F479243
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 369 | 701 | 394 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100097254|Ga0070713_1000972542 |
| Length | 429 |
| Sequence | VSTPVERLPARLATPETELTVSAPTNPLHLAVALDGAGWHPAAWREPDAQPNRLFTPGYWVDLAQQAERGLLDFVTIEDGLDLQSDDRFRHDERTDRVRGRLDAVLIAARVAPATRRIGLIPTAVTTHTEPFHLSKAIATVDYASTGRAGVRVQIGGRADTAAHFGRREIGQLDAARYNEPEVQRQIAAHFDEAADYVEVLRRLWDSWEDDAEIRDVATGRFIDREKLHYIDFAGRWFAVKGPSITPRPPQGQPVVAALGHASVPYGLIASSADVGFVTPRDRSHAAEIVTEIRVAQEKAGRPDVHLFGDVVVFLDDSADLARARRQRMDERAGAEYTSDARIFTGTAAQLADLLLDLSEAGLTGFRLRPAALPHDLTQITDALVPELQRRSAFRAAYPDSASGGGWSATLRGLLGLPRPANRYSRDVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 6 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 7 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 8 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 9 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 10 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 11 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 12 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 13 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 14 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 15 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 16 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 17 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 18 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 19 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 20 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 21 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 22 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 23 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 24 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 25 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 26 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 27 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 28 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 29 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 30 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 31 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 32 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 33 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 34 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 35 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 36 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 37 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 38 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 39 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 40 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 41 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 42 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 43 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 44 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 45 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 46 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 47 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 48 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 49 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 51 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 174 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 212 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 218 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 310 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 311 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 350 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 359 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 360 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 364 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 365 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 366 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 367 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 368 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 369 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.84 |
| Metatranscriptomes | 0.13 |
| Isolates | 7.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 0.53 |
| Rhizoplane | 8.89 |
| Rhizosphere | 69.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10013366 | 3300002067 | Bacteria | 2583 |
| 2 | rootH1_10108066 | 3300003316 | Bacteria | 1396 |
| 3 | JGI25160J50197_1005722 | 3300003354 | Bacteria | 5133 |
| 4 | Ga0006562J51391_1086760 | 3300003578 | Bacteria | 1700 |
| 5 | Ga0055540_1000036 | 3300003792 | Bacteria | 164285 |
| 6 | Ga0055540_1000710 | 3300003792 | Bacteria | 22736 |
| 7 | Ga0055540_1000951 | 3300003792 | Bacteria | 18813 |
| 8 | Ga0055540_1001570 | 3300003792 | Bacteria | 13325 |
| 9 | Ga0065714_10006054 | 3300005288 | Bacteria | 4507 |
| 10 | Ga0070658_10042920 | 3300005327 | Bacteria | 3653 |
| 11 | Ga0070683_100028208 | 3300005329 | Bacteria | 5071 |
| 12 | Ga0070683_100084928 | 3300005329 | Bacteria | 2966 |
| 13 | Ga0070683_100171871 | 3300005329 | Bacteria | 2057 |
| 14 | Ga0070683_100280320 | 3300005329 | Bacteria | 1585 |
| 15 | Ga0070666_10011772 | 3300005335 | Bacteria | 5500 |
| 16 | Ga0070682_100004731 | 3300005337 | Bacteria | 7564 |
| 17 | Ga0070682_100027560 | 3300005337 | Bacteria | 3410 |
| 18 | Ga0070682_100063083 | 3300005337 | Bacteria | 2348 |
| 19 | Ga0068868_100008432 | 3300005338 | Bacteria | 7380 |
| 20 | Ga0068868_100099272 | 3300005338 | Bacteria | 2355 |
| 21 | Ga0068868_100254550 | 3300005338 | Bacteria | 1479 |
| 22 | Ga0068868_100264652 | 3300005338 | Bacteria | 1451 |
| 23 | Ga0070689_100015610 | 3300005340 | Bacteria | 5543 |
| 24 | Ga0070689_100048702 | 3300005340 | Bacteria | 3269 |
| 25 | Ga0070692_10010302 | 3300005345 | Bacteria | 4248 |
| 26 | Ga0070668_100000347 | 3300005347 | Bacteria | 30543 |
| 27 | Ga0070668_100012548 | 3300005347 | Bacteria | 6310 |
| 28 | Ga0070668_100033452 | 3300005347 | Bacteria | 3915 |
| 29 | Ga0070668_100095059 | 3300005347 | Bacteria | 2354 |
| 30 | Ga0070668_100137698 | 3300005347 | Bacteria | 1965 |
| 31 | Ga0070668_100153723 | 3300005347 | Bacteria | 1863 |
| 32 | Ga0070669_100001706 | 3300005353 | Bacteria | 15898 |
| 33 | Ga0070671_100001367 | 3300005355 | Bacteria | 18280 |
| 34 | Ga0070688_100198379 | 3300005365 | Bacteria | 1403 |
| 35 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 36 | Ga0070667_100001523 | 3300005367 | Bacteria | 20742 |
| 37 | Ga0070709_10073610 | 3300005434 | Bacteria | 2212 |
| 38 | Ga0070714_100023229 | 3300005435 | Bacteria | 5091 |
| 39 | Ga0070714_100155884 | 3300005435 | Bacteria | 2061 |
| 40 | Ga0070714_100168788 | 3300005435 | Bacteria | 1985 |
| 41 | Ga0070714_100205231 | 3300005435 | Bacteria | 1804 |
| 42 | Ga0070713_100018089 | 3300005436 | Bacteria | 5352 |
| 43 | Ga0070713_100097254 | 3300005436 | Bacteria | 2543 |
| 44 | Ga0070713_100336854 | 3300005436 | Bacteria | 1397 |
| 45 | Ga0070713_100354071 | 3300005436 | Bacteria | 1363 |
| 46 | Ga0070710_10005431 | 3300005437 | Bacteria | 6053 |
| 47 | Ga0070710_10011306 | 3300005437 | Bacteria | 4409 |
| 48 | Ga0070710_10035164 | 3300005437 | Bacteria | 2730 |
| 49 | Ga0070711_100204898 | 3300005439 | Bacteria | 1524 |
| 50 | Ga0070711_100271176 | 3300005439 | Bacteria | 1339 |
| 51 | Ga0070663_100006011 | 3300005455 | Bacteria | 7263 |
| 52 | Ga0070663_100025352 | 3300005455 | Bacteria | 4002 |
