 Ga0451577_0733135 3300042876 Bacteria 894
614 Ga0453683_0092672 3300044673 Bacteria 1894
615 Ga0453683_0134334 3300044673 Bacteria 1560
616 Ga0453684_0005216 3300044712 Bacteria 26063
617 Ga0453684_0244278 3300044712 Bacteria 2065
618 Ga0453684_0251708 3300044712 Bacteria 2028
619 Ga0453684_0384845 3300044712 Bacteria 1574
620 Ga0451576_0017940 3300045051 Bacteria 7769
621 Ga0451576_0062948 3300045051 Bacteria 3867
622 Ga0451576_2164302 3300045051 Bacteria 571
623 Ga0495592_0000083 3300046454 Bacteria 83092
624 Ga0495629_0311784 3300046459 Bacteria 1076
625 Ga0495629_0365673 3300046459 Bacteria 983
626 Ga0495638_0111579 3300046460 Bacteria 1624
627 Ga0495650_0145821 3300046471 Bacteria 853
628 Ga0495580_0018628 3300046472 Bacteria 5167
629 Ga0495639_0142511 3300046475 Bacteria 1153
630 Ga0495606_0461145 3300046507 Bacteria 649
631 Ga0495618_0656644 3300046514 Bacteria 620
632 Ga0495631_0051252 3300046518 Bacteria 1804
633 Ga0495632_0168428 3300046519 Bacteria 1007
634 Ga0495632_0283575 3300046519 Bacteria 737
635 Ga0495648_0139642 3300046524 Bacteria 1277
636 Ga0495648_0271303 3300046524 Bacteria 809
637 Ga0495648_0283877 3300046524 Bacteria 783
638 Ga0495598_0072198 3300046537 Bacteria 1089
639 Ga0495621_0024915 3300046539 Bacteria 2004
640 Ga0495645_0538572 3300046543 Bacteria 725
641 Ga0495668_0087108 3300046616 Bacteria 1713
642 Ga0495625_0009747 3300046660 Bacteria 7995
643 Ga0495625_0108748 3300046660 Bacteria 1897
644 Ga0495646_0064363 3300046680 Bacteria 2174
645 Ga0495658_0178716 3300046683 Bacteria 1316
646 Ga0495658_0347228 3300046683 Bacteria 943
647 Ga0495613_0386887 3300046689 Bacteria 956
648 Ga0495624_0016323 3300046690 Bacteria 4998
649 Ga0495670_0045101 3300046691 Bacteria 2201
650 Ga0495671_0028003 3300046692 Bacteria 2906
651 Ga0495671_0118049 3300046692 Bacteria 1295
652 Ga0495600_0706943 3300046809 Bacteria 606
653 Ga0495581_0455107 3300047315 Bacteria 745
654 Ga0495604_0254180 3300047317 Bacteria 1197
655 Ga0495674_1236223 3300047319 Bacteria 563
656 Ga0495676_0392362 3300047321 Bacteria 922
657 Ga0495673_0152346 3300047469 Bacteria 893
658 Ga0495686_0030754 3300047472 Bacteria 3486
659 Ga0495686_0215174 3300047472 Bacteria 1096
660 Ga0495593_0059628 3300047673 Bacteria 1999
661 Ga0495602_0316539 3300048088 Bacteria 1137
662 Ga0495614_0056011 3300048089 Bacteria 1692
663 Ga0495614_0098532 3300048089 Bacteria 1276
664 Ga0496100_0091111 3300048903 Bacteria 2080
665 Ga0496100_0112887 3300048903 Bacteria 1891
666 Ga0496101_0008293 3300048904 Bacteria 6789
667 Ga0496101_0303590 3300048904 Bacteria 1251
668 Ga0496102_0018445 3300048905 Bacteria 6133
669 Ga0496102_0272326 3300048905 Bacteria 1596
670 Ga0496102_0503763 3300048905 Bacteria 1133
671 Ga0496104_0032470 3300048907 Bacteria 4859
672 Ga0496104_0055646 3300048907 Bacteria 3741
673 Ga0496104_0753854 3300048907 Bacteria 880
674 Ga0496104_1245281 3300048907 Bacteria 647
675 Ga0496105_0073192 3300048908 Bacteria 2831
676 Ga0496105_0167701 3300048908 Bacteria 1801
677 Ga0496106_0008934 3300048909 Bacteria 7406
678 Ga0496106_0294814 3300048909 Bacteria 1300
679 Ga0496107_0256318 3300048910 Bacteria 1302
680 Ga0496108_0011606 3300048911 Bacteria 7167
681 Ga0496108_0023125 3300048911 Bacteria 5112
682 Ga0496108_1030897 3300048911 Bacteria 702
683 Ga0496109_0082364 3300048912 Bacteria 2965
684 Ga0496109_0082794 3300048912 Bacteria 2958
685 Ga0496110_0118474 3300048913 Bacteria 2384
686 Ga0496111_0275498 3300048914 Bacteria 1248
687 Ga0496112_0193243 3300048915 Bacteria 1996
688 Ga0496113_0067776 3300048916 Bacteria 2707
689 Ga0496113_0068982 3300048916 Bacteria 2684
690 Ga0496114_0126437 3300048917 Bacteria 2204
691 Ga0496114_0559505 3300048917 Bacteria 1010
692 Ga0496122_0207922 3300048925 Bacteria 1137
693 Ga0496125_0423925 3300048928 Bacteria 770
694 Ga0501198_037180 3300049649 Bacteria 833
695 Ga0501206_007243 3300049653 Bacteria 1452
696 Ga0501209_276053 3300049656 Bacteria 527
697 Ga0501252_000122 3300049682 Bacteria 4551
698 Ga0501264_024709 3300049761 Bacteria 659
699 Ga0501226_010804 3300049853 Bacteria 1012
700 nmdc:mga03683_199333_c1 3300050489 Bacteria 918
701 nmdc:mga0k408_119019_c1 3300050493 Bacteria 1563
702 nmdc:mga0k408_16652_c1 3300050493 Bacteria 4083
703 nmdc:mga0k408_267305_c1 3300050493 Bacteria 1021
704 nmdc:mga0k408_33581_c1 3300050493 Bacteria 2935
705 nmdc:mga0k408_590424_c1 3300050493 Bacteria 655
706 nmdc:mga07m45_103137_c1 3300050496 Bacteria 1639
707 nmdc:mga07m45_147621_c1 3300050496 Bacteria 1363
708 nmdc:mga07m45_48382_c1 3300050496 Bacteria 2391
709 nmdc:mga07m45_517306_c1 3300050496 Bacteria 691
710 nmdc:mga07m45_71714_c1 3300050496 Bacteria 1971
711 nmdc:mga05p37_2022283_c1 3300050507 Bacteria 544
712 nmdc:mga08y16_114587_c1 3300050511 Bacteria 2806
713 nmdc:mga0n895_44649_c1 3300050512 Bacteria 4321
714 nmdc:mga0rr50_182035_c1 3300050513 Bacteria 1718
715 Ga0500635_0204951 3300053080 Bacteria 767
716 Ga0495619_0908110 3300053085 Bacteria 592
717 Ga0500578_0000363 3300053086 Bacteria 55670
718 Ga0500578_0068943 3300053086 Bacteria 2254
719 Ga0500644_0010849 3300053088 Bacteria 2474
720 Ga0500581_301149 3300053089 Bacteria 638
721 Ga0500647_0386792 3300053091 Bacteria 571
722 Ga0500651_0045174 3300053093 Bacteria 2772
723 Ga0500651_0319672 3300053093 Bacteria 887
724 Ga0500648_120659 3300053097 Bacteria 1436
725 Ga0500650_0199384 3300053098 Bacteria 912
726 Ga0500562_033273 3300053108 Bacteria 1362
727 Ga0500593_000526 3300053117 Bacteria 15083
728 Ga0500594_0004214 3300053118 Bacteria 3169
729 Ga0500594_0318097 3300053118 Bacteria 523
730 Ga0500597_335690 3300053120 Bacteria 593
731 Ga0500655_018956 3300053133 Bacteria 1279
732 Ga0500559_0000019 3300053136 Bacteria 134862
733 Ga0500564_199644 3300053138 Bacteria 822
734 Ga0500568_0064970 3300053139 Bacteria 1405
735 Ga0500568_0185956 3300053139 Bacteria 763
736 Ga0500604_0018787 3300053151 Bacteria 1930
737 Ga0500604_0028615 3300053151 Bacteria 1619
738 Ga0500616_0264849 3300053153 Bacteria 728
739 Ga0500619_000171 3300053154 Bacteria 15684
740 Ga0500619_048118 3300053154 Bacteria 1372
741 Ga0500622_0003170 3300053156 Bacteria 11250
742 Ga0500622_0206699 3300053156 Bacteria 889
743 Ga0500633_0246116 3300053160 Bacteria 665
744 Ga0500636_0250282 3300053177 Bacteria 904
745 Ga0500645_001960 3300053730 Bacteria 9727
746 Ga0500599_054603 3300053736 Bacteria 639
747 Ga0500587_006746 3300053739 Bacteria 1513
748 Ga0590077_062339 3300059426 Bacteria 846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_101050108 Ga0070674_1010501082 105
2 3300014326 Ga0157380_10258605 Ga0157380_102586052 105
3 3300005338 Ga0068868_101568063 Ga0068868_1015680631 107
4 3300025226 Ga0209674_113403 Ga0209674_1134032 108
