F479246

General Info

Members Datasets Scaffolds Average Seq Length
754 297 1508 270

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10083144|Ga0070681_100831441
Length 309
Sequence VVLGRRAQCSARARKDECRQRREPFAEPGLPGRERKAARGVRVFVVSDMEGVAGIVKWQQVTGGHAMYEEGRRLYTGEINAAVRGAKAAGASEIVVMDCHGAGEGWTFNSLIPEELDSDCEYVVQNEWTEYTQYLEEGVDAALFVGMHAMAGTRDGVLAHTVSGSSWWRLRFNGVEVGETGINAALCGAWNCPVVLVTGDEAACREGRKLLGPGVTVAAVKKGLGRFSARQFPATRARELIEDAARKAVENRAAVAPYDPGSPCEILVDFNTSDHVEKYRYRSGVEITGSRQISSRADDWWTAWRQFFF

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 11.8
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 8.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10083144 3300005458 Bacteria 3155
2 JGI24744J21845_10013602 3300002077 Bacteria 1639
3 JGI24742J22300_10002118 3300002244 Bacteria 3156
4 JGI25407J50210_10013808 3300003373 Bacteria 2078
5 Ga0070658_10007804 3300005327 Bacteria 8622
6 Ga0070658_10339576 3300005327 Bacteria 1285
7 Ga0070683_100001807 3300005329 Bacteria 16677
8 Ga0070683_100015246 3300005329 Bacteria 6748
9 Ga0070683_100023360 3300005329 Bacteria 5530
10 Ga0070683_100098437 3300005329 Bacteria 2753
11 Ga0070683_100137368 3300005329 Bacteria 2315
12 Ga0070690_100005751 3300005330 Bacteria 6987
13 Ga0070680_100008062 3300005336 Bacteria 8043
14 Ga0070680_100103828 3300005336 Bacteria 2361
15 Ga0070680_100180543 3300005336 Bacteria 1778
16 Ga0070682_100008224 3300005337 Bacteria 5882
17 Ga0070682_100025219 3300005337 Bacteria 3546
18 Ga0068868_100011349 3300005338 Bacteria 6487
19 Ga0070660_100003035 3300005339 Bacteria 11560
20 Ga0070660_100006777 3300005339 Bacteria 7951
21 Ga0070660_100009442 3300005339 Bacteria 6861
22 Ga0070660_100033558 3300005339 Bacteria 3869
23 Ga0070660_100150888 3300005339 Bacteria 1868
24 Ga0070660_100215315 3300005339 Bacteria 1560
25 Ga0070689_100011030 3300005340 Bacteria 6460
26 Ga0070687_100038582 3300005343 Bacteria 2395
27 Ga0070661_100106510 3300005344 Bacteria 2090
28 Ga0070692_10002790 3300005345 Bacteria 6889
29 Ga0070668_100008082 3300005347 Bacteria 7814
30 Ga0070669_100226526 3300005353 Bacteria 1480
31 Ga0070675_100066590 3300005354 Bacteria 2980
32 Ga0070671_100243927 3300005355 Bacteria 1525
33 Ga0070674_100005620 3300005356 Bacteria 7260
34 Ga0070673_100204650 3300005364 Bacteria 1701
35 Ga0070688_100072399 3300005365 Bacteria 2208
36 Ga0070659_100008764 3300005366 Bacteria 7403
37 Ga0070659_100222678 3300005366 Bacteria 1558
38 Ga0070709_10030882 3300005434 Bacteria 3219
39 Ga0070714_100005101 3300005435 Bacteria 9990
40 Ga0070714_100013785 3300005435 Bacteria 6481
41 Ga0070714_100153441 3300005435 Bacteria 2077
42 Ga0070714_100230865 3300005435 Unclassified 1704
43 Ga0070714_100297585 3300005435 Bacteria 1503
44 Ga0070714_100349166 3300005435 Bacteria 1389
45 Ga0070713_100156423 3300005436 Bacteria 2032
46 Ga0070713_100177585 3300005436 Bacteria 1912
47 Ga0070713_100185605 3300005436 Bacteria 1871
48 Ga0070710_10007127 3300005437 Bacteria 5400
49 Ga0070710_10023475 3300005437 Bacteria 3243
50 Ga0070701_10002508 3300005438 Bacteria 7091
51 Ga0070711_100007387 3300005439 Bacteria 6684
52 Ga0070711_100017465 3300005439 Bacteria 4569
53 Ga0070711_100069436 3300005439 Bacteria 2478
54 Ga0070711_100086149 3300005439 Bacteria 2252
55 Ga0070705_100087041 3300005440 Bacteria 1936
56 Ga0070700_100000619 3300005441 Bacteria 17639
57 Ga0070694_100027870 3300005444 Bacteria 3672
58 Ga0070694_100071277 3300005444 Bacteria 2395
59 Ga0070708_100003802 3300005445 Bacteria 11842
60 Ga0070708_100134153 3300005445 Unclassified 2292
61 Ga0070663_100041683 3300005455 Bacteria 3222
62 Ga0070678_100001059 3300005456 Bacteria 14356
63 Ga0070662_100031825 3300005457 Bacteria 3705
64 Ga0070681_10025296 3300005458 Bacteria 5971
65 Ga0070681_10062918 3300005458 Bacteria 3683
66 Ga0070681_10066967 3300005458 Unclassified 3560
67 Ga0070681_10108544 3300005458 Bacteria 2715
68 Ga0070681_10163743 3300005458 Bacteria 2147
69 Ga0070681_10246629 3300005458 Bacteria 1699
70 Ga0068867_100000785 3300005459 Bacteria 21474
71 Ga0070685_10125658 3300005466 Bacteria 1597
72 Ga0070706_100083178 3300005467 Bacteria 2965
73 Ga0070706_100321729 3300005467 Bacteria 1442
74 Ga0070707_100001216 3300005468 Bacteria 25361
75 Ga0070707_100006490 3300005468 Bacteria 10866
76 Ga0070698_100040271 3300005471 Bacteria 4803
77 Ga0070698_100050985 3300005471 Bacteria 4217
78 Ga0070698_100162549 3300005471 Unclassified 2176
79 Ga0070698_100473892 3300005471 Bacteria 1188
80 Ga0070699_100012338 3300005518 Bacteria 7373
81 Ga0070699_100044968 3300005518 Bacteria 3822
82 Ga0070679_100009551 3300005530 Bacteria 9176
83 Ga0070679_100024215 3300005530 Bacteria 5949
84 Ga0070679_100037712 3300005530 Bacteria 4802
85 Ga0070679_100096904 3300005530 Bacteria 2937
86 Ga0070679_100152707 3300005530 Bacteria 2285
87 Ga0070679_100181875 3300005530 Bacteria 2074
88 Ga0070684_100017413 3300005535 Bacteria 5897
89 Ga0070684_100077809 3300005535 Bacteria 2930
90 Ga0070684_100228716 3300005535 Bacteria 1698
91 Ga0070684_100450312 3300005535 Bacteria 1190
92 Ga0070697_100149186 3300005536 Bacteria 1970
93 Ga0070697_100255284 3300005536 Unclassified 1500
94 Ga0068853_100058945 3300005539 Bacteria 3315
95 Ga0068853_100092260 3300005539 Bacteria 2664
96 Ga0068853_100265514 3300005539 Bacteria 1579
97 Ga0070672_100014882 3300005543 Bacteria 5523
98 Ga0070686_100004879 3300005544 Bacteria 7401
99 Ga0070696_100032017 3300005546 Bacteria 3606
100 Ga0070665_100012078 3300005548 Bacteria 8712
101 Ga0070704_100018317 3300005549 Bacteria 4475
102 Ga0070704_100159020 3300005549 Bacteria 1785
103 Ga0070704_100285653 3300005549 Bacteria 1369
104 Ga0068855_100099066 3300005563 Bacteria 3357
105 Ga0068855_100527966 3300005563 Unclassified 1280
106 Ga0068857_100042464 3300005577 Bacteria 4034
107 Ga0068857_100652265 3300005577 Unclassified 998
108 Ga0068856_100007387 3300005614 Bacteria 10726
109 Ga0068856_100036810 3300005614 Bacteria 4798
110 Ga0070702_100029815 3300005615 Bacteria 2971
111 Ga0068852_100152206 3300005616 Bacteria 2152
112 Ga0068852_100661710 3300005616 Bacteria 1052
113 Ga0068859_100357455 3300005617 Bacteria 1555
114 Ga0068866_10008894 3300005718 Bacteria 4249
115 Ga0068861_100090489 3300005719 Bacteria 2414
116 Ga0068863_100274600 3300005841 Bacteria 1632
117 Ga0081538_10000918 3300005981 Bacteria 31780
118 Ga0081538_10001814 3300005981 Bacteria 21497
119 Ga0081539_10005765 3300005985 Bacteria 12352
120 Ga0081539_10031298 3300005985 Bacteria 3282
121 Ga0070717_10007564 3300006028 Bacteria 8073
122 Ga0070717_10115193 3300006028 Bacteria 2297
123 Ga0070717_10126472 3300006028 Bacteria 2194
124 Ga0070717_10202192 3300006028 Bacteria 1740
125 Ga0070717_10319121 3300006028 Bacteria 1384
126 Ga0070717_10450105 3300006028 Bacteria 1160
127 Ga0075364_10340166 3300006051 Unclassified 1022
128 Ga0070715_10059811 3300006163 Bacteria 1668
129 Ga0070716_100044921 3300006173 Unclassified 2477
130 Ga0070712_100004696 3300006175 Bacteria 8445
131 Ga0070712_100022839 3300006175 Bacteria 4124