| 53 | Ga0070663_100279563 | 3300005455 | Bacteria | 1330 |
| 54 | Ga0070662_100053940 | 3300005457 | Bacteria | 2912 |
| 55 | Ga0070707_100040022 | 3300005468 | Bacteria | 4483 |
| 56 | Ga0070697_100202792 | 3300005536 | Bacteria | 1686 |
| 57 | Ga0068853_100032974 | 3300005539 | Bacteria | 4391 |
| 58 | Ga0068853_100106781 | 3300005539 | Bacteria | 2482 |
| 59 | Ga0070686_100047935 | 3300005544 | Bacteria | 2704 |
| 60 | Ga0070665_100003950 | 3300005548 | Bacteria | 15646 |
| 61 | Ga0070665_100005830 | 3300005548 | Bacteria | 12634 |
| 62 | Ga0070665_100025431 | 3300005548 | Bacteria | 5965 |
| 63 | Ga0070665_100083145 | 3300005548 | Bacteria | 3207 |
| 64 | Ga0070665_100175099 | 3300005548 | Bacteria | 2146 |
| 65 | Ga0070665_100244543 | 3300005548 | Bacteria | 1795 |
| 66 | Ga0068855_100242562 | 3300005563 | Bacteria | 2013 |
| 67 | Ga0070664_100013642 | 3300005564 | Bacteria | 6621 |
| 68 | Ga0070664_100096882 | 3300005564 | Bacteria | 2560 |
| 69 | Ga0070664_100249873 | 3300005564 | Bacteria | 1594 |
| 70 | Ga0068857_100064410 | 3300005577 | Bacteria | 3259 |
| 71 | Ga0068857_100176977 | 3300005577 | Bacteria | 1941 |
| 72 | Ga0068856_100083313 | 3300005614 | Bacteria | 3175 |
| 73 | Ga0068856_100191822 | 3300005614 | Bacteria | 2057 |
| 74 | Ga0070702_100081959 | 3300005615 | Bacteria | 1934 |
| 75 | Ga0068852_100030669 | 3300005616 | Bacteria | 4429 |
| 76 | Ga0068859_100000751 | 3300005617 | Bacteria | 32654 |
| 77 | Ga0068864_100020731 | 3300005618 | Bacteria | 5501 |
| 78 | Ga0068864_100067107 | 3300005618 | Bacteria | 3114 |
| 79 | Ga0068864_100196688 | 3300005618 | Bacteria | 1850 |
| 80 | Ga0068870_10006476 | 3300005840 | Bacteria | 5164 |
| 81 | Ga0068863_100003061 | 3300005841 | Bacteria | 16532 |
| 82 | Ga0068863_100004393 | 3300005841 | Bacteria | 13902 |
| 83 | Ga0068863_100058432 | 3300005841 | Bacteria | 3649 |
| 84 | Ga0068863_100190384 | 3300005841 | Bacteria | 1971 |
| 85 | Ga0068858_100021321 | 3300005842 | Bacteria | 6051 |
| 86 | Ga0068858_100043454 | 3300005842 | Bacteria | 4166 |
| 87 | Ga0068858_100063112 | 3300005842 | Bacteria | 3428 |
| 88 | Ga0068858_100239850 | 3300005842 | Bacteria | 1720 |
| 89 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 90 | Ga0068860_100065619 | 3300005843 | Bacteria | 3447 |
| 91 | Ga0068860_100099535 | 3300005843 | Bacteria | 2773 |
| 92 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 93 | Ga0068862_100009803 | 3300005844 | Bacteria | 7916 |
| 94 | Ga0081455_10000090 | 3300005937 | Bacteria | 97813 |
| 95 | Ga0081455_10002986 | 3300005937 | Bacteria | 19737 |
| 96 | Ga0070717_10067102 | 3300006028 | Bacteria | 2984 |
| 97 | Ga0070717_10200230 | 3300006028 | Bacteria | 1749 |
| 98 | Ga0070717_10212387 | 3300006028 | Bacteria | 1699 |
| 99 | Ga0075365_10004991 | 3300006038 | Bacteria | 7107 |
| 100 | Ga0075365_10043575 | 3300006038 | Bacteria | 2937 |
| 101 | Ga0075363_100008182 | 3300006048 | Bacteria | 4857 |
| 102 | Ga0075364_10006220 | 3300006051 | Bacteria | 7002 |
| 103 | Ga0075364_10055815 | 3300006051 | Bacteria | 2585 |
| 104 | Ga0070712_100015368 | 3300006175 | Bacteria | 4928 |
| 105 | Ga0075369_10004266 | 3300006186 | Bacteria | 5268 |
| 106 | Ga0075369_10027494 | 3300006186 | Bacteria | 2378 |
| 107 | Ga0097621_100133059 | 3300006237 | Bacteria | 2118 |
| 108 | Ga0097621_100172750 | 3300006237 | Bacteria | 1864 |
| 109 | Ga0075430_100173757 | 3300006846 | Bacteria | 1792 |
| 110 | Ga0075434_100313343 | 3300006871 | Bacteria | 1589 |
| 111 | Ga0097620_100000751 | 3300006931 | Bacteria | 32654 |
| 112 | Ga0075435_100106709 | 3300007076 | Bacteria | 2326 |
| 113 | Ga0105251_10030879 | 3300009011 | Bacteria | 2686 |
| 114 | Ga0105245_10007000 | 3300009098 | Bacteria | 9894 |
| 115 | Ga0105245_10020466 | 3300009098 | Bacteria | 5802 |
| 116 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 117 | Ga0105243_10040570 | 3300009148 | Bacteria | 3636 |
| 118 | Ga0105243_10187234 | 3300009148 | Bacteria | 1805 |
| 119 | Ga0105241_10000239 | 3300009174 | Bacteria | 41568 |
| 120 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 121 | Ga0105248_10192652 | 3300009177 | Bacteria | 2297 |
| 122 | Ga0105248_10218510 | 3300009177 | Bacteria | 2146 |
| 123 | Ga0105248_10322508 | 3300009177 | Bacteria | 1740 |
| 124 | Ga0105237_10012977 | 3300009545 | Bacteria | 8748 |
| 125 | Ga0105237_10052218 | 3300009545 | Bacteria | 4104 |
| 126 | Ga0105237_10123088 | 3300009545 | Bacteria | 2588 |
| 127 | Ga0105238_10043053 | 3300009551 | Bacteria | 4569 |
| 128 | Ga0105238_10049757 | 3300009551 | Bacteria | 4220 |
| 129 | Ga0105238_10101783 | 3300009551 | Bacteria | 2855 |
| 130 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 131 | Ga0105249_10024832 | 3300009553 | Bacteria | 5389 |
| 132 | Ga0105239_10009798 | 3300010375 | Bacteria | 10764 |
| 133 | Ga0105239_10063452 | 3300010375 | Bacteria | 4056 |
| 134 | Ga0105239_10164326 | 3300010375 | Bacteria | 2481 |
| 135 | Ga0157369_10091263 | 3300013105 | Bacteria | 3252 |
| 136 | Ga0157369_10138995 | 3300013105 | Bacteria | 2571 |
| 137 | Ga0157369_10222774 | 3300013105 | Bacteria | 1974 |
| 138 | Ga0157374_10018011 | 3300013296 | Bacteria | 6228 |
| 139 | Ga0157374_10103464 | 3300013296 | Bacteria | 2732 |
| 140 | Ga0157372_10177069 | 3300013307 | Bacteria | 2469 |
| 141 | Ga0157372_10277705 | 3300013307 | Bacteria | 1947 |
| 142 | Ga0157375_10016532 | 3300013308 | Bacteria | 6633 |
| 143 | Ga0157375_10150564 | 3300013308 | Bacteria | 2462 |
| 144 | Ga0157375_10179549 | 3300013308 | Bacteria | 2268 |
| 145 | Ga0163163_10030509 | 3300014325 | Bacteria | 5195 |
| 146 | Ga0163163_10083421 | 3300014325 | Bacteria | 3201 |
| 147 | Ga0157377_10026174 | 3300014745 | Bacteria | 3119 |
| 148 | Ga0157377_10139477 | 3300014745 | Bacteria | 1489 |
| 149 | Ga0157379_10007317 | 3300014968 | Bacteria | 9553 |
| 150 | Ga0157379_10020562 | 3300014968 | Bacteria | 5839 |
| 151 | Ga0157379_10098581 | 3300014968 | Bacteria | 2624 |
| 152 | Ga0157379_10139072 | 3300014968 | Bacteria | 2189 |
| 153 | Ga0213876_10001397 | 3300021384 | Bacteria | 15068 |
| 154 | Ga0213875_10000235 | 3300021388 | Bacteria | 56070 |
| 155 | Ga0213875_10000634 | 3300021388 | Bacteria | 28091 |
| 156 | Ga0213875_10006833 | 3300021388 | Bacteria | 5955 |
| 157 | Ga0213875_10011514 | 3300021388 | Bacteria | 4399 |
| 158 | Ga0213875_10015450 | 3300021388 | Bacteria | 3714 |
| 159 | Ga0213875_10051837 | 3300021388 | Bacteria | 1922 |
| 160 | Ga0209455_1001859 | 3300025272 | Bacteria | 8827 |
| 161 | Ga0209673_1014992 | 3300025273 | Bacteria | 2969 |
| 162 | Ga0207426_1000920 | 3300025302 | Bacteria | 29413 |
| 163 | Ga0207426_1005429 | 3300025302 | Bacteria | 5817 |
| 164 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 165 | Ga0209051_1000466 | 3300025303 | Bacteria | 53034 |
| 166 | Ga0209051_1002017 | 3300025303 | Bacteria | 15468 |
| 167 | Ga0209051_1057088 | 3300025303 | Bacteria | 1253 |
| 168 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 169 | Ga0207688_10002529 | 3300025901 | Bacteria | 9864 |
| 170 | Ga0207688_10045250 | 3300025901 | Bacteria | 2455 |
| 171 | Ga0207699_10035924 | 3300025906 | Bacteria | 2822 |
| 172 | Ga0207699_10058887 | 3300025906 | Bacteria | 2300 |
| 173 | Ga0207643_10027244 | 3300025908 | Bacteria | 3167 |
| 174 | Ga0207705_10080049 | 3300025909 | Bacteria | 2380 |
| 175 | Ga0207705_10096431 | 3300025909 | Bacteria | 2171 |