5 3300025230 Ga0209563_100013 Ga0209563_100013209 108
6 3300048925 Ga0496122_0207922 Ga0496122_0207922_657_1061 108
7 iso_pu_bacteria 2886848708 2886850375 109
8 3300027512 Ga0209179_1001677 Ga0209179_10016774 110
9 3300005340 Ga0070689_102109219 Ga0070689_1021092192 111
10 3300005353 Ga0070669_101338456 Ga0070669_1013384561 111
11 3300005457 Ga0070662_101424447 Ga0070662_1014244471 111
12 3300005543 Ga0070672_100021973 Ga0070672_1000219738 111
13 3300025923 Ga0207681_10287302 Ga0207681_102873023 111
14 3300025940 Ga0207691_10039159 Ga0207691_100391595 111
15 3300028794 Ga0307515_10001693 Ga0307515_1000169346 111
16 3300031235 Ga0265330_10031672 Ga0265330_100316723 111
17 3300031238 Ga0265332_10076988 Ga0265332_100769883 111
18 3300031239 Ga0265328_10385106 Ga0265328_103851062 111
19 3300031249 Ga0265339_10238007 Ga0265339_102380072 111
20 3300031344 Ga0265316_10103655 Ga0265316_101036552 111
21 3300031456 Ga0307513_10392129 Ga0307513_103921292 111
22 3300031548 Ga0307408_101356986 Ga0307408_1013569862 111
23 3300031711 Ga0265314_10006203 Ga0265314_100062038 111
24 3300031712 Ga0265342_10060778 Ga0265342_100607786 111
25 3300031995 Ga0307409_102811226 Ga0307409_1028112261 111
26 3300039447 Ga0436361_1177655 Ga0436361_1177655_140_535 111
27 3300041459 Ga0451800_1641012 Ga0451800_1641012_168_524 111
28 3300042876 Ga0451577_0057615 Ga0451577_0057615_168_515 111
29 3300044673 Ga0453683_0092672 Ga0453683_0092672_880_1227 111
30 3300047472 Ga0495686_0030754 Ga0495686_0030754_1412_1759 111
31 3300048909 Ga0496106_0294814 Ga0496106_0294814_754_1101 111
32 3300053086 Ga0500578_0068943 Ga0500578_0068943_1699_2046 111
33 3300053730 Ga0500645_001960 Ga0500645_001960_8224_8571 111
34 3300002773 JGI25152J39213_1001224 JGI25152J39213_10012244 112
35 3300002773 JGI25152J39213_1001251 JGI25152J39213_10012514 112
36 3300002773 JGI25152J39213_1001299 JGI25152J39213_100129910 112
37 3300002774 JGI25150J39212_1005235 JGI25150J39212_10052353 112
38 3300003215 JGI25153J46596_10002653 JGI25153J46596_1000265313 112
39 3300003771 Ga0055526_1002262 Ga0055526_100226213 112
40 3300005327 Ga0070658_10678651 Ga0070658_106786512 112
41 3300005548 Ga0070665_100163978 Ga0070665_1001639784 112
42 3300005578 Ga0068854_100436926 Ga0068854_1004369262 112
43 3300005617 Ga0068859_101511878 Ga0068859_1015118782 112
44 3300005843 Ga0068860_101476549 Ga0068860_1014765492 112
45 3300006195 Ga0075366_10055381 Ga0075366_100553814 112
46 3300006195 Ga0075366_10146543 Ga0075366_101465433 112
47 3300006358 Ga0068871_100582458 Ga0068871_1005824582 112
48 3300006881 Ga0068865_100241335 Ga0068865_1002413352 112
49 3300006931 Ga0097620_101512653 Ga0097620_1015126532 112
50 3300009098 Ga0105245_10290168 Ga0105245_102901682 112
51 3300009553 Ga0105249_11483979 Ga0105249_114839791 112
52 3300013306 Ga0163162_10332792 Ga0163162_103327924 112
53 3300013306 Ga0163162_11136810 Ga0163162_111368102 112
54 3300013308 Ga0157375_10572082 Ga0157375_105720822 112
55 3300014968 Ga0157379_10120153 Ga0157379_101201534 112
56 3300014968 Ga0157379_10176376 Ga0157379_101763765 112
57 3300014968 Ga0157379_11074407 Ga0157379_110744072 112
58 3300025245 Ga0207425_1001237 Ga0207425_100123712 112
59 3300025258 Ga0209129_1000027 Ga0209129_1000027142 112
60 3300025273 Ga0209673_1010832 Ga0209673_10108324 112
61 3300025295 Ga0209564_1000139 Ga0209564_1000139133 112
62 3300025297 Ga0209758_1000310 Ga0209758_100031072 112
63 3300025304 Ga0209257_1088606 Ga0209257_10886062 112
64 3300025927 Ga0207687_10266526 Ga0207687_102665261 112
65 3300025986 Ga0207658_10010175 Ga0207658_100101758 112
66 3300031507 Ga0307509_10212595 Ga0307509_102125952 112
67 3300031507 Ga0307509_11007268 Ga0307509_110072681 112
68 3300032002 Ga0307416_100291949 Ga0307416_1002919492 112
69 3300035172 Ga0373955_0309537 Ga0373955_0309537_187_534 112
70 3300035410 Ga0373924_0172895 Ga0373924_0172895_122_469 112
71 3300036401 Ga0373937_0321803 Ga0373937_0321803_708_1067 112
72 3300036401 Ga0373937_1086171 Ga0373937_1086171_335_682 112
73 3300037068 Ga0373925_0132974 Ga0373925_0132974_1257_1610 112
74 3300037471 Ga0395905_0167972 Ga0395905_0167972_577_948 112
75 3300037471 Ga0395905_0601971 Ga0395905_0601971_35_403 112
76 3300041453 Ga0451797_0220704 Ga0451797_0220704_135_473 112
77 3300042438 Ga0439459_0014586 Ga0439459_0014586_240_578 112
78 3300042876 Ga0451577_0004741 Ga0451577_0004741_636_992 112
79 3300042876 Ga0451577_0401658 Ga0451577_0401658_848_1201 112
80 3300042876 Ga0451577_0733135 Ga0451577_0733135_432_785 112
81 3300044712 Ga0453684_0244278 Ga0453684_0244278_1194_1547 112
82 3300046514 Ga0495618_0656644 Ga0495618_0656644_144_491 112
83 3300046524 Ga0495648_0271303 Ga0495648_0271303_378_731 112
84 3300046543 Ga0495645_0538572 Ga0495645_0538572_339_686 112
85 3300046689 Ga0495613_0386887 Ga0495613_0386887_48_395 112
86 3300046692 Ga0495671_0118049 Ga0495671_0118049_903_1256 112
87 3300049653 Ga0501206_007243 Ga0501206_007243_771_1121 112
88 3300053085 Ga0495619_0908110 Ga0495619_0908110_138_485 112
89 3300003215 JGI25153J46596_10004183 JGI25153J46596_100041835 113
90 3300003308 Ga0006777J48905_1047703 Ga0006777J48905_10477032 113
91 3300003791 Ga0055530_10009773 Ga0055530_100097737 113
92 3300005262 Ga0065165_1001456 Ga0065165_100145611 113
93 3300005295 Ga0065707_10220135 Ga0065707_102201353 113
94 3300005327 Ga0070658_10551114 Ga0070658_105511142 113
95 3300005328 Ga0070676_10021332 Ga0070676_100213324 113
96 3300005328 Ga0070676_10034097 Ga0070676_100340975 113
97 3300005328 Ga0070676_10056576 Ga0070676_100565762 113
98 3300005329 Ga0070683_100252217 Ga0070683_1002522173 113
99 3300005329 Ga0070683_100403035 Ga0070683_1004030353 113
100 3300005330 Ga0070690_100020420 Ga0070690_1000204207 113
101 3300005330 Ga0070690_100645339 Ga0070690_1006453392 113
102 3300005330 Ga0070690_100728401 Ga0070690_1007284011 113
103 3300005331 Ga0070670_100001787 Ga0070670_10000178717 113
104 3300005331 Ga0070670_100096015 Ga0070670_1000960153 113
105 3300005331 Ga0070670_100168819 Ga0070670_1001688193 113
106 3300005331 Ga0070670_100655440 Ga0070670_1006554402 113
107 3300005333 Ga0070677_10039217 Ga0070677_100392175 113
108 3300005333 Ga0070677_10067530 Ga0070677_100675302 113
109 3300005333 Ga0070677_10344192 Ga0070677_103441921 113
110 3300005334 Ga0068869_100006465 Ga0068869_1000064656 113
111 3300005334 Ga0068869_100009400 Ga0068869_1000094007 113
112 3300005334 Ga0068869_100090154 Ga0068869_1000901542 113
113 3300005334 Ga0068869_100804787 Ga0068869_1008047872 113
114 3300005335 Ga0070666_10006757 Ga0070666_100067577 113
115 3300005335 Ga0070666_10197154 Ga0070666_101971542 113
116 3300005335 Ga0070666_10486118 Ga0070666_104861183 113