132 Ga0070712_100050798 3300006175 Bacteria 2887
133 Ga0070712_100074724 3300006175 Bacteria 2436
134 Ga0070712_100240459 3300006175 Bacteria 1442
135 Ga0097621_100002499 3300006237 Bacteria 12601
136 Ga0097621_100166943 3300006237 Bacteria 1895
137 Ga0097621_100642532 3300006237 Bacteria 973
138 Ga0068871_100014567 3300006358 Bacteria 5865
139 Ga0068865_100003265 3300006881 Bacteria 9707
140 Ga0075436_100418462 3300006914 Bacteria 973
141 Ga0097620_100357476 3300006931 Bacteria 1555
142 Ga0075435_100039944 3300007076 Bacteria 3746
143 Ga0075435_100103080 3300007076 Bacteria 2366
144 Ga0105240_10015546 3300009093 Bacteria 10344
145 Ga0105240_10023383 3300009093 Bacteria 8173
146 Ga0105240_10053856 3300009093 Bacteria 5047
147 Ga0105240_10713590 3300009093 Bacteria 1093
148 Ga0105245_10065693 3300009098 Bacteria 3281
149 Ga0105245_10078124 3300009098 Unclassified 3020
150 Ga0105245_10099365 3300009098 Bacteria 2690
151 Ga0105245_10516536 3300009098 Bacteria 1212
152 Ga0105247_10035630 3300009101 Bacteria 3034
153 Ga0114129_10104212 3300009147 Bacteria 3920
154 Ga0114129_10163337 3300009147 Bacteria 3041
155 Ga0105243_10009832 3300009148 Bacteria 7279
156 Ga0105243_10023720 3300009148 Bacteria 4676
157 Ga0105243_10309753 3300009148 Bacteria 1434
158 Ga0105241_10149113 3300009174 Bacteria 1912
159 Ga0105242_10005266 3300009176 Bacteria 9987
160 Ga0105242_10041712 3300009176 Bacteria 3703
161 Ga0105248_10127222 3300009177 Bacteria 2874
162 Ga0105248_10203534 3300009177 Unclassified 2230
163 Ga0105237_10081192 3300009545 Bacteria 3233
164 Ga0105237_10222440 3300009545 Bacteria 1888
165 Ga0105238_10016197 3300009551 Bacteria 7544
166 Ga0105249_10003100 3300009553 Bacteria 14354
167 Ga0105239_10012473 3300010375 Bacteria 9464
168 Ga0105239_10640920 3300010375 Bacteria 1213
169 Ga0105246_10157495 3300011119 Bacteria 1727
170 Ga0105246_10224365 3300011119 Archaea 1475
171 Ga0157370_10040266 3300013104 Bacteria 4512
172 Ga0157370_10098346 3300013104 Bacteria 2744
173 Ga0157370_10416099 3300013104 Bacteria 1237
174 Ga0157369_10001071 3300013105 Bacteria 34352
175 Ga0157369_10039620 3300013105 Bacteria 5149
176 Ga0157369_10179108 3300013105 Bacteria 2231
177 Ga0157369_10212732 3300013105 Bacteria 2026
178 Ga0157369_10218939 3300013105 Bacteria 1993
179 Ga0157369_10364740 3300013105 Bacteria 1500
180 Ga0157374_10016438 3300013296 Bacteria 6504
181 Ga0157374_10100570 3300013296 Bacteria 2771
182 Ga0157374_10110412 3300013296 Unclassified 2645
183 Ga0157374_10599154 3300013296 Bacteria 1112
184 Ga0157378_10053836 3300013297 Bacteria 3583
185 Ga0163162_10052705 3300013306 Bacteria 4087
186 Ga0157372_10015441 3300013307 Bacteria 8184
187 Ga0157372_10084322 3300013307 Bacteria 3601
188 Ga0157372_10096848 3300013307 Bacteria 3363
189 Ga0157372_10351247 3300013307 Bacteria 1718
190 Ga0157372_10530106 3300013307 Bacteria 1373
191 Ga0157375_10006704 3300013308 Bacteria 10032
192 Ga0182008_10013089 3300014497 Bacteria 4364
193 Ga0182008_10230383 3300014497 Bacteria 950
194 Ga0157377_10001695 3300014745 Bacteria 9605
195 Ga0157379_10384676 3300014968 Bacteria 1288
196 Ga0157376_10076748 3300014969 Bacteria 2856
197 Ga0157376_10464502 3300014969 Bacteria 1237
198 Ga0182007_10011693 3300015262 Bacteria 3408
199 Ga0197907_10014689 3300020069 Bacteria 4870
200 Ga0206356_11151171 3300020070 Bacteria 1033
201 Ga0206353_10393701 3300020082 Bacteria 12377
202 Ga0206353_10701498 3300020082 Bacteria 3985
203 Ga0206353_10871076 3300020082 Bacteria 3435
204 Ga0206353_11082925 3300020082 Bacteria 1963
205 Ga0213876_10119501 3300021384 Bacteria 1399
206 Ga0213875_10000139 3300021388 Bacteria 79384
207 Ga0207692_10006035 3300025898 Bacteria 4898
208 Ga0207692_10085127 3300025898 Bacteria 1700
209 Ga0207642_10002889 3300025899 Bacteria 5375
210 Ga0207642_10022311 3300025899 Unclassified 2508
211 Ga0207710_10064378 3300025900 Bacteria 1670
212 Ga0207688_10264393 3300025901 Bacteria 1045
213 Ga0207647_10080306 3300025904 Bacteria 1956
214 Ga0207699_10021459 3300025906 Bacteria 3481
215 Ga0207699_10057259 3300025906 Bacteria 2327
216 Ga0207705_10017685 3300025909 Bacteria 5100
217 Ga0207705_10094381 3300025909 Bacteria 2194
218 Ga0207684_10150919 3300025910 Bacteria 1999
219 Ga0207684_10266530 3300025910 Unclassified 1478
220 Ga0207684_10268349 3300025910 Bacteria 1472
221 Ga0207654_10078493 3300025911 Bacteria 1981
222 Ga0207654_10360573 3300025911 Unclassified 1003
223 Ga0207707_10004008 3300025912 Bacteria 13068
224 Ga0207707_10004433 3300025912 Bacteria 12371
225 Ga0207707_10022674 3300025912 Bacteria 5491
226 Ga0207707_10070087 3300025912 Bacteria 3055
227 Ga0207707_10132968 3300025912 Bacteria 2176
228 Ga0207695_10199635 3300025913 Bacteria 1915
229 Ga0207695_10218919 3300025913 Bacteria 1812
230 Ga0207695_10244182 3300025913 Bacteria 1696
231 Ga0207671_10173186 3300025914 Bacteria 1677
232 Ga0207693_10000932 3300025915 Bacteria 26301
233 Ga0207693_10001268 3300025915 Bacteria 22513
234 Ga0207693_10014948 3300025915 Bacteria 6233
235 Ga0207693_10159235 3300025915 Bacteria 1776
236 Ga0207693_10237805 3300025915 Bacteria 1430
237 Ga0207663_10011702 3300025916 Bacteria 4719
238 Ga0207663_10055905 3300025916 Bacteria 2478
239 Ga0207660_10111515 3300025917 Unclassified 2059
240 Ga0207660_10117020 3300025917 Bacteria 2014
241 Ga0207660_10286218 3300025917 Bacteria 1309
242 Ga0207662_10006932 3300025918 Bacteria 6145
243 Ga0207657_10000220 3300025919 Bacteria 59453
244 Ga0207657_10002441 3300025919 Bacteria 20078
245 Ga0207657_10002509 3300025919 Bacteria 19862
246 Ga0207657_10026950 3300025919 Bacteria 5270
247 Ga0207657_10166608 3300025919 Bacteria 1787
248 Ga0207657_10249423 3300025919 Bacteria 1415
249 Ga0207657_10346522 3300025919 Unclassified 1172
250 Ga0207649_10255752 3300025920 Bacteria 1263
251 Ga0207652_10010577 3300025921 Bacteria 7427
252 Ga0207652_10047039 3300025921 Bacteria 3684
253 Ga0207652_10234368 3300025921 Unclassified 1654
254 Ga0207652_10349441 3300025921 Bacteria 1334
255 Ga0207652_10547076 3300025921 Bacteria 1041
256 Ga0207646_10005761 3300025922 Bacteria 12982
257 Ga0207646_10013641 3300025922 Bacteria 7761
258 Ga0207694_10316971 3300025924 Bacteria 1286
259 Ga0207659_10207118 3300025926 Bacteria 1570
260 Ga0207687_10010840 3300025927 Bacteria 5958
261 Ga0207700_10119806 3300025928 Bacteria 2132
262 Ga0207700_10139750 3300025928 Bacteria 1988
263 Ga0207700_10491528 3300025928 Bacteria 1085
264 Ga0207664_10089937 3300025929 Unclassified 2515
265 Ga0207664_10313728 3300025929 Bacteria 1382
266 Ga0207664_10481137 3300025929 Bacteria 1111
267 Ga0207690_10067222 3300025932 Bacteria 2457
268 Ga0207706_10049696 3300025933 Bacteria 3706
269 Ga0207706_10113134 3300025933 Bacteria 2388
270 Ga0207686_10003526 3300025934 Bacteria 8403
271 Ga0207709_10004784 3300025935 Bacteria 7760
272 Ga0207669_10064169 3300025937 Bacteria 2271
273 Ga0207704_10001037 3300025938 Bacteria 12339
274 Ga0207665_10114586 3300025939 Unclassified 1898
275 Ga0207691_10006258 3300025940 Bacteria 11493