| 176 | Ga0207654_10041372 | 3300025911 | Bacteria | 2602 |
| 177 | Ga0207671_10000365 | 3300025914 | Bacteria | 64530 |
| 178 | Ga0207671_10113842 | 3300025914 | Bacteria | 2061 |
| 179 | Ga0207693_10030363 | 3300025915 | Bacteria | 4268 |
| 180 | Ga0207662_10023219 | 3300025918 | Bacteria | 3562 |
| 181 | Ga0207646_10065677 | 3300025922 | Bacteria | 3240 |
| 182 | Ga0207681_10001181 | 3300025923 | Bacteria | 16820 |
| 183 | Ga0207694_10001761 | 3300025924 | Bacteria | 18157 |
| 184 | Ga0207694_10075529 | 3300025924 | Bacteria | 2638 |
| 185 | Ga0207687_10012002 | 3300025927 | Bacteria | 5666 |
| 186 | Ga0207687_10026927 | 3300025927 | Bacteria | 3854 |
| 187 | Ga0207700_10063526 | 3300025928 | Bacteria | 2808 |
| 188 | Ga0207664_10054885 | 3300025929 | Bacteria | 3159 |
| 189 | Ga0207664_10077458 | 3300025929 | Bacteria | 2694 |
| 190 | Ga0207664_10097014 | 3300025929 | Bacteria | 2428 |
| 191 | Ga0207664_10323351 | 3300025929 | Bacteria | 1361 |
| 192 | Ga0207644_10000916 | 3300025931 | Bacteria | 18706 |
| 193 | Ga0207690_10127050 | 3300025932 | Bacteria | 1860 |
| 194 | Ga0207706_10021851 | 3300025933 | Bacteria | 5744 |
| 195 | Ga0207706_10121169 | 3300025933 | Bacteria | 2300 |
| 196 | Ga0207670_10034083 | 3300025936 | Bacteria | 3286 |
| 197 | Ga0207665_10008824 | 3300025939 | Bacteria | 6626 |
| 198 | Ga0207665_10026153 | 3300025939 | Bacteria | 3851 |
| 199 | Ga0207665_10040401 | 3300025939 | Bacteria | 3112 |
| 200 | Ga0207691_10104049 | 3300025940 | Bacteria | 2531 |
| 201 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 202 | Ga0207711_10108029 | 3300025941 | Bacteria | 2471 |
| 203 | Ga0207689_10006694 | 3300025942 | Bacteria | 10166 |
| 204 | Ga0207689_10056012 | 3300025942 | Bacteria | 3244 |
| 205 | Ga0207661_10114848 | 3300025944 | Bacteria | 2283 |
| 206 | Ga0207661_10126342 | 3300025944 | Bacteria | 2185 |
| 207 | Ga0207679_10029836 | 3300025945 | Bacteria | 3801 |
| 208 | Ga0207679_10069586 | 3300025945 | Bacteria | 2649 |
| 209 | Ga0207679_10141600 | 3300025945 | Bacteria | 1945 |
| 210 | Ga0207651_10223183 | 3300025960 | Bacteria | 1525 |
| 211 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 212 | Ga0207668_10003758 | 3300025972 | Bacteria | 8942 |
| 213 | Ga0207668_10012725 | 3300025972 | Bacteria | 5160 |
| 214 | Ga0207668_10016784 | 3300025972 | Bacteria | 4577 |
| 215 | Ga0207668_10036567 | 3300025972 | Bacteria | 3278 |
| 216 | Ga0207658_10000611 | 3300025986 | Bacteria | 31714 |
| 217 | Ga0207658_10000664 | 3300025986 | Bacteria | 30027 |
| 218 | Ga0207677_10133668 | 3300026023 | Bacteria | 1888 |
| 219 | Ga0207677_10243608 | 3300026023 | Bacteria | 1456 |
| 220 | Ga0207703_10059827 | 3300026035 | Bacteria | 3113 |
| 221 | Ga0207703_10126774 | 3300026035 | Bacteria | 2199 |
| 222 | Ga0207639_10020125 | 3300026041 | Bacteria | 4775 |
| 223 | Ga0207678_10000318 | 3300026067 | Bacteria | 43470 |
| 224 | Ga0207678_10022477 | 3300026067 | Bacteria | 5523 |
| 225 | Ga0207678_10029113 | 3300026067 | Bacteria | 4820 |
| 226 | Ga0207678_10031395 | 3300026067 | Bacteria | 4634 |
| 227 | Ga0207678_10076531 | 3300026067 | Bacteria | 2866 |
| 228 | Ga0207678_10124428 | 3300026067 | Bacteria | 2200 |
| 229 | Ga0207702_10095896 | 3300026078 | Bacteria | 2607 |
| 230 | Ga0207702_10111872 | 3300026078 | Bacteria | 2429 |
| 231 | Ga0207702_10155960 | 3300026078 | Bacteria | 2081 |
| 232 | Ga0207641_10003278 | 3300026088 | Bacteria | 14399 |
| 233 | Ga0207641_10003364 | 3300026088 | Bacteria | 14205 |
| 234 | Ga0207641_10210600 | 3300026088 | Bacteria | 1797 |
| 235 | Ga0207676_10082498 | 3300026095 | Bacteria | 2615 |
| 236 | Ga0207676_10093470 | 3300026095 | Bacteria | 2476 |
| 237 | Ga0207674_10008338 | 3300026116 | Bacteria | 11991 |
| 238 | Ga0207674_10016576 | 3300026116 | Bacteria | 8058 |
| 239 | Ga0207683_10063268 | 3300026121 | Bacteria | 3259 |
| 240 | Ga0207683_10266922 | 3300026121 | Bacteria | 1563 |
| 241 | Ga0207698_10021930 | 3300026142 | Bacteria | 4427 |
| 242 | Ga0207698_10046169 | 3300026142 | Bacteria | 3287 |
| 243 | Ga0207698_10221136 | 3300026142 | Bacteria | 1711 |
| 244 | Ga0268266_10015163 | 3300028379 | Bacteria | 6617 |
| 245 | Ga0268266_10027084 | 3300028379 | Bacteria | 4877 |
| 246 | Ga0268266_10028517 | 3300028379 | Bacteria | 4744 |
| 247 | Ga0268266_10061022 | 3300028379 | Bacteria | 3251 |
| 248 | Ga0268266_10121114 | 3300028379 | Bacteria | 2329 |
| 249 | Ga0268266_10206495 | 3300028379 | Bacteria | 1800 |
| 250 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 251 | Ga0268265_10011636 | 3300028380 | Bacteria | 5950 |
| 252 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 253 | Ga0268264_10004745 | 3300028381 | Bacteria | 11545 |
| 254 | Ga0268264_10067008 | 3300028381 | Bacteria | 3029 |
| 255 | Ga0268264_10111430 | 3300028381 | Bacteria | 2397 |
| 256 | Ga0265337_1000404 | 3300028556 | Bacteria | 23232 |
| 257 | Ga0265334_10007863 | 3300028573 | Bacteria | 4560 |
| 258 | Ga0265336_10003483 | 3300028666 | Bacteria | 6157 |
| 259 | Ga0265336_10009230 | 3300028666 | Bacteria | 3416 |
| 260 | Ga0307517_10012361 | 3300028786 | Bacteria | 11727 |
| 261 | Ga0307515_10036520 | 3300028794 | Bacteria | 7945 |
| 262 | Ga0265338_10002127 | 3300028800 | Bacteria | 30414 |
| 263 | Ga0265338_10003375 | 3300028800 | Bacteria | 22553 |
| 264 | Ga0265338_10004287 | 3300028800 | Bacteria | 19361 |
| 265 | Ga0265338_10065466 | 3300028800 | Bacteria | 3152 |
| 266 | Ga0307511_10000191 | 3300030521 | Bacteria | 60992 |
| 267 | Ga0307512_10010989 | 3300030522 | Bacteria | 8602 |
| 268 | Ga0307512_10011774 | 3300030522 | Bacteria | 8271 |
| 269 | Ga0307512_10110013 | 3300030522 | Bacteria | 1820 |
| 270 | Ga0265332_10026063 | 3300031238 | Bacteria | 2565 |
| 271 | Ga0265327_10000177 | 3300031251 | Bacteria | 136559 |
| 272 | Ga0265316_10046074 | 3300031344 | Bacteria | 3457 |
| 273 | Ga0307513_10000248 | 3300031456 | Bacteria | 78312 |
| 274 | Ga0307513_10005780 | 3300031456 | Bacteria | 16269 |
| 275 | Ga0307513_10060487 | 3300031456 | Bacteria | 4016 |
| 276 | Ga0307508_10017127 | 3300031616 | Bacteria | 6590 |
| 277 | Ga0307508_10219578 | 3300031616 | Bacteria | 1501 |
| 278 | Ga0307514_10018424 | 3300031649 | Bacteria | 5724 |
| 279 | Ga0307514_10051472 | 3300031649 | Bacteria | 3191 |
| 280 | Ga0265314_10043522 | 3300031711 | Bacteria | 3191 |
| 281 | Ga0265342_10040486 | 3300031712 | Bacteria | 2825 |
| 282 | Ga0307516_10028531 | 3300031730 | Bacteria | 5647 |
| 283 | Ga0307407_10095384 | 3300031903 | Bacteria | 1834 |
| 284 | Ga0307416_100197060 | 3300032002 | Bacteria | 1906 |
| 285 | Ga0307507_10020556 | 3300033179 | Bacteria | 7389 |
| 286 | Ga0373926_0001427 | 3300035083 | Bacteria | 7259 |
| 287 | Ga0373944_0000291 | 3300035089 | Bacteria | 11152 |
| 288 | Ga0373949_0024732 | 3300035090 | Bacteria | 1398 |
| 289 | Ga0373951_0000001 | 3300035091 | Bacteria | 119231 |
| 290 | Ga0373923_0020939 | 3300035111 | Bacteria | 2547 |
| 291 | Ga0373936_0000195 | 3300035113 | Bacteria | 20212 |
| 292 | Ga0373936_0027486 | 3300035113 | Bacteria | 2231 |
| 293 | Ga0373945_0000055 | 3300035116 | Bacteria | 24558 |
| 294 | Ga0373945_0063736 | 3300035116 | Bacteria | 1380 |
| 295 | Ga0373954_0014483 | 3300035118 | Bacteria | 3516 |
| 296 | Ga0373956_0009965 | 3300035119 | Bacteria | 3876 |
| 297 | Ga0373943_0000041 | 3300035170 | Bacteria | 43691 |
