F479246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 297 | 1508 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10083144|Ga0070681_100831441 |
| Length | 309 |
| Sequence | VVLGRRAQCSARARKDECRQRREPFAEPGLPGRERKAARGVRVFVVSDMEGVAGIVKWQQVTGGHAMYEEGRRLYTGEINAAVRGAKAAGASEIVVMDCHGAGEGWTFNSLIPEELDSDCEYVVQNEWTEYTQYLEEGVDAALFVGMHAMAGTRDGVLAHTVSGSSWWRLRFNGVEVGETGINAALCGAWNCPVVLVTGDEAACREGRKLLGPGVTVAAVKKGLGRFSARQFPATRARELIEDAARKAVENRAAVAPYDPGSPCEILVDFNTSDHVEKYRYRSGVEITGSRQISSRADDWWTAWRQFFF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 190 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 191 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.93 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 11.8 |
| Rhizosphere | 86.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10083144 | 3300005458 | Bacteria | 3155 |
| 2 | JGI24744J21845_10013602 | 3300002077 | Bacteria | 1639 |
| 3 | JGI24742J22300_10002118 | 3300002244 | Bacteria | 3156 |
| 4 | JGI25407J50210_10013808 | 3300003373 | Bacteria | 2078 |
| 5 | Ga0070658_10007804 | 3300005327 | Bacteria | 8622 |
| 6 | Ga0070658_10339576 | 3300005327 | Bacteria | 1285 |
| 7 | Ga0070683_100001807 | 3300005329 | Bacteria | 16677 |
| 8 | Ga0070683_100015246 | 3300005329 | Bacteria | 6748 |
| 9 | Ga0070683_100023360 | 3300005329 | Bacteria | 5530 |
| 10 | Ga0070683_100098437 | 3300005329 | Bacteria | 2753 |
| 11 | Ga0070683_100137368 | 3300005329 | Bacteria | 2315 |
| 12 | Ga0070690_100005751 | 3300005330 | Bacteria | 6987 |
| 13 | Ga0070680_100008062 | 3300005336 | Bacteria | 8043 |
| 14 | Ga0070680_100103828 | 3300005336 | Bacteria | 2361 |
| 15 | Ga0070680_100180543 | 3300005336 | Bacteria | 1778 |
| 16 | Ga0070682_100008224 | 3300005337 | Bacteria | 5882 |
| 17 | Ga0070682_100025219 | 3300005337 | Bacteria | 3546 |
| 18 | Ga0068868_100011349 | 3300005338 | Bacteria | 6487 |
| 19 | Ga0070660_100003035 | 3300005339 | Bacteria | 11560 |
| 20 | Ga0070660_100006777 | 3300005339 | Bacteria | 7951 |
| 21 | Ga0070660_100009442 | 3300005339 | Bacteria | 6861 |
| 22 | Ga0070660_100033558 | 3300005339 | Bacteria | 3869 |
| 23 | Ga0070660_100150888 | 3300005339 | Bacteria | 1868 |
| 24 | Ga0070660_100215315 | 3300005339 | Bacteria | 1560 |
| 25 | Ga0070689_100011030 | 3300005340 | Bacteria | 6460 |
| 26 | Ga0070687_100038582 | 3300005343 | Bacteria | 2395 |
| 27 | Ga0070661_100106510 | 3300005344 | Bacteria | 2090 |
| 28 | Ga0070692_10002790 | 3300005345 | Bacteria | 6889 |
| 29 | Ga0070668_100008082 | 3300005347 | Bacteria | 7814 |
| 30 | Ga0070669_100226526 | 3300005353 | Bacteria | 1480 |
| 31 | Ga0070675_100066590 | 3300005354 | Bacteria | 2980 |
| 32 | Ga0070671_100243927 | 3300005355 | Bacteria | 1525 |
| 33 | Ga0070674_100005620 | 3300005356 | Bacteria | 7260 |
| 34 | Ga0070673_100204650 | 3300005364 | Bacteria | 1701 |
| 35 | Ga0070688_100072399 | 3300005365 | Bacteria | 2208 |
| 36 | Ga0070659_100008764 | 3300005366 | Bacteria | 7403 |
| 37 | Ga0070659_100222678 | 3300005366 | Bacteria | 1558 |
| 38 | Ga0070709_10030882 | 3300005434 | Bacteria | 3219 |
| 39 | Ga0070714_100005101 | 3300005435 | Bacteria | 9990 |
| 40 | Ga0070714_100013785 | 3300005435 | Bacteria | 6481 |
| 41 | Ga0070714_100153441 | 3300005435 | Bacteria | 2077 |
| 42 | Ga0070714_100230865 | 3300005435 | Unclassified | 1704 |
| 43 | Ga0070714_100297585 | 3300005435 | Bacteria | 1503 |
| 44 | Ga0070714_100349166 | 3300005435 | Bacteria | 1389 |
| 45 | Ga0070713_100156423 | 3300005436 | Bacteria | 2032 |
| 46 | Ga0070713_100177585 | 3300005436 | Bacteria | 1912 |
| 47 | Ga0070713_100185605 | 3300005436 | Bacteria | 1871 |
| 48 | Ga0070710_10007127 | 3300005437 | Bacteria | 5400 |
| 49 | Ga0070710_10023475 | 3300005437 | Bacteria | 3243 |
| 50 | Ga0070701_10002508 | 3300005438 | Bacteria | 7091 |
| 51 | Ga0070711_100007387 | 3300005439 | Bacteria | 6684 |
| 52 | Ga0070711_100017465 | 3300005439 | Bacteria | 4569 |
| 53 | Ga0070711_100069436 | 3300005439 | Bacteria | 2478 |
| 54 | Ga0070711_100086149 | 3300005439 | Bacteria | 2252 |
| 55 | Ga0070705_100087041 | 3300005440 | Bacteria | 1936 |
| 56 | Ga0070700_100000619 | 3300005441 | Bacteria | 17639 |
| 57 | Ga0070694_100027870 | 3300005444 | Bacteria | 3672 |
| 58 | Ga0070694_100071277 | 3300005444 | Bacteria | 2395 |
| 59 | Ga0070708_100003802 | 3300005445 | Bacteria | 11842 |
| 60 | Ga0070708_100134153 | 3300005445 | Unclassified | 2292 |
| 61 | Ga0070663_100041683 | 3300005455 | Bacteria | 3222 |
| 62 | Ga0070678_100001059 | 3300005456 | Bacteria | 14356 |
| 63 | Ga0070662_100031825 | 3300005457 | Bacteria | 3705 |
| 64 | Ga0070681_10025296 | 3300005458 | Bacteria | 5971 |
| 65 | Ga0070681_10062918 | 3300005458 | Bacteria | 3683 |
| 66 | Ga0070681_10066967 | 3300005458 | Unclassified | 3560 |
| 67 | Ga0070681_10108544 | 3300005458 | Bacteria | 2715 |
| 68 | Ga0070681_10163743 | 3300005458 | Bacteria | 2147 |
| 69 | Ga0070681_10246629 | 3300005458 | Bacteria | 1699 |
| 70 | Ga0068867_100000785 | 3300005459 | Bacteria | 21474 |
| 71 | Ga0070685_10125658 | 3300005466 | Bacteria | 1597 |
| 72 | Ga0070706_100083178 | 3300005467 | Bacteria | 2965 |
| 73 | Ga0070706_100321729 | 3300005467 | Bacteria | 1442 |
| 74 | Ga0070707_100001216 | 3300005468 | Bacteria | 25361 |
| 75 | Ga0070707_100006490 | 3300005468 | Bacteria | 10866 |
| 76 | Ga0070698_100040271 | 3300005471 | Bacteria | 4803 |
| 77 | Ga0070698_100050985 | 3300005471 | Bacteria | 4217 |
| 78 | Ga0070698_100162549 | 3300005471 | Unclassified | 2176 |
| 79 | Ga0070698_100473892 | 3300005471 | Bacteria | 1188 |
| 80 | Ga0070699_100012338 | 3300005518 | Bacteria | 7373 |
| 81 | Ga0070699_100044968 | 3300005518 | Bacteria | 3822 |
| 82 | Ga0070679_100009551 | 3300005530 | Bacteria | 9176 |
| 83 | Ga0070679_100024215 | 3300005530 | Bacteria | 5949 |
| 84 | Ga0070679_100037712 | 3300005530 | Bacteria | 4802 |
| 85 | Ga0070679_100096904 | 3300005530 | Bacteria | 2937 |
| 86 | Ga0070679_100152707 | 3300005530 | Bacteria | 2285 |
| 87 | Ga0070679_100181875 | 3300005530 | Bacteria | 2074 |
| 88 | Ga0070684_100017413 | 3300005535 | Bacteria | 5897 |
| 89 | Ga0070684_100077809 | 3300005535 | Bacteria | 2930 |
| 90 | Ga0070684_100228716 | 3300005535 | Bacteria | 1698 |
| 91 | Ga0070684_100450312 | 3300005535 | Bacteria | 1190 |
| 92 | Ga0070697_100149186 | 3300005536 | Bacteria | 1970 |
| 93 | Ga0070697_100255284 | 3300005536 | Unclassified | 1500 |
| 94 | Ga0068853_100058945 | 3300005539 | Bacteria | 3315 |
| 95 | Ga0068853_100092260 | 3300005539 | Bacteria | 2664 |
| 96 | Ga0068853_100265514 | 3300005539 | Bacteria | 1579 |
| 97 | Ga0070672_100014882 | 3300005543 | Bacteria | 5523 |
| 98 | Ga0070686_100004879 | 3300005544 | Bacteria | 7401 |
| 99 | Ga0070696_100032017 | 3300005546 | Bacteria | 3606 |
| 100 | Ga0070665_100012078 | 3300005548 | Bacteria | 8712 |
| 101 | Ga0070704_100018317 | 3300005549 | Bacteria | 4475 |
| 102 | Ga0070704_100159020 | 3300005549 | Bacteria | 1785 |
| 103 | Ga0070704_100285653 | 3300005549 | Bacteria | 1369 |
| 104 | Ga0068855_100099066 | 3300005563 | Bacteria | 3357 |
| 105 | Ga0068855_100527966 | 3300005563 | Unclassified | 1280 |
| 106 | Ga0068857_100042464 | 3300005577 | Bacteria | 4034 |
| 107 | Ga0068857_100652265 | 3300005577 | Unclassified | 998 |
| 108 | Ga0068856_100007387 | 3300005614 | Bacteria | 10726 |
| 109 | Ga0068856_100036810 | 3300005614 | Bacteria | 4798 |
| 110 | Ga0070702_100029815 | 3300005615 | Bacteria | 2971 |
| 111 | Ga0068852_100152206 | 3300005616 | Bacteria | 2152 |
| 112 | Ga0068852_100661710 | 3300005616 | Bacteria | 1052 |
| 113 | Ga0068859_100357455 | 3300005617 | Bacteria | 1555 |
| 114 | Ga0068866_10008894 | 3300005718 | Bacteria | 4249 |
| 115 | Ga0068861_100090489 | 3300005719 | Bacteria | 2414 |
| 116 | Ga0068863_100274600 | 3300005841 | Bacteria | 1632 |
| 117 | Ga0081538_10000918 | 3300005981 | Bacteria | 31780 |
| 118 | Ga0081538_10001814 | 3300005981 | Bacteria | 21497 |
| 119 | Ga0081539_10005765 | 3300005985 | Bacteria | 12352 |
| 120 | Ga0081539_10031298 | 3300005985 | Bacteria | 3282 |
| 121 | Ga0070717_10007564 | 3300006028 | Bacteria | 8073 |
| 122 | Ga0070717_10115193 | 3300006028 | Bacteria | 2297 |
| 123 | Ga0070717_10126472 | 3300006028 | Bacteria | 2194 |
| 124 | Ga0070717_10202192 | 3300006028 | Bacteria | 1740 |
| 125 | Ga0070717_10319121 | 3300006028 | Bacteria | 1384 |
| 126 | Ga0070717_10450105 | 3300006028 | Bacteria | 1160 |
| 127 | Ga0075364_10340166 | 3300006051 | Unclassified | 1022 |
| 128 | Ga0070715_10059811 | 3300006163 | Bacteria | 1668 |
| 129 | Ga0070716_100044921 | 3300006173 | Unclassified | 2477 |
| 130 | Ga0070712_100004696 | 3300006175 | Bacteria | 8445 |
| 131 | Ga0070712_100022839 | 3300006175 | Bacteria | 4124 |
| 132 | Ga0070712_100050798 | 3300006175 | Bacteria | 2887 |
| 133 | Ga0070712_100074724 | 3300006175 | Bacteria | 2436 |
| 134 | Ga0070712_100240459 | 3300006175 | Bacteria | 1442 |
| 135 | Ga0097621_100002499 | 3300006237 | Bacteria | 12601 |
| 136 | Ga0097621_100166943 | 3300006237 | Bacteria | 1895 |
| 137 | Ga0097621_100642532 | 3300006237 | Bacteria | 973 |
| 138 | Ga0068871_100014567 | 3300006358 | Bacteria | 5865 |