276 Ga0207661_10043242 3300025944 Bacteria 3555
277 Ga0207661_10152644 3300025944 Bacteria 1997
278 Ga0207661_10219730 3300025944 Bacteria 1679
279 Ga0207661_10266599 3300025944 Bacteria 1527
280 Ga0207679_10207732 3300025945 Bacteria 1640
281 Ga0207667_10111863 3300025949 Bacteria 2816
282 Ga0207712_10034192 3300025961 Bacteria 3443
283 Ga0207712_10159645 3300025961 Bacteria 1751
284 Ga0207668_10014814 3300025972 Bacteria 4833
285 Ga0207668_10232324 3300025972 Unclassified 1488
286 Ga0207640_10072154 3300025981 Bacteria 2328
287 Ga0207677_10242560 3300026023 Bacteria 1459
288 Ga0207677_10291605 3300026023 Bacteria 1344
289 Ga0207639_10259321 3300026041 Bacteria 1519
290 Ga0207678_10030917 3300026067 Bacteria 4674
291 Ga0207678_10228815 3300026067 Bacteria 1592
292 Ga0207708_10001150 3300026075 Bacteria 19902
293 Ga0207708_10229562 3300026075 Unclassified 1490
294 Ga0207702_10007662 3300026078 Bacteria 9180
295 Ga0207702_10031934 3300026078 Bacteria 4392
296 Ga0207702_10209195 3300026078 Bacteria 1813
297 Ga0207648_10018507 3300026089 Bacteria 6304
298 Ga0207674_10028737 3300026116 Bacteria 5865
299 Ga0207674_10062027 3300026116 Bacteria 3776
300 Ga0207674_10594757 3300026116 Unclassified 1069
301 Ga0207675_100070757 3300026118 Bacteria 3260
302 Ga0207683_10003171 3300026121 Bacteria 14356
303 Ga0207698_10588545 3300026142 Bacteria 1095
304 Ga0268266_10037261 3300028379 Bacteria 4144
305 Ga0265318_10077709 3300028577 Bacteria 1227
306 Ga0265338_10300125 3300028800 Bacteria 1168
307 Ga0265325_10024734 3300031241 Unclassified 3264
308 Ga0265339_10020362 3300031249 Unclassified 3877
309 Ga0265327_10004501 3300031251 Bacteria 12302
310 Ga0265327_10023721 3300031251 Bacteria 3624
311 Ga0265327_10027455 3300031251 Unclassified 3275
312 Ga0265316_10018679 3300031344 Bacteria 5954
313 Ga0265313_10005636 3300031595 Bacteria 9149
314 Ga0265314_10011206 3300031711 Bacteria 7422
315 Ga0265314_10126634 3300031711 Bacteria 1599
316 Ga0316578_10112081 3300031728 Bacteria 1639
317 Ga0307409_100059402 3300031995 Bacteria 2975
318 Ga0316593_10110335 3300032168 Bacteria 982
319 Ga0373926_0006929 3300035083 Bacteria 3767
320 Ga0373944_0009796 3300035089 Bacteria 2605
321 Ga0373949_0066128 3300035090 Bacteria 939
322 Ga0373936_0008829 3300035113 Bacteria 3797
323 Ga0373936_0019566 3300035113 Bacteria 2624
324 Ga0373945_0001928 3300035116 Bacteria 6439
325 Ga0373945_0019464 3300035116 Bacteria 2318
326 Ga0373956_0105791 3300035119 Bacteria 1308
327 Ga0373943_0000138 3300035170 Bacteria 27619
328 Ga0373946_0003446 3300035171 Bacteria 5616
329 Ga0373946_0005779 3300035171 Bacteria 4476
330 Ga0373955_0075767 3300035172 Bacteria 1891
331 Ga0373935_0022735 3300035692 Bacteria 3849
332 Ga0373935_0057206 3300035692 Bacteria 2488
333 Ga0373935_0086396 3300035692 Bacteria 2047
334 Ga0373927_0012766 3300035695 Bacteria 5589
335 Ga0373927_0254221 3300035695 Bacteria 1155
336 Ga0373933_0027770 3300035724 Unclassified 3262
337 Ga0373947_0000780 3300035725 Bacteria 19144
338 Ga0373947_0004021 3300035725 Bacteria 8639
339 Ga0373947_0048862 3300035725 Bacteria 2539
340 Ga0373937_0106553 3300036401 Bacteria 2605
341 Ga0373937_0324088 3300036401 Unclassified 1458
342 Ga0373925_0126699 3300037068 Bacteria 1987
343 Ga0395899_0011656 3300037312 Bacteria 6729
344 Ga0395899_0012524 3300037312 Bacteria 6499
345 Ga0395899_0026143 3300037312 Bacteria 4406
346 Ga0395899_0094571 3300037312 Bacteria 2162
347 Ga0395900_0004292 3300037418 Bacteria 15113
348 Ga0395900_0014640 3300037418 Bacteria 7999
349 Ga0395900_0024178 3300037418 Bacteria 6221
350 Ga0395900_0033988 3300037418 Bacteria 5248
351 Ga0395900_0144220 3300037418 Bacteria 2436
352 Ga0395900_0265826 3300037418 Unclassified 1711
353 Ga0395900_0448252 3300037418 Unclassified 1247
354 Ga0395898_0010255 3300037466 Bacteria 9808
355 Ga0395898_0022429 3300037466 Bacteria 6395
356 Ga0395898_0027273 3300037466 Bacteria 5736
357 Ga0395898_0036075 3300037466 Bacteria 4912
358 Ga0395898_0068529 3300037466 Bacteria 3433
359 Ga0395898_0220904 3300037466 Bacteria 1807
360 Ga0395898_0282127 3300037466 Bacteria 1584
361 Ga0395898_0287050 3300037466 Unclassified 1570
362 Ga0395898_0352211 3300037466 Bacteria 1404
363 Ga0395898_0377474 3300037466 Bacteria 1352
364 Ga0395905_0019083 3300037471 Bacteria 6504
365 Ga0395905_0034534 3300037471 Bacteria 4749
366 Ga0395905_0099413 3300037471 Bacteria 2732
367 Ga0395905_0216880 3300037471 Bacteria 1791
368 Ga0395905_0223817 3300037471 Unclassified 1761
369 Ga0395905_0295135 3300037471 Bacteria 1508
370 Ga0395905_0354114 3300037471 Bacteria 1360
371 Ga0316581_0024173 3300037588 Bacteria 1800
372 Ga0436364_0070103 3300037853 Bacteria 509097
373 Ga0436364_0882234 3300037853 Bacteria 1998
374 Ga0395901_0004913 3300038443 Bacteria 13490
375 Ga0395901_0021596 3300038443 Bacteria 6595
376 Ga0395901_0028453 3300038443 Bacteria 5747
377 Ga0395901_0071855 3300038443 Bacteria 3606
378 Ga0395901_0075626 3300038443 Bacteria 3513
379 Ga0395901_0107206 3300038443 Bacteria 2932
380 Ga0395901_0114070 3300038443 Bacteria 2838
381 Ga0395901_0129466 3300038443 Bacteria 2652
382 Ga0395901_0129965 3300038443 Unclassified 2646
383 Ga0395901_0173997 3300038443 Bacteria 2258
384 Ga0395901_0209557 3300038443 Bacteria 2040
385 Ga0395901_0240889 3300038443 Bacteria 1887
386 Ga0395901_0264980 3300038443 Bacteria 1788
387 Ga0395901_0281030 3300038443 Bacteria 1729
388 Ga0395901_0287759 3300038443 Unclassified 1706
389 Ga0395901_0419581 3300038443 Bacteria 1372
390 Ga0395901_0447256 3300038443 Bacteria 1322
391 Ga0395901_0452429 3300038443 Bacteria 1313
392 Ga0436365_1562679 3300039437 Bacteria 1478
393 Ga0436362_1106946 3300039453 Unclassified 1098
394 Ga0451839_0267739 3300041496 Bacteria 4032
395 Ga0451849_1211443 3300041505 Bacteria 1618
396 Ga0451855_1850265 3300041511 Bacteria 1541
397 Ga0466972_0142458 3300044658 Bacteria 1128
398 Ga0466965_0067372 3300044683 Unclassified 1797
399 Ga0466966_0004970 3300044684 Bacteria 8740
400 Ga0466966_0039063 3300044684 Bacteria 3057
401 Ga0466961_0001191 3300044693 Bacteria 16033
402 Ga0466961_0008399 3300044693 Bacteria 6577
403 Ga0466961_0046054 3300044693 Bacteria 2790
404 Ga0466961_0131748 3300044693 Bacteria 1567
405 Ga0466961_0132020 3300044693 Bacteria 1565
406 Ga0466961_0162175 3300044693 Unclassified 1393
407 Ga0466963_0000216 3300044694 Bacteria 24575
408 Ga0466963_0002945 3300044694 Bacteria 9623
409 Ga0466963_0003754 3300044694 Bacteria 8746
410 Ga0466963_0009526 3300044694 Bacteria 5850
411 Ga0466963_0011577 3300044694 Bacteria 5370
412 Ga0466963_0023702 3300044694 Bacteria 3901
413 Ga0466963_0025022 3300044694 Bacteria 3804
414 Ga0466963_0027679 3300044694 Bacteria 3632
415 Ga0466963_0045874 3300044694 Bacteria 2879
416 Ga0466963_0057032 3300044694 Bacteria 2600
417 Ga0466963_0077346 3300044694 Bacteria 2248
418 Ga0466963_0154646 3300044694 Bacteria 1594
419 Ga0466963_0235946 3300044694 Bacteria 1282
420 Ga0466964_0015238 3300044706 Bacteria 2926
421 Ga0466964_0019024 3300044706 Bacteria 2639