| 298 | Ga0373943_0072571 | 3300035170 | Bacteria | 1746 |
| 299 | Ga0373943_0110819 | 3300035170 | Bacteria | 1447 |
| 300 | Ga0373946_0001009 | 3300035171 | Bacteria | 9657 |
| 301 | Ga0373955_0005335 | 3300035172 | Bacteria | 5773 |
| 302 | Ga0373924_0074223 | 3300035410 | Bacteria | 1438 |
| 303 | Ga0373935_0000404 | 3300035692 | Bacteria | 22444 |
| 304 | Ga0373935_0032787 | 3300035692 | Bacteria | 3229 |
| 305 | Ga0373935_0089967 | 3300035692 | Bacteria | 2008 |
| 306 | Ga0373927_0001129 | 3300035695 | Bacteria | 20211 |
| 307 | Ga0373933_0021427 | 3300035724 | Bacteria | 3671 |
| 308 | Ga0373933_0064036 | 3300035724 | Bacteria | 2223 |
| 309 | Ga0373947_0000535 | 3300035725 | Bacteria | 22232 |
| 310 | Ga0373937_0053708 | 3300036401 | Bacteria | 3695 |
| 311 | Ga0373937_0102443 | 3300036401 | Bacteria | 2658 |
| 312 | Ga0373925_0000592 | 3300037068 | Bacteria | 34869 |
| 313 | Ga0373925_0004534 | 3300037068 | Bacteria | 10495 |
| 314 | Ga0373925_0076296 | 3300037068 | Bacteria | 2541 |
| 315 | Ga0373925_0253242 | 3300037068 | Bacteria | 1412 |
| 316 | Ga0395900_0153964 | 3300037418 | Bacteria | 2349 |
| 317 | Ga0395898_0025057 | 3300037466 | Bacteria | 6014 |
| 318 | Ga0395898_0059610 | 3300037466 | Bacteria | 3712 |
| 319 | Ga0436364_0256666 | 3300037853 | Bacteria | 3569 |
| 320 | Ga0436364_0256931 | 3300037853 | Bacteria | 1575 |
| 321 | Ga0436364_0282469 | 3300037853 | Bacteria | 49422 |
| 322 | Ga0436364_0507746 | 3300037853 | Bacteria | 25113 |
| 323 | Ga0436364_0633952 | 3300037853 | Bacteria | 26538 |
| 324 | Ga0436364_0691418 | 3300037853 | Bacteria | 23018 |
| 325 | Ga0436364_1009099 | 3300037853 | Bacteria | 3966 |
| 326 | Ga0436364_1034848 | 3300037853 | Bacteria | 1922 |
| 327 | Ga0395901_0018525 | 3300038443 | Bacteria | 7108 |
| 328 | Ga0436365_0514921 | 3300039437 | Bacteria | 2737 |
| 329 | Ga0436365_0931839 | 3300039437 | Bacteria | 121124 |
| 330 | Ga0439461_0008187 | 3300041410 | Bacteria | 1868 |
| 331 | Ga0439466_0012279 | 3300041411 | Bacteria | 3158 |
| 332 | Ga0451807_1774657 | 3300041486 | Bacteria | 1807 |
| 333 | Ga0451845_0999523 | 3300041501 | Bacteria | 1311 |
| 334 | Ga0439431_0001647 | 3300041997 | Bacteria | 4936 |
| 335 | Ga0439445_0005083 | 3300042004 | Bacteria | 2989 |
| 336 | Ga0450903_004971 | 3300042138 | Bacteria | 2240 |
| 337 | Ga0439434_0022683 | 3300042435 | Bacteria | 1887 |
| 338 | Ga0466969_0005780 | 3300044656 | Bacteria | 6572 |
| 339 | Ga0466969_0066241 | 3300044656 | Bacteria | 1744 |
| 340 | Ga0466972_0004530 | 3300044658 | Bacteria | 6957 |
| 341 | Ga0466965_0001210 | 3300044683 | Bacteria | 10199 |
| 342 | Ga0466965_0006039 | 3300044683 | Bacteria | 5473 |
| 343 | Ga0466965_0037292 | 3300044683 | Bacteria | 2387 |
| 344 | Ga0466965_0094844 | 3300044683 | Bacteria | 1521 |
| 345 | Ga0466966_0007160 | 3300044684 | Bacteria | 7392 |
| 346 | Ga0466966_0116310 | 3300044684 | Bacteria | 1646 |
| 347 | Ga0466961_0016771 | 3300044693 | Bacteria | 4708 |
| 348 | Ga0466961_0141162 | 3300044693 | Bacteria | 1508 |
| 349 | Ga0466963_0149218 | 3300044694 | Bacteria | 1623 |
| 350 | Ga0466971_0011830 | 3300044719 | Bacteria | 3823 |
| 351 | Ga0466971_0021849 | 3300044719 | Bacteria | 2848 |
| 352 | Ga0466971_0052020 | 3300044719 | Bacteria | 1845 |
| 353 | Ga0466970_0012016 | 3300044765 | Bacteria | 4421 |
| 354 | Ga0466970_0016852 | 3300044765 | Bacteria | 3772 |
| 355 | Ga0466970_0018071 | 3300044765 | Bacteria | 3650 |
| 356 | Ga0466970_0045069 | 3300044765 | Bacteria | 2348 |
| 357 | Ga0466970_0061415 | 3300044765 | Bacteria | 2013 |
| 358 | Ga0466957_0010103 | 3300044842 | Bacteria | 5403 |
| 359 | Ga0466960_0000354 | 3300044901 | Bacteria | 15670 |
| 360 | Ga0466960_0004305 | 3300044901 | Bacteria | 5549 |
| 361 | Ga0466960_0056896 | 3300044901 | Bacteria | 1905 |
| 362 | Ga0466960_0106329 | 3300044901 | Bacteria | 1451 |
| 363 | Ga0466959_0001342 | 3300045049 | Bacteria | 14996 |
| 364 | Ga0466959_0005746 | 3300045049 | Bacteria | 8533 |
| 365 | Ga0466959_0005769 | 3300045049 | Bacteria | 8523 |
| 366 | Ga0466959_0029424 | 3300045049 | Bacteria | 4069 |
| 367 | Ga0466958_0049375 | 3300045836 | Bacteria | 2545 |
| 368 | Ga0466967_0003959 | 3300045976 | Bacteria | 9856 |
| 369 | Ga0466967_0011767 | 3300045976 | Bacteria | 6652 |
| 370 | Ga0466967_0056906 | 3300045976 | Bacteria | 3450 |
| 371 | Ga0466967_0062679 | 3300045976 | Bacteria | 3301 |
| 372 | Ga0466967_0077240 | 3300045976 | Bacteria | 2997 |
| 373 | Ga0466967_0117346 | 3300045976 | Bacteria | 2453 |
| 374 | Ga0466967_0179104 | 3300045976 | Bacteria | 1998 |
| 375 | Ga0466967_0219203 | 3300045976 | Bacteria | 1807 |
| 376 | Ga0495592_0000533 | 3300046454 | Bacteria | 27280 |
| 377 | Ga0495592_0022151 | 3300046454 | Bacteria | 4834 |
| 378 | Ga0495592_0044771 | 3300046454 | Bacteria | 3305 |
| 379 | Ga0495592_0061583 | 3300046454 | Bacteria | 2757 |
| 380 | Ga0495603_0028858 | 3300046455 | Bacteria | 3347 |
| 381 | Ga0495629_0019402 | 3300046459 | Bacteria | 4857 |
| 382 | Ga0495629_0033843 | 3300046459 | Bacteria | 3614 |
| 383 | Ga0495629_0108593 | 3300046459 | Bacteria | 1935 |
| 384 | Ga0495638_0000563 | 3300046460 | Bacteria | 42248 |
| 385 | Ga0495638_0003192 | 3300046460 | Bacteria | 12956 |
| 386 | Ga0495638_0016872 | 3300046460 | Bacteria | 4883 |
| 387 | Ga0495641_0017895 | 3300046461 | Bacteria | 3673 |
| 388 | Ga0495641_0019964 | 3300046461 | Bacteria | 3414 |
| 389 | Ga0495641_0064723 | 3300046461 | Bacteria | 1646 |
| 390 | Ga0495651_0000122 | 3300046462 | Bacteria | 57344 |
| 391 | Ga0495651_0009308 | 3300046462 | Bacteria | 7538 |
| 392 | Ga0495651_0012823 | 3300046462 | Bacteria | 6472 |
| 393 | Ga0495653_0001396 | 3300046463 | Bacteria | 18786 |
| 394 | Ga0495653_0016189 | 3300046463 | Bacteria | 6074 |
| 395 | Ga0495582_0003116 | 3300046473 | Bacteria | 9297 |
| 396 | Ga0495582_0112530 | 3300046473 | Bacteria | 1529 |
| 397 | Ga0495662_0000937 | 3300046476 | Bacteria | 14286 |
| 398 | Ga0495662_0030153 | 3300046476 | Bacteria | 2618 |
| 399 | Ga0495664_0000524 | 3300046477 | Bacteria | 19225 |
| 400 | Ga0495664_0002583 | 3300046477 | Bacteria | 9740 |
| 401 | Ga0495664_0033208 | 3300046477 | Bacteria | 3032 |
| 402 | Ga0495664_0133968 | 3300046477 | Bacteria | 1501 |
| 403 | Ga0495585_0069283 | 3300046492 | Bacteria | 1925 |
| 404 | Ga0495608_0001351 | 3300046511 | Bacteria | 17478 |
| 405 | Ga0495610_0089467 | 3300046512 | Bacteria | 1398 |
| 406 | Ga0495616_0026004 | 3300046513 | Bacteria | 3120 |
| 407 | Ga0495618_0038890 | 3300046514 | Bacteria | 2990 |
| 408 | Ga0495620_0016695 | 3300046515 | Bacteria | 3677 |
| 409 | Ga0495628_0004846 | 3300046516 | Bacteria | 11839 |
| 410 | Ga0495628_0040917 | 3300046516 | Bacteria | 3700 |
| 411 | Ga0495630_0022340 | 3300046517 | Bacteria | 4671 |
| 412 | Ga0495631_0008239 | 3300046518 | Bacteria | 5254 |
| 413 | Ga0495648_0028691 | 3300046524 | Bacteria | 3702 |
| 414 | Ga0495648_0112331 | 3300046524 | Bacteria | 1480 |
| 415 | Ga0495666_0000566 | 3300046526 | Bacteria | 16543 |
| 416 | Ga0495666_0069062 | 3300046526 | Bacteria | 1681 |
| 417 | Ga0495666_0107626 | 3300046526 | Bacteria | 1311 |
| 418 | Ga0495652_0000719 | 3300046529 | Bacteria | 38479 |
| 419 | Ga0495652_0027316 | 3300046529 | Bacteria | 5029 |
| 420 | Ga0495652_0031218 | 3300046529 | Bacteria | 4667 |
| 421 | Ga0495652_0136573 | 3300046529 | Bacteria | 1934 |
| 422 | Ga0495654_0038015 | 3300046530 | Bacteria | 2409 |