117 3300005337 Ga0070682_100600912 Ga0070682_1006009122 113
118 3300005337 Ga0070682_101627522 Ga0070682_1016275221 113
119 3300005338 Ga0068868_100000966 Ga0068868_10000096612 113
120 3300005338 Ga0068868_100032419 Ga0068868_1000324196 113
121 3300005338 Ga0068868_100073841 Ga0068868_1000738413 113
122 3300005338 Ga0068868_100229637 Ga0068868_1002296372 113
123 3300005338 Ga0068868_100361051 Ga0068868_1003610513 113
124 3300005339 Ga0070660_100102149 Ga0070660_1001021494 113
125 3300005340 Ga0070689_100175898 Ga0070689_1001758983 113
126 3300005343 Ga0070687_100781062 Ga0070687_1007810622 113
127 3300005343 Ga0070687_101207084 Ga0070687_1012070841 113
128 3300005344 Ga0070661_100108802 Ga0070661_1001088023 113
129 3300005344 Ga0070661_100156321 Ga0070661_1001563213 113
130 3300005345 Ga0070692_10262472 Ga0070692_102624723 113
131 3300005347 Ga0070668_100036969 Ga0070668_1000369697 113
132 3300005347 Ga0070668_100137109 Ga0070668_1001371093 113
133 3300005347 Ga0070668_100173369 Ga0070668_1001733693 113
134 3300005353 Ga0070669_100088090 Ga0070669_1000880904 113
135 3300005353 Ga0070669_100101683 Ga0070669_1001016833 113
136 3300005353 Ga0070669_100382001 Ga0070669_1003820013 113
137 3300005353 Ga0070669_100395680 Ga0070669_1003956803 113
138 3300005354 Ga0070675_100008036 Ga0070675_1000080367 113
139 3300005354 Ga0070675_100061241 Ga0070675_1000612415 113
140 3300005354 Ga0070675_100062673 Ga0070675_1000626732 113
141 3300005354 Ga0070675_100080667 Ga0070675_1000806675 113
142 3300005355 Ga0070671_100011057 Ga0070671_1000110576 113
143 3300005355 Ga0070671_100160588 Ga0070671_1001605882 113
144 3300005355 Ga0070671_100208222 Ga0070671_1002082223 113
145 3300005355 Ga0070671_100323786 Ga0070671_1003237863 113
146 3300005355 Ga0070671_102113961 Ga0070671_1021139611 113
147 3300005356 Ga0070674_100094896 Ga0070674_1000948964 113
148 3300005356 Ga0070674_100102944 Ga0070674_1001029445 113
149 3300005356 Ga0070674_100348681 Ga0070674_1003486812 113
150 3300005356 Ga0070674_101090703 Ga0070674_1010907032 113
151 3300005364 Ga0070673_100019930 Ga0070673_1000199305 113
152 3300005364 Ga0070673_100050040 Ga0070673_1000500404 113
153 3300005364 Ga0070673_100118826 Ga0070673_1001188263 113
154 3300005364 Ga0070673_100244226 Ga0070673_1002442264 113
155 3300005364 Ga0070673_100495865 Ga0070673_1004958653 113
156 3300005365 Ga0070688_100072638 Ga0070688_1000726382 113
157 3300005365 Ga0070688_101379380 Ga0070688_1013793801 113
158 3300005366 Ga0070659_100043932 Ga0070659_1000439325 113
159 3300005366 Ga0070659_101312441 Ga0070659_1013124411 113
160 3300005367 Ga0070667_100023158 Ga0070667_1000231586 113
161 3300005367 Ga0070667_100081424 Ga0070667_1000814242 113
162 3300005367 Ga0070667_100099658 Ga0070667_1000996582 113
163 3300005367 Ga0070667_100192145 Ga0070667_1001921453 113
164 3300005367 Ga0070667_100533439 Ga0070667_1005334393 113
165 3300005367 Ga0070667_100950070 Ga0070667_1009500702 113
166 3300005441 Ga0070700_100095800 Ga0070700_1000958001 113
167 3300005441 Ga0070700_100973609 Ga0070700_1009736092 113
168 3300005455 Ga0070663_100001375 Ga0070663_1000013752 113
169 3300005455 Ga0070663_100273872 Ga0070663_1002738721 113
170 3300005455 Ga0070663_102104065 Ga0070663_1021040651 113
171 3300005456 Ga0070678_100006239 Ga0070678_1000062396 113
172 3300005456 Ga0070678_100077866 Ga0070678_1000778662 113
173 3300005456 Ga0070678_101352439 Ga0070678_1013524392 113
174 3300005457 Ga0070662_100017313 Ga0070662_1000173135 113
175 3300005457 Ga0070662_100034193 Ga0070662_1000341934 113
176 3300005457 Ga0070662_100947686 Ga0070662_1009476862 113
177 3300005458 Ga0070681_10176293 Ga0070681_101762935 113
178 3300005458 Ga0070681_10628428 Ga0070681_106284283 113
179 3300005459 Ga0068867_100005640 Ga0068867_1000056407 113
180 3300005459 Ga0068867_100011669 Ga0068867_1000116694 113
181 3300005459 Ga0068867_100049124 Ga0068867_1000491245 113
182 3300005466 Ga0070685_10296691 Ga0070685_102966912 113
183 3300005466 Ga0070685_10367513 Ga0070685_103675132 113
184 3300005468 Ga0070707_100985463 Ga0070707_1009854631 113
185 3300005518 Ga0070699_102152406 Ga0070699_1021524061 113
186 3300005530 Ga0070679_100108254 Ga0070679_1001082541 113
187 3300005530 Ga0070679_101489044 Ga0070679_1014890442 113
188 3300005535 Ga0070684_100031515 Ga0070684_1000315156 113
189 3300005535 Ga0070684_100468989 Ga0070684_1004689891 113
190 3300005535 Ga0070684_101008342 Ga0070684_1010083422 113
191 3300005539 Ga0068853_100077580 Ga0068853_1000775803 113
192 3300005539 Ga0068853_101845419 Ga0068853_1018454191 113
193 3300005543 Ga0070672_100007718 Ga0070672_1000077187 113
194 3300005543 Ga0070672_100013592 Ga0070672_1000135922 113
195 3300005543 Ga0070672_100036721 Ga0070672_1000367214 113
196 3300005543 Ga0070672_100042843 Ga0070672_1000428435 113
197 3300005543 Ga0070672_100149059 Ga0070672_1001490592 113
198 3300005544 Ga0070686_100452954 Ga0070686_1004529542 113
199 3300005544 Ga0070686_100702272 Ga0070686_1007022722 113
200 3300005547 Ga0070693_100079478 Ga0070693_1000794782 113
201 3300005547 Ga0070693_100952951 Ga0070693_1009529512 113
202 3300005547 Ga0070693_100988821 Ga0070693_1009888212 113
203 3300005548 Ga0070665_100015286 Ga0070665_1000152864 113
204 3300005548 Ga0070665_100523187 Ga0070665_1005231873 113
205 3300005548 Ga0070665_100656324 Ga0070665_1006563243 113
206 3300005549 Ga0070704_100581445 Ga0070704_1005814451 113
207 3300005564 Ga0070664_100112711 Ga0070664_1001127114 113
208 3300005564 Ga0070664_100240697 Ga0070664_1002406973 113
209 3300005564 Ga0070664_101111116 Ga0070664_1011111162 113
210 3300005577 Ga0068857_100241040 Ga0068857_1002410404 113
211 3300005577 Ga0068857_100285172 Ga0068857_1002851722 113
212 3300005577 Ga0068857_100354262 Ga0068857_1003542621 113
213 3300005577 Ga0068857_101673816 Ga0068857_1016738162 113
214 3300005578 Ga0068854_100499553 Ga0068854_1004995532 113
215 3300005614 Ga0068856_100007776 Ga0068856_1000077764 113
216 3300005614 Ga0068856_100200434 Ga0068856_1002004342 113
217 3300005615 Ga0070702_100261656 Ga0070702_1002616563 113
218 3300005615 Ga0070702_100410075 Ga0070702_1004100752 113
219 3300005616 Ga0068852_100005075 Ga0068852_1000050759 113
220 3300005616 Ga0068852_100030245 Ga0068852_1000302455 113
221 3300005616 Ga0068852_100256445 Ga0068852_1002564453 113
222 3300005616 Ga0068852_100707440 Ga0068852_1007074401 113
223 3300005616 Ga0068852_100709170 Ga0068852_1007091703 113
224 3300005616 Ga0068852_101023768 Ga0068852_1010237682 113
225 3300005617 Ga0068859_100019167 Ga0068859_1000191678 113
226 3300005617 Ga0068859_100594680 Ga0068859_1005946802 113
227 3300005618 Ga0068864_100002065 Ga0068864_10000206514 113