422 Ga0466964_0206423 3300044706 Bacteria 946
423 Ga0466971_0005236 3300044719 Bacteria 5616
424 Ga0466971_0005761 3300044719 Bacteria 5387
425 Ga0466971_0017434 3300044719 Bacteria 3177
426 Ga0466971_0040908 3300044719 Bacteria 2082
427 Ga0466968_0003170 3300044735 Bacteria 6070
428 Ga0466968_0082233 3300044735 Bacteria 1417
429 Ga0466968_0109436 3300044735 Bacteria 1241
430 Ga0466970_0124841 3300044765 Bacteria 1411
431 Ga0466957_0001257 3300044842 Bacteria 13198
432 Ga0466957_0001822 3300044842 Bacteria 11234
433 Ga0466957_0038979 3300044842 Bacteria 2865
434 Ga0466957_0044720 3300044842 Unclassified 2684
435 Ga0466957_0053471 3300044842 Bacteria 2462
436 Ga0466957_0077983 3300044842 Bacteria 2059
437 Ga0466957_0123022 3300044842 Bacteria 1655
438 Ga0466957_0132642 3300044842 Unclassified 1598
439 Ga0466957_0233570 3300044842 Bacteria 1218
440 Ga0466960_0009798 3300044901 Bacteria 3961
441 Ga0466960_0102199 3300044901 Bacteria 1478
442 Ga0466959_0014922 3300045049 Bacteria 5660
443 Ga0466959_0043506 3300045049 Bacteria 3311
444 Ga0466959_0045832 3300045049 Bacteria 3219
445 Ga0466959_0104607 3300045049 Bacteria 2025
446 Ga0466959_0205685 3300045049 Bacteria 1369
447 Ga0466959_0208241 3300045049 Bacteria 1359
448 Ga0466959_0222926 3300045049 Bacteria 1307
449 Ga0451576_0258718 3300045051 Bacteria 1819
450 Ga0466958_0014306 3300045836 Bacteria 4531
451 Ga0466958_0075499 3300045836 Bacteria 2067
452 Ga0466958_0098217 3300045836 Bacteria 1818
453 Ga0466958_0101665 3300045836 Bacteria 1788
454 Ga0466958_0153040 3300045836 Bacteria 1455
455 Ga0466958_0317952 3300045836 Bacteria 1000
456 Ga0466958_0322039 3300045836 Bacteria 994
457 Ga0466967_0000590 3300045976 Bacteria 17986
458 Ga0466967_0001203 3300045976 Bacteria 14562
459 Ga0466967_0002361 3300045976 Bacteria 11685
460 Ga0466967_0003509 3300045976 Bacteria 10249
461 Ga0466967_0004227 3300045976 Bacteria 9635
462 Ga0466967_0010862 3300045976 Bacteria 6859
463 Ga0466967_0025106 3300045976 Bacteria 4909
464 Ga0466967_0036129 3300045976 Bacteria 4215
465 Ga0466967_0039898 3300045976 Bacteria 4039
466 Ga0466967_0043542 3300045976 Bacteria 3887
467 Ga0466967_0047045 3300045976 Bacteria 3759
468 Ga0466967_0077679 3300045976 Bacteria 2989
469 Ga0466967_0087447 3300045976 Bacteria 2825
470 Ga0466967_0112980 3300045976 Unclassified 2498
471 Ga0466967_0114204 3300045976 Bacteria 2486
472 Ga0466967_0131176 3300045976 Unclassified 2326
473 Ga0466967_0202967 3300045976 Bacteria 1878
474 Ga0466967_0253840 3300045976 Archaea 1681
475 Ga0466967_0290937 3300045976 Bacteria 1569
476 Ga0466967_0319999 3300045976 Bacteria 1496
477 Ga0466967_0374042 3300045976 Bacteria 1382
478 Ga0466967_0456655 3300045976 Bacteria 1249
479 Ga0466967_0469754 3300045976 Bacteria 1231
480 Ga0466967_0575966 3300045976 Bacteria 1109
481 Ga0466967_0825384 3300045976 Bacteria 921
482 Ga0495592_0023712 3300046454 Bacteria 4667
483 Ga0495592_0026104 3300046454 Bacteria 4432
484 Ga0495592_0044909 3300046454 Bacteria 3299
485 Ga0495629_0004586 3300046459 Bacteria 10337
486 Ga0495629_0017675 3300046459 Bacteria 5111
487 Ga0495641_0000345 3300046461 Bacteria 38081
488 Ga0495641_0000988 3300046461 Bacteria 24404
489 Ga0495641_0083977 3300046461 Bacteria 1426
490 Ga0495651_0168595 3300046462 Bacteria 1561
491 Ga0495651_0241211 3300046462 Bacteria 1239
492 Ga0495653_0012552 3300046463 Bacteria 6918
493 Ga0495653_0082357 3300046463 Bacteria 2375
494 Ga0495653_0209247 3300046463 Bacteria 1318
495 Ga0495653_0352368 3300046463 Bacteria 946
496 Ga0495580_0009358 3300046472 Bacteria 7708
497 Ga0495582_0000703 3300046473 Bacteria 18466
498 Ga0495582_0002677 3300046473 Bacteria 9944
499 Ga0495582_0017739 3300046473 Bacteria 3892
500 Ga0495582_0031456 3300046473 Bacteria 2916
501 Ga0495582_0050258 3300046473 Bacteria 2297
502 Ga0495582_0065423 3300046473 Bacteria 2009
503 Ga0495605_0059087 3300046474 Bacteria 1842
504 Ga0495639_0000185 3300046475 Bacteria 33068
505 Ga0495639_0003743 3300046475 Bacteria 6543
506 Ga0495639_0054834 3300046475 Bacteria 1817
507 Ga0495662_0000116 3300046476 Bacteria 30019
508 Ga0495662_0000853 3300046476 Bacteria 14869
509 Ga0495664_0003908 3300046477 Bacteria 8132
510 Ga0495664_0021736 3300046477 Bacteria 3707
511 Ga0495664_0040604 3300046477 Bacteria 2752
512 Ga0495584_0059470 3300046491 Bacteria 1922
513 Ga0495594_0093684 3300046499 Bacteria 1685
514 Ga0495596_0035080 3300046500 Bacteria 1990
515 Ga0495608_0057228 3300046511 Bacteria 2573
516 Ga0495608_0257520 3300046511 Bacteria 1087
517 Ga0495618_0024008 3300046514 Bacteria 3774
518 Ga0495618_0068582 3300046514 Bacteria 2255
519 Ga0495618_0211462 3300046514 Bacteria 1226
520 Ga0495628_0030093 3300046516 Bacteria 4397
521 Ga0495628_0211529 3300046516 Unclassified 1458
522 Ga0495630_0001166 3300046517 Bacteria 18157
523 Ga0495630_0018782 3300046517 Bacteria 5079
524 Ga0495630_0055185 3300046517 Bacteria 2977
525 Ga0495630_0055497 3300046517 Bacteria 2969
526 Ga0495630_0138838 3300046517 Bacteria 1847
527 Ga0495637_0154731 3300046520 Unclassified 863
528 Ga0495663_0080539 3300046525 Bacteria 1048
529 Ga0495666_0000602 3300046526 Bacteria 16116
530 Ga0495666_0047185 3300046526 Bacteria 2075
531 Ga0495642_0127140 3300046528 Bacteria 1096
532 Ga0495652_0006005 3300046529 Bacteria 11359
533 Ga0495652_0238437 3300046529 Bacteria 1355
534 Ga0495665_0000433 3300046531 Bacteria 21230
535 Ga0495665_0040988 3300046531 Unclassified 2465
536 Ga0495665_0082267 3300046531 Bacteria 1692
537 Ga0495640_0001987 3300046533 Bacteria 16309
538 Ga0495640_0017059 3300046533 Bacteria 5419
539 Ga0495640_0070293 3300046533 Bacteria 2352
540 Ga0495586_0013357 3300046535 Bacteria 4354
541 Ga0495586_0042827 3300046535 Bacteria 2438
542 Ga0495587_0029904 3300046536 Bacteria 3305
543 Ga0495587_0253781 3300046536 Unclassified 988
544 Ga0495645_0051939 3300046543 Bacteria 2983
545 Ga0495645_0078004 3300046543 Bacteria 2381
546 Ga0495645_0083114 3300046543 Bacteria 2295
547 Ga0495645_0200843 3300046543 Bacteria 1352
548 Ga0495667_0061581 3300046559 Unclassified 2460
549 Ga0495667_0080491 3300046559 Bacteria 2117
550 Ga0495634_0030112 3300046642 Bacteria 3751
551 Ga0495635_0022627 3300046663 Bacteria 4380
552 Ga0495635_0046609 3300046663 Bacteria 2990
553 Ga0495635_0138717 3300046663 Bacteria 1656
554 Ga0495635_0179977 3300046663 Bacteria 1437
555 Ga0495635_0298384 3300046663 Bacteria 1081
556 Ga0495659_0065038 3300046664 Bacteria 1355
557 Ga0495599_0011138 3300046678 Bacteria 5519
558 Ga0495599_0047182 3300046678 Unclassified 2700
559 Ga0495599_0092022 3300046678 Bacteria 1892
560 Ga0495623_0013305 3300046679 Bacteria 5337
561 Ga0495623_0031033 3300046679 Bacteria 3437
562 Ga0495646_0025496 3300046680 Bacteria 3718
563 Ga0495646_0043025 3300046680 Bacteria 2768
564 Ga0495647_0000280 3300046681 Bacteria 14184
565 Ga0495647_0000893 3300046681 Bacteria 8934
566 Ga0495658_0030107 3300046683 Bacteria 2944
567 Ga0495658_0075078 3300046683 Bacteria 1972
568 Ga0495613_0001439 3300046689 Bacteria 18178
569 Ga0495613_0032038 3300046689 Bacteria 3905