| 423 | Ga0495665_0005751 | 3300046531 | Bacteria | 6692 |
| 424 | Ga0495665_0020537 | 3300046531 | Bacteria | 3546 |
| 425 | Ga0495640_0104594 | 3300046533 | Bacteria | 1855 |
| 426 | Ga0495640_0152436 | 3300046533 | Bacteria | 1484 |
| 427 | Ga0495587_0003107 | 3300046536 | Bacteria | 11100 |
| 428 | Ga0495587_0014543 | 3300046536 | Bacteria | 4933 |
| 429 | Ga0495587_0132275 | 3300046536 | Bacteria | 1426 |
| 430 | Ga0495609_0013107 | 3300046538 | Bacteria | 3920 |
| 431 | Ga0495645_0005319 | 3300046543 | Bacteria | 8817 |
| 432 | Ga0495667_0004249 | 3300046559 | Bacteria | 9651 |
| 433 | Ga0495667_0053430 | 3300046559 | Bacteria | 2660 |
| 434 | Ga0495667_0232827 | 3300046559 | Bacteria | 1174 |
| 435 | Ga0495668_0114260 | 3300046616 | Bacteria | 1476 |
| 436 | Ga0495634_0030978 | 3300046642 | Bacteria | 3687 |
| 437 | Ga0495625_0119662 | 3300046660 | Bacteria | 1793 |
| 438 | Ga0495635_0000353 | 3300046663 | Bacteria | 29160 |
| 439 | Ga0495635_0106007 | 3300046663 | Bacteria | 1920 |
| 440 | Ga0495661_0031457 | 3300046665 | Bacteria | 3367 |
| 441 | Ga0495588_0019465 | 3300046674 | Bacteria | 3324 |
| 442 | Ga0495657_0005834 | 3300046675 | Bacteria | 9691 |
| 443 | Ga0495657_0016427 | 3300046675 | Bacteria | 5394 |
| 444 | Ga0495657_0023808 | 3300046675 | Bacteria | 4371 |
| 445 | Ga0495657_0026610 | 3300046675 | Bacteria | 4094 |
| 446 | Ga0495657_0102330 | 3300046675 | Bacteria | 1823 |
| 447 | Ga0495599_0004312 | 3300046678 | Bacteria | 8415 |
| 448 | Ga0495599_0011835 | 3300046678 | Bacteria | 5364 |
| 449 | Ga0495623_0070073 | 3300046679 | Bacteria | 2184 |
| 450 | Ga0495646_0085505 | 3300046680 | Bacteria | 1830 |
| 451 | Ga0495613_0005276 | 3300046689 | Bacteria | 9706 |
| 452 | Ga0495624_0001681 | 3300046690 | Bacteria | 16953 |
| 453 | Ga0495670_0002891 | 3300046691 | Bacteria | 8465 |
| 454 | Ga0495589_0033338 | 3300046794 | Bacteria | 2587 |
| 455 | Ga0495589_0046187 | 3300046794 | Bacteria | 2162 |
| 456 | Ga0495600_0010944 | 3300046809 | Bacteria | 5643 |
| 457 | Ga0495600_0071881 | 3300046809 | Bacteria | 2260 |
| 458 | Ga0495660_0043997 | 3300046810 | Bacteria | 2458 |
| 459 | Ga0495660_0092770 | 3300046810 | Bacteria | 1566 |
| 460 | Ga0495581_0010688 | 3300047315 | Bacteria | 5308 |
| 461 | Ga0495581_0086198 | 3300047315 | Bacteria | 1821 |
| 462 | Ga0495604_0003940 | 3300047317 | Bacteria | 11818 |
| 463 | Ga0495636_0051845 | 3300047318 | Bacteria | 1720 |
| 464 | Ga0495674_0002196 | 3300047319 | Bacteria | 19187 |
| 465 | Ga0495674_0013653 | 3300047319 | Bacteria | 7632 |
| 466 | Ga0495672_0006161 | 3300047320 | Bacteria | 9354 |
| 467 | Ga0495676_0047009 | 3300047321 | Bacteria | 3495 |
| 468 | Ga0495680_0008327 | 3300047322 | Bacteria | 9434 |
| 469 | Ga0495680_0024787 | 3300047322 | Bacteria | 4970 |
| 470 | Ga0495680_0042489 | 3300047322 | Bacteria | 3606 |
| 471 | Ga0495683_0086602 | 3300047323 | Bacteria | 1522 |
| 472 | Ga0495687_002365 | 3300047443 | Bacteria | 15262 |
| 473 | Ga0495687_011320 | 3300047443 | Bacteria | 4809 |
| 474 | Ga0495687_019284 | 3300047443 | Bacteria | 3352 |
| 475 | Ga0495687_027845 | 3300047443 | Bacteria | 2638 |
| 476 | Ga0495685_000392 | 3300047447 | Bacteria | 13913 |
| 477 | Ga0495685_008655 | 3300047447 | Bacteria | 3385 |
| 478 | Ga0495673_0016923 | 3300047469 | Bacteria | 3716 |
| 479 | Ga0495681_0002275 | 3300047470 | Bacteria | 13803 |
| 480 | Ga0495684_0001427 | 3300047471 | Bacteria | 19151 |
| 481 | Ga0495686_0003209 | 3300047472 | Bacteria | 14397 |
| 482 | Ga0495593_0004801 | 3300047673 | Bacteria | 8020 |
| 483 | Ga0495593_0039521 | 3300047673 | Bacteria | 2543 |
| 484 | Ga0495593_0068950 | 3300047673 | Bacteria | 1840 |
| 485 | Ga0495602_0019844 | 3300048088 | Bacteria | 6659 |
| 486 | Ga0495602_0067885 | 3300048088 | Bacteria | 3065 |
| 487 | Ga0495602_0204549 | 3300048088 | Bacteria | 1503 |
| 488 | Ga0496100_0000011 | 3300048903 | Bacteria | 190969 |
| 489 | Ga0496100_0002517 | 3300048903 | Bacteria | 9332 |
| 490 | Ga0496100_0011912 | 3300048903 | Bacteria | 4966 |
| 491 | Ga0496100_0038132 | 3300048903 | Bacteria | 3043 |
| 492 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 493 | Ga0496101_0000017 | 3300048904 | Bacteria | 239153 |
| 494 | Ga0496101_0033560 | 3300048904 | Bacteria | 3620 |
| 495 | Ga0496101_0048830 | 3300048904 | Bacteria | 3042 |
| 496 | Ga0496101_0166707 | 3300048904 | Bacteria | 1691 |
| 497 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 498 | Ga0496102_0000089 | 3300048905 | Bacteria | 128594 |
| 499 | Ga0496102_0000390 | 3300048905 | Bacteria | 51759 |
| 500 | Ga0496102_0003154 | 3300048905 | Bacteria | 13980 |
| 501 | Ga0496102_0034561 | 3300048905 | Bacteria | 4546 |
| 502 | Ga0496102_0100401 | 3300048905 | Bacteria | 2688 |
| 503 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 504 | Ga0496103_0000065 | 3300048906 | Bacteria | 128496 |
| 505 | Ga0496103_0000388 | 3300048906 | Bacteria | 39328 |
| 506 | Ga0496103_0001526 | 3300048906 | Bacteria | 15464 |
| 507 | Ga0496103_0010622 | 3300048906 | Bacteria | 5448 |
| 508 | Ga0496103_0052104 | 3300048906 | Bacteria | 2534 |
| 509 | Ga0496104_0001045 | 3300048907 | Bacteria | 23660 |
| 510 | Ga0496104_0032787 | 3300048907 | Bacteria | 4835 |
| 511 | Ga0496104_0093862 | 3300048907 | Bacteria | 2870 |
| 512 | Ga0496104_0176118 | 3300048907 | Bacteria | 2049 |
| 513 | Ga0496104_0256180 | 3300048907 | Bacteria | 1662 |
| 514 | Ga0496105_0010160 | 3300048908 | Bacteria | 7396 |
| 515 | Ga0496105_0012641 | 3300048908 | Bacteria | 6685 |
| 516 | Ga0496105_0013023 | 3300048908 | Bacteria | 6590 |
| 517 | Ga0496106_0001106 | 3300048909 | Bacteria | 19947 |
| 518 | Ga0496106_0003523 | 3300048909 | Bacteria | 11667 |
| 519 | Ga0496106_0024279 | 3300048909 | Bacteria | 4506 |
| 520 | Ga0496107_0000139 | 3300048910 | Bacteria | 35977 |
| 521 | Ga0496107_0022520 | 3300048910 | Bacteria | 4452 |
| 522 | Ga0496107_0040038 | 3300048910 | Bacteria | 3363 |
| 523 | Ga0496107_0154267 | 3300048910 | Bacteria | 1700 |
| 524 | Ga0496108_0000075 | 3300048911 | Bacteria | 105616 |
| 525 | Ga0496108_0011376 | 3300048911 | Bacteria | 7232 |
| 526 | Ga0496108_0036415 | 3300048911 | Bacteria | 4094 |
| 527 | Ga0496108_0076901 | 3300048911 | Bacteria | 2822 |
| 528 | Ga0496108_0116875 | 3300048911 | Bacteria | 2285 |
| 529 | Ga0496108_0207570 | 3300048911 | Bacteria | 1700 |
| 530 | Ga0496108_0292952 | 3300048911 | Bacteria | 1417 |
| 531 | Ga0496109_0000041 | 3300048912 | Bacteria | 141346 |
| 532 | Ga0496109_0018148 | 3300048912 | Bacteria | 6178 |
| 533 | Ga0496109_0039196 | 3300048912 | Bacteria | 4287 |
| 534 | Ga0496109_0101402 | 3300048912 | Bacteria | 2671 |
| 535 | Ga0496110_0012986 | 3300048913 | Bacteria | 6869 |
| 536 | Ga0496110_0014998 | 3300048913 | Bacteria | 6444 |
| 537 | Ga0496110_0180121 | 3300048913 | Bacteria | 1919 |
| 538 | Ga0496110_0259339 | 3300048913 | Bacteria | 1582 |
| 539 | Ga0496111_0000841 | 3300048914 | Bacteria | 16565 |
| 540 | Ga0496111_0012250 | 3300048914 | Bacteria | 5801 |
| 541 | Ga0496111_0073581 | 3300048914 | Bacteria | 2488 |
| 542 | Ga0496111_0172915 | 3300048914 | Bacteria | 1605 |
| 543 | Ga0496112_0021619 | 3300048915 | Bacteria | 6119 |
| 544 | Ga0496112_0058297 | 3300048915 | Bacteria | 3802 |
| 545 | Ga0496113_0053253 | 3300048916 | Bacteria | 3025 |
| 546 | Ga0496113_0103495 | 3300048916 | Bacteria | 2208 |