| 139 | Ga0068865_100003265 | 3300006881 | Bacteria | 9707 |
| 140 | Ga0075436_100418462 | 3300006914 | Bacteria | 973 |
| 141 | Ga0097620_100357476 | 3300006931 | Bacteria | 1555 |
| 142 | Ga0075435_100039944 | 3300007076 | Bacteria | 3746 |
| 143 | Ga0075435_100103080 | 3300007076 | Bacteria | 2366 |
| 144 | Ga0105240_10015546 | 3300009093 | Bacteria | 10344 |
| 145 | Ga0105240_10023383 | 3300009093 | Bacteria | 8173 |
| 146 | Ga0105240_10053856 | 3300009093 | Bacteria | 5047 |
| 147 | Ga0105240_10713590 | 3300009093 | Bacteria | 1093 |
| 148 | Ga0105245_10065693 | 3300009098 | Bacteria | 3281 |
| 149 | Ga0105245_10078124 | 3300009098 | Unclassified | 3020 |
| 150 | Ga0105245_10099365 | 3300009098 | Bacteria | 2690 |
| 151 | Ga0105245_10516536 | 3300009098 | Bacteria | 1212 |
| 152 | Ga0105247_10035630 | 3300009101 | Bacteria | 3034 |
| 153 | Ga0114129_10104212 | 3300009147 | Bacteria | 3920 |
| 154 | Ga0114129_10163337 | 3300009147 | Bacteria | 3041 |
| 155 | Ga0105243_10009832 | 3300009148 | Bacteria | 7279 |
| 156 | Ga0105243_10023720 | 3300009148 | Bacteria | 4676 |
| 157 | Ga0105243_10309753 | 3300009148 | Bacteria | 1434 |
| 158 | Ga0105241_10149113 | 3300009174 | Bacteria | 1912 |
| 159 | Ga0105242_10005266 | 3300009176 | Bacteria | 9987 |
| 160 | Ga0105242_10041712 | 3300009176 | Bacteria | 3703 |
| 161 | Ga0105248_10127222 | 3300009177 | Bacteria | 2874 |
| 162 | Ga0105248_10203534 | 3300009177 | Unclassified | 2230 |
| 163 | Ga0105237_10081192 | 3300009545 | Bacteria | 3233 |
| 164 | Ga0105237_10222440 | 3300009545 | Bacteria | 1888 |
| 165 | Ga0105238_10016197 | 3300009551 | Bacteria | 7544 |
| 166 | Ga0105249_10003100 | 3300009553 | Bacteria | 14354 |
| 167 | Ga0105239_10012473 | 3300010375 | Bacteria | 9464 |
| 168 | Ga0105239_10640920 | 3300010375 | Bacteria | 1213 |
| 169 | Ga0105246_10157495 | 3300011119 | Bacteria | 1727 |
| 170 | Ga0105246_10224365 | 3300011119 | Archaea | 1475 |
| 171 | Ga0157370_10040266 | 3300013104 | Bacteria | 4512 |
| 172 | Ga0157370_10098346 | 3300013104 | Bacteria | 2744 |
| 173 | Ga0157370_10416099 | 3300013104 | Bacteria | 1237 |
| 174 | Ga0157369_10001071 | 3300013105 | Bacteria | 34352 |
| 175 | Ga0157369_10039620 | 3300013105 | Bacteria | 5149 |
| 176 | Ga0157369_10179108 | 3300013105 | Bacteria | 2231 |
| 177 | Ga0157369_10212732 | 3300013105 | Bacteria | 2026 |
| 178 | Ga0157369_10218939 | 3300013105 | Bacteria | 1993 |
| 179 | Ga0157369_10364740 | 3300013105 | Bacteria | 1500 |
| 180 | Ga0157374_10016438 | 3300013296 | Bacteria | 6504 |
| 181 | Ga0157374_10100570 | 3300013296 | Bacteria | 2771 |
| 182 | Ga0157374_10110412 | 3300013296 | Unclassified | 2645 |
| 183 | Ga0157374_10599154 | 3300013296 | Bacteria | 1112 |
| 184 | Ga0157378_10053836 | 3300013297 | Bacteria | 3583 |
| 185 | Ga0163162_10052705 | 3300013306 | Bacteria | 4087 |
| 186 | Ga0157372_10015441 | 3300013307 | Bacteria | 8184 |
| 187 | Ga0157372_10084322 | 3300013307 | Bacteria | 3601 |
| 188 | Ga0157372_10096848 | 3300013307 | Bacteria | 3363 |
| 189 | Ga0157372_10351247 | 3300013307 | Bacteria | 1718 |
| 190 | Ga0157372_10530106 | 3300013307 | Bacteria | 1373 |
| 191 | Ga0157375_10006704 | 3300013308 | Bacteria | 10032 |
| 192 | Ga0182008_10013089 | 3300014497 | Bacteria | 4364 |
| 193 | Ga0182008_10230383 | 3300014497 | Bacteria | 950 |
| 194 | Ga0157377_10001695 | 3300014745 | Bacteria | 9605 |
| 195 | Ga0157379_10384676 | 3300014968 | Bacteria | 1288 |
| 196 | Ga0157376_10076748 | 3300014969 | Bacteria | 2856 |
| 197 | Ga0157376_10464502 | 3300014969 | Bacteria | 1237 |
| 198 | Ga0182007_10011693 | 3300015262 | Bacteria | 3408 |
| 199 | Ga0197907_10014689 | 3300020069 | Bacteria | 4870 |
| 200 | Ga0206356_11151171 | 3300020070 | Bacteria | 1033 |
| 201 | Ga0206353_10393701 | 3300020082 | Bacteria | 12377 |
| 202 | Ga0206353_10701498 | 3300020082 | Bacteria | 3985 |
| 203 | Ga0206353_10871076 | 3300020082 | Bacteria | 3435 |
| 204 | Ga0206353_11082925 | 3300020082 | Bacteria | 1963 |
| 205 | Ga0213876_10119501 | 3300021384 | Bacteria | 1399 |
| 206 | Ga0213875_10000139 | 3300021388 | Bacteria | 79384 |
| 207 | Ga0207692_10006035 | 3300025898 | Bacteria | 4898 |
| 208 | Ga0207692_10085127 | 3300025898 | Bacteria | 1700 |
| 209 | Ga0207642_10002889 | 3300025899 | Bacteria | 5375 |
| 210 | Ga0207642_10022311 | 3300025899 | Unclassified | 2508 |
| 211 | Ga0207710_10064378 | 3300025900 | Bacteria | 1670 |
| 212 | Ga0207688_10264393 | 3300025901 | Bacteria | 1045 |
| 213 | Ga0207647_10080306 | 3300025904 | Bacteria | 1956 |
| 214 | Ga0207699_10021459 | 3300025906 | Bacteria | 3481 |
| 215 | Ga0207699_10057259 | 3300025906 | Bacteria | 2327 |
| 216 | Ga0207705_10017685 | 3300025909 | Bacteria | 5100 |
| 217 | Ga0207705_10094381 | 3300025909 | Bacteria | 2194 |
| 218 | Ga0207684_10150919 | 3300025910 | Bacteria | 1999 |
| 219 | Ga0207684_10266530 | 3300025910 | Unclassified | 1478 |
| 220 | Ga0207684_10268349 | 3300025910 | Bacteria | 1472 |
| 221 | Ga0207654_10078493 | 3300025911 | Bacteria | 1981 |
| 222 | Ga0207654_10360573 | 3300025911 | Unclassified | 1003 |
| 223 | Ga0207707_10004008 | 3300025912 | Bacteria | 13068 |
| 224 | Ga0207707_10004433 | 3300025912 | Bacteria | 12371 |
| 225 | Ga0207707_10022674 | 3300025912 | Bacteria | 5491 |
| 226 | Ga0207707_10070087 | 3300025912 | Bacteria | 3055 |
| 227 | Ga0207707_10132968 | 3300025912 | Bacteria | 2176 |
| 228 | Ga0207695_10199635 | 3300025913 | Bacteria | 1915 |
| 229 | Ga0207695_10218919 | 3300025913 | Bacteria | 1812 |
| 230 | Ga0207695_10244182 | 3300025913 | Bacteria | 1696 |
| 231 | Ga0207671_10173186 | 3300025914 | Bacteria | 1677 |
| 232 | Ga0207693_10000932 | 3300025915 | Bacteria | 26301 |
| 233 | Ga0207693_10001268 | 3300025915 | Bacteria | 22513 |
| 234 | Ga0207693_10014948 | 3300025915 | Bacteria | 6233 |
| 235 | Ga0207693_10159235 | 3300025915 | Bacteria | 1776 |
| 236 | Ga0207693_10237805 | 3300025915 | Bacteria | 1430 |
| 237 | Ga0207663_10011702 | 3300025916 | Bacteria | 4719 |
| 238 | Ga0207663_10055905 | 3300025916 | Bacteria | 2478 |
| 239 | Ga0207660_10111515 | 3300025917 | Unclassified | 2059 |
| 240 | Ga0207660_10117020 | 3300025917 | Bacteria | 2014 |
| 241 | Ga0207660_10286218 | 3300025917 | Bacteria | 1309 |
| 242 | Ga0207662_10006932 | 3300025918 | Bacteria | 6145 |
| 243 | Ga0207657_10000220 | 3300025919 | Bacteria | 59453 |
| 244 | Ga0207657_10002441 | 3300025919 | Bacteria | 20078 |
| 245 | Ga0207657_10002509 | 3300025919 | Bacteria | 19862 |
| 246 | Ga0207657_10026950 | 3300025919 | Bacteria | 5270 |
| 247 | Ga0207657_10166608 | 3300025919 | Bacteria | 1787 |
| 248 | Ga0207657_10249423 | 3300025919 | Bacteria | 1415 |
| 249 | Ga0207657_10346522 | 3300025919 | Unclassified | 1172 |
| 250 | Ga0207649_10255752 | 3300025920 | Bacteria | 1263 |
| 251 | Ga0207652_10010577 | 3300025921 | Bacteria | 7427 |
| 252 | Ga0207652_10047039 | 3300025921 | Bacteria | 3684 |
| 253 | Ga0207652_10234368 | 3300025921 | Unclassified | 1654 |
| 254 | Ga0207652_10349441 | 3300025921 | Bacteria | 1334 |
| 255 | Ga0207652_10547076 | 3300025921 | Bacteria | 1041 |
| 256 | Ga0207646_10005761 | 3300025922 | Bacteria | 12982 |
| 257 | Ga0207646_10013641 | 3300025922 | Bacteria | 7761 |
| 258 | Ga0207694_10316971 | 3300025924 | Bacteria | 1286 |
| 259 | Ga0207659_10207118 | 3300025926 | Bacteria | 1570 |
| 260 | Ga0207687_10010840 | 3300025927 | Bacteria | 5958 |
| 261 | Ga0207700_10119806 | 3300025928 | Bacteria | 2132 |
| 262 | Ga0207700_10139750 | 3300025928 | Bacteria | 1988 |
| 263 | Ga0207700_10491528 | 3300025928 | Bacteria | 1085 |
| 264 | Ga0207664_10089937 | 3300025929 | Unclassified | 2515 |
| 265 | Ga0207664_10313728 | 3300025929 | Bacteria | 1382 |
| 266 | Ga0207664_10481137 | 3300025929 | Bacteria | 1111 |
| 267 | Ga0207690_10067222 | 3300025932 | Bacteria | 2457 |
| 268 | Ga0207706_10049696 | 3300025933 | Bacteria | 3706 |
| 269 | Ga0207706_10113134 | 3300025933 | Bacteria | 2388 |
| 270 | Ga0207686_10003526 | 3300025934 | Bacteria | 8403 |
| 271 | Ga0207709_10004784 | 3300025935 | Bacteria | 7760 |
| 272 | Ga0207669_10064169 | 3300025937 | Bacteria | 2271 |
| 273 | Ga0207704_10001037 | 3300025938 | Bacteria | 12339 |
| 274 | Ga0207665_10114586 | 3300025939 | Unclassified | 1898 |
| 275 | Ga0207691_10006258 | 3300025940 | Bacteria | 11493 |
| 276 | Ga0207661_10043242 | 3300025944 | Bacteria | 3555 |
| 277 | Ga0207661_10152644 | 3300025944 | Bacteria | 1997 |
| 278 | Ga0207661_10219730 | 3300025944 | Bacteria | 1679 |
| 279 | Ga0207661_10266599 | 3300025944 | Bacteria | 1527 |
| 280 | Ga0207679_10207732 | 3300025945 | Bacteria | 1640 |
| 281 | Ga0207667_10111863 | 3300025949 | Bacteria | 2816 |
| 282 | Ga0207712_10034192 | 3300025961 | Bacteria | 3443 |
| 283 | Ga0207712_10159645 | 3300025961 | Bacteria | 1751 |
| 284 | Ga0207668_10014814 | 3300025972 | Bacteria | 4833 |
| 285 | Ga0207668_10232324 | 3300025972 | Unclassified | 1488 |
| 286 | Ga0207640_10072154 | 3300025981 | Bacteria | 2328 |
| 287 | Ga0207677_10242560 | 3300026023 | Bacteria | 1459 |
| 288 | Ga0207677_10291605 | 3300026023 | Bacteria | 1344 |