228 3300005618 Ga0068864_100013594 Ga0068864_1000135944 113
229 3300005618 Ga0068864_100035249 Ga0068864_1000352496 113
230 3300005618 Ga0068864_100072290 Ga0068864_1000722904 113
231 3300005718 Ga0068866_10003257 Ga0068866_100032577 113
232 3300005718 Ga0068866_10569852 Ga0068866_105698522 113
233 3300005718 Ga0068866_10725864 Ga0068866_107258642 113
234 3300005719 Ga0068861_100052430 Ga0068861_1000524304 113
235 3300005719 Ga0068861_100236372 Ga0068861_1002363724 113
236 3300005719 Ga0068861_100510359 Ga0068861_1005103593 113
237 3300005834 Ga0068851_10071766 Ga0068851_100717662 113
238 3300005834 Ga0068851_10102633 Ga0068851_101026332 113
239 3300005834 Ga0068851_10261466 Ga0068851_102614662 113
240 3300005834 Ga0068851_10489408 Ga0068851_104894082 113
241 3300005840 Ga0068870_11362289 Ga0068870_113622891 113
242 3300005841 Ga0068863_100017036 Ga0068863_1000170365 113
243 3300005841 Ga0068863_100020937 Ga0068863_1000209378 113
244 3300005841 Ga0068863_100059870 Ga0068863_1000598706 113
245 3300005841 Ga0068863_100085478 Ga0068863_1000854786 113
246 3300005841 Ga0068863_100248762 Ga0068863_1002487625 113
247 3300005842 Ga0068858_100015823 Ga0068858_1000158238 113
248 3300005842 Ga0068858_100039082 Ga0068858_1000390827 113
249 3300005842 Ga0068858_100061093 Ga0068858_1000610934 113
250 3300005842 Ga0068858_100319144 Ga0068858_1003191442 113
251 3300005842 Ga0068858_100936021 Ga0068858_1009360212 113
252 3300005842 Ga0068858_101711269 Ga0068858_1017112692 113
253 3300005843 Ga0068860_100000823 Ga0068860_10000082320 113
254 3300005843 Ga0068860_100022795 Ga0068860_1000227957 113
255 3300005843 Ga0068860_100139445 Ga0068860_1001394453 113
256 3300005843 Ga0068860_100975716 Ga0068860_1009757162 113
257 3300005843 Ga0068860_101949740 Ga0068860_1019497402 113
258 3300005844 Ga0068862_100020457 Ga0068862_1000204574 113
259 3300005844 Ga0068862_100074012 Ga0068862_1000740123 113
260 3300005844 Ga0068862_100155446 Ga0068862_1001554465 113
261 3300005844 Ga0068862_100303293 Ga0068862_1003032932 113
262 3300006048 Ga0075363_100362819 Ga0075363_1003628192 113
263 3300006195 Ga0075366_10010581 Ga0075366_100105814 113
264 3300006195 Ga0075366_10031527 Ga0075366_100315273 113
265 3300006195 Ga0075366_10224405 Ga0075366_102244052 113
266 3300006195 Ga0075366_10501107 Ga0075366_105011072 113
267 3300006237 Ga0097621_100047919 Ga0097621_1000479193 113
268 3300006237 Ga0097621_100081780 Ga0097621_1000817805 113
269 3300006237 Ga0097621_100144783 Ga0097621_1001447832 113
270 3300006237 Ga0097621_100205376 Ga0097621_1002053762 113
271 3300006237 Ga0097621_100501400 Ga0097621_1005014003 113
272 3300006353 Ga0075370_10028805 Ga0075370_100288052 113
273 3300006353 Ga0075370_10040124 Ga0075370_100401246 113
274 3300006353 Ga0075370_10195814 Ga0075370_101958142 113
275 3300006358 Ga0068871_100041620 Ga0068871_1000416205 113
276 3300006358 Ga0068871_100071350 Ga0068871_1000713506 113
277 3300006358 Ga0068871_100143639 Ga0068871_1001436395 113
278 3300006871 Ga0075434_100203918 Ga0075434_1002039182 113
279 3300006881 Ga0068865_100027661 Ga0068865_1000276617 113
280 3300006881 Ga0068865_100141331 Ga0068865_1001413312 113
281 3300006931 Ga0097620_100019167 Ga0097620_1000191678 113
282 3300006931 Ga0097620_100594727 Ga0097620_1005947273 113
283 3300007076 Ga0075435_100347657 Ga0075435_1003476572 113
284 3300009092 Ga0105250_10087916 Ga0105250_100879162 113
285 3300009093 Ga0105240_10025030 Ga0105240_100250307 113
286 3300009093 Ga0105240_10646029 Ga0105240_106460293 113
287 3300009093 Ga0105240_11241366 Ga0105240_112413662 113
288 3300009094 Ga0111539_12021008 Ga0111539_120210082 113
289 3300009098 Ga0105245_10085160 Ga0105245_100851605 113
290 3300009098 Ga0105245_10381366 Ga0105245_103813663 113
291 3300009101 Ga0105247_11386081 Ga0105247_113860812 113
292 3300009147 Ga0114129_12679103 Ga0114129_126791032 113
293 3300009148 Ga0105243_10011388 Ga0105243_100113889 113
294 3300009148 Ga0105243_10206614 Ga0105243_102066143 113
295 3300009148 Ga0105243_10587883 Ga0105243_105878832 113
296 3300009148 Ga0105243_10847446 Ga0105243_108474462 113
297 3300009148 Ga0105243_11192326 Ga0105243_111923262 113
298 3300009148 Ga0105243_12547590 Ga0105243_125475902 113
299 3300009174 Ga0105241_10327317 Ga0105241_103273173 113
300 3300009174 Ga0105241_11754658 Ga0105241_117546582 113
301 3300009176 Ga0105242_10260803 Ga0105242_102608032 113
302 3300009177 Ga0105248_10040305 Ga0105248_100403056 113
303 3300009177 Ga0105248_10074832 Ga0105248_100748323 113
304 3300009177 Ga0105248_10360699 Ga0105248_103606993 113
305 3300009177 Ga0105248_10388190 Ga0105248_103881905 113
306 3300009177 Ga0105248_10423779 Ga0105248_104237793 113
307 3300009545 Ga0105237_10007447 Ga0105237_1000744713 113
308 3300009545 Ga0105237_10098355 Ga0105237_100983553 113
309 3300009545 Ga0105237_10191070 Ga0105237_101910705 113
310 3300009545 Ga0105237_11401836 Ga0105237_114018362 113
311 3300009551 Ga0105238_10005477 Ga0105238_1000547713 113
312 3300009551 Ga0105238_10053451 Ga0105238_100534517 113
313 3300009551 Ga0105238_10959206 Ga0105238_109592062 113
314 3300009551 Ga0105238_11614897 Ga0105238_116148972 113
315 3300009553 Ga0105249_10023493 Ga0105249_100234932 113
316 3300009553 Ga0105249_10315700 Ga0105249_103157002 113
317 3300009553 Ga0105249_10636261 Ga0105249_106362613 113
318 3300009553 Ga0105249_12699000 Ga0105249_126990002 113
319 3300010375 Ga0105239_10010780 Ga0105239_1001078012 113
320 3300010375 Ga0105239_10114929 Ga0105239_101149294 113
321 3300010375 Ga0105239_12771490 Ga0105239_127714902 113
322 3300011119 Ga0105246_11004708 Ga0105246_110047082 113
323 3300012495 Ga0157323_1045220 Ga0157323_10452202 113
324 3300012510 Ga0157316_1071264 Ga0157316_10712642 113
325 3300012512 Ga0157327_1003137 Ga0157327_10031373 113
326 3300013100 Ga0157373_10108192 Ga0157373_101081923 113
327 3300013102 Ga0157371_10107101 Ga0157371_101071014 113
328 3300013105 Ga0157369_10083325 Ga0157369_100833253 113
329 3300013105 Ga0157369_10243757 Ga0157369_102437573 113
330 3300013296 Ga0157374_10047942 Ga0157374_100479424 113
331 3300013296 Ga0157374_10084070 Ga0157374_100840704 113
332 3300013296 Ga0157374_10570997 Ga0157374_105709972 113
333 3300013296 Ga0157374_10733648 Ga0157374_107336482 113
334 3300013296 Ga0157374_10903417 Ga0157374_109034172 113
335 3300013297 Ga0157378_10001703 Ga0157378_1000170319 113
336 3300013297 Ga0157378_10107143 Ga0157378_101071433 113
337 3300013297 Ga0157378_10606877 Ga0157378_106068771 113
338 3300013306 Ga0163162_10002252 Ga0163162_1000225212 113
339 3300013306 Ga0163162_10011131 Ga0163162_1001113111 113
340 3300013306 Ga0163162_10181411 Ga0163162_101814113 113
341 3300013306 Ga0163162_10205553 Ga0163162_102055534 113