| 547 | Ga0496114_0001890 | 3300048917 | Bacteria | 15902 |
| 548 | Ga0496114_0003226 | 3300048917 | Bacteria | 12505 |
| 549 | Ga0496114_0010589 | 3300048917 | Bacteria | 7337 |
| 550 | Ga0496114_0011531 | 3300048917 | Bacteria | 7063 |
| 551 | Ga0496114_0013230 | 3300048917 | Bacteria | 6615 |
| 552 | Ga0496115_0015617 | 3300048918 | Bacteria | 5764 |
| 553 | Ga0496115_0347387 | 3300048918 | Bacteria | 1210 |
| 554 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 555 | Ga0496116_0000208 | 3300048919 | Bacteria | 111165 |
| 556 | Ga0496116_0002861 | 3300048919 | Bacteria | 17688 |
| 557 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 558 | Ga0496117_0000191 | 3300048920 | Bacteria | 124489 |
| 559 | Ga0496117_0000430 | 3300048920 | Bacteria | 70406 |
| 560 | Ga0496117_0031727 | 3300048920 | Bacteria | 4029 |
| 561 | Ga0496117_0054303 | 3300048920 | Bacteria | 2807 |
| 562 | Ga0496118_0000029 | 3300048921 | Bacteria | 340978 |
| 563 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 564 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 565 | Ga0496118_0002013 | 3300048921 | Bacteria | 28760 |
| 566 | Ga0496119_0000181 | 3300048922 | Bacteria | 88025 |
| 567 | Ga0496119_0000539 | 3300048922 | Bacteria | 51578 |
| 568 | Ga0496119_0000634 | 3300048922 | Bacteria | 47422 |
| 569 | Ga0496119_0045876 | 3300048922 | Bacteria | 2735 |
| 570 | Ga0496119_0087609 | 3300048922 | Bacteria | 1777 |
| 571 | Ga0496120_0000121 | 3300048923 | Bacteria | 131612 |
| 572 | Ga0496120_0013827 | 3300048923 | Bacteria | 5409 |
| 573 | Ga0496120_0019535 | 3300048923 | Bacteria | 4331 |
| 574 | Ga0496120_0039049 | 3300048923 | Bacteria | 2805 |
| 575 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 576 | Ga0496121_0000250 | 3300048924 | Bacteria | 114145 |
| 577 | Ga0496121_0001920 | 3300048924 | Bacteria | 33194 |
| 578 | Ga0496121_0009581 | 3300048924 | Bacteria | 11094 |
| 579 | Ga0496122_0000084 | 3300048925 | Bacteria | 208740 |
| 580 | Ga0496122_0012560 | 3300048925 | Bacteria | 8410 |
| 581 | Ga0496123_0001922 | 3300048926 | Bacteria | 27126 |
| 582 | Ga0496124_0000019 | 3300048927 | Bacteria | 436995 |
| 583 | Ga0496124_0070236 | 3300048927 | Bacteria | 2905 |
| 584 | Ga0496124_0206152 | 3300048927 | Bacteria | 1491 |
| 585 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 586 | Ga0496125_0015484 | 3300048928 | Bacteria | 7371 |
| 587 | Ga0496125_0081930 | 3300048928 | Bacteria | 2462 |
| 588 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 589 | Ga0496126_0000090 | 3300048929 | Bacteria | 210538 |
| 590 | Ga0496126_0000317 | 3300048929 | Bacteria | 102866 |
| 591 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 592 | Ga0496126_0002505 | 3300048929 | Bacteria | 24639 |
| 593 | Ga0496126_0023449 | 3300048929 | Bacteria | 5980 |
| 594 | Ga0496126_0034019 | 3300048929 | Bacteria | 4791 |
| 595 | Ga0496126_0113046 | 3300048929 | Bacteria | 2364 |
| 596 | Ga0501032_0001282 | 3300049569 | Bacteria | 20142 |
| 597 | Ga0501032_0011027 | 3300049569 | Bacteria | 6497 |
| 598 | Ga0501032_0021656 | 3300049569 | Bacteria | 4467 |
| 599 | Ga0501033_0008524 | 3300049570 | Bacteria | 7932 |
| 600 | Ga0501033_0016575 | 3300049570 | Bacteria | 5575 |
| 601 | Ga0501034_0006280 | 3300049571 | Bacteria | 12789 |
| 602 | Ga0501034_0014524 | 3300049571 | Bacteria | 8108 |
| 603 | Ga0501034_0018107 | 3300049571 | Bacteria | 7229 |
| 604 | Ga0501034_0045164 | 3300049571 | Bacteria | 4452 |
| 605 | Ga0501034_0052324 | 3300049571 | Bacteria | 4114 |
| 606 | Ga0501034_0101386 | 3300049571 | Bacteria | 2872 |
| 607 | Ga0501034_0170809 | 3300049571 | Bacteria | 2141 |
| 608 | Ga0501036_0003289 | 3300049572 | Bacteria | 12889 |
| 609 | Ga0501036_0003690 | 3300049572 | Bacteria | 12262 |
| 610 | Ga0501036_0005010 | 3300049572 | Bacteria | 10721 |
| 611 | Ga0501036_0030059 | 3300049572 | Bacteria | 4589 |
| 612 | Ga0501036_0032699 | 3300049572 | Bacteria | 4397 |
| 613 | Ga0501036_0101468 | 3300049572 | Bacteria | 2434 |
| 614 | Ga0501036_0168700 | 3300049572 | Bacteria | 1844 |
| 615 | Ga0501037_0000475 | 3300049573 | Bacteria | 32426 |
| 616 | Ga0501037_0146465 | 3300049573 | Bacteria | 1689 |
| 617 | Ga0501038_0000993 | 3300049574 | Bacteria | 25525 |
| 618 | Ga0501038_0007390 | 3300049574 | Bacteria | 10134 |
| 619 | Ga0501038_0014975 | 3300049574 | Bacteria | 7062 |
| 620 | Ga0501038_0020374 | 3300049574 | Bacteria | 5962 |
| 621 | Ga0501038_0039094 | 3300049574 | Bacteria | 4151 |
| 622 | Ga0501038_0051215 | 3300049574 | Bacteria | 3565 |
| 623 | Ga0501039_0000450 | 3300049575 | Bacteria | 29852 |
| 624 | Ga0501039_0014528 | 3300049575 | Bacteria | 6028 |
| 625 | Ga0501039_0042197 | 3300049575 | Bacteria | 3525 |
| 626 | Ga0501039_0076713 | 3300049575 | Bacteria | 2598 |
| 627 | Ga0501042_0012037 | 3300049578 | Bacteria | 5851 |
| 628 | Ga0501042_0013605 | 3300049578 | Bacteria | 5541 |
| 629 | Ga0501043_0000358 | 3300049579 | Bacteria | 41459 |
| 630 | Ga0501043_0001171 | 3300049579 | Bacteria | 23059 |
| 631 | Ga0501043_0006736 | 3300049579 | Bacteria | 9171 |
| 632 | Ga0501043_0008776 | 3300049579 | Bacteria | 7960 |
| 633 | Ga0501043_0022918 | 3300049579 | Bacteria | 4896 |
| 634 | Ga0501047_0000036 | 3300049581 | Bacteria | 195504 |
| 635 | Ga0501047_0006080 | 3300049581 | Bacteria | 11346 |
| 636 | Ga0501047_0017843 | 3300049581 | Bacteria | 6798 |
| 637 | Ga0501047_0058299 | 3300049581 | Bacteria | 3730 |
| 638 | Ga0501047_0102471 | 3300049581 | Bacteria | 2742 |
| 639 | Ga0501047_0149958 | 3300049581 | Bacteria | 2208 |
| 640 | Ga0501047_0219591 | 3300049581 | Bacteria | 1757 |
| 641 | Ga0501047_0240166 | 3300049581 | Bacteria | 1662 |
| 642 | Ga0501048_0014537 | 3300049582 | Bacteria | 5825 |
| 643 | Ga0501070_0000136 | 3300049586 | Bacteria | 66212 |
| 644 | Ga0501070_0001563 | 3300049586 | Bacteria | 20351 |
| 645 | Ga0501070_0002257 | 3300049586 | Bacteria | 16940 |
| 646 | Ga0501070_0028862 | 3300049586 | Bacteria | 4651 |
| 647 | Ga0501074_0009064 | 3300049590 | Bacteria | 7226 |
| 648 | Ga0501074_0013224 | 3300049590 | Bacteria | 6001 |
| 649 | Ga0501035_0005197 | 3300049822 | Bacteria | 12315 |
| 650 | Ga0501035_0009695 | 3300049822 | Bacteria | 8957 |
| 651 | Ga0501035_0013357 | 3300049822 | Bacteria | 7580 |
| 652 | Ga0501035_0026526 | 3300049822 | Bacteria | 5300 |
| 653 | Ga0501035_0079284 | 3300049822 | Bacteria | 2901 |
| 654 | Ga0501044_0019751 | 3300049823 | Bacteria | 7198 |
| 655 | Ga0501044_0038044 | 3300049823 | Bacteria | 5024 |
| 656 | Ga0501044_0039319 | 3300049823 | Bacteria | 4935 |
| 657 | Ga0501044_0054980 | 3300049823 | Bacteria | 4090 |
| 658 | Ga0501044_0123582 | 3300049823 | Bacteria | 2586 |
| 659 | Ga0501044_0160161 | 3300049823 | Bacteria | 2228 |
| 660 | Ga0501044_0227744 | 3300049823 | Bacteria | 1813 |
| 661 | Ga0501044_0316755 | 3300049823 | Bacteria | 1485 |
| 662 | Ga0501045_0134898 | 3300049824 | Bacteria | 1835 |
| 663 | Ga0501045_0218570 | 3300049824 | Bacteria | 1419 |
| 664 | nmdc:mga03n38_65661_c1 | 3300050490 | Bacteria | 1664 |
| 665 | nmdc:mga00v17_851_c1 | 3300050491 | Bacteria | 16535 |
| 666 | nmdc:mga0yw44_595_c1 | 3300050492 | Bacteria | 11915 |
| 667 | nmdc:mga0qj67_196701_c1 | 3300050509 | Bacteria | 1638 |
| 668 | nmdc:mga0qj67_247246_c1 | 3300050509 | Bacteria | 1447 |
| 669 | nmdc:mga0n895_311622_c1 | 3300050512 | Bacteria | 1595 |
| 670 | nmdc:mga0sz30_31343_c1 | 3300050516 | Bacteria | 2199 |