| 289 | Ga0207639_10259321 | 3300026041 | Bacteria | 1519 |
| 290 | Ga0207678_10030917 | 3300026067 | Bacteria | 4674 |
| 291 | Ga0207678_10228815 | 3300026067 | Bacteria | 1592 |
| 292 | Ga0207708_10001150 | 3300026075 | Bacteria | 19902 |
| 293 | Ga0207708_10229562 | 3300026075 | Unclassified | 1490 |
| 294 | Ga0207702_10007662 | 3300026078 | Bacteria | 9180 |
| 295 | Ga0207702_10031934 | 3300026078 | Bacteria | 4392 |
| 296 | Ga0207702_10209195 | 3300026078 | Bacteria | 1813 |
| 297 | Ga0207648_10018507 | 3300026089 | Bacteria | 6304 |
| 298 | Ga0207674_10028737 | 3300026116 | Bacteria | 5865 |
| 299 | Ga0207674_10062027 | 3300026116 | Bacteria | 3776 |
| 300 | Ga0207674_10594757 | 3300026116 | Unclassified | 1069 |
| 301 | Ga0207675_100070757 | 3300026118 | Bacteria | 3260 |
| 302 | Ga0207683_10003171 | 3300026121 | Bacteria | 14356 |
| 303 | Ga0207698_10588545 | 3300026142 | Bacteria | 1095 |
| 304 | Ga0268266_10037261 | 3300028379 | Bacteria | 4144 |
| 305 | Ga0265318_10077709 | 3300028577 | Bacteria | 1227 |
| 306 | Ga0265338_10300125 | 3300028800 | Bacteria | 1168 |
| 307 | Ga0265325_10024734 | 3300031241 | Unclassified | 3264 |
| 308 | Ga0265339_10020362 | 3300031249 | Unclassified | 3877 |
| 309 | Ga0265327_10004501 | 3300031251 | Bacteria | 12302 |
| 310 | Ga0265327_10023721 | 3300031251 | Bacteria | 3624 |
| 311 | Ga0265327_10027455 | 3300031251 | Unclassified | 3275 |
| 312 | Ga0265316_10018679 | 3300031344 | Bacteria | 5954 |
| 313 | Ga0265313_10005636 | 3300031595 | Bacteria | 9149 |
| 314 | Ga0265314_10011206 | 3300031711 | Bacteria | 7422 |
| 315 | Ga0265314_10126634 | 3300031711 | Bacteria | 1599 |
| 316 | Ga0316578_10112081 | 3300031728 | Bacteria | 1639 |
| 317 | Ga0307409_100059402 | 3300031995 | Bacteria | 2975 |
| 318 | Ga0316593_10110335 | 3300032168 | Bacteria | 982 |
| 319 | Ga0373926_0006929 | 3300035083 | Bacteria | 3767 |
| 320 | Ga0373944_0009796 | 3300035089 | Bacteria | 2605 |
| 321 | Ga0373949_0066128 | 3300035090 | Bacteria | 939 |
| 322 | Ga0373936_0008829 | 3300035113 | Bacteria | 3797 |
| 323 | Ga0373936_0019566 | 3300035113 | Bacteria | 2624 |
| 324 | Ga0373945_0001928 | 3300035116 | Bacteria | 6439 |
| 325 | Ga0373945_0019464 | 3300035116 | Bacteria | 2318 |
| 326 | Ga0373956_0105791 | 3300035119 | Bacteria | 1308 |
| 327 | Ga0373943_0000138 | 3300035170 | Bacteria | 27619 |
| 328 | Ga0373946_0003446 | 3300035171 | Bacteria | 5616 |
| 329 | Ga0373946_0005779 | 3300035171 | Bacteria | 4476 |
| 330 | Ga0373955_0075767 | 3300035172 | Bacteria | 1891 |
| 331 | Ga0373935_0022735 | 3300035692 | Bacteria | 3849 |
| 332 | Ga0373935_0057206 | 3300035692 | Bacteria | 2488 |
| 333 | Ga0373935_0086396 | 3300035692 | Bacteria | 2047 |
| 334 | Ga0373927_0012766 | 3300035695 | Bacteria | 5589 |
| 335 | Ga0373927_0254221 | 3300035695 | Bacteria | 1155 |
| 336 | Ga0373933_0027770 | 3300035724 | Unclassified | 3262 |
| 337 | Ga0373947_0000780 | 3300035725 | Bacteria | 19144 |
| 338 | Ga0373947_0004021 | 3300035725 | Bacteria | 8639 |
| 339 | Ga0373947_0048862 | 3300035725 | Bacteria | 2539 |
| 340 | Ga0373937_0106553 | 3300036401 | Bacteria | 2605 |
| 341 | Ga0373937_0324088 | 3300036401 | Unclassified | 1458 |
| 342 | Ga0373925_0126699 | 3300037068 | Bacteria | 1987 |
| 343 | Ga0395899_0011656 | 3300037312 | Bacteria | 6729 |
| 344 | Ga0395899_0012524 | 3300037312 | Bacteria | 6499 |
| 345 | Ga0395899_0026143 | 3300037312 | Bacteria | 4406 |
| 346 | Ga0395899_0094571 | 3300037312 | Bacteria | 2162 |
| 347 | Ga0395900_0004292 | 3300037418 | Bacteria | 15113 |
| 348 | Ga0395900_0014640 | 3300037418 | Bacteria | 7999 |
| 349 | Ga0395900_0024178 | 3300037418 | Bacteria | 6221 |
| 350 | Ga0395900_0033988 | 3300037418 | Bacteria | 5248 |
| 351 | Ga0395900_0144220 | 3300037418 | Bacteria | 2436 |
| 352 | Ga0395900_0265826 | 3300037418 | Unclassified | 1711 |
| 353 | Ga0395900_0448252 | 3300037418 | Unclassified | 1247 |
| 354 | Ga0395898_0010255 | 3300037466 | Bacteria | 9808 |
| 355 | Ga0395898_0022429 | 3300037466 | Bacteria | 6395 |
| 356 | Ga0395898_0027273 | 3300037466 | Bacteria | 5736 |
| 357 | Ga0395898_0036075 | 3300037466 | Bacteria | 4912 |
| 358 | Ga0395898_0068529 | 3300037466 | Bacteria | 3433 |
| 359 | Ga0395898_0220904 | 3300037466 | Bacteria | 1807 |
| 360 | Ga0395898_0282127 | 3300037466 | Bacteria | 1584 |
| 361 | Ga0395898_0287050 | 3300037466 | Unclassified | 1570 |
| 362 | Ga0395898_0352211 | 3300037466 | Bacteria | 1404 |
| 363 | Ga0395898_0377474 | 3300037466 | Bacteria | 1352 |
| 364 | Ga0395905_0019083 | 3300037471 | Bacteria | 6504 |
| 365 | Ga0395905_0034534 | 3300037471 | Bacteria | 4749 |
| 366 | Ga0395905_0099413 | 3300037471 | Bacteria | 2732 |
| 367 | Ga0395905_0216880 | 3300037471 | Bacteria | 1791 |
| 368 | Ga0395905_0223817 | 3300037471 | Unclassified | 1761 |
| 369 | Ga0395905_0295135 | 3300037471 | Bacteria | 1508 |
| 370 | Ga0395905_0354114 | 3300037471 | Bacteria | 1360 |
| 371 | Ga0316581_0024173 | 3300037588 | Bacteria | 1800 |
| 372 | Ga0436364_0070103 | 3300037853 | Bacteria | 509097 |
| 373 | Ga0436364_0882234 | 3300037853 | Bacteria | 1998 |
| 374 | Ga0395901_0004913 | 3300038443 | Bacteria | 13490 |
| 375 | Ga0395901_0021596 | 3300038443 | Bacteria | 6595 |
| 376 | Ga0395901_0028453 | 3300038443 | Bacteria | 5747 |
| 377 | Ga0395901_0071855 | 3300038443 | Bacteria | 3606 |
| 378 | Ga0395901_0075626 | 3300038443 | Bacteria | 3513 |
| 379 | Ga0395901_0107206 | 3300038443 | Bacteria | 2932 |
| 380 | Ga0395901_0114070 | 3300038443 | Bacteria | 2838 |
| 381 | Ga0395901_0129466 | 3300038443 | Bacteria | 2652 |
| 382 | Ga0395901_0129965 | 3300038443 | Unclassified | 2646 |
| 383 | Ga0395901_0173997 | 3300038443 | Bacteria | 2258 |
| 384 | Ga0395901_0209557 | 3300038443 | Bacteria | 2040 |
| 385 | Ga0395901_0240889 | 3300038443 | Bacteria | 1887 |
| 386 | Ga0395901_0264980 | 3300038443 | Bacteria | 1788 |
| 387 | Ga0395901_0281030 | 3300038443 | Bacteria | 1729 |
| 388 | Ga0395901_0287759 | 3300038443 | Unclassified | 1706 |
| 389 | Ga0395901_0419581 | 3300038443 | Bacteria | 1372 |
| 390 | Ga0395901_0447256 | 3300038443 | Bacteria | 1322 |
| 391 | Ga0395901_0452429 | 3300038443 | Bacteria | 1313 |
| 392 | Ga0436365_1562679 | 3300039437 | Bacteria | 1478 |
| 393 | Ga0436362_1106946 | 3300039453 | Unclassified | 1098 |
| 394 | Ga0451839_0267739 | 3300041496 | Bacteria | 4032 |
| 395 | Ga0451849_1211443 | 3300041505 | Bacteria | 1618 |
| 396 | Ga0451855_1850265 | 3300041511 | Bacteria | 1541 |
| 397 | Ga0466972_0142458 | 3300044658 | Bacteria | 1128 |
| 398 | Ga0466965_0067372 | 3300044683 | Unclassified | 1797 |
| 399 | Ga0466966_0004970 | 3300044684 | Bacteria | 8740 |
| 400 | Ga0466966_0039063 | 3300044684 | Bacteria | 3057 |
| 401 | Ga0466961_0001191 | 3300044693 | Bacteria | 16033 |
| 402 | Ga0466961_0008399 | 3300044693 | Bacteria | 6577 |
| 403 | Ga0466961_0046054 | 3300044693 | Bacteria | 2790 |
| 404 | Ga0466961_0131748 | 3300044693 | Bacteria | 1567 |
| 405 | Ga0466961_0132020 | 3300044693 | Bacteria | 1565 |
| 406 | Ga0466961_0162175 | 3300044693 | Unclassified | 1393 |
| 407 | Ga0466963_0000216 | 3300044694 | Bacteria | 24575 |
| 408 | Ga0466963_0002945 | 3300044694 | Bacteria | 9623 |
| 409 | Ga0466963_0003754 | 3300044694 | Bacteria | 8746 |
| 410 | Ga0466963_0009526 | 3300044694 | Bacteria | 5850 |
| 411 | Ga0466963_0011577 | 3300044694 | Bacteria | 5370 |
| 412 | Ga0466963_0023702 | 3300044694 | Bacteria | 3901 |
| 413 | Ga0466963_0025022 | 3300044694 | Bacteria | 3804 |
| 414 | Ga0466963_0027679 | 3300044694 | Bacteria | 3632 |
| 415 | Ga0466963_0045874 | 3300044694 | Bacteria | 2879 |
| 416 | Ga0466963_0057032 | 3300044694 | Bacteria | 2600 |
| 417 | Ga0466963_0077346 | 3300044694 | Bacteria | 2248 |
| 418 | Ga0466963_0154646 | 3300044694 | Bacteria | 1594 |
| 419 | Ga0466963_0235946 | 3300044694 | Bacteria | 1282 |
| 420 | Ga0466964_0015238 | 3300044706 | Bacteria | 2926 |
| 421 | Ga0466964_0019024 | 3300044706 | Bacteria | 2639 |
| 422 | Ga0466964_0206423 | 3300044706 | Bacteria | 946 |
| 423 | Ga0466971_0005236 | 3300044719 | Bacteria | 5616 |
| 424 | Ga0466971_0005761 | 3300044719 | Bacteria | 5387 |
| 425 | Ga0466971_0017434 | 3300044719 | Bacteria | 3177 |
| 426 | Ga0466971_0040908 | 3300044719 | Bacteria | 2082 |
| 427 | Ga0466968_0003170 | 3300044735 | Bacteria | 6070 |
| 428 | Ga0466968_0082233 | 3300044735 | Bacteria | 1417 |
| 429 | Ga0466968_0109436 | 3300044735 | Bacteria | 1241 |
| 430 | Ga0466970_0124841 | 3300044765 | Bacteria | 1411 |
| 431 | Ga0466957_0001257 | 3300044842 | Bacteria | 13198 |
| 432 | Ga0466957_0001822 | 3300044842 | Bacteria | 11234 |
| 433 | Ga0466957_0038979 | 3300044842 | Bacteria | 2865 |
| 434 | Ga0466957_0044720 | 3300044842 | Unclassified | 2684 |
| 435 | Ga0466957_0053471 | 3300044842 | Bacteria | 2462 |
| 436 | Ga0466957_0077983 | 3300044842 | Bacteria | 2059 |
| 437 | Ga0466957_0123022 | 3300044842 | Bacteria | 1655 |
| 438 | Ga0466957_0132642 | 3300044842 | Unclassified | 1598 |
| 439 | Ga0466957_0233570 | 3300044842 | Bacteria | 1218 |
| 440 | Ga0466960_0009798 | 3300044901 | Bacteria | 3961 |