342 3300013306 Ga0163162_10327514 Ga0163162_103275144 113
343 3300013306 Ga0163162_10352505 Ga0163162_103525054 113
344 3300013307 Ga0157372_10076894 Ga0157372_100768944 113
345 3300013307 Ga0157372_10188338 Ga0157372_101883383 113
346 3300013308 Ga0157375_10048298 Ga0157375_100482986 113
347 3300013308 Ga0157375_10151456 Ga0157375_101514563 113
348 3300013308 Ga0157375_10192035 Ga0157375_101920354 113
349 3300013308 Ga0157375_10528887 Ga0157375_105288872 113
350 3300013308 Ga0157375_10707123 Ga0157375_107071232 113
351 3300013308 Ga0157375_11341169 Ga0157375_113411692 113
352 3300014325 Ga0163163_10009458 Ga0163163_100094586 113
353 3300014326 Ga0157380_10040311 Ga0157380_100403113 113
354 3300014326 Ga0157380_12906071 Ga0157380_129060712 113
355 3300014497 Ga0182008_10248962 Ga0182008_102489622 113
356 3300014745 Ga0157377_10000032 Ga0157377_10000032112 113
357 3300014968 Ga0157379_10013272 Ga0157379_100132729 113
358 3300014968 Ga0157379_10069128 Ga0157379_100691285 113
359 3300014968 Ga0157379_10276440 Ga0157379_102764403 113
360 3300014968 Ga0157379_10858909 Ga0157379_108589092 113
361 3300014969 Ga0157376_10098430 Ga0157376_100984303 113
362 3300014969 Ga0157376_10115161 Ga0157376_101151615 113
363 3300014969 Ga0157376_10115243 Ga0157376_101152433 113
364 3300014969 Ga0157376_10176155 Ga0157376_101761552 113
365 3300014969 Ga0157376_10543407 Ga0157376_105434072 113
366 3300014969 Ga0157376_11459910 Ga0157376_114599102 113
367 3300015262 Ga0182007_10115543 Ga0182007_101155432 113
368 3300017792 Ga0163161_10076960 Ga0163161_100769603 113
369 3300017792 Ga0163161_10079358 Ga0163161_100793583 113
370 3300017792 Ga0163161_10462343 Ga0163161_104623432 113
371 3300021384 Ga0213876_10030362 Ga0213876_100303624 113
372 3300025273 Ga0209673_1065425 Ga0209673_10654252 113
373 3300025297 Ga0209758_1000281 Ga0209758_100028123 113
374 3300025298 Ga0209050_1000303 Ga0209050_100030331 113
375 3300025303 Ga0209051_1013169 Ga0209051_10131694 113
376 3300025304 Ga0209257_1006026 Ga0209257_100602610 113
377 3300025315 Ga0207697_10145728 Ga0207697_101457282 113
378 3300025315 Ga0207697_10163381 Ga0207697_101633812 113
379 3300025321 Ga0207656_10030997 Ga0207656_100309972 113
380 3300025321 Ga0207656_10031008 Ga0207656_100310084 113
381 3300025321 Ga0207656_10377168 Ga0207656_103771682 113
382 3300025711 Ga0207696_1085435 Ga0207696_10854352 113
383 3300025893 Ga0207682_10023185 Ga0207682_100231852 113
384 3300025893 Ga0207682_10111417 Ga0207682_101114172 113
385 3300025893 Ga0207682_10114272 Ga0207682_101142723 113
386 3300025899 Ga0207642_10012685 Ga0207642_100126852 113
387 3300025903 Ga0207680_10002140 Ga0207680_100021409 113
388 3300025904 Ga0207647_10136054 Ga0207647_101360543 113
389 3300025907 Ga0207645_10023242 Ga0207645_100232427 113
390 3300025907 Ga0207645_10063446 Ga0207645_100634464 113
391 3300025907 Ga0207645_10113574 Ga0207645_101135744 113
392 3300025908 Ga0207643_10837842 Ga0207643_108378422 113
393 3300025909 Ga0207705_10344261 Ga0207705_103442612 113
394 3300025911 Ga0207654_10354674 Ga0207654_103546743 113
395 3300025911 Ga0207654_11328800 Ga0207654_113288002 113
396 3300025913 Ga0207695_10009980 Ga0207695_100099808 113
397 3300025913 Ga0207695_10736876 Ga0207695_107368762 113
398 3300025914 Ga0207671_10008972 Ga0207671_100089723 113
399 3300025914 Ga0207671_10113852 Ga0207671_101138523 113
400 3300025914 Ga0207671_10153863 Ga0207671_101538632 113
401 3300025917 Ga0207660_10145784 Ga0207660_101457843 113
402 3300025918 Ga0207662_10721860 Ga0207662_107218601 113
403 3300025920 Ga0207649_10070050 Ga0207649_100700503 113
404 3300025920 Ga0207649_10412864 Ga0207649_104128642 113
405 3300025921 Ga0207652_10030048 Ga0207652_100300486 113
406 3300025923 Ga0207681_10016930 Ga0207681_100169307 113
407 3300025923 Ga0207681_10081625 Ga0207681_100816254 113
408 3300025923 Ga0207681_10248638 Ga0207681_102486382 113
409 3300025923 Ga0207681_10331005 Ga0207681_103310052 113
410 3300025923 Ga0207681_10636469 Ga0207681_106364693 113
411 3300025923 Ga0207681_11005095 Ga0207681_110050952 113
412 3300025924 Ga0207694_10149504 Ga0207694_101495042 113
413 3300025924 Ga0207694_11149245 Ga0207694_111492452 113
414 3300025925 Ga0207650_10072993 Ga0207650_100729934 113
415 3300025925 Ga0207650_10169482 Ga0207650_101694823 113
416 3300025925 Ga0207650_10240084 Ga0207650_102400842 113
417 3300025926 Ga0207659_10020943 Ga0207659_100209434 113
418 3300025926 Ga0207659_10024900 Ga0207659_100249007 113
419 3300025926 Ga0207659_10090445 Ga0207659_100904452 113
420 3300025926 Ga0207659_10098365 Ga0207659_100983654 113
421 3300025927 Ga0207687_10102368 Ga0207687_101023686 113
422 3300025927 Ga0207687_10251793 Ga0207687_102517932 113
423 3300025931 Ga0207644_10002654 Ga0207644_100026547 113
424 3300025931 Ga0207644_10220439 Ga0207644_102204392 113
425 3300025931 Ga0207644_10423984 Ga0207644_104239842 113
426 3300025932 Ga0207690_10112138 Ga0207690_101121383 113
427 3300025932 Ga0207690_10454509 Ga0207690_104545092 113
428 3300025933 Ga0207706_10013493 Ga0207706_100134939 113
429 3300025933 Ga0207706_10031863 Ga0207706_100318636 113
430 3300025933 Ga0207706_10388948 Ga0207706_103889483 113
431 3300025935 Ga0207709_10002313 Ga0207709_100023136 113
432 3300025935 Ga0207709_10063317 Ga0207709_100633174 113
433 3300025935 Ga0207709_10577994 Ga0207709_105779942 113
434 3300025936 Ga0207670_10007649 Ga0207670_100076497 113
435 3300025936 Ga0207670_11561846 Ga0207670_115618462 113
436 3300025937 Ga0207669_10259192 Ga0207669_102591924 113
437 3300025937 Ga0207669_10715248 Ga0207669_107152482 113
438 3300025938 Ga0207704_10003689 Ga0207704_100036897 113
439 3300025940 Ga0207691_10004404 Ga0207691_1000440412 113
440 3300025940 Ga0207691_10018804 Ga0207691_100188047 113
441 3300025940 Ga0207691_10019002 Ga0207691_1001900210 113
442 3300025940 Ga0207691_10031019 Ga0207691_100310196 113
443 3300025940 Ga0207691_10395526 Ga0207691_103955262 113
444 3300025941 Ga0207711_10048589 Ga0207711_100485896 113
445 3300025941 Ga0207711_10087324 Ga0207711_100873244 113
446 3300025941 Ga0207711_10195222 Ga0207711_101952222 113
447 3300025941 Ga0207711_10239440 Ga0207711_102394403 113
448 3300025942 Ga0207689_10014107 Ga0207689_100141079 113
449 3300025942 Ga0207689_10060014 Ga0207689_100600143 113
450 3300025942 Ga0207689_10116843 Ga0207689_101168435 113
451 3300025944 Ga0207661_10500212 Ga0207661_105002121 113
452 3300025945 Ga0207679_10008471 Ga0207679_100084718 113
453 3300025945 Ga0207679_11061976 Ga0207679_110619762 113
454 3300025949 Ga0207667_10514752 Ga0207667_105147523 113
455 3300025960 Ga0207651_10004672 Ga0207651_100046728 113
456 3300025960 Ga0207651_10013837 Ga0207651_100138374 113