| 671 | Ga0500635_0009368 | 3300053080 | Bacteria | 2718 |
| 672 | Ga0495655_0011334 | 3300053083 | Bacteria | 1789 |
| 673 | Ga0495595_0006578 | 3300053084 | Bacteria | 4744 |
| 674 | Ga0495619_0020510 | 3300053085 | Bacteria | 4211 |
| 675 | Ga0495619_0051391 | 3300053085 | Bacteria | 2723 |
| 676 | Ga0500578_0008906 | 3300053086 | Bacteria | 6540 |
| 677 | Ga0500643_003250 | 3300053087 | Bacteria | 7917 |
| 678 | Ga0500643_015982 | 3300053087 | Bacteria | 2559 |
| 679 | Ga0500566_0042913 | 3300053094 | Bacteria | 2607 |
| 680 | Ga0500641_0043924 | 3300053096 | Bacteria | 1816 |
| 681 | Ga0500654_016403 | 3300053099 | Bacteria | 4864 |
| 682 | Ga0500562_001428 | 3300053108 | Bacteria | 5876 |
| 683 | Ga0500594_0009004 | 3300053118 | Bacteria | 2288 |
| 684 | Ga0500628_002455 | 3300053129 | Bacteria | 3064 |
| 685 | Ga0500652_000656 | 3300053131 | Bacteria | 11779 |
| 686 | Ga0500652_001499 | 3300053131 | Bacteria | 7177 |
| 687 | Ga0500658_0003539 | 3300053134 | Bacteria | 5895 |
| 688 | Ga0500559_0009433 | 3300053136 | Bacteria | 4224 |
| 689 | Ga0500561_0000193 | 3300053137 | Bacteria | 11059 |
| 690 | Ga0500573_0044559 | 3300053140 | Bacteria | 2559 |
| 691 | Ga0500573_0053749 | 3300053140 | Bacteria | 2314 |
| 692 | Ga0500579_059051 | 3300053143 | Bacteria | 2291 |
| 693 | Ga0500600_0017781 | 3300053149 | Bacteria | 4294 |
| 694 | Ga0500616_0000081 | 3300053153 | Bacteria | 199653 |
| 695 | Ga0500616_0000822 | 3300053153 | Bacteria | 35169 |
| 696 | Ga0500616_0008951 | 3300053153 | Bacteria | 6136 |
| 697 | Ga0500616_0014012 | 3300053153 | Bacteria | 4623 |
| 698 | Ga0500616_0030361 | 3300053153 | Bacteria | 2968 |
| 699 | Ga0500645_000031 | 3300053730 | Bacteria | 119643 |
| 700 | Ga0500645_015782 | 3300053730 | Bacteria | 2388 |
| 701 | Ga0500656_000058 | 3300053732 | Bacteria | 6360 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10043053 | Ga0105238_100430535 | 323 |
| 2 | 3300044765 | Ga0466970_0061415 | Ga0466970_0061415_579_1574 | 325 |
| 3 | 3300044693 | Ga0466961_0016771 | Ga0466961_0016771_2022_3086 | 331 |
| 4 | 3300045049 | Ga0466959_0005769 | Ga0466959_0005769_262_1326 | 331 |
| 5 | 3300006846 | Ga0075430_100173757 | Ga0075430_1001737572 | 335 |
| 6 | 3300050509 | nmdc:mga0qj67_196701_c1 | nmdc:mga0qj67_196701_c1_428_1543 | 335 |
| 7 | 3300048911 | Ga0496108_0116875 | Ga0496108_0116875_1142_2272 | 343 |
| 8 | 3300003316 | rootH1_10108066 | rootH1_101080662 | 344 |
| 9 | 3300042004 | Ga0439445_0005083 | Ga0439445_0005083_68_1201 | 344 |
| 10 | 3300042435 | Ga0439434_0022683 | Ga0439434_0022683_658_1791 | 344 |
| 11 | 3300030521 | Ga0307511_10000191 | Ga0307511_1000019142 | 347 |
| 12 | iso_pu_bacteria | 2558860280 | 2559432802 | 347 |
| 13 | 3300050492 | nmdc:mga0yw44_595_c1 | nmdc:mga0yw44_595_c1_2393_3481 | 348 |
| 14 | 3300006186 | Ga0075369_10027494 | Ga0075369_100274942 | 349 |
| 15 | 3300044901 | Ga0466960_0106329 | Ga0466960_0106329_20_1093 | 349 |
| 16 | 3300049823 | Ga0501044_0054980 | Ga0501044_0054980_1473_2654 | 350 |
| 17 | 3300005329 | Ga0070683_100171871 | Ga0070683_1001718711 | 352 |
| 18 | 3300005337 | Ga0070682_100027560 | Ga0070682_1000275602 | 352 |
| 19 | 3300005338 | Ga0068868_100264652 | Ga0068868_1002646522 | 352 |
| 20 | 3300005455 | Ga0070663_100025352 | Ga0070663_1000253522 | 352 |
| 21 | 3300005564 | Ga0070664_100249873 | Ga0070664_1002498732 | 352 |
| 22 | 3300006048 | Ga0075363_100008182 | Ga0075363_1000081824 | 352 |
| 23 | 3300009177 | Ga0105248_10322508 | Ga0105248_103225082 | 352 |
| 24 | 3300025932 | Ga0207690_10127050 | Ga0207690_101270502 | 352 |
| 25 | 3300025945 | Ga0207679_10141600 | Ga0207679_101416002 | 352 |
| 26 | 3300026023 | Ga0207677_10243608 | Ga0207677_102436082 | 352 |
| 27 | 3300045976 | Ga0466967_0219203 | Ga0466967_0219203_58_1146 | 352 |
| 28 | 3300046459 | Ga0495629_0033843 | Ga0495629_0033843_1942_3030 | 352 |
| 29 | 3300046461 | Ga0495641_0019964 | Ga0495641_0019964_1150_2238 | 352 |
| 30 | 3300047319 | Ga0495674_0013653 | Ga0495674_0013653_6182_7270 | 352 |
| 31 | 3300047323 | Ga0495683_0086602 | Ga0495683_0086602_12_1139 | 352 |
| 32 | 3300047443 | Ga0495687_027845 | Ga0495687_027845_126_1253 | 352 |
| 33 | 3300047673 | Ga0495593_0039521 | Ga0495593_0039521_577_1665 | 352 |
| 34 | 3300048910 | Ga0496107_0154267 | Ga0496107_0154267_519_1607 | 352 |
| 35 | 3300048911 | Ga0496108_0036415 | Ga0496108_0036415_2300_3385 | 352 |
| 36 | 3300048912 | Ga0496109_0018148 | Ga0496109_0018148_1984_3069 | 352 |
| 37 | 3300048915 | Ga0496112_0021619 | Ga0496112_0021619_955_2040 | 352 |
| 38 | 3300048916 | Ga0496113_0103495 | Ga0496113_0103495_559_1644 | 352 |
| 39 | 3300053083 | Ga0495655_0011334 | Ga0495655_0011334_657_1742 | 352 |
| 40 | 3300046460 | Ga0495638_0003192 | Ga0495638_0003192_3119_4222 | 353 |
| 41 | 3300053087 | Ga0500643_015982 | Ga0500643_015982_743_1846 | 353 |
| 42 | 3300053730 | Ga0500645_000031 | Ga0500645_000031_2850_3953 | 353 |
| 43 | 3300053730 | Ga0500645_015782 | Ga0500645_015782_128_1231 | 353 |
| 44 | iso_pu_bacteria | 2738541274 | 2738702548 | 353 |
| 45 | iso_pu_bacteria | 2738543028 | 2739329457 | 353 |
| 46 | 3300003578 | Ga0006562J51391_1086760 | Ga0006562J51391_10867602 | 354 |
| 47 | 3300048929 | Ga0496126_0034019 | Ga0496126_0034019_2218_3315 | 354 |
| 48 | 3300049822 | Ga0501035_0026526 | Ga0501035_0026526_1651_2853 | 354 |
| 49 | 3300048918 | Ga0496115_0347387 | Ga0496115_0347387_32_1198 | 356 |
| 50 | iso_pu_bacteria | 2917736166 | 2917737999 | 356 |
| 51 | 3300035724 | Ga0373933_0064036 | Ga0373933_0064036_10_1116 | 357 |
| 52 | 3300046559 | Ga0495667_0232827 | Ga0495667_0232827_43_1149 | 357 |
| 53 | 3300053153 | Ga0500616_0008951 | Ga0500616_0008951_2418_3527 | 357 |
| 54 | iso_pu_bacteria | 2775506925 | 2776374634 | 357 |
| 55 | 3300030522 | Ga0307512_10011774 | Ga0307512_100117744 | 358 |
| 56 | 3300044694 | Ga0466963_0149218 | Ga0466963_0149218_216_1331 | 358 |
| 57 | 3300045976 | Ga0466967_0062679 | Ga0466967_0062679_345_1460 | 358 |
| 58 | 3300046459 | Ga0495629_0019402 | Ga0495629_0019402_3297_4544 | 358 |
| 59 | 3300048912 | Ga0496109_0101402 | Ga0496109_0101402_1087_2217 | 358 |
| 60 | 3300053094 | Ga0500566_0042913 | Ga0500566_0042913_1159_2406 | 358 |
| 61 | 3300033179 | Ga0307507_10020556 | Ga0307507_100205562 | 359 |
| 62 | 3300048903 | Ga0496100_0000011 | Ga0496100_0000011_37691_38830 | 359 |
| 63 | 3300048904 | Ga0496101_0000017 | Ga0496101_0000017_139820_140959 | 359 |
| 64 | 3300048909 | Ga0496106_0001106 | Ga0496106_0001106_12394_13533 | 359 |
| 65 | 3300048910 | Ga0496107_0000139 | Ga0496107_0000139_30947_32086 | 359 |
| 66 | 3300048912 | Ga0496109_0000041 | Ga0496109_0000041_59509_60648 | 359 |
| 67 | 3300048913 | Ga0496110_0012986 | Ga0496110_0012986_2205_3344 | 359 |
| 68 | 3300048914 | Ga0496111_0000841 | Ga0496111_0000841_6530_7669 | 359 |
| 69 | 3300048917 | Ga0496114_0001890 | Ga0496114_0001890_13741_14880 | 359 |
| 70 | 3300048919 | Ga0496116_0002861 | Ga0496116_0002861_13024_14163 | 359 |
| 71 | 3300048923 | Ga0496120_0013827 | Ga0496120_0013827_1957_3096 | 359 |
| 72 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_292301_293440 | 359 |
| 73 | 3300048925 | Ga0496122_0000084 | Ga0496122_0000084_93052_94191 | 359 |
| 74 | 3300048926 | Ga0496123_0001922 | Ga0496123_0001922_17107_18246 | 359 |
| 75 | 3300048927 | Ga0496124_0000019 | Ga0496124_0000019_292301_293440 | 359 |