| 441 | Ga0466960_0102199 | 3300044901 | Bacteria | 1478 |
| 442 | Ga0466959_0014922 | 3300045049 | Bacteria | 5660 |
| 443 | Ga0466959_0043506 | 3300045049 | Bacteria | 3311 |
| 444 | Ga0466959_0045832 | 3300045049 | Bacteria | 3219 |
| 445 | Ga0466959_0104607 | 3300045049 | Bacteria | 2025 |
| 446 | Ga0466959_0205685 | 3300045049 | Bacteria | 1369 |
| 447 | Ga0466959_0208241 | 3300045049 | Bacteria | 1359 |
| 448 | Ga0466959_0222926 | 3300045049 | Bacteria | 1307 |
| 449 | Ga0451576_0258718 | 3300045051 | Bacteria | 1819 |
| 450 | Ga0466958_0014306 | 3300045836 | Bacteria | 4531 |
| 451 | Ga0466958_0075499 | 3300045836 | Bacteria | 2067 |
| 452 | Ga0466958_0098217 | 3300045836 | Bacteria | 1818 |
| 453 | Ga0466958_0101665 | 3300045836 | Bacteria | 1788 |
| 454 | Ga0466958_0153040 | 3300045836 | Bacteria | 1455 |
| 455 | Ga0466958_0317952 | 3300045836 | Bacteria | 1000 |
| 456 | Ga0466958_0322039 | 3300045836 | Bacteria | 994 |
| 457 | Ga0466967_0000590 | 3300045976 | Bacteria | 17986 |
| 458 | Ga0466967_0001203 | 3300045976 | Bacteria | 14562 |
| 459 | Ga0466967_0002361 | 3300045976 | Bacteria | 11685 |
| 460 | Ga0466967_0003509 | 3300045976 | Bacteria | 10249 |
| 461 | Ga0466967_0004227 | 3300045976 | Bacteria | 9635 |
| 462 | Ga0466967_0010862 | 3300045976 | Bacteria | 6859 |
| 463 | Ga0466967_0025106 | 3300045976 | Bacteria | 4909 |
| 464 | Ga0466967_0036129 | 3300045976 | Bacteria | 4215 |
| 465 | Ga0466967_0039898 | 3300045976 | Bacteria | 4039 |
| 466 | Ga0466967_0043542 | 3300045976 | Bacteria | 3887 |
| 467 | Ga0466967_0047045 | 3300045976 | Bacteria | 3759 |
| 468 | Ga0466967_0077679 | 3300045976 | Bacteria | 2989 |
| 469 | Ga0466967_0087447 | 3300045976 | Bacteria | 2825 |
| 470 | Ga0466967_0112980 | 3300045976 | Unclassified | 2498 |
| 471 | Ga0466967_0114204 | 3300045976 | Bacteria | 2486 |
| 472 | Ga0466967_0131176 | 3300045976 | Unclassified | 2326 |
| 473 | Ga0466967_0202967 | 3300045976 | Bacteria | 1878 |
| 474 | Ga0466967_0253840 | 3300045976 | Archaea | 1681 |
| 475 | Ga0466967_0290937 | 3300045976 | Bacteria | 1569 |
| 476 | Ga0466967_0319999 | 3300045976 | Bacteria | 1496 |
| 477 | Ga0466967_0374042 | 3300045976 | Bacteria | 1382 |
| 478 | Ga0466967_0456655 | 3300045976 | Bacteria | 1249 |
| 479 | Ga0466967_0469754 | 3300045976 | Bacteria | 1231 |
| 480 | Ga0466967_0575966 | 3300045976 | Bacteria | 1109 |
| 481 | Ga0466967_0825384 | 3300045976 | Bacteria | 921 |
| 482 | Ga0495592_0023712 | 3300046454 | Bacteria | 4667 |
| 483 | Ga0495592_0026104 | 3300046454 | Bacteria | 4432 |
| 484 | Ga0495592_0044909 | 3300046454 | Bacteria | 3299 |
| 485 | Ga0495629_0004586 | 3300046459 | Bacteria | 10337 |
| 486 | Ga0495629_0017675 | 3300046459 | Bacteria | 5111 |
| 487 | Ga0495641_0000345 | 3300046461 | Bacteria | 38081 |
| 488 | Ga0495641_0000988 | 3300046461 | Bacteria | 24404 |
| 489 | Ga0495641_0083977 | 3300046461 | Bacteria | 1426 |
| 490 | Ga0495651_0168595 | 3300046462 | Bacteria | 1561 |
| 491 | Ga0495651_0241211 | 3300046462 | Bacteria | 1239 |
| 492 | Ga0495653_0012552 | 3300046463 | Bacteria | 6918 |
| 493 | Ga0495653_0082357 | 3300046463 | Bacteria | 2375 |
| 494 | Ga0495653_0209247 | 3300046463 | Bacteria | 1318 |
| 495 | Ga0495653_0352368 | 3300046463 | Bacteria | 946 |
| 496 | Ga0495580_0009358 | 3300046472 | Bacteria | 7708 |
| 497 | Ga0495582_0000703 | 3300046473 | Bacteria | 18466 |
| 498 | Ga0495582_0002677 | 3300046473 | Bacteria | 9944 |
| 499 | Ga0495582_0017739 | 3300046473 | Bacteria | 3892 |
| 500 | Ga0495582_0031456 | 3300046473 | Bacteria | 2916 |
| 501 | Ga0495582_0050258 | 3300046473 | Bacteria | 2297 |
| 502 | Ga0495582_0065423 | 3300046473 | Bacteria | 2009 |
| 503 | Ga0495605_0059087 | 3300046474 | Bacteria | 1842 |
| 504 | Ga0495639_0000185 | 3300046475 | Bacteria | 33068 |
| 505 | Ga0495639_0003743 | 3300046475 | Bacteria | 6543 |
| 506 | Ga0495639_0054834 | 3300046475 | Bacteria | 1817 |
| 507 | Ga0495662_0000116 | 3300046476 | Bacteria | 30019 |
| 508 | Ga0495662_0000853 | 3300046476 | Bacteria | 14869 |
| 509 | Ga0495664_0003908 | 3300046477 | Bacteria | 8132 |
| 510 | Ga0495664_0021736 | 3300046477 | Bacteria | 3707 |
| 511 | Ga0495664_0040604 | 3300046477 | Bacteria | 2752 |
| 512 | Ga0495584_0059470 | 3300046491 | Bacteria | 1922 |
| 513 | Ga0495594_0093684 | 3300046499 | Bacteria | 1685 |
| 514 | Ga0495596_0035080 | 3300046500 | Bacteria | 1990 |
| 515 | Ga0495608_0057228 | 3300046511 | Bacteria | 2573 |
| 516 | Ga0495608_0257520 | 3300046511 | Bacteria | 1087 |
| 517 | Ga0495618_0024008 | 3300046514 | Bacteria | 3774 |
| 518 | Ga0495618_0068582 | 3300046514 | Bacteria | 2255 |
| 519 | Ga0495618_0211462 | 3300046514 | Bacteria | 1226 |
| 520 | Ga0495628_0030093 | 3300046516 | Bacteria | 4397 |
| 521 | Ga0495628_0211529 | 3300046516 | Unclassified | 1458 |
| 522 | Ga0495630_0001166 | 3300046517 | Bacteria | 18157 |
| 523 | Ga0495630_0018782 | 3300046517 | Bacteria | 5079 |
| 524 | Ga0495630_0055185 | 3300046517 | Bacteria | 2977 |
| 525 | Ga0495630_0055497 | 3300046517 | Bacteria | 2969 |
| 526 | Ga0495630_0138838 | 3300046517 | Bacteria | 1847 |
| 527 | Ga0495637_0154731 | 3300046520 | Unclassified | 863 |
| 528 | Ga0495663_0080539 | 3300046525 | Bacteria | 1048 |
| 529 | Ga0495666_0000602 | 3300046526 | Bacteria | 16116 |
| 530 | Ga0495666_0047185 | 3300046526 | Bacteria | 2075 |
| 531 | Ga0495642_0127140 | 3300046528 | Bacteria | 1096 |
| 532 | Ga0495652_0006005 | 3300046529 | Bacteria | 11359 |
| 533 | Ga0495652_0238437 | 3300046529 | Bacteria | 1355 |
| 534 | Ga0495665_0000433 | 3300046531 | Bacteria | 21230 |
| 535 | Ga0495665_0040988 | 3300046531 | Unclassified | 2465 |
| 536 | Ga0495665_0082267 | 3300046531 | Bacteria | 1692 |
| 537 | Ga0495640_0001987 | 3300046533 | Bacteria | 16309 |
| 538 | Ga0495640_0017059 | 3300046533 | Bacteria | 5419 |
| 539 | Ga0495640_0070293 | 3300046533 | Bacteria | 2352 |
| 540 | Ga0495586_0013357 | 3300046535 | Bacteria | 4354 |
| 541 | Ga0495586_0042827 | 3300046535 | Bacteria | 2438 |
| 542 | Ga0495587_0029904 | 3300046536 | Bacteria | 3305 |
| 543 | Ga0495587_0253781 | 3300046536 | Unclassified | 988 |
| 544 | Ga0495645_0051939 | 3300046543 | Bacteria | 2983 |
| 545 | Ga0495645_0078004 | 3300046543 | Bacteria | 2381 |
| 546 | Ga0495645_0083114 | 3300046543 | Bacteria | 2295 |
| 547 | Ga0495645_0200843 | 3300046543 | Bacteria | 1352 |
| 548 | Ga0495667_0061581 | 3300046559 | Unclassified | 2460 |
| 549 | Ga0495667_0080491 | 3300046559 | Bacteria | 2117 |
| 550 | Ga0495634_0030112 | 3300046642 | Bacteria | 3751 |
| 551 | Ga0495635_0022627 | 3300046663 | Bacteria | 4380 |
| 552 | Ga0495635_0046609 | 3300046663 | Bacteria | 2990 |
| 553 | Ga0495635_0138717 | 3300046663 | Bacteria | 1656 |
| 554 | Ga0495635_0179977 | 3300046663 | Bacteria | 1437 |
| 555 | Ga0495635_0298384 | 3300046663 | Bacteria | 1081 |
| 556 | Ga0495659_0065038 | 3300046664 | Bacteria | 1355 |
| 557 | Ga0495599_0011138 | 3300046678 | Bacteria | 5519 |
| 558 | Ga0495599_0047182 | 3300046678 | Unclassified | 2700 |
| 559 | Ga0495599_0092022 | 3300046678 | Bacteria | 1892 |
| 560 | Ga0495623_0013305 | 3300046679 | Bacteria | 5337 |
| 561 | Ga0495623_0031033 | 3300046679 | Bacteria | 3437 |
| 562 | Ga0495646_0025496 | 3300046680 | Bacteria | 3718 |
| 563 | Ga0495646_0043025 | 3300046680 | Bacteria | 2768 |
| 564 | Ga0495647_0000280 | 3300046681 | Bacteria | 14184 |
| 565 | Ga0495647_0000893 | 3300046681 | Bacteria | 8934 |
| 566 | Ga0495658_0030107 | 3300046683 | Bacteria | 2944 |
| 567 | Ga0495658_0075078 | 3300046683 | Bacteria | 1972 |
| 568 | Ga0495613_0001439 | 3300046689 | Bacteria | 18178 |
| 569 | Ga0495613_0032038 | 3300046689 | Bacteria | 3905 |
| 570 | Ga0495613_0062418 | 3300046689 | Unclassified | 2727 |
| 571 | Ga0495624_0001702 | 3300046690 | Bacteria | 16822 |
| 572 | Ga0495624_0097102 | 3300046690 | Bacteria | 1815 |
| 573 | Ga0495624_0102288 | 3300046690 | Bacteria | 1763 |
| 574 | Ga0495670_0129514 | 3300046691 | Bacteria | 1315 |
| 575 | Ga0495671_0128117 | 3300046692 | Bacteria | 1238 |
| 576 | Ga0495600_0003646 | 3300046809 | Bacteria | 9084 |
| 577 | Ga0495600_0007507 | 3300046809 | Bacteria | 6674 |
| 578 | Ga0495600_0021465 | 3300046809 | Bacteria | 4135 |
| 579 | Ga0495600_0051576 | 3300046809 | Bacteria | 2685 |
| 580 | Ga0495600_0233955 | 3300046809 | Bacteria | 1172 |
| 581 | Ga0495581_0001135 | 3300047315 | Bacteria | 14578 |
| 582 | Ga0495581_0001524 | 3300047315 | Bacteria | 12908 |
| 583 | Ga0495581_0144339 | 3300047315 | Unclassified | 1389 |
| 584 | Ga0495581_0213418 | 3300047315 | Bacteria | 1128 |
| 585 | Ga0495604_0055796 | 3300047317 | Bacteria | 3044 |
| 586 | Ga0495604_0069013 | 3300047317 | Bacteria | 2680 |
| 587 | Ga0495604_0085984 | 3300047317 | Bacteria | 2346 |
| 588 | Ga0495674_0020823 | 3300047319 | Bacteria | 6071 |
| 589 | Ga0495674_0022551 | 3300047319 | Bacteria | 5807 |
| 590 | Ga0495674_0075586 | 3300047319 | Bacteria | 2899 |
| 591 | Ga0495674_0322872 | 3300047319 | Bacteria | 1257 |
| 592 | Ga0495676_0007504 | 3300047321 | Bacteria | 10004 |
| 593 | Ga0495676_0016613 | 3300047321 | Bacteria | 6523 |
| 594 | Ga0495676_0146960 | 3300047321 | Bacteria | 1682 |