457 3300025960 Ga0207651_10032262 Ga0207651_100322625 113
458 3300025961 Ga0207712_10043080 Ga0207712_100430805 113
459 3300025961 Ga0207712_10284197 Ga0207712_102841972 113
460 3300025972 Ga0207668_10024415 Ga0207668_100244154 113
461 3300025972 Ga0207668_10121965 Ga0207668_101219654 113
462 3300025972 Ga0207668_10275890 Ga0207668_102758903 113
463 3300025972 Ga0207668_10570713 Ga0207668_105707132 113
464 3300025972 Ga0207668_10971850 Ga0207668_109718502 113
465 3300025981 Ga0207640_10155351 Ga0207640_101553513 113
466 3300025981 Ga0207640_10158498 Ga0207640_101584983 113
467 3300025981 Ga0207640_10443593 Ga0207640_104435932 113
468 3300025981 Ga0207640_11481529 Ga0207640_114815292 113
469 3300025986 Ga0207658_10020095 Ga0207658_100200956 113
470 3300025986 Ga0207658_10051018 Ga0207658_100510185 113
471 3300025986 Ga0207658_10062467 Ga0207658_100624675 113
472 3300025986 Ga0207658_10084433 Ga0207658_100844332 113
473 3300025986 Ga0207658_10223334 Ga0207658_102233342 113
474 3300025986 Ga0207658_10252241 Ga0207658_102522414 113
475 3300025986 Ga0207658_11639547 Ga0207658_116395472 113
476 3300026023 Ga0207677_10001522 Ga0207677_100015225 113
477 3300026023 Ga0207677_10018664 Ga0207677_100186646 113
478 3300026023 Ga0207677_10156774 Ga0207677_101567742 113
479 3300026023 Ga0207677_10158317 Ga0207677_101583173 113
480 3300026023 Ga0207677_10336598 Ga0207677_103365984 113
481 3300026035 Ga0207703_10006009 Ga0207703_1000600910 113
482 3300026035 Ga0207703_10026459 Ga0207703_100264597 113
483 3300026035 Ga0207703_10032964 Ga0207703_100329647 113
484 3300026035 Ga0207703_11171630 Ga0207703_111716302 113
485 3300026035 Ga0207703_11290075 Ga0207703_112900752 113
486 3300026041 Ga0207639_10099598 Ga0207639_100995984 113
487 3300026041 Ga0207639_10141624 Ga0207639_101416242 113
488 3300026041 Ga0207639_11765660 Ga0207639_117656602 113
489 3300026067 Ga0207678_10016216 Ga0207678_1001621610 113
490 3300026067 Ga0207678_10083543 Ga0207678_100835435 113
491 3300026075 Ga0207708_10153438 Ga0207708_101534384 113
492 3300026075 Ga0207708_10699366 Ga0207708_106993662 113
493 3300026078 Ga0207702_10004429 Ga0207702_100044297 113
494 3300026078 Ga0207702_10335077 Ga0207702_103350773 113
495 3300026088 Ga0207641_10003329 Ga0207641_1000332911 113
496 3300026088 Ga0207641_10079161 Ga0207641_100791615 113
497 3300026088 Ga0207641_10137677 Ga0207641_101376775 113
498 3300026088 Ga0207641_10452533 Ga0207641_104525332 113
499 3300026088 Ga0207641_10639320 Ga0207641_106393202 113
500 3300026088 Ga0207641_10715550 Ga0207641_107155501 113
501 3300026089 Ga0207648_10000179 Ga0207648_1000017954 113
502 3300026089 Ga0207648_10001296 Ga0207648_1000129614 113
503 3300026089 Ga0207648_10010028 Ga0207648_100100287 113
504 3300026089 Ga0207648_10101337 Ga0207648_101013375 113
505 3300026089 Ga0207648_10325133 Ga0207648_103251333 113
506 3300026089 Ga0207648_10449942 Ga0207648_104499422 113
507 3300026089 Ga0207648_11271580 Ga0207648_112715801 113
508 3300026095 Ga0207676_10002741 Ga0207676_1000274114 113
509 3300026095 Ga0207676_10003295 Ga0207676_100032959 113
510 3300026095 Ga0207676_10044642 Ga0207676_100446424 113
511 3300026095 Ga0207676_10073876 Ga0207676_100738762 113
512 3300026095 Ga0207676_10904337 Ga0207676_109043372 113
513 3300026116 Ga0207674_10008627 Ga0207674_1000862712 113
514 3300026116 Ga0207674_10332208 Ga0207674_103322082 113
515 3300026116 Ga0207674_10446401 Ga0207674_104464011 113
516 3300026118 Ga0207675_100005391 Ga0207675_10000539113 113
517 3300026118 Ga0207675_100060714 Ga0207675_1000607146 113
518 3300026118 Ga0207675_100088572 Ga0207675_1000885724 113
519 3300026121 Ga0207683_10148626 Ga0207683_101486262 113
520 3300026121 Ga0207683_10365924 Ga0207683_103659241 113
521 3300026121 Ga0207683_10673289 Ga0207683_106732892 113
522 3300026142 Ga0207698_10009766 Ga0207698_1000976610 113
523 3300026142 Ga0207698_10021332 Ga0207698_100213326 113
524 3300026142 Ga0207698_10051692 Ga0207698_100516926 113
525 3300026142 Ga0207698_10603936 Ga0207698_106039362 113
526 3300026142 Ga0207698_10687655 Ga0207698_106876551 113
527 3300026142 Ga0207698_10748657 Ga0207698_107486572 113
528 3300026142 Ga0207698_11223306 Ga0207698_112233062 113
529 3300028379 Ga0268266_10045732 Ga0268266_100457323 113
530 3300028379 Ga0268266_10350275 Ga0268266_103502753 113
531 3300028379 Ga0268266_10368943 Ga0268266_103689433 113
532 3300028380 Ga0268265_10011328 Ga0268265_100113288 113
533 3300028380 Ga0268265_10026717 Ga0268265_100267173 113
534 3300028380 Ga0268265_10201146 Ga0268265_102011464 113
535 3300028381 Ga0268264_10000613 Ga0268264_1000061315 113
536 3300028381 Ga0268264_10024923 Ga0268264_100249236 113
537 3300028381 Ga0268264_10572287 Ga0268264_105722872 113
538 3300028786 Ga0307517_10076041 Ga0307517_100760415 113
539 3300028786 Ga0307517_10184301 Ga0307517_101843013 113
540 3300028786 Ga0307517_10189474 Ga0307517_101894743 113
541 3300028794 Ga0307515_10000609 Ga0307515_1000060928 113
542 3300028794 Ga0307515_10003934 Ga0307515_1000393410 113
543 3300028794 Ga0307515_10018282 Ga0307515_1001828215 113
544 3300028794 Ga0307515_10044072 Ga0307515_100440729 113
545 3300028794 Ga0307515_10260267 Ga0307515_102602672 113
546 3300028794 Ga0307515_10472368 Ga0307515_104723682 113
547 3300030522 Ga0307512_10121681 Ga0307512_101216814 113
548 3300030522 Ga0307512_10385555 Ga0307512_103855552 113
549 3300031456 Ga0307513_10114170 Ga0307513_101141705 113
550 3300031456 Ga0307513_10378910 Ga0307513_103789102 113
551 3300031456 Ga0307513_10424194 Ga0307513_104241942 113
552 3300031507 Ga0307509_10000991 Ga0307509_1000099121 113
553 3300031507 Ga0307509_10040089 Ga0307509_100400895 113
554 3300031507 Ga0307509_10058903 Ga0307509_100589036 113
555 3300031507 Ga0307509_10106381 Ga0307509_101063813 113
556 3300031507 Ga0307509_10142847 Ga0307509_101428475 113
557 3300031507 Ga0307509_10420658 Ga0307509_104206582 113
558 3300031507 Ga0307509_10646017 Ga0307509_106460171 113
559 3300031507 Ga0307509_10689182 Ga0307509_106891822 113
560 3300031507 Ga0307509_10780701 Ga0307509_107807011 113
561 3300031507 Ga0307509_10891337 Ga0307509_108913372 113
562 3300031548 Ga0307408_100046772 Ga0307408_1000467726 113
563 3300031548 Ga0307408_100311467 Ga0307408_1003114673 113
564 3300031616 Ga0307508_10000404 Ga0307508_1000040441 113
565 3300031616 Ga0307508_10005736 Ga0307508_1000573613 113
566 3300031616 Ga0307508_10011564 Ga0307508_100115645 113
567 3300031616 Ga0307508_10349404 Ga0307508_103494043 113
568 3300031649 Ga0307514_10053594 Ga0307514_100535946 113
569 3300031649 Ga0307514_10058422 Ga0307514_100584223 113
570 3300031649 Ga0307514_10149542 Ga0307514_101495422 113