570 Ga0495613_0062418 3300046689 Unclassified 2727
571 Ga0495624_0001702 3300046690 Bacteria 16822
572 Ga0495624_0097102 3300046690 Bacteria 1815
573 Ga0495624_0102288 3300046690 Bacteria 1763
574 Ga0495670_0129514 3300046691 Bacteria 1315
575 Ga0495671_0128117 3300046692 Bacteria 1238
576 Ga0495600_0003646 3300046809 Bacteria 9084
577 Ga0495600_0007507 3300046809 Bacteria 6674
578 Ga0495600_0021465 3300046809 Bacteria 4135
579 Ga0495600_0051576 3300046809 Bacteria 2685
580 Ga0495600_0233955 3300046809 Bacteria 1172
581 Ga0495581_0001135 3300047315 Bacteria 14578
582 Ga0495581_0001524 3300047315 Bacteria 12908
583 Ga0495581_0144339 3300047315 Unclassified 1389
584 Ga0495581_0213418 3300047315 Bacteria 1128
585 Ga0495604_0055796 3300047317 Bacteria 3044
586 Ga0495604_0069013 3300047317 Bacteria 2680
587 Ga0495604_0085984 3300047317 Bacteria 2346
588 Ga0495674_0020823 3300047319 Bacteria 6071
589 Ga0495674_0022551 3300047319 Bacteria 5807
590 Ga0495674_0075586 3300047319 Bacteria 2899
591 Ga0495674_0322872 3300047319 Bacteria 1257
592 Ga0495676_0007504 3300047321 Bacteria 10004
593 Ga0495676_0016613 3300047321 Bacteria 6523
594 Ga0495676_0146960 3300047321 Bacteria 1682
595 Ga0495680_0009832 3300047322 Bacteria 8575
596 Ga0495680_0012062 3300047322 Bacteria 7626
597 Ga0495680_0122893 3300047322 Bacteria 1915
598 Ga0495675_0183204 3300047444 Bacteria 1281
599 Ga0495677_0073091 3300047445 Bacteria 1279
600 Ga0495684_0017150 3300047471 Bacteria 5577
601 Ga0495684_0074509 3300047471 Unclassified 2579
602 Ga0495684_0147026 3300047471 Bacteria 1764
603 Ga0495684_0235185 3300047471 Bacteria 1339
604 Ga0495593_0000503 3300047673 Bacteria 22089
605 Ga0495593_0001727 3300047673 Bacteria 12939
606 Ga0495614_0000171 3300048089 Bacteria 24006
607 Ga0495614_0006047 3300048089 Bacteria 5442
608 Ga0495614_0133978 3300048089 Bacteria 1098
609 Ga0496100_0012354 3300048903 Bacteria 4893
610 Ga0496100_0014226 3300048903 Bacteria 4614
611 Ga0496100_0018754 3300048903 Bacteria 4112
612 Ga0496100_0048384 3300048903 Bacteria 2744
613 Ga0496100_0060408 3300048903 Bacteria 2494
614 Ga0496101_0000470 3300048904 Bacteria 25417
615 Ga0496101_0004892 3300048904 Bacteria 8504
616 Ga0496101_0026910 3300048904 Bacteria 4000
617 Ga0496101_0030071 3300048904 Bacteria 3804
618 Ga0496101_0050570 3300048904 Bacteria 2992
619 Ga0496101_0057189 3300048904 Bacteria 2820
620 Ga0496102_0012163 3300048905 Bacteria 7440
621 Ga0496102_0014263 3300048905 Bacteria 6905
622 Ga0496102_0018183 3300048905 Bacteria 6170
623 Ga0496102_0076960 3300048905 Bacteria 3070
624 Ga0496102_0121606 3300048905 Bacteria 2439
625 Ga0496102_0271069 3300048905 Bacteria 1600
626 Ga0496103_0002328 3300048906 Bacteria 12007
627 Ga0496103_0006757 3300048906 Bacteria 6846
628 Ga0496103_0012163 3300048906 Bacteria 5114
629 Ga0496103_0172797 3300048906 Bacteria 1388
630 Ga0496104_0004159 3300048907 Bacteria 12557
631 Ga0496104_0031526 3300048907 Bacteria 4930
632 Ga0496104_0146658 3300048907 Bacteria 2266
633 Ga0496104_0220780 3300048907 Bacteria 1807
634 Ga0496105_0003261 3300048908 Bacteria 11959
635 Ga0496105_0008389 3300048908 Bacteria 8031
636 Ga0496105_0016818 3300048908 Bacteria 5848
637 Ga0496105_0110867 3300048908 Bacteria 2265
638 Ga0496105_0135102 3300048908 Bacteria 2032
639 Ga0496105_0355978 3300048908 Bacteria 1168
640 Ga0496106_0003017 3300048909 Bacteria 12538
641 Ga0496106_0006436 3300048909 Bacteria 8695
642 Ga0496106_0008847 3300048909 Bacteria 7441
643 Ga0496106_0044986 3300048909 Bacteria 3315
644 Ga0496107_0006473 3300048910 Bacteria 8054
645 Ga0496107_0006646 3300048910 Bacteria 7961
646 Ga0496107_0020551 3300048910 Bacteria 4665
647 Ga0496107_0032355 3300048910 Bacteria 3738
648 Ga0496107_0182836 3300048910 Unclassified 1557
649 Ga0496108_0029282 3300048911 Bacteria 4558
650 Ga0496108_0049034 3300048911 Bacteria 3532
651 Ga0496108_0054446 3300048911 Bacteria 3357
652 Ga0496108_0063548 3300048911 Bacteria 3109
653 Ga0496108_0094825 3300048911 Unclassified 2540
654 Ga0496108_0103606 3300048911 Bacteria 2428
655 Ga0496108_0311490 3300048911 Bacteria 1372
656 Ga0496109_0004326 3300048912 Bacteria 11861
657 Ga0496109_0006938 3300048912 Bacteria 9560
658 Ga0496109_0160993 3300048912 Bacteria 2103
659 Ga0496109_0220259 3300048912 Unclassified 1785
660 Ga0496109_0235693 3300048912 Bacteria 1722
661 Ga0496109_0306817 3300048912 Unclassified 1497
662 Ga0496109_0921215 3300048912 Bacteria 812
663 Ga0496110_0012652 3300048913 Bacteria 6943
664 Ga0496110_0047681 3300048913 Bacteria 3753
665 Ga0496110_0053254 3300048913 Bacteria 3557
666 Ga0496110_0108421 3300048913 Bacteria 2493
667 Ga0496110_0275644 3300048913 Bacteria 1532
668 Ga0496111_0038400 3300048914 Bacteria 3431
669 Ga0496111_0100524 3300048914 Bacteria 2124
670 Ga0496111_0172647 3300048914 Bacteria 1606
671 Ga0496112_0002575 3300048915 Bacteria 14646
672 Ga0496112_0014522 3300048915 Bacteria 7314
673 Ga0496112_0017446 3300048915 Bacteria 6744
674 Ga0496112_0034739 3300048915 Unclassified 4907
675 Ga0496112_0035258 3300048915 Bacteria 4872
676 Ga0496112_0057281 3300048915 Bacteria 3836
677 Ga0496112_0186508 3300048915 Bacteria 2037
678 Ga0496112_0299148 3300048915 Bacteria 1555
679 Ga0496113_0025455 3300048916 Bacteria 4218
680 Ga0496113_0039522 3300048916 Bacteria 3473
681 Ga0496113_0145848 3300048916 Bacteria 1865
682 Ga0496113_0181384 3300048916 Bacteria 1669
683 Ga0496113_0273111 3300048916 Bacteria 1351
684 Ga0496113_0354713 3300048916 Bacteria 1177
685 Ga0496114_0009346 3300048917 Bacteria 7783
686 Ga0496114_0016565 3300048917 Bacteria 5941
687 Ga0496114_0016873 3300048917 Bacteria 5888
688 Ga0496114_0026276 3300048917 Bacteria 4765
689 Ga0496114_0033389 3300048917 Bacteria 4240
690 Ga0496114_0037607 3300048917 Bacteria 4003
691 Ga0496114_0039990 3300048917 Bacteria 3880
692 Ga0496114_0046971 3300048917 Bacteria 3589
693 Ga0496115_0002749 3300048918 Bacteria 12641
694 Ga0496115_0004523 3300048918 Bacteria 10058
695 Ga0496115_0019663 3300048918 Bacteria 5199
696 Ga0496115_0020350 3300048918 Bacteria 5118
697 Ga0496115_0028491 3300048918 Bacteria 4378
698 Ga0501034_0065822 3300049571 Bacteria 3638
699 Ga0501040_0272932 3300049576 Bacteria 1207
700 Ga0501047_0049922 3300049581 Bacteria 4040
701 Ga0501047_0138992 3300049581 Unclassified 2308
702 Ga0501067_0014385 3300049583 Bacteria 4381
703 Ga0501067_0019142 3300049583 Bacteria 3789
704 Ga0501067_0082921 3300049583 Bacteria 1778
705 Ga0501067_0280903 3300049583 Archaea 927
706 Ga0501069_0031223 3300049585 Bacteria 2928
707 Ga0501069_0041911 3300049585 Bacteria 2531
708 Ga0501070_0001687 3300049586 Bacteria 19581
709 Ga0501070_0001972 3300049586 Bacteria 18110
710 Ga0501070_0365281 3300049586 Unclassified 1170
711 Ga0501070_0669412 3300049586 Bacteria 823
712 Ga0501073_0113610 3300049589 Unclassified 1878
713 Ga0501074_0030188 3300049590 Bacteria 3929
714 Ga0501074_0059070 3300049590 Bacteria 2763
715 Ga0501074_0097265 3300049590 Bacteria 2107
716 Ga0501074_0272996 3300049590 Bacteria 1202