| 595 | Ga0495680_0009832 | 3300047322 | Bacteria | 8575 |
| 596 | Ga0495680_0012062 | 3300047322 | Bacteria | 7626 |
| 597 | Ga0495680_0122893 | 3300047322 | Bacteria | 1915 |
| 598 | Ga0495675_0183204 | 3300047444 | Bacteria | 1281 |
| 599 | Ga0495677_0073091 | 3300047445 | Bacteria | 1279 |
| 600 | Ga0495684_0017150 | 3300047471 | Bacteria | 5577 |
| 601 | Ga0495684_0074509 | 3300047471 | Unclassified | 2579 |
| 602 | Ga0495684_0147026 | 3300047471 | Bacteria | 1764 |
| 603 | Ga0495684_0235185 | 3300047471 | Bacteria | 1339 |
| 604 | Ga0495593_0000503 | 3300047673 | Bacteria | 22089 |
| 605 | Ga0495593_0001727 | 3300047673 | Bacteria | 12939 |
| 606 | Ga0495614_0000171 | 3300048089 | Bacteria | 24006 |
| 607 | Ga0495614_0006047 | 3300048089 | Bacteria | 5442 |
| 608 | Ga0495614_0133978 | 3300048089 | Bacteria | 1098 |
| 609 | Ga0496100_0012354 | 3300048903 | Bacteria | 4893 |
| 610 | Ga0496100_0014226 | 3300048903 | Bacteria | 4614 |
| 611 | Ga0496100_0018754 | 3300048903 | Bacteria | 4112 |
| 612 | Ga0496100_0048384 | 3300048903 | Bacteria | 2744 |
| 613 | Ga0496100_0060408 | 3300048903 | Bacteria | 2494 |
| 614 | Ga0496101_0000470 | 3300048904 | Bacteria | 25417 |
| 615 | Ga0496101_0004892 | 3300048904 | Bacteria | 8504 |
| 616 | Ga0496101_0026910 | 3300048904 | Bacteria | 4000 |
| 617 | Ga0496101_0030071 | 3300048904 | Bacteria | 3804 |
| 618 | Ga0496101_0050570 | 3300048904 | Bacteria | 2992 |
| 619 | Ga0496101_0057189 | 3300048904 | Bacteria | 2820 |
| 620 | Ga0496102_0012163 | 3300048905 | Bacteria | 7440 |
| 621 | Ga0496102_0014263 | 3300048905 | Bacteria | 6905 |
| 622 | Ga0496102_0018183 | 3300048905 | Bacteria | 6170 |
| 623 | Ga0496102_0076960 | 3300048905 | Bacteria | 3070 |
| 624 | Ga0496102_0121606 | 3300048905 | Bacteria | 2439 |
| 625 | Ga0496102_0271069 | 3300048905 | Bacteria | 1600 |
| 626 | Ga0496103_0002328 | 3300048906 | Bacteria | 12007 |
| 627 | Ga0496103_0006757 | 3300048906 | Bacteria | 6846 |
| 628 | Ga0496103_0012163 | 3300048906 | Bacteria | 5114 |
| 629 | Ga0496103_0172797 | 3300048906 | Bacteria | 1388 |
| 630 | Ga0496104_0004159 | 3300048907 | Bacteria | 12557 |
| 631 | Ga0496104_0031526 | 3300048907 | Bacteria | 4930 |
| 632 | Ga0496104_0146658 | 3300048907 | Bacteria | 2266 |
| 633 | Ga0496104_0220780 | 3300048907 | Bacteria | 1807 |
| 634 | Ga0496105_0003261 | 3300048908 | Bacteria | 11959 |
| 635 | Ga0496105_0008389 | 3300048908 | Bacteria | 8031 |
| 636 | Ga0496105_0016818 | 3300048908 | Bacteria | 5848 |
| 637 | Ga0496105_0110867 | 3300048908 | Bacteria | 2265 |
| 638 | Ga0496105_0135102 | 3300048908 | Bacteria | 2032 |
| 639 | Ga0496105_0355978 | 3300048908 | Bacteria | 1168 |
| 640 | Ga0496106_0003017 | 3300048909 | Bacteria | 12538 |
| 641 | Ga0496106_0006436 | 3300048909 | Bacteria | 8695 |
| 642 | Ga0496106_0008847 | 3300048909 | Bacteria | 7441 |
| 643 | Ga0496106_0044986 | 3300048909 | Bacteria | 3315 |
| 644 | Ga0496107_0006473 | 3300048910 | Bacteria | 8054 |
| 645 | Ga0496107_0006646 | 3300048910 | Bacteria | 7961 |
| 646 | Ga0496107_0020551 | 3300048910 | Bacteria | 4665 |
| 647 | Ga0496107_0032355 | 3300048910 | Bacteria | 3738 |
| 648 | Ga0496107_0182836 | 3300048910 | Unclassified | 1557 |
| 649 | Ga0496108_0029282 | 3300048911 | Bacteria | 4558 |
| 650 | Ga0496108_0049034 | 3300048911 | Bacteria | 3532 |
| 651 | Ga0496108_0054446 | 3300048911 | Bacteria | 3357 |
| 652 | Ga0496108_0063548 | 3300048911 | Bacteria | 3109 |
| 653 | Ga0496108_0094825 | 3300048911 | Unclassified | 2540 |
| 654 | Ga0496108_0103606 | 3300048911 | Bacteria | 2428 |
| 655 | Ga0496108_0311490 | 3300048911 | Bacteria | 1372 |
| 656 | Ga0496109_0004326 | 3300048912 | Bacteria | 11861 |
| 657 | Ga0496109_0006938 | 3300048912 | Bacteria | 9560 |
| 658 | Ga0496109_0160993 | 3300048912 | Bacteria | 2103 |
| 659 | Ga0496109_0220259 | 3300048912 | Unclassified | 1785 |
| 660 | Ga0496109_0235693 | 3300048912 | Bacteria | 1722 |
| 661 | Ga0496109_0306817 | 3300048912 | Unclassified | 1497 |
| 662 | Ga0496109_0921215 | 3300048912 | Bacteria | 812 |
| 663 | Ga0496110_0012652 | 3300048913 | Bacteria | 6943 |
| 664 | Ga0496110_0047681 | 3300048913 | Bacteria | 3753 |
| 665 | Ga0496110_0053254 | 3300048913 | Bacteria | 3557 |
| 666 | Ga0496110_0108421 | 3300048913 | Bacteria | 2493 |
| 667 | Ga0496110_0275644 | 3300048913 | Bacteria | 1532 |
| 668 | Ga0496111_0038400 | 3300048914 | Bacteria | 3431 |
| 669 | Ga0496111_0100524 | 3300048914 | Bacteria | 2124 |
| 670 | Ga0496111_0172647 | 3300048914 | Bacteria | 1606 |
| 671 | Ga0496112_0002575 | 3300048915 | Bacteria | 14646 |
| 672 | Ga0496112_0014522 | 3300048915 | Bacteria | 7314 |
| 673 | Ga0496112_0017446 | 3300048915 | Bacteria | 6744 |
| 674 | Ga0496112_0034739 | 3300048915 | Unclassified | 4907 |
| 675 | Ga0496112_0035258 | 3300048915 | Bacteria | 4872 |
| 676 | Ga0496112_0057281 | 3300048915 | Bacteria | 3836 |
| 677 | Ga0496112_0186508 | 3300048915 | Bacteria | 2037 |
| 678 | Ga0496112_0299148 | 3300048915 | Bacteria | 1555 |
| 679 | Ga0496113_0025455 | 3300048916 | Bacteria | 4218 |
| 680 | Ga0496113_0039522 | 3300048916 | Bacteria | 3473 |
| 681 | Ga0496113_0145848 | 3300048916 | Bacteria | 1865 |
| 682 | Ga0496113_0181384 | 3300048916 | Bacteria | 1669 |
| 683 | Ga0496113_0273111 | 3300048916 | Bacteria | 1351 |
| 684 | Ga0496113_0354713 | 3300048916 | Bacteria | 1177 |
| 685 | Ga0496114_0009346 | 3300048917 | Bacteria | 7783 |
| 686 | Ga0496114_0016565 | 3300048917 | Bacteria | 5941 |
| 687 | Ga0496114_0016873 | 3300048917 | Bacteria | 5888 |
| 688 | Ga0496114_0026276 | 3300048917 | Bacteria | 4765 |
| 689 | Ga0496114_0033389 | 3300048917 | Bacteria | 4240 |
| 690 | Ga0496114_0037607 | 3300048917 | Bacteria | 4003 |
| 691 | Ga0496114_0039990 | 3300048917 | Bacteria | 3880 |
| 692 | Ga0496114_0046971 | 3300048917 | Bacteria | 3589 |
| 693 | Ga0496115_0002749 | 3300048918 | Bacteria | 12641 |
| 694 | Ga0496115_0004523 | 3300048918 | Bacteria | 10058 |
| 695 | Ga0496115_0019663 | 3300048918 | Bacteria | 5199 |
| 696 | Ga0496115_0020350 | 3300048918 | Bacteria | 5118 |
| 697 | Ga0496115_0028491 | 3300048918 | Bacteria | 4378 |
| 698 | Ga0501034_0065822 | 3300049571 | Bacteria | 3638 |
| 699 | Ga0501040_0272932 | 3300049576 | Bacteria | 1207 |
| 700 | Ga0501047_0049922 | 3300049581 | Bacteria | 4040 |
| 701 | Ga0501047_0138992 | 3300049581 | Unclassified | 2308 |
| 702 | Ga0501067_0014385 | 3300049583 | Bacteria | 4381 |
| 703 | Ga0501067_0019142 | 3300049583 | Bacteria | 3789 |
| 704 | Ga0501067_0082921 | 3300049583 | Bacteria | 1778 |
| 705 | Ga0501067_0280903 | 3300049583 | Archaea | 927 |
| 706 | Ga0501069_0031223 | 3300049585 | Bacteria | 2928 |
| 707 | Ga0501069_0041911 | 3300049585 | Bacteria | 2531 |
| 708 | Ga0501070_0001687 | 3300049586 | Bacteria | 19581 |
| 709 | Ga0501070_0001972 | 3300049586 | Bacteria | 18110 |
| 710 | Ga0501070_0365281 | 3300049586 | Unclassified | 1170 |
| 711 | Ga0501070_0669412 | 3300049586 | Bacteria | 823 |
| 712 | Ga0501073_0113610 | 3300049589 | Unclassified | 1878 |
| 713 | Ga0501074_0030188 | 3300049590 | Bacteria | 3929 |
| 714 | Ga0501074_0059070 | 3300049590 | Bacteria | 2763 |
| 715 | Ga0501074_0097265 | 3300049590 | Bacteria | 2107 |
| 716 | Ga0501074_0272996 | 3300049590 | Bacteria | 1202 |
| 717 | Ga0501080_0061626 | 3300049742 | Bacteria | 3492 |
| 718 | Ga0501045_0360008 | 3300049824 | Bacteria | 1083 |
| 719 | nmdc:mga00v17_322044_c1 | 3300050491 | Unclassified | 1004 |
| 720 | nmdc:mga0yw44_216635_c1 | 3300050492 | Unclassified | 1268 |
| 721 | nmdc:mga05p37_1094866_c1 | 3300050507 | Bacteria | 835 |
| 722 | nmdc:mga05p37_139605_c1 | 3300050507 | Bacteria | 2969 |
| 723 | nmdc:mga05p37_354933_c1 | 3300050507 | Bacteria | 1725 |
| 724 | nmdc:mga05p37_37920_c1 | 3300050507 | Bacteria | 5911 |
| 725 | nmdc:mga06r32_186790_c1 | 3300050510 | Bacteria | 2059 |
| 726 | nmdc:mga0n895_29487_c1 | 3300050512 | Bacteria | 5235 |
| 727 | nmdc:mga0n895_360801_c1 | 3300050512 | Unclassified | 1471 |
| 728 | nmdc:mga0n895_42551_c1 | 3300050512 | Bacteria | 4420 |
| 729 | nmdc:mga0rr50_27191_c1 | 3300050513 | Bacteria | 4001 |
| 730 | nmdc:mga0rr50_64864_c1 | 3300050513 | Unclassified | 2764 |
| 731 | nmdc:mga0rr50_73048_c1 | 3300050513 | Bacteria | 2621 |
| 732 | nmdc:mga0a205_159840_c1 | 3300050515 | Bacteria | 2150 |
| 733 | Ga0495601_0093931 | 3300053077 | Bacteria | 1932 |
| 734 | Ga0495601_0113731 | 3300053077 | Bacteria | 1754 |
| 735 | Ga0495601_0170683 | 3300053077 | Bacteria | 1422 |
| 736 | Ga0495601_0237639 | 3300053077 | Bacteria | 1190 |
| 737 | Ga0495612_0004387 | 3300053078 | Bacteria | 5853 |
| 738 | Ga0495612_0020417 | 3300053078 | Bacteria | 2655 |
| 739 | Ga0495612_0040039 | 3300053078 | Bacteria | 1908 |
| 740 | Ga0495612_0043138 | 3300053078 | Bacteria | 1842 |
| 741 | Ga0495612_0120518 | 3300053078 | Unclassified | 1128 |
| 742 | Ga0495612_0224759 | 3300053078 | Unclassified | 832 |
| 743 | Ga0495595_0059668 | 3300053084 | Bacteria | 1784 |
| 744 | Ga0495595_0244670 | 3300053084 | Bacteria | 897 |
| 745 | Ga0495595_0270927 | 3300053084 | Bacteria | 851 |
| 746 | Ga0495619_0027207 | 3300053085 | Bacteria | 3683 |