571 3300031649 Ga0307514_10394112 Ga0307514_103941122 113
572 3300031730 Ga0307516_10009071 Ga0307516_100090719 113
573 3300031730 Ga0307516_10237732 Ga0307516_102377323 113
574 3300031730 Ga0307516_10370119 Ga0307516_103701192 113
575 3300031731 Ga0307405_10006962 Ga0307405_100069626 113
576 3300031824 Ga0307413_10263992 Ga0307413_102639923 113
577 3300031838 Ga0307518_10047827 Ga0307518_100478276 113
578 3300031852 Ga0307410_10916573 Ga0307410_109165732 113
579 3300031901 Ga0307406_10114919 Ga0307406_101149193 113
580 3300031901 Ga0307406_10712935 Ga0307406_107129352 113
581 3300031903 Ga0307407_10907830 Ga0307407_109078302 113
582 3300031911 Ga0307412_10024007 Ga0307412_100240073 113
583 3300031911 Ga0307412_10277509 Ga0307412_102775092 113
584 3300031995 Ga0307409_100000580 Ga0307409_10000058010 113
585 3300032002 Ga0307416_100014097 Ga0307416_1000140976 113
586 3300032002 Ga0307416_100236784 Ga0307416_1002367843 113
587 3300032002 Ga0307416_101955761 Ga0307416_1019557612 113
588 3300032005 Ga0307411_10351244 Ga0307411_103512442 113
589 3300032005 Ga0307411_10521007 Ga0307411_105210071 113
590 3300032005 Ga0307411_10738275 Ga0307411_107382752 113
591 3300032126 Ga0307415_100002051 Ga0307415_1000020517 113
592 3300033179 Ga0307507_10038483 Ga0307507_100384836 113
593 3300033179 Ga0307507_10050992 Ga0307507_100509926 113
594 3300033179 Ga0307507_10161529 Ga0307507_101615294 113
595 3300033180 Ga0307510_10003212 Ga0307510_1000321213 113
596 3300033180 Ga0307510_10059995 Ga0307510_100599956 113
597 3300033180 Ga0307510_10131040 Ga0307510_101310405 113
598 3300033180 Ga0307510_10135291 Ga0307510_101352912 113
599 3300035089 Ga0373944_0194926 Ga0373944_0194926_220_579 113
600 3300035112 Ga0373932_0019983 Ga0373932_0019983_760_1119 113
601 3300035241 Ga0373961_0378091 Ga0373961_0378091_101_463 113
602 3300035691 Ga0373931_0001378 Ga0373931_0001378_5423_5785 113
603 3300035695 Ga0373927_0064689 Ga0373927_0064689_1094_1459 113
604 3300037068 Ga0373925_0552801 Ga0373925_0552801_125_496 113
605 3300037471 Ga0395905_0023956 Ga0395905_0023956_4588_4968 113
606 3300039437 Ga0436365_1640203 Ga0436365_1640203_1871_2233 113
607 3300039450 Ga0436363_1475448 Ga0436363_1475448_623_985 113
608 3300041441 Ga0451787_580127 Ga0451787_580127_117_467 113
609 3300041443 Ga0451789_0198671 Ga0451789_0198671_250_600 113
610 3300041452 Ga0451793_0018596 Ga0451793_0018596_481_831 113
611 3300041452 Ga0451793_1009547 Ga0451793_1009547_101_466 113
612 3300041460 Ga0451802_2074907 Ga0451802_2074907_33_383 113
613 3300041486 Ga0451807_1825296 Ga0451807_1825296_53_403 113
614 3300041491 Ga0451833_1469414 Ga0451833_1469414_195_545 113
615 3300041501 Ga0451845_0977099 Ga0451845_0977099_282_647 113
616 3300041509 Ga0451843_0870225 Ga0451843_0870225_111_491 113
617 3300041512 Ga0451853_0327863 Ga0451853_0327863_233_598 113
618 3300041512 Ga0451853_0350852 Ga0451853_0350852_1017_1376 113
619 3300041512 Ga0451853_3674141 Ga0451853_3674141_229_579 113
620 3300042007 Ga0439449_0343875 Ga0439449_0343875_54_416 113
621 3300042013 Ga0439456_144950 Ga0439456_144950_42_407 113
622 3300042133 Ga0450896_022249 Ga0450896_022249_457_822 113
623 3300042461 Ga0439460_0175468 Ga0439460_0175468_343_705 113
624 3300042532 Ga0450893_0034880 Ga0450893_0034880_122_493 113
625 3300042876 Ga0451577_0004221 Ga0451577_0004221_7660_8031 113
626 3300042876 Ga0451577_0020267 Ga0451577_0020267_1729_2082 113
627 3300042876 Ga0451577_0186853 Ga0451577_0186853_581_937 113
628 3300044673 Ga0453683_0134334 Ga0453683_0134334_860_1216 113
629 3300044712 Ga0453684_0005216 Ga0453684_0005216_15702_16049 113
630 3300044712 Ga0453684_0251708 Ga0453684_0251708_74_427 113
631 3300044712 Ga0453684_0384845 Ga0453684_0384845_888_1244 113
632 3300045051 Ga0451576_0017940 Ga0451576_0017940_4799_5155 113
633 3300045051 Ga0451576_0062948 Ga0451576_0062948_1537_1899 113
634 3300045051 Ga0451576_2164302 Ga0451576_2164302_29_376 113
635 3300046454 Ga0495592_0000083 Ga0495592_0000083_46204_46554 113
636 3300046459 Ga0495629_0311784 Ga0495629_0311784_661_1020 113
637 3300046459 Ga0495629_0365673 Ga0495629_0365673_118_483 113
638 3300046460 Ga0495638_0111579 Ga0495638_0111579_377_742 113
639 3300046471 Ga0495650_0145821 Ga0495650_0145821_491_841 113
640 3300046472 Ga0495580_0018628 Ga0495580_0018628_1109_1471 113
641 3300046475 Ga0495639_0142511 Ga0495639_0142511_663_1028 113
642 3300046507 Ga0495606_0461145 Ga0495606_0461145_193_543 113
643 3300046518 Ga0495631_0051252 Ga0495631_0051252_1139_1498 113
644 3300046519 Ga0495632_0168428 Ga0495632_0168428_464_829 113
645 3300046519 Ga0495632_0283575 Ga0495632_0283575_235_594 113
646 3300046524 Ga0495648_0139642 Ga0495648_0139642_730_1089 113
647 3300046524 Ga0495648_0283877 Ga0495648_0283877_84_434 113
648 3300046537 Ga0495598_0072198 Ga0495598_0072198_300_665 113
649 3300046539 Ga0495621_0024915 Ga0495621_0024915_1601_1966 113
650 3300046616 Ga0495668_0087108 Ga0495668_0087108_917_1276 113
651 3300046660 Ga0495625_0009747 Ga0495625_0009747_2435_2794 113
652 3300046660 Ga0495625_0108748 Ga0495625_0108748_739_1104 113
653 3300046680 Ga0495646_0064363 Ga0495646_0064363_539_889 113
654 3300046683 Ga0495658_0178716 Ga0495658_0178716_891_1256 113
655 3300046683 Ga0495658_0347228 Ga0495658_0347228_196_558 113
656 3300046690 Ga0495624_0016323 Ga0495624_0016323_2008_2367 113
657 3300046691 Ga0495670_0045101 Ga0495670_0045101_703_1068 113
658 3300046692 Ga0495671_0028003 Ga0495671_0028003_2123_2479 113
659 3300046809 Ga0495600_0706943 Ga0495600_0706943_80_439 113
660 3300047315 Ga0495581_0455107 Ga0495581_0455107_149_508 113
661 3300047317 Ga0495604_0254180 Ga0495604_0254180_585_944 113
662 3300047319 Ga0495674_1236223 Ga0495674_1236223_116_475 113
663 3300047321 Ga0495676_0392362 Ga0495676_0392362_312_671 113
664 3300047469 Ga0495673_0152346 Ga0495673_0152346_482_847 113
665 3300047472 Ga0495686_0215174 Ga0495686_0215174_16_366 113
666 3300047673 Ga0495593_0059628 Ga0495593_0059628_501_860 113
667 3300048088 Ga0495602_0316539 Ga0495602_0316539_741_1100 113
668 3300048089 Ga0495614_0056011 Ga0495614_0056011_401_760 113
669 3300048089 Ga0495614_0098532 Ga0495614_0098532_657_1016 113
670 3300048903 Ga0496100_0091111 Ga0496100_0091111_1115_1477 113
671 3300048903 Ga0496100_0112887 Ga0496100_0112887_364_729 113
672 3300048904 Ga0496101_0008293 Ga0496101_0008293_1110_1472 113
673 3300048904 Ga0496101_0303590 Ga0496101_0303590_806_1171 113
674 3300048905 Ga0496102_0018445 Ga0496102_0018445_1309_1677 113
675 3300048905 Ga0496102_0272326 Ga0496102_0272326_201_563 113
676 3300048905 Ga0496102_0503763 Ga0496102_0503763_599_967 113
677 3300048907 Ga0496104_0032470 Ga0496104_0032470_3269_3634 113