717 Ga0501080_0061626 3300049742 Bacteria 3492
718 Ga0501045_0360008 3300049824 Bacteria 1083
719 nmdc:mga00v17_322044_c1 3300050491 Unclassified 1004
720 nmdc:mga0yw44_216635_c1 3300050492 Unclassified 1268
721 nmdc:mga05p37_1094866_c1 3300050507 Bacteria 835
722 nmdc:mga05p37_139605_c1 3300050507 Bacteria 2969
723 nmdc:mga05p37_354933_c1 3300050507 Bacteria 1725
724 nmdc:mga05p37_37920_c1 3300050507 Bacteria 5911
725 nmdc:mga06r32_186790_c1 3300050510 Bacteria 2059
726 nmdc:mga0n895_29487_c1 3300050512 Bacteria 5235
727 nmdc:mga0n895_360801_c1 3300050512 Unclassified 1471
728 nmdc:mga0n895_42551_c1 3300050512 Bacteria 4420
729 nmdc:mga0rr50_27191_c1 3300050513 Bacteria 4001
730 nmdc:mga0rr50_64864_c1 3300050513 Unclassified 2764
731 nmdc:mga0rr50_73048_c1 3300050513 Bacteria 2621
732 nmdc:mga0a205_159840_c1 3300050515 Bacteria 2150
733 Ga0495601_0093931 3300053077 Bacteria 1932
734 Ga0495601_0113731 3300053077 Bacteria 1754
735 Ga0495601_0170683 3300053077 Bacteria 1422
736 Ga0495601_0237639 3300053077 Bacteria 1190
737 Ga0495612_0004387 3300053078 Bacteria 5853
738 Ga0495612_0020417 3300053078 Bacteria 2655
739 Ga0495612_0040039 3300053078 Bacteria 1908
740 Ga0495612_0043138 3300053078 Bacteria 1842
741 Ga0495612_0120518 3300053078 Unclassified 1128
742 Ga0495612_0224759 3300053078 Unclassified 832
743 Ga0495595_0059668 3300053084 Bacteria 1784
744 Ga0495595_0244670 3300053084 Bacteria 897
745 Ga0495595_0270927 3300053084 Bacteria 851
746 Ga0495619_0027207 3300053085 Bacteria 3683
747 Ga0495619_0034005 3300053085 Bacteria 3312
748 Ga0495619_0035548 3300053085 Bacteria 3240
749 Ga0495619_0040865 3300053085 Bacteria 3031
750 Ga0495619_0056291 3300053085 Bacteria 2607
751 Ga0500566_0010618 3300053094 Bacteria 5426
752 Ga0466962_0004093 3300061719 Bacteria 6985
753 Ga0466962_0024544 3300061719 Unclassified 2896
754 Ga0466962_0069509 3300061719 Bacteria 1682
755 Ga0070681_10083144
756 JGI24744J21845_10013602
757 JGI24742J22300_10002118
758 JGI25407J50210_10013808
759 Ga0070658_10007804
760 Ga0070658_10339576
761 Ga0070683_100001807
762 Ga0070683_100015246
763 Ga0070683_100023360
764 Ga0070683_100098437
765 Ga0070683_100137368
766 Ga0070690_100005751
767 Ga0070680_100008062
768 Ga0070680_100103828
769 Ga0070680_100180543
770 Ga0070682_100008224
771 Ga0070682_100025219
772 Ga0068868_100011349
773 Ga0070660_100003035
774 Ga0070660_100006777
775 Ga0070660_100009442
776 Ga0070660_100033558
777 Ga0070660_100150888
778 Ga0070660_100215315
779 Ga0070689_100011030
780 Ga0070687_100038582
781 Ga0070661_100106510
782 Ga0070692_10002790
783 Ga0070668_100008082
784 Ga0070669_100226526
785 Ga0070675_100066590
786 Ga0070671_100243927
787 Ga0070674_100005620
788 Ga0070673_100204650
789 Ga0070688_100072399
790 Ga0070659_100008764
791 Ga0070659_100222678
792 Ga0070709_10030882
793 Ga0070714_100005101
794 Ga0070714_100013785
795 Ga0070714_100153441
796 Ga0070714_100230865
797 Ga0070714_100297585
798 Ga0070714_100349166
799 Ga0070713_100156423
800 Ga0070713_100177585
801 Ga0070713_100185605
802 Ga0070710_10007127
803 Ga0070710_10023475
804 Ga0070701_10002508
805 Ga0070711_100007387
806 Ga0070711_100017465
807 Ga0070711_100069436
808 Ga0070711_100086149
809 Ga0070705_100087041
810 Ga0070700_100000619
811 Ga0070694_100027870
812 Ga0070694_100071277
813 Ga0070708_100003802
814 Ga0070708_100134153
815 Ga0070663_100041683
816 Ga0070678_100001059
817 Ga0070662_100031825
818 Ga0070681_10025296
819 Ga0070681_10062918
820 Ga0070681_10066967
821 Ga0070681_10108544
822 Ga0070681_10163743
823 Ga0070681_10246629
824 Ga0068867_100000785
825 Ga0070685_10125658
826 Ga0070706_100083178
827 Ga0070706_100321729
828 Ga0070707_100001216
829 Ga0070707_100006490
830 Ga0070698_100040271
831 Ga0070698_100050985
832 Ga0070698_100162549
833 Ga0070698_100473892
834 Ga0070699_100012338
835 Ga0070699_100044968
836 Ga0070679_100009551
837 Ga0070679_100024215
838 Ga0070679_100037712
839 Ga0070679_100096904
840 Ga0070679_100152707
841 Ga0070679_100181875
842 Ga0070684_100017413
843 Ga0070684_100077809
844 Ga0070684_100228716
845 Ga0070684_100450312
846 Ga0070697_100149186
847 Ga0070697_100255284
848 Ga0068853_100058945
849 Ga0068853_100092260
850 Ga0068853_100265514
851 Ga0070672_100014882
852 Ga0070686_100004879
853 Ga0070696_100032017
854 Ga0070665_100012078
855 Ga0070704_100018317
856 Ga0070704_100159020
857 Ga0070704_100285653
858 Ga0068855_100099066
859 Ga0068855_100527966
860 Ga0068857_100042464
861 Ga0068857_100652265
862 Ga0068856_100007387
863 Ga0068856_100036810
864 Ga0070702_100029815
865 Ga0068852_100152206
866 Ga0068852_100661710
867 Ga0068859_100357455
868 Ga0068866_10008894
869 Ga0068861_100090489
870 Ga0068863_100274600
871 Ga0081538_10000918
872 Ga0081538_10001814
873 Ga0081539_10005765
874 Ga0081539_10031298
875 Ga0070717_10007564
876 Ga0070717_10115193
877 Ga0070717_10126472
878 Ga0070717_10202192
879 Ga0070717_10319121
880 Ga0070717_10450105
881 Ga0075364_10340166
882 Ga0070715_10059811
883 Ga0070716_100044921
884 Ga0070712_100004696
885 Ga0070712_100022839
886 Ga0070712_100050798
887 Ga0070712_100074724
888 Ga0070712_100240459
889 Ga0097621_100002499
890 Ga0097621_100166943
891 Ga0097621_100642532
892 Ga0068871_100014567
893 Ga0068865_100003265
894 Ga0075436_100418462
895 Ga0097620_100357476
896 Ga0075435_100039944
897 Ga0075435_100103080
898 Ga0105240_10015546
899 Ga0105240_10023383
900 Ga0105240_10053856
901 Ga0105240_10713590
902 Ga0105245_10065693
903 Ga0105245_10078124
904 Ga0105245_10099365
905 Ga0105245_10516536
906 Ga0105247_10035630
907 Ga0114129_10104212
908 Ga0114129_10163337
909 Ga0105243_10009832
910 Ga0105243_10023720
911 Ga0105243_10309753
912 Ga0105241_10149113
913 Ga0105242_10005266
914 Ga0105242_10041712
915 Ga0105248_10127222
916 Ga0105248_10203534
917 Ga0105237_10081192
918 Ga0105237_10222440
919 Ga0105238_10016197
920 Ga0105249_10003100
921 Ga0105239_10012473
922 Ga0105239_10640920
923 Ga0105246_10157495
924 Ga0105246_10224365
925 Ga0157370_10040266
926 Ga0157370_10098346
927 Ga0157370_10416099
928 Ga0157369_10001071
929 Ga0157369_10039620
930 Ga0157369_10179108
931 Ga0157369_10212732
932 Ga0157369_10218939
933 Ga0157369_10364740
934 Ga0157374_10016438
935 Ga0157374_10100570
936 Ga0157374_10110412
937 Ga0157374_10599154
938 Ga0157378_10053836
939 Ga0163162_10052705
940 Ga0157372_10015441
941 Ga0157372_10084322
942 Ga0157372_10096848
943 Ga0157372_10351247
944 Ga0157372_10530106
945 Ga0157375_10006704
946 Ga0182008_10013089
947 Ga0182008_10230383
948 Ga0157377_10001695
949 Ga0157379_10384676
950 Ga0157376_10076748
951 Ga0157376_10464502
952 Ga0182007_10011693
953 Ga0197907_10014689
954 Ga0206356_11151171
955 Ga0206353_10393701
956 Ga0206353_10701498
957 Ga0206353_10871076
958 Ga0206353_11082925
959 Ga0213876_10119501
960 Ga0213875_10000139
961 Ga0207692_10006035
962 Ga0207692_10085127
963 Ga0207642_10002889
964 Ga0207642_10022311
965 Ga0207710_10064378
966 Ga0207688_10264393
967 Ga0207647_10080306
968 Ga0207699_10021459
969 Ga0207699_10057259
970 Ga0207705_10017685
971 Ga0207705_10094381