| 747 | Ga0495619_0034005 | 3300053085 | Bacteria | 3312 |
| 748 | Ga0495619_0035548 | 3300053085 | Bacteria | 3240 |
| 749 | Ga0495619_0040865 | 3300053085 | Bacteria | 3031 |
| 750 | Ga0495619_0056291 | 3300053085 | Bacteria | 2607 |
| 751 | Ga0500566_0010618 | 3300053094 | Bacteria | 5426 |
| 752 | Ga0466962_0004093 | 3300061719 | Bacteria | 6985 |
| 753 | Ga0466962_0024544 | 3300061719 | Unclassified | 2896 |
| 754 | Ga0466962_0069509 | 3300061719 | Bacteria | 1682 |
| 755 | Ga0070681_10083144 | |||
| 756 | JGI24744J21845_10013602 | |||
| 757 | JGI24742J22300_10002118 | |||
| 758 | JGI25407J50210_10013808 | |||
| 759 | Ga0070658_10007804 | |||
| 760 | Ga0070658_10339576 | |||
| 761 | Ga0070683_100001807 | |||
| 762 | Ga0070683_100015246 | |||
| 763 | Ga0070683_100023360 | |||
| 764 | Ga0070683_100098437 | |||
| 765 | Ga0070683_100137368 | |||
| 766 | Ga0070690_100005751 | |||
| 767 | Ga0070680_100008062 | |||
| 768 | Ga0070680_100103828 | |||
| 769 | Ga0070680_100180543 | |||
| 770 | Ga0070682_100008224 | |||
| 771 | Ga0070682_100025219 | |||
| 772 | Ga0068868_100011349 | |||
| 773 | Ga0070660_100003035 | |||
| 774 | Ga0070660_100006777 | |||
| 775 | Ga0070660_100009442 | |||
| 776 | Ga0070660_100033558 | |||
| 777 | Ga0070660_100150888 | |||
| 778 | Ga0070660_100215315 | |||
| 779 | Ga0070689_100011030 | |||
| 780 | Ga0070687_100038582 | |||
| 781 | Ga0070661_100106510 | |||
| 782 | Ga0070692_10002790 | |||
| 783 | Ga0070668_100008082 | |||
| 784 | Ga0070669_100226526 | |||
| 785 | Ga0070675_100066590 | |||
| 786 | Ga0070671_100243927 | |||
| 787 | Ga0070674_100005620 | |||
| 788 | Ga0070673_100204650 | |||
| 789 | Ga0070688_100072399 | |||
| 790 | Ga0070659_100008764 | |||
| 791 | Ga0070659_100222678 | |||
| 792 | Ga0070709_10030882 | |||
| 793 | Ga0070714_100005101 | |||
| 794 | Ga0070714_100013785 | |||
| 795 | Ga0070714_100153441 | |||
| 796 | Ga0070714_100230865 | |||
| 797 | Ga0070714_100297585 | |||
| 798 | Ga0070714_100349166 | |||
| 799 | Ga0070713_100156423 | |||
| 800 | Ga0070713_100177585 | |||
| 801 | Ga0070713_100185605 | |||
| 802 | Ga0070710_10007127 | |||
| 803 | Ga0070710_10023475 | |||
| 804 | Ga0070701_10002508 | |||
| 805 | Ga0070711_100007387 | |||
| 806 | Ga0070711_100017465 | |||
| 807 | Ga0070711_100069436 | |||
| 808 | Ga0070711_100086149 | |||
| 809 | Ga0070705_100087041 | |||
| 810 | Ga0070700_100000619 | |||
| 811 | Ga0070694_100027870 | |||
| 812 | Ga0070694_100071277 | |||
| 813 | Ga0070708_100003802 | |||
| 814 | Ga0070708_100134153 | |||
| 815 | Ga0070663_100041683 | |||
| 816 | Ga0070678_100001059 | |||
| 817 | Ga0070662_100031825 | |||
| 818 | Ga0070681_10025296 | |||
| 819 | Ga0070681_10062918 | |||
| 820 | Ga0070681_10066967 | |||
| 821 | Ga0070681_10108544 | |||
| 822 | Ga0070681_10163743 | |||
| 823 | Ga0070681_10246629 | |||
| 824 | Ga0068867_100000785 | |||
| 825 | Ga0070685_10125658 | |||
| 826 | Ga0070706_100083178 | |||
| 827 | Ga0070706_100321729 | |||
| 828 | Ga0070707_100001216 | |||
| 829 | Ga0070707_100006490 | |||
| 830 | Ga0070698_100040271 | |||
| 831 | Ga0070698_100050985 | |||
| 832 | Ga0070698_100162549 | |||
| 833 | Ga0070698_100473892 | |||
| 834 | Ga0070699_100012338 | |||
| 835 | Ga0070699_100044968 | |||
| 836 | Ga0070679_100009551 | |||
| 837 | Ga0070679_100024215 | |||
| 838 | Ga0070679_100037712 | |||
| 839 | Ga0070679_100096904 | |||
| 840 | Ga0070679_100152707 | |||
| 841 | Ga0070679_100181875 | |||
| 842 | Ga0070684_100017413 | |||
| 843 | Ga0070684_100077809 | |||
| 844 | Ga0070684_100228716 | |||
| 845 | Ga0070684_100450312 | |||
| 846 | Ga0070697_100149186 | |||
| 847 | Ga0070697_100255284 | |||
| 848 | Ga0068853_100058945 | |||
| 849 | Ga0068853_100092260 | |||
| 850 | Ga0068853_100265514 | |||
| 851 | Ga0070672_100014882 | |||
| 852 | Ga0070686_100004879 | |||
| 853 | Ga0070696_100032017 | |||
| 854 | Ga0070665_100012078 | |||
| 855 | Ga0070704_100018317 | |||
| 856 | Ga0070704_100159020 | |||
| 857 | Ga0070704_100285653 | |||
| 858 | Ga0068855_100099066 | |||
| 859 | Ga0068855_100527966 | |||
| 860 | Ga0068857_100042464 | |||
| 861 | Ga0068857_100652265 | |||
| 862 | Ga0068856_100007387 | |||
| 863 | Ga0068856_100036810 | |||
| 864 | Ga0070702_100029815 | |||
| 865 | Ga0068852_100152206 | |||
| 866 | Ga0068852_100661710 | |||
| 867 | Ga0068859_100357455 | |||
| 868 | Ga0068866_10008894 | |||
| 869 | Ga0068861_100090489 | |||
| 870 | Ga0068863_100274600 | |||
| 871 | Ga0081538_10000918 | |||
| 872 | Ga0081538_10001814 | |||
| 873 | Ga0081539_10005765 | |||
| 874 | Ga0081539_10031298 | |||
| 875 | Ga0070717_10007564 | |||
| 876 | Ga0070717_10115193 | |||
| 877 | Ga0070717_10126472 | |||
| 878 | Ga0070717_10202192 | |||
| 879 | Ga0070717_10319121 | |||
| 880 | Ga0070717_10450105 | |||
| 881 | Ga0075364_10340166 | |||
| 882 | Ga0070715_10059811 | |||
| 883 | Ga0070716_100044921 | |||
| 884 | Ga0070712_100004696 | |||
| 885 | Ga0070712_100022839 | |||
| 886 | Ga0070712_100050798 | |||
| 887 | Ga0070712_100074724 | |||
| 888 | Ga0070712_100240459 | |||
| 889 | Ga0097621_100002499 | |||
| 890 | Ga0097621_100166943 | |||
| 891 | Ga0097621_100642532 | |||
| 892 | Ga0068871_100014567 | |||
| 893 | Ga0068865_100003265 | |||
| 894 | Ga0075436_100418462 | |||
| 895 | Ga0097620_100357476 | |||
| 896 | Ga0075435_100039944 | |||
| 897 | Ga0075435_100103080 | |||
| 898 | Ga0105240_10015546 | |||
| 899 | Ga0105240_10023383 | |||
| 900 | Ga0105240_10053856 | |||
| 901 | Ga0105240_10713590 | |||
| 902 | Ga0105245_10065693 | |||
| 903 | Ga0105245_10078124 | |||
| 904 | Ga0105245_10099365 | |||
| 905 | Ga0105245_10516536 | |||
| 906 | Ga0105247_10035630 | |||
| 907 | Ga0114129_10104212 | |||
| 908 | Ga0114129_10163337 | |||
| 909 | Ga0105243_10009832 | |||
| 910 | Ga0105243_10023720 | |||
| 911 | Ga0105243_10309753 | |||
| 912 | Ga0105241_10149113 | |||
| 913 | Ga0105242_10005266 | |||
| 914 | Ga0105242_10041712 | |||
| 915 | Ga0105248_10127222 | |||
| 916 | Ga0105248_10203534 | |||
| 917 | Ga0105237_10081192 | |||
| 918 | Ga0105237_10222440 | |||
| 919 | Ga0105238_10016197 | |||
| 920 | Ga0105249_10003100 | |||
| 921 | Ga0105239_10012473 | |||
| 922 | Ga0105239_10640920 | |||
| 923 | Ga0105246_10157495 | |||
| 924 | Ga0105246_10224365 | |||
| 925 | Ga0157370_10040266 | |||
| 926 | Ga0157370_10098346 | |||
| 927 | Ga0157370_10416099 | |||
| 928 | Ga0157369_10001071 | |||
| 929 | Ga0157369_10039620 | |||
| 930 | Ga0157369_10179108 | |||
| 931 | Ga0157369_10212732 | |||
| 932 | Ga0157369_10218939 | |||
| 933 | Ga0157369_10364740 | |||
| 934 | Ga0157374_10016438 | |||
| 935 | Ga0157374_10100570 | |||
| 936 | Ga0157374_10110412 | |||
| 937 | Ga0157374_10599154 | |||
| 938 | Ga0157378_10053836 | |||
| 939 | Ga0163162_10052705 | |||
| 940 | Ga0157372_10015441 | |||
| 941 | Ga0157372_10084322 | |||
| 942 | Ga0157372_10096848 | |||
| 943 | Ga0157372_10351247 | |||
| 944 | Ga0157372_10530106 | |||
| 945 | Ga0157375_10006704 | |||
| 946 | Ga0182008_10013089 | |||
| 947 | Ga0182008_10230383 | |||
| 948 | Ga0157377_10001695 | |||
| 949 | Ga0157379_10384676 | |||
| 950 | Ga0157376_10076748 | |||
| 951 | Ga0157376_10464502 | |||
| 952 | Ga0182007_10011693 | |||
| 953 | Ga0197907_10014689 | |||
| 954 | Ga0206356_11151171 | |||
| 955 | Ga0206353_10393701 | |||
| 956 | Ga0206353_10701498 | |||
| 957 | Ga0206353_10871076 | |||
| 958 | Ga0206353_11082925 | |||
| 959 | Ga0213876_10119501 | |||
| 960 | Ga0213875_10000139 | |||
| 961 | Ga0207692_10006035 | |||
| 962 | Ga0207692_10085127 | |||
| 963 | Ga0207642_10002889 | |||
| 964 | Ga0207642_10022311 | |||
| 965 | Ga0207710_10064378 | |||
| 966 | Ga0207688_10264393 | |||
| 967 | Ga0207647_10080306 | |||
| 968 | Ga0207699_10021459 | |||
| 969 | Ga0207699_10057259 | |||
| 970 | Ga0207705_10017685 | |||
| 971 | Ga0207705_10094381 | |||
| 972 | Ga0207684_10150919 | |||
| 973 | Ga0207684_10266530 | |||
| 974 | Ga0207684_10268349 | |||
| 975 | Ga0207654_10078493 | |||
| 976 | Ga0207654_10360573 | |||
| 977 | Ga0207707_10004008 | |||
| 978 | Ga0207707_10004433 | |||
| 979 | Ga0207707_10022674 | |||
| 980 | Ga0207707_10070087 | |||
| 981 | Ga0207707_10132968 | |||
| 982 | Ga0207695_10199635 | |||
| 983 | Ga0207695_10218919 | |||
| 984 | Ga0207695_10244182 | |||
| 985 | Ga0207671_10173186 | |||
| 986 | Ga0207693_10000932 | |||
| 987 | Ga0207693_10001268 | |||
| 988 | Ga0207693_10014948 | |||
| 989 | Ga0207693_10159235 | |||
| 990 | Ga0207693_10237805 | |||
| 991 | Ga0207663_10011702 | |||
| 992 | Ga0207663_10055905 | |||
| 993 | Ga0207660_10111515 | |||
| 994 | Ga0207660_10117020 | |||
| 995 | Ga0207660_10286218 | |||
| 996 | Ga0207662_10006932 | |||
| 997 | Ga0207657_10000220 | |||
| 998 | Ga0207657_10002441 | |||
| 999 | Ga0207657_10002509 | |||
| 1000 | Ga0207657_10026950 | |||
| 1001 | Ga0207657_10166608 | |||
| 1002 | Ga0207657_10249423 | |||
| 1003 | Ga0207657_10346522 | |||
| 1004 | Ga0207649_10255752 | |||
| 1005 | Ga0207652_10010577 | |||
| 1006 | Ga0207652_10047039 | |||
| 1007 | Ga0207652_10234368 | |||
| 1008 | Ga0207652_10349441 | |||
| 1009 | Ga0207652_10547076 | |||
| 1010 | Ga0207646_10005761 | |||