678 3300048907 Ga0496104_0055646 Ga0496104_0055646_465_827 113
679 3300048907 Ga0496104_0753854 Ga0496104_0753854_72_437 113
680 3300048907 Ga0496104_1245281 Ga0496104_1245281_215_580 113
681 3300048908 Ga0496105_0073192 Ga0496105_0073192_153_518 113
682 3300048908 Ga0496105_0167701 Ga0496105_0167701_247_612 113
683 3300048909 Ga0496106_0008934 Ga0496106_0008934_1227_1589 113
684 3300048910 Ga0496107_0256318 Ga0496107_0256318_139_504 113
685 3300048911 Ga0496108_0011606 Ga0496108_0011606_5950_6312 113
686 3300048911 Ga0496108_0023125 Ga0496108_0023125_1388_1753 113
687 3300048911 Ga0496108_1030897 Ga0496108_1030897_310_678 113
688 3300048912 Ga0496109_0082364 Ga0496109_0082364_1598_1960 113
689 3300048912 Ga0496109_0082794 Ga0496109_0082794_1912_2277 113
690 3300048913 Ga0496110_0118474 Ga0496110_0118474_1944_2306 113
691 3300048914 Ga0496111_0275498 Ga0496111_0275498_548_910 113
692 3300048915 Ga0496112_0193243 Ga0496112_0193243_460_822 113
693 3300048916 Ga0496113_0067776 Ga0496113_0067776_1886_2254 113
694 3300048916 Ga0496113_0068982 Ga0496113_0068982_1584_1946 113
695 3300048917 Ga0496114_0126437 Ga0496114_0126437_1025_1387 113
696 3300048917 Ga0496114_0559505 Ga0496114_0559505_126_491 113
697 3300048928 Ga0496125_0423925 Ga0496125_0423925_152_499 113
698 3300049649 Ga0501198_037180 Ga0501198_037180_397_747 113
699 3300049656 Ga0501209_276053 Ga0501209_276053_99_449 113
700 3300049682 Ga0501252_000122 Ga0501252_000122_1757_2113 113
701 3300049761 Ga0501264_024709 Ga0501264_024709_233_601 113
702 3300049853 Ga0501226_010804 Ga0501226_010804_180_536 113
703 3300050489 nmdc:mga03683_199333_c1 nmdc:mga03683_199333_c1_433_813 113
704 3300050493 nmdc:mga0k408_119019_c1 nmdc:mga0k408_119019_c1_61_441 113
705 3300050493 nmdc:mga0k408_16652_c1 nmdc:mga0k408_16652_c1_1903_2250 113
706 3300050493 nmdc:mga0k408_267305_c1 nmdc:mga0k408_267305_c1_180_536 113
707 3300050493 nmdc:mga0k408_33581_c1 nmdc:mga0k408_33581_c1_1546_1893 113
708 3300050493 nmdc:mga0k408_590424_c1 nmdc:mga0k408_590424_c1_273_626 113
709 3300050496 nmdc:mga07m45_103137_c1 nmdc:mga07m45_103137_c1_49_405 113
710 3300050496 nmdc:mga07m45_147621_c1 nmdc:mga07m45_147621_c1_147_494 113
711 3300050496 nmdc:mga07m45_48382_c1 nmdc:mga07m45_48382_c1_163_513 113
712 3300050496 nmdc:mga07m45_517306_c1 nmdc:mga07m45_517306_c1_28_387 113
713 3300050496 nmdc:mga07m45_71714_c1 nmdc:mga07m45_71714_c1_360_740 113
714 3300050507 nmdc:mga05p37_2022283_c1 nmdc:mga05p37_2022283_c1_28_390 113
715 3300050511 nmdc:mga08y16_114587_c1 nmdc:mga08y16_114587_c1_680_1042 113
716 3300050512 nmdc:mga0n895_44649_c1 nmdc:mga0n895_44649_c1_2543_2905 113
717 3300050513 nmdc:mga0rr50_182035_c1 nmdc:mga0rr50_182035_c1_865_1227 113
718 3300053080 Ga0500635_0204951 Ga0500635_0204951_142_519 113
719 3300053086 Ga0500578_0000363 Ga0500578_0000363_22094_22459 113
720 3300053088 Ga0500644_0010849 Ga0500644_0010849_1204_1554 113
721 3300053089 Ga0500581_301149 Ga0500581_301149_255_605 113
722 3300053091 Ga0500647_0386792 Ga0500647_0386792_133_498 113
723 3300053093 Ga0500651_0045174 Ga0500651_0045174_638_988 113
724 3300053093 Ga0500651_0319672 Ga0500651_0319672_154_513 113
725 3300053097 Ga0500648_120659 Ga0500648_120659_485_847 113
726 3300053098 Ga0500650_0199384 Ga0500650_0199384_518_883 113
727 3300053108 Ga0500562_033273 Ga0500562_033273_598_978 113
728 3300053117 Ga0500593_000526 Ga0500593_000526_10116_10478 113
729 3300053118 Ga0500594_0004214 Ga0500594_0004214_35_385 113
730 3300053118 Ga0500594_0318097 Ga0500594_0318097_132_512 113
731 3300053120 Ga0500597_335690 Ga0500597_335690_161_541 113
732 3300053133 Ga0500655_018956 Ga0500655_018956_376_726 113
733 3300053136 Ga0500559_0000019 Ga0500559_0000019_98518_98868 113
734 3300053138 Ga0500564_199644 Ga0500564_199644_216_566 113
735 3300053139 Ga0500568_0064970 Ga0500568_0064970_511_891 113
736 3300053139 Ga0500568_0185956 Ga0500568_0185956_107_457 113
737 3300053151 Ga0500604_0018787 Ga0500604_0018787_529_879 113
738 3300053151 Ga0500604_0028615 Ga0500604_0028615_823_1200 113
739 3300053153 Ga0500616_0264849 Ga0500616_0264849_367_717 113
740 3300053154 Ga0500619_000171 Ga0500619_000171_9895_10266 113
741 3300053154 Ga0500619_048118 Ga0500619_048118_28_378 113
742 3300053156 Ga0500622_0003170 Ga0500622_0003170_2763_3113 113
743 3300053156 Ga0500622_0206699 Ga0500622_0206699_126_506 113
744 3300053160 Ga0500633_0246116 Ga0500633_0246116_288_638 113
745 3300053177 Ga0500636_0250282 Ga0500636_0250282_19_399 113
746 3300053736 Ga0500599_054603 Ga0500599_054603_243_593 113
747 3300053739 Ga0500587_006746 Ga0500587_006746_432_782 113
748 3300059426 Ga0590077_062339 Ga0590077_062339_114_494 113
749 iso_pu_bacteria 2585428057 2587724929 113
750 iso_pu_bacteria 2588253510 2588292431 113
751 iso_pu_bacteria 2643221592 2643968189 113
752 iso_pu_bacteria 2643221625 2644142455 113
753 iso_pu_bacteria 2643221648 2644277046 113
754 3300002077 JGI24744J21845_10006631 JGI24744J21845_100066314 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

11

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cpq-assembly1.cif.gz_A cytochrome c' from rhodopseudomonas capsulata 0.9796 35 77
4ulv-assembly1.cif.gz_B cytochrome c prime from shewanella frigidimarina 0.968 35 76
3vrc-assembly1.cif.gz_B crystal structure of cytochrome c' from thermochromatium tepidum 0.9664 37 76
2a7w-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7 0.9663 5 93
1bbh-assembly1.cif.gz_A atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution 0.9552 37 77
ID Description Score Start End Superfamily
af_K7MSJ4_110_274_3.90.1600.10 Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain 0.9764 37 78 3.90.1600.10
2a7wA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9595 5 93 1.10.287.1080
af_Q54P12_52_173_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9558 37 74 1.20.120.230
1bbhA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9552 37 77 1.20.120.10
1z0jB00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9503 35 79 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A536V468-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9941 1 95 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A536WTV4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.985 6 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A126R805-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9827 2 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A7Y5DLF5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9814 5 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A2D6H5Q3-F1-model_v4 deleted 0.9804 5 103

Feature Viewer

pLDDT pTM Quality
88.51 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map