972 Ga0207684_10150919
973 Ga0207684_10266530
974 Ga0207684_10268349
975 Ga0207654_10078493
976 Ga0207654_10360573
977 Ga0207707_10004008
978 Ga0207707_10004433
979 Ga0207707_10022674
980 Ga0207707_10070087
981 Ga0207707_10132968
982 Ga0207695_10199635
983 Ga0207695_10218919
984 Ga0207695_10244182
985 Ga0207671_10173186
986 Ga0207693_10000932
987 Ga0207693_10001268
988 Ga0207693_10014948
989 Ga0207693_10159235
990 Ga0207693_10237805
991 Ga0207663_10011702
992 Ga0207663_10055905
993 Ga0207660_10111515
994 Ga0207660_10117020
995 Ga0207660_10286218
996 Ga0207662_10006932
997 Ga0207657_10000220
998 Ga0207657_10002441
999 Ga0207657_10002509
1000 Ga0207657_10026950
1001 Ga0207657_10166608
1002 Ga0207657_10249423
1003 Ga0207657_10346522
1004 Ga0207649_10255752
1005 Ga0207652_10010577
1006 Ga0207652_10047039
1007 Ga0207652_10234368
1008 Ga0207652_10349441
1009 Ga0207652_10547076
1010 Ga0207646_10005761
1011 Ga0207646_10013641
1012 Ga0207694_10316971
1013 Ga0207659_10207118
1014 Ga0207687_10010840
1015 Ga0207700_10119806
1016 Ga0207700_10139750
1017 Ga0207700_10491528
1018 Ga0207664_10089937
1019 Ga0207664_10313728
1020 Ga0207664_10481137
1021 Ga0207690_10067222
1022 Ga0207706_10049696
1023 Ga0207706_10113134
1024 Ga0207686_10003526
1025 Ga0207709_10004784
1026 Ga0207669_10064169
1027 Ga0207704_10001037
1028 Ga0207665_10114586
1029 Ga0207691_10006258
1030 Ga0207661_10043242
1031 Ga0207661_10152644
1032 Ga0207661_10219730
1033 Ga0207661_10266599
1034 Ga0207679_10207732
1035 Ga0207667_10111863
1036 Ga0207712_10034192
1037 Ga0207712_10159645
1038 Ga0207668_10014814
1039 Ga0207668_10232324
1040 Ga0207640_10072154
1041 Ga0207677_10242560
1042 Ga0207677_10291605
1043 Ga0207639_10259321
1044 Ga0207678_10030917
1045 Ga0207678_10228815
1046 Ga0207708_10001150
1047 Ga0207708_10229562
1048 Ga0207702_10007662
1049 Ga0207702_10031934
1050 Ga0207702_10209195
1051 Ga0207648_10018507
1052 Ga0207674_10028737
1053 Ga0207674_10062027
1054 Ga0207674_10594757
1055 Ga0207675_100070757
1056 Ga0207683_10003171
1057 Ga0207698_10588545
1058 Ga0268266_10037261
1059 Ga0265318_10077709
1060 Ga0265338_10300125
1061 Ga0265325_10024734
1062 Ga0265339_10020362
1063 Ga0265327_10004501
1064 Ga0265327_10023721
1065 Ga0265327_10027455
1066 Ga0265316_10018679
1067 Ga0265313_10005636
1068 Ga0265314_10011206
1069 Ga0265314_10126634
1070 Ga0316578_10112081
1071 Ga0307409_100059402
1072 Ga0316593_10110335
1073 Ga0373926_0006929
1074 Ga0373944_0009796
1075 Ga0373949_0066128
1076 Ga0373936_0008829
1077 Ga0373936_0019566
1078 Ga0373945_0001928
1079 Ga0373945_0019464
1080 Ga0373956_0105791
1081 Ga0373943_0000138
1082 Ga0373946_0003446
1083 Ga0373946_0005779
1084 Ga0373955_0075767
1085 Ga0373935_0022735
1086 Ga0373935_0057206
1087 Ga0373935_0086396
1088 Ga0373927_0012766
1089 Ga0373927_0254221
1090 Ga0373933_0027770
1091 Ga0373947_0000780
1092 Ga0373947_0004021
1093 Ga0373947_0048862
1094 Ga0373937_0106553
1095 Ga0373937_0324088
1096 Ga0373925_0126699
1097 Ga0395899_0011656
1098 Ga0395899_0012524
1099 Ga0395899_0026143
1100 Ga0395899_0094571
1101 Ga0395900_0004292
1102 Ga0395900_0014640
1103 Ga0395900_0024178
1104 Ga0395900_0033988
1105 Ga0395900_0144220
1106 Ga0395900_0265826
1107 Ga0395900_0448252
1108 Ga0395898_0010255
1109 Ga0395898_0022429
1110 Ga0395898_0027273
1111 Ga0395898_0036075
1112 Ga0395898_0068529
1113 Ga0395898_0220904
1114 Ga0395898_0282127
1115 Ga0395898_0287050
1116 Ga0395898_0352211
1117 Ga0395898_0377474
1118 Ga0395905_0019083
1119 Ga0395905_0034534
1120 Ga0395905_0099413
1121 Ga0395905_0216880
1122 Ga0395905_0223817
1123 Ga0395905_0295135
1124 Ga0395905_0354114
1125 Ga0316581_0024173
1126 Ga0436364_0070103
1127 Ga0436364_0882234
1128 Ga0395901_0004913
1129 Ga0395901_0021596
1130 Ga0395901_0028453
1131 Ga0395901_0071855
1132 Ga0395901_0075626
1133 Ga0395901_0107206
1134 Ga0395901_0114070
1135 Ga0395901_0129466
1136 Ga0395901_0129965
1137 Ga0395901_0173997
1138 Ga0395901_0209557
1139 Ga0395901_0240889
1140 Ga0395901_0264980
1141 Ga0395901_0281030
1142 Ga0395901_0287759
1143 Ga0395901_0419581
1144 Ga0395901_0447256
1145 Ga0395901_0452429
1146 Ga0436365_1562679
1147 Ga0436362_1106946
1148 Ga0451839_0267739
1149 Ga0451849_1211443
1150 Ga0451855_1850265
1151 Ga0466972_0142458
1152 Ga0466965_0067372
1153 Ga0466966_0004970
1154 Ga0466966_0039063
1155 Ga0466961_0001191
1156 Ga0466961_0008399
1157 Ga0466961_0046054
1158 Ga0466961_0131748
1159 Ga0466961_0132020
1160 Ga0466961_0162175
1161 Ga0466963_0000216
1162 Ga0466963_0002945
1163 Ga0466963_0003754
1164 Ga0466963_0009526
1165 Ga0466963_0011577
1166 Ga0466963_0023702
1167 Ga0466963_0025022
1168 Ga0466963_0027679
1169 Ga0466963_0045874
1170 Ga0466963_0057032
1171 Ga0466963_0077346
1172 Ga0466963_0154646
1173 Ga0466963_0235946
1174 Ga0466964_0015238
1175 Ga0466964_0019024
1176 Ga0466964_0206423
1177 Ga0466971_0005236
1178 Ga0466971_0005761
1179 Ga0466971_0017434
1180 Ga0466971_0040908
1181 Ga0466968_0003170
1182 Ga0466968_0082233
1183 Ga0466968_0109436
1184 Ga0466970_0124841
1185 Ga0466957_0001257
1186 Ga0466957_0001822
1187 Ga0466957_0038979
1188 Ga0466957_0044720
1189 Ga0466957_0053471
1190 Ga0466957_0077983
1191 Ga0466957_0123022
1192 Ga0466957_0132642
1193 Ga0466957_0233570
1194 Ga0466960_0009798
1195 Ga0466960_0102199
1196 Ga0466959_0014922
1197 Ga0466959_0043506
1198 Ga0466959_0045832
1199 Ga0466959_0104607
1200 Ga0466959_0205685
1201 Ga0466959_0208241
1202 Ga0466959_0222926
1203 Ga0451576_0258718
1204 Ga0466958_0014306
1205 Ga0466958_0075499
1206 Ga0466958_0098217
1207 Ga0466958_0101665
1208 Ga0466958_0153040
1209 Ga0466958_0317952
1210 Ga0466958_0322039
1211 Ga0466967_0000590
1212 Ga0466967_0001203
1213 Ga0466967_0002361
1214 Ga0466967_0003509
1215 Ga0466967_0004227
1216 Ga0466967_0010862
1217 Ga0466967_0025106
1218 Ga0466967_0036129
1219 Ga0466967_0039898
1220 Ga0466967_0043542
1221 Ga0466967_0047045
1222 Ga0466967_0077679
1223 Ga0466967_0087447
1224 Ga0466967_0112980
1225 Ga0466967_0114204
1226 Ga0466967_0131176
1227 Ga0466967_0202967
1228 Ga0466967_0253840
1229 Ga0466967_0290937
1230 Ga0466967_0319999
1231 Ga0466967_0374042
1232 Ga0466967_0456655
1233 Ga0466967_0469754
1234 Ga0466967_0575966
1235 Ga0466967_0825384
1236 Ga0495592_0023712
1237 Ga0495592_0026104
1238 Ga0495592_0044909
1239 Ga0495629_0004586
1240 Ga0495629_0017675
1241 Ga0495641_0000345
1242 Ga0495641_0000988
1243 Ga0495641_0083977
1244 Ga0495651_0168595
1245 Ga0495651_0241211
1246 Ga0495653_0012552
1247 Ga0495653_0082357
1248 Ga0495653_0209247
1249 Ga0495653_0352368
1250 Ga0495580_0009358
1251 Ga0495582_0000703
1252 Ga0495582_0002677
1253 Ga0495582_0017739
1254 Ga0495582_0031456
1255 Ga0495582_0050258
1256 Ga0495582_0065423
1257 Ga0495605_0059087
1258 Ga0495639_0000185
1259 Ga0495639_0003743
1260 Ga0495639_0054834
1261 Ga0495662_0000116
1262 Ga0495662_0000853
1263 Ga0495664_0003908
1264 Ga0495664_0021736
1265 Ga0495664_0040604
1266 Ga0495584_0059470
1267 Ga0495594_0093684
1268 Ga0495596_0035080
1269 Ga0495608_0057228
1270 Ga0495608_0257520
1271 Ga0495618_0024008