| 1011 | Ga0207646_10013641 | |||
| 1012 | Ga0207694_10316971 | |||
| 1013 | Ga0207659_10207118 | |||
| 1014 | Ga0207687_10010840 | |||
| 1015 | Ga0207700_10119806 | |||
| 1016 | Ga0207700_10139750 | |||
| 1017 | Ga0207700_10491528 | |||
| 1018 | Ga0207664_10089937 | |||
| 1019 | Ga0207664_10313728 | |||
| 1020 | Ga0207664_10481137 | |||
| 1021 | Ga0207690_10067222 | |||
| 1022 | Ga0207706_10049696 | |||
| 1023 | Ga0207706_10113134 | |||
| 1024 | Ga0207686_10003526 | |||
| 1025 | Ga0207709_10004784 | |||
| 1026 | Ga0207669_10064169 | |||
| 1027 | Ga0207704_10001037 | |||
| 1028 | Ga0207665_10114586 | |||
| 1029 | Ga0207691_10006258 | |||
| 1030 | Ga0207661_10043242 | |||
| 1031 | Ga0207661_10152644 | |||
| 1032 | Ga0207661_10219730 | |||
| 1033 | Ga0207661_10266599 | |||
| 1034 | Ga0207679_10207732 | |||
| 1035 | Ga0207667_10111863 | |||
| 1036 | Ga0207712_10034192 | |||
| 1037 | Ga0207712_10159645 | |||
| 1038 | Ga0207668_10014814 | |||
| 1039 | Ga0207668_10232324 | |||
| 1040 | Ga0207640_10072154 | |||
| 1041 | Ga0207677_10242560 | |||
| 1042 | Ga0207677_10291605 | |||
| 1043 | Ga0207639_10259321 | |||
| 1044 | Ga0207678_10030917 | |||
| 1045 | Ga0207678_10228815 | |||
| 1046 | Ga0207708_10001150 | |||
| 1047 | Ga0207708_10229562 | |||
| 1048 | Ga0207702_10007662 | |||
| 1049 | Ga0207702_10031934 | |||
| 1050 | Ga0207702_10209195 | |||
| 1051 | Ga0207648_10018507 | |||
| 1052 | Ga0207674_10028737 | |||
| 1053 | Ga0207674_10062027 | |||
| 1054 | Ga0207674_10594757 | |||
| 1055 | Ga0207675_100070757 | |||
| 1056 | Ga0207683_10003171 | |||
| 1057 | Ga0207698_10588545 | |||
| 1058 | Ga0268266_10037261 | |||
| 1059 | Ga0265318_10077709 | |||
| 1060 | Ga0265338_10300125 | |||
| 1061 | Ga0265325_10024734 | |||
| 1062 | Ga0265339_10020362 | |||
| 1063 | Ga0265327_10004501 | |||
| 1064 | Ga0265327_10023721 | |||
| 1065 | Ga0265327_10027455 | |||
| 1066 | Ga0265316_10018679 | |||
| 1067 | Ga0265313_10005636 | |||
| 1068 | Ga0265314_10011206 | |||
| 1069 | Ga0265314_10126634 | |||
| 1070 | Ga0316578_10112081 | |||
| 1071 | Ga0307409_100059402 | |||
| 1072 | Ga0316593_10110335 | |||
| 1073 | Ga0373926_0006929 | |||
| 1074 | Ga0373944_0009796 | |||
| 1075 | Ga0373949_0066128 | |||
| 1076 | Ga0373936_0008829 | |||
| 1077 | Ga0373936_0019566 | |||
| 1078 | Ga0373945_0001928 | |||
| 1079 | Ga0373945_0019464 | |||
| 1080 | Ga0373956_0105791 | |||
| 1081 | Ga0373943_0000138 | |||
| 1082 | Ga0373946_0003446 | |||
| 1083 | Ga0373946_0005779 | |||
| 1084 | Ga0373955_0075767 | |||
| 1085 | Ga0373935_0022735 | |||
| 1086 | Ga0373935_0057206 | |||
| 1087 | Ga0373935_0086396 | |||
| 1088 | Ga0373927_0012766 | |||
| 1089 | Ga0373927_0254221 | |||
| 1090 | Ga0373933_0027770 | |||
| 1091 | Ga0373947_0000780 | |||
| 1092 | Ga0373947_0004021 | |||
| 1093 | Ga0373947_0048862 | |||
| 1094 | Ga0373937_0106553 | |||
| 1095 | Ga0373937_0324088 | |||
| 1096 | Ga0373925_0126699 | |||
| 1097 | Ga0395899_0011656 | |||
| 1098 | Ga0395899_0012524 | |||
| 1099 | Ga0395899_0026143 | |||
| 1100 | Ga0395899_0094571 | |||
| 1101 | Ga0395900_0004292 | |||
| 1102 | Ga0395900_0014640 | |||
| 1103 | Ga0395900_0024178 | |||
| 1104 | Ga0395900_0033988 | |||
| 1105 | Ga0395900_0144220 | |||
| 1106 | Ga0395900_0265826 | |||
| 1107 | Ga0395900_0448252 | |||
| 1108 | Ga0395898_0010255 | |||
| 1109 | Ga0395898_0022429 | |||
| 1110 | Ga0395898_0027273 | |||
| 1111 | Ga0395898_0036075 | |||
| 1112 | Ga0395898_0068529 | |||
| 1113 | Ga0395898_0220904 | |||
| 1114 | Ga0395898_0282127 | |||
| 1115 | Ga0395898_0287050 | |||
| 1116 | Ga0395898_0352211 | |||
| 1117 | Ga0395898_0377474 | |||
| 1118 | Ga0395905_0019083 | |||
| 1119 | Ga0395905_0034534 | |||
| 1120 | Ga0395905_0099413 | |||
| 1121 | Ga0395905_0216880 | |||
| 1122 | Ga0395905_0223817 | |||
| 1123 | Ga0395905_0295135 | |||
| 1124 | Ga0395905_0354114 | |||
| 1125 | Ga0316581_0024173 | |||
| 1126 | Ga0436364_0070103 | |||
| 1127 | Ga0436364_0882234 | |||
| 1128 | Ga0395901_0004913 | |||
| 1129 | Ga0395901_0021596 | |||
| 1130 | Ga0395901_0028453 | |||
| 1131 | Ga0395901_0071855 | |||
| 1132 | Ga0395901_0075626 | |||
| 1133 | Ga0395901_0107206 | |||
| 1134 | Ga0395901_0114070 | |||
| 1135 | Ga0395901_0129466 | |||
| 1136 | Ga0395901_0129965 | |||
| 1137 | Ga0395901_0173997 | |||
| 1138 | Ga0395901_0209557 | |||
| 1139 | Ga0395901_0240889 | |||
| 1140 | Ga0395901_0264980 | |||
| 1141 | Ga0395901_0281030 | |||
| 1142 | Ga0395901_0287759 | |||
| 1143 | Ga0395901_0419581 | |||
| 1144 | Ga0395901_0447256 | |||
| 1145 | Ga0395901_0452429 | |||
| 1146 | Ga0436365_1562679 | |||
| 1147 | Ga0436362_1106946 | |||
| 1148 | Ga0451839_0267739 | |||
| 1149 | Ga0451849_1211443 | |||
| 1150 | Ga0451855_1850265 | |||
| 1151 | Ga0466972_0142458 | |||
| 1152 | Ga0466965_0067372 | |||
| 1153 | Ga0466966_0004970 | |||
| 1154 | Ga0466966_0039063 | |||
| 1155 | Ga0466961_0001191 | |||
| 1156 | Ga0466961_0008399 | |||
| 1157 | Ga0466961_0046054 | |||
| 1158 | Ga0466961_0131748 | |||
| 1159 | Ga0466961_0132020 | |||
| 1160 | Ga0466961_0162175 | |||
| 1161 | Ga0466963_0000216 | |||
| 1162 | Ga0466963_0002945 | |||
| 1163 | Ga0466963_0003754 | |||
| 1164 | Ga0466963_0009526 | |||
| 1165 | Ga0466963_0011577 | |||
| 1166 | Ga0466963_0023702 | |||
| 1167 | Ga0466963_0025022 | |||
| 1168 | Ga0466963_0027679 | |||
| 1169 | Ga0466963_0045874 | |||
| 1170 | Ga0466963_0057032 | |||
| 1171 | Ga0466963_0077346 | |||
| 1172 | Ga0466963_0154646 | |||
| 1173 | Ga0466963_0235946 | |||
| 1174 | Ga0466964_0015238 | |||
| 1175 | Ga0466964_0019024 | |||
| 1176 | Ga0466964_0206423 | |||
| 1177 | Ga0466971_0005236 | |||
| 1178 | Ga0466971_0005761 | |||
| 1179 | Ga0466971_0017434 | |||
| 1180 | Ga0466971_0040908 | |||
| 1181 | Ga0466968_0003170 | |||
| 1182 | Ga0466968_0082233 | |||
| 1183 | Ga0466968_0109436 | |||
| 1184 | Ga0466970_0124841 | |||
| 1185 | Ga0466957_0001257 | |||
| 1186 | Ga0466957_0001822 | |||
| 1187 | Ga0466957_0038979 | |||
| 1188 | Ga0466957_0044720 | |||
| 1189 | Ga0466957_0053471 | |||
| 1190 | Ga0466957_0077983 | |||
| 1191 | Ga0466957_0123022 | |||
| 1192 | Ga0466957_0132642 | |||
| 1193 | Ga0466957_0233570 | |||
| 1194 | Ga0466960_0009798 | |||
| 1195 | Ga0466960_0102199 | |||
| 1196 | Ga0466959_0014922 | |||
| 1197 | Ga0466959_0043506 | |||
| 1198 | Ga0466959_0045832 | |||
| 1199 | Ga0466959_0104607 | |||
| 1200 | Ga0466959_0205685 | |||
| 1201 | Ga0466959_0208241 | |||
| 1202 | Ga0466959_0222926 | |||
| 1203 | Ga0451576_0258718 | |||
| 1204 | Ga0466958_0014306 | |||
| 1205 | Ga0466958_0075499 | |||
| 1206 | Ga0466958_0098217 | |||
| 1207 | Ga0466958_0101665 | |||
| 1208 | Ga0466958_0153040 | |||
| 1209 | Ga0466958_0317952 | |||
| 1210 | Ga0466958_0322039 | |||
| 1211 | Ga0466967_0000590 | |||
| 1212 | Ga0466967_0001203 | |||
| 1213 | Ga0466967_0002361 | |||
| 1214 | Ga0466967_0003509 | |||
| 1215 | Ga0466967_0004227 | |||
| 1216 | Ga0466967_0010862 | |||
| 1217 | Ga0466967_0025106 | |||
| 1218 | Ga0466967_0036129 | |||
| 1219 | Ga0466967_0039898 | |||
| 1220 | Ga0466967_0043542 | |||
| 1221 | Ga0466967_0047045 | |||
| 1222 | Ga0466967_0077679 | |||
| 1223 | Ga0466967_0087447 | |||
| 1224 | Ga0466967_0112980 | |||
| 1225 | Ga0466967_0114204 | |||
| 1226 | Ga0466967_0131176 | |||
| 1227 | Ga0466967_0202967 | |||
| 1228 | Ga0466967_0253840 | |||
| 1229 | Ga0466967_0290937 | |||
| 1230 | Ga0466967_0319999 | |||
| 1231 | Ga0466967_0374042 | |||
| 1232 | Ga0466967_0456655 | |||
| 1233 | Ga0466967_0469754 | |||
| 1234 | Ga0466967_0575966 | |||
| 1235 | Ga0466967_0825384 | |||
| 1236 | Ga0495592_0023712 | |||
| 1237 | Ga0495592_0026104 | |||
| 1238 | Ga0495592_0044909 | |||
| 1239 | Ga0495629_0004586 | |||
| 1240 | Ga0495629_0017675 | |||
| 1241 | Ga0495641_0000345 | |||
| 1242 | Ga0495641_0000988 | |||
| 1243 | Ga0495641_0083977 | |||
| 1244 | Ga0495651_0168595 | |||
| 1245 | Ga0495651_0241211 | |||
| 1246 | Ga0495653_0012552 | |||
| 1247 | Ga0495653_0082357 | |||
| 1248 | Ga0495653_0209247 | |||
| 1249 | Ga0495653_0352368 | |||
| 1250 | Ga0495580_0009358 | |||
| 1251 | Ga0495582_0000703 | |||
| 1252 | Ga0495582_0002677 | |||
| 1253 | Ga0495582_0017739 | |||
| 1254 | Ga0495582_0031456 | |||
| 1255 | Ga0495582_0050258 | |||
| 1256 | Ga0495582_0065423 | |||
| 1257 | Ga0495605_0059087 | |||
| 1258 | Ga0495639_0000185 | |||
| 1259 | Ga0495639_0003743 | |||
| 1260 | Ga0495639_0054834 | |||
| 1261 | Ga0495662_0000116 | |||
| 1262 | Ga0495662_0000853 | |||
| 1263 | Ga0495664_0003908 | |||
| 1264 | Ga0495664_0021736 | |||
| 1265 | Ga0495664_0040604 | |||
| 1266 | Ga0495584_0059470 | |||
| 1267 | Ga0495594_0093684 | |||
| 1268 | Ga0495596_0035080 | |||
| 1269 | Ga0495608_0057228 | |||
| 1270 | Ga0495608_0257520 | |||
| 1271 | Ga0495618_0024008 | |||
| 1272 | Ga0495618_0068582 | |||
| 1273 | Ga0495618_0211462 | |||
| 1274 | Ga0495628_0030093 | |||
| 1275 | Ga0495628_0211529 | |||
| 1276 | Ga0495630_0001166 | |||
| 1277 | Ga0495630_0018782 | |||
| 1278 | Ga0495630_0055185 | |||
| 1279 | Ga0495630_0055497 | |||
| 1280 | Ga0495630_0138838 | |||
| 1281 | Ga0495637_0154731 | |||
| 1282 | Ga0495663_0080539 | |||
| 1283 | Ga0495666_0000602 | |||
| 1284 | Ga0495666_0047185 | |||
| 1285 | Ga0495642_0127140 | |||
| 1286 | Ga0495652_0006005 | |||
| 1287 | Ga0495652_0238437 | |||
| 1288 | Ga0495665_0000433 | |||
| 1289 | Ga0495665_0040988 | |||
| 1290 | Ga0495665_0082267 | |||
| 1291 | Ga0495640_0001987 | |||
| 1292 | Ga0495640_0017059 | |||
| 1293 | Ga0495640_0070293 | |||
| 1294 | Ga0495586_0013357 | |||
| 1295 | Ga0495586_0042827 | |||
| 1296 | Ga0495587_0029904 | |||
| 1297 | Ga0495587_0253781 | |||
| 1298 | Ga0495645_0051939 | |||
| 1299 | Ga0495645_0078004 | |||
| 1300 | Ga0495645_0083114 | |||
| 1301 | Ga0495645_0200843 | |||
| 1302 | Ga0495667_0061581 | |||
| 1303 | Ga0495667_0080491 | |||
| 1304 | Ga0495634_0030112 | |||
| 1305 | Ga0495635_0022627 | |||
| 1306 | Ga0495635_0046609 | |||
| 1307 | Ga0495635_0138717 | |||
| 1308 | Ga0495635_0179977 | |||
| 1309 | Ga0495635_0298384 | |||
| 1310 | Ga0495659_0065038 | |||
| 1311 | Ga0495599_0011138 | |||
| 1312 | Ga0495599_0047182 | |||
| 1313 | Ga0495599_0092022 | |||
| 1314 | Ga0495623_0013305 | |||
| 1315 | Ga0495623_0031033 | |||
| 1316 | Ga0495646_0025496 | |||
| 1317 | Ga0495646_0043025 | |||
| 1318 | Ga0495647_0000280 | |||
| 1319 | Ga0495647_0000893 | |||
| 1320 | Ga0495658_0030107 | |||
| 1321 | Ga0495658_0075078 | |||
| 1322 | Ga0495613_0001439 | |||
| 1323 | Ga0495613_0032038 | |||
| 1324 | Ga0495613_0062418 | |||
| 1325 | Ga0495624_0001702 | |||
| 1326 | Ga0495624_0097102 | |||
| 1327 | Ga0495624_0102288 | |||
| 1328 | Ga0495670_0129514 | |||
| 1329 | Ga0495671_0128117 | |||
| 1330 | Ga0495600_0003646 | |||
| 1331 | Ga0495600_0007507 | |||
| 1332 | Ga0495600_0021465 | |||
| 1333 | Ga0495600_0051576 | |||
| 1334 | Ga0495600_0233955 | |||
| 1335 | Ga0495581_0001135 | |||
| 1336 | Ga0495581_0001524 | |||
| 1337 | Ga0495581_0144339 | |||
| 1338 | Ga0495581_0213418 | |||
| 1339 | Ga0495604_0055796 | |||
| 1340 | Ga0495604_0069013 | |||
| 1341 | Ga0495604_0085984 | |||
| 1342 | Ga0495674_0020823 | |||
| 1343 | Ga0495674_0022551 | |||
| 1344 | Ga0495674_0075586 | |||
| 1345 | Ga0495674_0322872 | |||
| 1346 | Ga0495676_0007504 | |||
| 1347 | Ga0495676_0016613 | |||
| 1348 | Ga0495676_0146960 | |||
| 1349 | Ga0495680_0009832 | |||
| 1350 | Ga0495680_0012062 | |||
| 1351 | Ga0495680_0122893 | |||
| 1352 | Ga0495675_0183204 | |||
| 1353 | Ga0495677_0073091 | |||
| 1354 | Ga0495684_0017150 | |||
| 1355 | Ga0495684_0074509 | |||
| 1356 | Ga0495684_0147026 | |||
| 1357 | Ga0495684_0235185 | |||
| 1358 | Ga0495593_0000503 | |||
| 1359 | Ga0495593_0001727 | |||
| 1360 | Ga0495614_0000171 | |||
| 1361 | Ga0495614_0006047 | |||
| 1362 | Ga0495614_0133978 | |||
| 1363 | Ga0496100_0012354 | |||
| 1364 | Ga0496100_0014226 | |||
| 1365 | Ga0496100_0018754 | |||
| 1366 | Ga0496100_0048384 | |||
| 1367 | Ga0496100_0060408 | |||
| 1368 | Ga0496101_0000470 | |||
| 1369 | Ga0496101_0004892 | |||
| 1370 | Ga0496101_0026910 | |||
| 1371 | Ga0496101_0030071 | |||
| 1372 | Ga0496101_0050570 | |||
| 1373 | Ga0496101_0057189 | |||
| 1374 | Ga0496102_0012163 | |||
| 1375 | Ga0496102_0014263 | |||
| 1376 | Ga0496102_0018183 | |||
| 1377 | Ga0496102_0076960 | |||
| 1378 | Ga0496102_0121606 | |||
| 1379 | Ga0496102_0271069 | |||
| 1380 | Ga0496103_0002328 | |||
| 1381 | Ga0496103_0006757 | |||
| 1382 | Ga0496103_0012163 | |||
| 1383 | Ga0496103_0172797 | |||
| 1384 | Ga0496104_0004159 | |||
| 1385 | Ga0496104_0031526 | |||
| 1386 | Ga0496104_0146658 | |||
| 1387 | Ga0496104_0220780 | |||
| 1388 | Ga0496105_0003261 | |||
| 1389 | Ga0496105_0008389 | |||
| 1390 | Ga0496105_0016818 | |||
| 1391 | Ga0496105_0110867 | |||
| 1392 | Ga0496105_0135102 | |||
| 1393 | Ga0496105_0355978 | |||
| 1394 | Ga0496106_0003017 | |||
| 1395 | Ga0496106_0006436 | |||
| 1396 | Ga0496106_0008847 | |||
| 1397 | Ga0496106_0044986 | |||
| 1398 | Ga0496107_0006473 | |||
| 1399 | Ga0496107_0006646 | |||
| 1400 | Ga0496107_0020551 | |||
| 1401 | Ga0496107_0032355 | |||
| 1402 | Ga0496107_0182836 | |||
| 1403 | Ga0496108_0029282 | |||
| 1404 | Ga0496108_0049034 | |||
| 1405 | Ga0496108_0054446 | |||
| 1406 | Ga0496108_0063548 | |||
| 1407 | Ga0496108_0094825 | |||
| 1408 | Ga0496108_0103606 | |||
| 1409 | Ga0496108_0311490 | |||
| 1410 | Ga0496109_0004326 | |||
| 1411 | Ga0496109_0006938 | |||
| 1412 | Ga0496109_0160993 | |||
| 1413 | Ga0496109_0220259 | |||
| 1414 | Ga0496109_0235693 | |||
| 1415 | Ga0496109_0306817 | |||
| 1416 | Ga0496109_0921215 | |||
| 1417 | Ga0496110_0012652 | |||
| 1418 | Ga0496110_0047681 | |||
| 1419 | Ga0496110_0053254 | |||
| 1420 | Ga0496110_0108421 | |||
| 1421 | Ga0496110_0275644 | |||
| 1422 | Ga0496111_0038400 | |||
| 1423 | Ga0496111_0100524 | |||
| 1424 | Ga0496111_0172647 | |||
| 1425 | Ga0496112_0002575 | |||
| 1426 | Ga0496112_0014522 | |||
| 1427 | Ga0496112_0017446 | |||
| 1428 | Ga0496112_0034739 | |||
| 1429 | Ga0496112_0035258 | |||
| 1430 | Ga0496112_0057281 | |||
| 1431 | Ga0496112_0186508 | |||
| 1432 | Ga0496112_0299148 | |||
| 1433 | Ga0496113_0025455 | |||
| 1434 | Ga0496113_0039522 | |||
| 1435 | Ga0496113_0145848 | |||
| 1436 | Ga0496113_0181384 | |||
| 1437 | Ga0496113_0273111 | |||
| 1438 | Ga0496113_0354713 | |||
| 1439 | Ga0496114_0009346 | |||
| 1440 | Ga0496114_0016565 | |||
| 1441 | Ga0496114_0016873 | |||
| 1442 | Ga0496114_0026276 | |||
| 1443 | Ga0496114_0033389 | |||
| 1444 | Ga0496114_0037607 | |||
| 1445 | Ga0496114_0039990 | |||
| 1446 | Ga0496114_0046971 | |||
| 1447 | Ga0496115_0002749 | |||
| 1448 | Ga0496115_0004523 | |||
| 1449 | Ga0496115_0019663 | |||
| 1450 | Ga0496115_0020350 | |||
| 1451 | Ga0496115_0028491 | |||
| 1452 | Ga0501034_0065822 | |||
| 1453 | Ga0501040_0272932 | |||
| 1454 | Ga0501047_0049922 | |||
| 1455 | Ga0501047_0138992 | |||
| 1456 | Ga0501067_0014385 | |||
| 1457 | Ga0501067_0019142 | |||
| 1458 | Ga0501067_0082921 | |||
| 1459 | Ga0501067_0280903 | |||
| 1460 | Ga0501069_0031223 | |||
| 1461 | Ga0501069_0041911 | |||
| 1462 | Ga0501070_0001687 | |||
| 1463 | Ga0501070_0001972 | |||
| 1464 | Ga0501070_0365281 | |||
| 1465 | Ga0501070_0669412 | |||
| 1466 | Ga0501073_0113610 | |||
| 1467 | Ga0501074_0030188 | |||
| 1468 | Ga0501074_0059070 | |||
| 1469 | Ga0501074_0097265 | |||
| 1470 | Ga0501074_0272996 | |||
| 1471 | Ga0501080_0061626 | |||
| 1472 | Ga0501045_0360008 | |||
| 1473 | nmdc:mga00v17_322044_c1 | |||
| 1474 | nmdc:mga0yw44_216635_c1 | |||
| 1475 | nmdc:mga05p37_1094866_c1 | |||
| 1476 | nmdc:mga05p37_139605_c1 | |||
| 1477 | nmdc:mga05p37_354933_c1 | |||
| 1478 | nmdc:mga05p37_37920_c1 | |||
| 1479 | nmdc:mga06r32_186790_c1 | |||
| 1480 | nmdc:mga0n895_29487_c1 | |||
| 1481 | nmdc:mga0n895_360801_c1 | |||
| 1482 | nmdc:mga0n895_42551_c1 | |||
| 1483 | nmdc:mga0rr50_27191_c1 | |||
| 1484 | nmdc:mga0rr50_64864_c1 | |||
| 1485 | nmdc:mga0rr50_73048_c1 | |||
| 1486 | nmdc:mga0a205_159840_c1 | |||
| 1487 | Ga0495601_0093931 | |||
| 1488 | Ga0495601_0113731 | |||
| 1489 | Ga0495601_0170683 | |||
| 1490 | Ga0495601_0237639 | |||
| 1491 | Ga0495612_0004387 | |||
| 1492 | Ga0495612_0020417 | |||
| 1493 | Ga0495612_0040039 | |||
| 1494 | Ga0495612_0043138 | |||
| 1495 | Ga0495612_0120518 | |||
| 1496 | Ga0495612_0224759 | |||
| 1497 | Ga0495595_0059668 | |||
| 1498 | Ga0495595_0244670 | |||
| 1499 | Ga0495595_0270927 | |||
| 1500 | Ga0495619_0027207 | |||
| 1501 | Ga0495619_0034005 | |||
| 1502 | Ga0495619_0035548 | |||
| 1503 | Ga0495619_0040865 | |||
| 1504 | Ga0495619_0056291 | |||
| 1505 | Ga0500566_0010618 | |||
| 1506 | Ga0466962_0004093 | |||
| 1507 | Ga0466962_0024544 | |||
| 1508 | Ga0466962_0069509 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hi9-assembly1.cif.gz_A | zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. | 0.9273 | 1 | 268 |
| 1hi9-assembly1.cif.gz_A | zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. | 0.8877 | 1 | 268 |
| 5btx-assembly2.cif.gz_B | structure of the n-terminal domain of lpg1496 from legionella pneumophila in complex with nucleotide | 0.7167 | 225 | 262 |
| 5kh2-assembly1.cif.gz_A | crystal structure of steptococcus pneumoniae undecaprenyl pyrophosphate synthase (upps) | 0.6744 | 3 | 58 |
| 5mzv-assembly1.cif.gz_C | il-23:il-23r:nb22e11 complex | 0.6507 | 223 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hi9E01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein | 0.9316 | 1 | 219 | 3.40.50.10780 |
| 1hi9E01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein | 0.9135 | 1 | 219 | 3.40.50.10780 |
| 1hi9A02 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Dipeptide transport protein | 0.8468 | 223 | 268 | 3.30.1360.130 |
| 2cx8A02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.6225 | 1 | 58 | 3.40.1280.10 |
| af_Q8K4B4_1_120_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6211 | 223 | 261 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9PZX1-F1-model_v4 | M55 family metallopeptidase | 0.9916 | 1 | 271 |
GO:0046872
|
| AF-A0A1Q7UG93-F1-model_v4 | Peptidase M55 | 0.9902 | 1 | 250 |
|
| AF-A0A7V9PZX1-F1-model_v4 | M55 family metallopeptidase | 0.9879 | 1 | 271 |
GO:0046872
|
| AF-A0A7W1K7G7-F1-model_v4 | M55 family metallopeptidase | 0.9836 | 128 | 271 |
|
| AF-A0A7V9IGF3-F1-model_v4 | M55 family metallopeptidase | 0.9829 | 56 | 271 |
|