1272 Ga0495618_0068582
1273 Ga0495618_0211462
1274 Ga0495628_0030093
1275 Ga0495628_0211529
1276 Ga0495630_0001166
1277 Ga0495630_0018782
1278 Ga0495630_0055185
1279 Ga0495630_0055497
1280 Ga0495630_0138838
1281 Ga0495637_0154731
1282 Ga0495663_0080539
1283 Ga0495666_0000602
1284 Ga0495666_0047185
1285 Ga0495642_0127140
1286 Ga0495652_0006005
1287 Ga0495652_0238437
1288 Ga0495665_0000433
1289 Ga0495665_0040988
1290 Ga0495665_0082267
1291 Ga0495640_0001987
1292 Ga0495640_0017059
1293 Ga0495640_0070293
1294 Ga0495586_0013357
1295 Ga0495586_0042827
1296 Ga0495587_0029904
1297 Ga0495587_0253781
1298 Ga0495645_0051939
1299 Ga0495645_0078004
1300 Ga0495645_0083114
1301 Ga0495645_0200843
1302 Ga0495667_0061581
1303 Ga0495667_0080491
1304 Ga0495634_0030112
1305 Ga0495635_0022627
1306 Ga0495635_0046609
1307 Ga0495635_0138717
1308 Ga0495635_0179977
1309 Ga0495635_0298384
1310 Ga0495659_0065038
1311 Ga0495599_0011138
1312 Ga0495599_0047182
1313 Ga0495599_0092022
1314 Ga0495623_0013305
1315 Ga0495623_0031033
1316 Ga0495646_0025496
1317 Ga0495646_0043025
1318 Ga0495647_0000280
1319 Ga0495647_0000893
1320 Ga0495658_0030107
1321 Ga0495658_0075078
1322 Ga0495613_0001439
1323 Ga0495613_0032038
1324 Ga0495613_0062418
1325 Ga0495624_0001702
1326 Ga0495624_0097102
1327 Ga0495624_0102288
1328 Ga0495670_0129514
1329 Ga0495671_0128117
1330 Ga0495600_0003646
1331 Ga0495600_0007507
1332 Ga0495600_0021465
1333 Ga0495600_0051576
1334 Ga0495600_0233955
1335 Ga0495581_0001135
1336 Ga0495581_0001524
1337 Ga0495581_0144339
1338 Ga0495581_0213418
1339 Ga0495604_0055796
1340 Ga0495604_0069013
1341 Ga0495604_0085984
1342 Ga0495674_0020823
1343 Ga0495674_0022551
1344 Ga0495674_0075586
1345 Ga0495674_0322872
1346 Ga0495676_0007504
1347 Ga0495676_0016613
1348 Ga0495676_0146960
1349 Ga0495680_0009832
1350 Ga0495680_0012062
1351 Ga0495680_0122893
1352 Ga0495675_0183204
1353 Ga0495677_0073091
1354 Ga0495684_0017150
1355 Ga0495684_0074509
1356 Ga0495684_0147026
1357 Ga0495684_0235185
1358 Ga0495593_0000503
1359 Ga0495593_0001727
1360 Ga0495614_0000171
1361 Ga0495614_0006047
1362 Ga0495614_0133978
1363 Ga0496100_0012354
1364 Ga0496100_0014226
1365 Ga0496100_0018754
1366 Ga0496100_0048384
1367 Ga0496100_0060408
1368 Ga0496101_0000470
1369 Ga0496101_0004892
1370 Ga0496101_0026910
1371 Ga0496101_0030071
1372 Ga0496101_0050570
1373 Ga0496101_0057189
1374 Ga0496102_0012163
1375 Ga0496102_0014263
1376 Ga0496102_0018183
1377 Ga0496102_0076960
1378 Ga0496102_0121606
1379 Ga0496102_0271069
1380 Ga0496103_0002328
1381 Ga0496103_0006757
1382 Ga0496103_0012163
1383 Ga0496103_0172797
1384 Ga0496104_0004159
1385 Ga0496104_0031526
1386 Ga0496104_0146658
1387 Ga0496104_0220780
1388 Ga0496105_0003261
1389 Ga0496105_0008389
1390 Ga0496105_0016818
1391 Ga0496105_0110867
1392 Ga0496105_0135102
1393 Ga0496105_0355978
1394 Ga0496106_0003017
1395 Ga0496106_0006436
1396 Ga0496106_0008847
1397 Ga0496106_0044986
1398 Ga0496107_0006473
1399 Ga0496107_0006646
1400 Ga0496107_0020551
1401 Ga0496107_0032355
1402 Ga0496107_0182836
1403 Ga0496108_0029282
1404 Ga0496108_0049034
1405 Ga0496108_0054446
1406 Ga0496108_0063548
1407 Ga0496108_0094825
1408 Ga0496108_0103606
1409 Ga0496108_0311490
1410 Ga0496109_0004326
1411 Ga0496109_0006938
1412 Ga0496109_0160993
1413 Ga0496109_0220259
1414 Ga0496109_0235693
1415 Ga0496109_0306817
1416 Ga0496109_0921215
1417 Ga0496110_0012652
1418 Ga0496110_0047681
1419 Ga0496110_0053254
1420 Ga0496110_0108421
1421 Ga0496110_0275644
1422 Ga0496111_0038400
1423 Ga0496111_0100524
1424 Ga0496111_0172647
1425 Ga0496112_0002575
1426 Ga0496112_0014522
1427 Ga0496112_0017446
1428 Ga0496112_0034739
1429 Ga0496112_0035258
1430 Ga0496112_0057281
1431 Ga0496112_0186508
1432 Ga0496112_0299148
1433 Ga0496113_0025455
1434 Ga0496113_0039522
1435 Ga0496113_0145848
1436 Ga0496113_0181384
1437 Ga0496113_0273111
1438 Ga0496113_0354713
1439 Ga0496114_0009346
1440 Ga0496114_0016565
1441 Ga0496114_0016873
1442 Ga0496114_0026276
1443 Ga0496114_0033389
1444 Ga0496114_0037607
1445 Ga0496114_0039990
1446 Ga0496114_0046971
1447 Ga0496115_0002749
1448 Ga0496115_0004523
1449 Ga0496115_0019663
1450 Ga0496115_0020350
1451 Ga0496115_0028491
1452 Ga0501034_0065822
1453 Ga0501040_0272932
1454 Ga0501047_0049922
1455 Ga0501047_0138992
1456 Ga0501067_0014385
1457 Ga0501067_0019142
1458 Ga0501067_0082921
1459 Ga0501067_0280903
1460 Ga0501069_0031223
1461 Ga0501069_0041911
1462 Ga0501070_0001687
1463 Ga0501070_0001972
1464 Ga0501070_0365281
1465 Ga0501070_0669412
1466 Ga0501073_0113610
1467 Ga0501074_0030188
1468 Ga0501074_0059070
1469 Ga0501074_0097265
1470 Ga0501074_0272996
1471 Ga0501080_0061626
1472 Ga0501045_0360008
1473 nmdc:mga00v17_322044_c1
1474 nmdc:mga0yw44_216635_c1
1475 nmdc:mga05p37_1094866_c1
1476 nmdc:mga05p37_139605_c1
1477 nmdc:mga05p37_354933_c1
1478 nmdc:mga05p37_37920_c1
1479 nmdc:mga06r32_186790_c1
1480 nmdc:mga0n895_29487_c1
1481 nmdc:mga0n895_360801_c1
1482 nmdc:mga0n895_42551_c1
1483 nmdc:mga0rr50_27191_c1
1484 nmdc:mga0rr50_64864_c1
1485 nmdc:mga0rr50_73048_c1
1486 nmdc:mga0a205_159840_c1
1487 Ga0495601_0093931
1488 Ga0495601_0113731
1489 Ga0495601_0170683
1490 Ga0495601_0237639
1491 Ga0495612_0004387
1492 Ga0495612_0020417
1493 Ga0495612_0040039
1494 Ga0495612_0043138
1495 Ga0495612_0120518
1496 Ga0495612_0224759
1497 Ga0495595_0059668
1498 Ga0495595_0244670
1499 Ga0495595_0270927
1500 Ga0495619_0027207
1501 Ga0495619_0034005
1502 Ga0495619_0035548
1503 Ga0495619_0040865
1504 Ga0495619_0056291
1505 Ga0500566_0010618
1506 Ga0466962_0004093
1507 Ga0466962_0024544
1508 Ga0466962_0069509

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04951

Peptidase_M55

D-aminopeptidase

41

309

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.9273 1 268
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.8877 1 268
5btx-assembly2.cif.gz_B structure of the n-terminal domain of lpg1496 from legionella pneumophila in complex with nucleotide 0.7167 225 262
5kh2-assembly1.cif.gz_A crystal structure of steptococcus pneumoniae undecaprenyl pyrophosphate synthase (upps) 0.6744 3 58
5mzv-assembly1.cif.gz_C il-23:il-23r:nb22e11 complex 0.6507 223 261
ID Description Score Start End Superfamily
1hi9E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein 0.9316 1 219 3.40.50.10780
1hi9E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein 0.9135 1 219 3.40.50.10780
1hi9A02 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Dipeptide transport protein 0.8468 223 268 3.30.1360.130
2cx8A02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.6225 1 58 3.40.1280.10
af_Q8K4B4_1_120_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6211 223 261 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7V9PZX1-F1-model_v4 M55 family metallopeptidase 0.9916 1 271 GO:0046872
AF-A0A1Q7UG93-F1-model_v4 Peptidase M55 0.9902 1 250
AF-A0A7V9PZX1-F1-model_v4 M55 family metallopeptidase 0.9879 1 271 GO:0046872
AF-A0A7W1K7G7-F1-model_v4 M55 family metallopeptidase 0.9836 128 271
AF-A0A7V9IGF3-F1-model_v4 M55 family metallopeptidase 0.9829 56 271

Map