| 76 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_292301_293440 | 359 |
| 77 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_317237_318376 | 359 |
| 78 | 3300005937 | Ga0081455_10002986 | Ga0081455_100029868 | 361 |
| 79 | 3300006038 | Ga0075365_10043575 | Ga0075365_100435752 | 361 |
| 80 | 3300006051 | Ga0075364_10055815 | Ga0075364_100558152 | 361 |
| 81 | 3300021388 | Ga0213875_10000634 | Ga0213875_1000063421 | 361 |
| 82 | 3300037853 | Ga0436364_0507746 | Ga0436364_0507746_3700_4797 | 361 |
| 83 | 3300048922 | Ga0496119_0045876 | Ga0496119_0045876_841_2007 | 361 |
| 84 | iso_pu_bacteria | 2915358134 | 2915362721 | 361 |
| 85 | 3300005435 | Ga0070714_100155884 | Ga0070714_1001558843 | 362 |
| 86 | 3300005436 | Ga0070713_100336854 | Ga0070713_1003368541 | 362 |
| 87 | 3300005437 | Ga0070710_10011306 | Ga0070710_100113064 | 362 |
| 88 | 3300005439 | Ga0070711_100271176 | Ga0070711_1002711761 | 362 |
| 89 | 3300025929 | Ga0207664_10323351 | Ga0207664_103233512 | 362 |
| 90 | 3300046663 | Ga0495635_0106007 | Ga0495635_0106007_651_1889 | 363 |
| 91 | 3300047322 | Ga0495680_0042489 | Ga0495680_0042489_2337_3575 | 363 |
| 92 | iso_pu_bacteria | 2863067949 | 2863075411 | 363 |
| 93 | 3300005347 | Ga0070668_100033452 | Ga0070668_1000334522 | 364 |
| 94 | 3300005841 | Ga0068863_100003061 | Ga0068863_1000030613 | 364 |
| 95 | 3300005937 | Ga0081455_10000090 | Ga0081455_1000009058 | 364 |
| 96 | 3300014968 | Ga0157379_10020562 | Ga0157379_100205622 | 364 |
| 97 | 3300021388 | Ga0213875_10011514 | Ga0213875_100115142 | 364 |
| 98 | 3300025972 | Ga0207668_10036567 | Ga0207668_100365671 | 364 |
| 99 | 3300026088 | Ga0207641_10003364 | Ga0207641_1000336410 | 364 |
| 100 | 3300037853 | Ga0436364_1009099 | Ga0436364_1009099_2318_3421 | 364 |
| 101 | 3300048905 | Ga0496102_0000089 | Ga0496102_0000089_107924_109042 | 364 |
| 102 | 3300048906 | Ga0496103_0000065 | Ga0496103_0000065_19553_20671 | 364 |
| 103 | 3300048911 | Ga0496108_0076901 | Ga0496108_0076901_1523_2641 | 364 |
| 104 | 3300048914 | Ga0496111_0172915 | Ga0496111_0172915_159_1277 | 364 |
| 105 | 3300048919 | Ga0496116_0000208 | Ga0496116_0000208_107889_109007 | 364 |
| 106 | 3300048920 | Ga0496117_0000191 | Ga0496117_0000191_107855_108973 | 364 |
| 107 | 3300048921 | Ga0496118_0002013 | Ga0496118_0002013_8090_9208 | 364 |
| 108 | 3300048922 | Ga0496119_0000634 | Ga0496119_0000634_15537_16655 | 364 |
| 109 | 3300048923 | Ga0496120_0019535 | Ga0496120_0019535_1263_2381 | 364 |
| 110 | 3300048924 | Ga0496121_0009581 | Ga0496121_0009581_768_1886 | 364 |
| 111 | 3300048927 | Ga0496124_0070236 | Ga0496124_0070236_1271_2389 | 364 |
| 112 | 3300048928 | Ga0496125_0081930 | Ga0496125_0081930_724_1842 | 364 |
| 113 | 3300048929 | Ga0496126_0002505 | Ga0496126_0002505_15498_16616 | 364 |
| 114 | 3300005367 | Ga0070667_100001523 | Ga0070667_1000015237 | 365 |
| 115 | 3300025986 | Ga0207658_10000611 | Ga0207658_1000061128 | 365 |
| 116 | 3300030522 | Ga0307512_10010989 | Ga0307512_100109897 | 365 |
| 117 | 3300048905 | Ga0496102_0034561 | Ga0496102_0034561_2531_3709 | 365 |
| 118 | 3300048906 | Ga0496103_0000388 | Ga0496103_0000388_25126_26304 | 365 |
| 119 | 3300048911 | Ga0496108_0000075 | Ga0496108_0000075_32926_34065 | 365 |
| 120 | 3300048922 | Ga0496119_0000539 | Ga0496119_0000539_1730_2908 | 365 |
| 121 | 3300053096 | Ga0500641_0043924 | Ga0500641_0043924_198_1397 | 365 |
| 122 | 3300053118 | Ga0500594_0009004 | Ga0500594_0009004_403_1602 | 365 |
| 123 | 3300031903 | Ga0307407_10095384 | Ga0307407_100953842 | 366 |
| 124 | 3300032002 | Ga0307416_100197060 | Ga0307416_1001970602 | 366 |
| 125 | 3300044683 | Ga0466965_0094844 | Ga0466965_0094844_150_1346 | 366 |
| 126 | 3300044719 | Ga0466971_0021849 | Ga0466971_0021849_941_2119 | 366 |
| 127 | 3300045049 | Ga0466959_0029424 | Ga0466959_0029424_1449_2615 | 366 |
| 128 | 3300045836 | Ga0466958_0049375 | Ga0466958_0049375_703_1869 | 366 |
| 129 | 3300025933 | Ga0207706_10121169 | Ga0207706_101211692 | 367 |
| 130 | 3300025960 | Ga0207651_10223183 | Ga0207651_102231832 | 367 |
| 131 | 3300045976 | Ga0466967_0003959 | Ga0466967_0003959_7641_8786 | 367 |
| 132 | 3300048929 | Ga0496126_0000090 | Ga0496126_0000090_13949_15169 | 367 |
| 133 | iso_pu_bacteria | 2915358134 | 2915363450 | 367 |
| 134 | 3300005347 | Ga0070668_100153723 | Ga0070668_1001537232 | 368 |
| 135 | 3300005355 | Ga0070671_100001367 | Ga0070671_10000136712 | 368 |
| 136 | 3300005548 | Ga0070665_100003950 | Ga0070665_10000395011 | 368 |
| 137 | 3300005841 | Ga0068863_100190384 | Ga0068863_1001903842 | 368 |
| 138 | 3300005843 | Ga0068860_100065619 | Ga0068860_1000656193 | 368 |
| 139 | 3300025931 | Ga0207644_10000916 | Ga0207644_1000091612 | 368 |
| 140 | 3300026088 | Ga0207641_10210600 | Ga0207641_102106002 | 368 |
| 141 | 3300026095 | Ga0207676_10093470 | Ga0207676_100934702 | 368 |
| 142 | 3300028379 | Ga0268266_10015163 | Ga0268266_100151634 | 368 |
| 143 | 3300028381 | Ga0268264_10004745 | Ga0268264_100047459 | 368 |
| 144 | 3300030522 | Ga0307512_10110013 | Ga0307512_101100132 | 368 |
| 145 | 3300031456 | Ga0307513_10000248 | Ga0307513_100002482 | 368 |
| 146 | 3300045976 | Ga0466967_0011767 | Ga0466967_0011767_4034_5185 | 368 |
| 147 | 3300049586 | Ga0501070_0000136 | Ga0501070_0000136_18425_19597 | 368 |
| 148 | iso_pu_bacteria | 2643221715 | 2644637675 | 368 |
| 149 | iso_pu_bacteria | 2902810491 | 2902815247 | 368 |
| 150 | 3300003792 | Ga0055540_1001570 | Ga0055540_10015705 | 369 |
| 151 | 3300005288 | Ga0065714_10006054 | Ga0065714_100060543 | 369 |
| 152 | 3300005337 | Ga0070682_100063083 | Ga0070682_1000630832 | 369 |
| 153 | 3300006028 | Ga0070717_10067102 | Ga0070717_100671022 | 369 |
| 154 | 3300006051 | Ga0075364_10006220 | Ga0075364_100062202 | 369 |
| 155 | 3300025303 | Ga0209051_1002017 | Ga0209051_100201710 | 369 |
| 156 | 3300025303 | Ga0209051_1057088 | Ga0209051_10570882 | 369 |
| 157 | 3300028556 | Ga0265337_1000404 | Ga0265337_100040438 | 369 |
| 158 | 3300028800 | Ga0265338_10004287 | Ga0265338_100042877 | 369 |
| 159 | 3300031238 | Ga0265332_10026063 | Ga0265332_100260632 | 369 |
| 160 | 3300031711 | Ga0265314_10043522 | Ga0265314_100435222 | 369 |
| 161 | 3300031712 | Ga0265342_10040486 | Ga0265342_100404862 | 369 |
| 162 | 3300037853 | Ga0436364_0256931 | Ga0436364_0256931_78_1250 | 369 |
| 163 | 3300041410 | Ga0439461_0008187 | Ga0439461_0008187_369_1502 | 369 |
| 164 | 3300041411 | Ga0439466_0012279 | Ga0439466_0012279_828_1961 | 369 |
| 165 | 3300041486 | Ga0451807_1774657 | Ga0451807_1774657_331_1488 | 369 |
| 166 | 3300041501 | Ga0451845_0999523 | Ga0451845_0999523_119_1276 | 369 |
| 167 | 3300041997 | Ga0439431_0001647 | Ga0439431_0001647_1102_2235 | 369 |
| 168 | 3300044683 | Ga0466965_0037292 | Ga0466965_0037292_568_1731 | 369 |
| 169 | 3300048928 | Ga0496125_0015484 | Ga0496125_0015484_1300_2517 | 369 |
| 170 | 3300050491 | nmdc:mga00v17_851_c1 | nmdc:mga00v17_851_c1_14420_15553 | 369 |
| 171 | 3300050516 | nmdc:mga0sz30_31343_c1 | nmdc:mga0sz30_31343_c1_224_1414 | 369 |
| 172 | iso_pu_bacteria | 2643221687 | 2644486187 | 369 |
| 173 | iso_pu_bacteria | 2675903060 | 2676492288 | 369 |
| 174 | 3300046680 | Ga0495646_0085505 | Ga0495646_0085505_218_1450 | 370 |
| 175 | 3300053136 | Ga0500559_0009433 | Ga0500559_0009433_2318_3472 | 370 |
| 176 | iso_pu_bacteria | 2791354901 | 2791910285 | 370 |
| 177 | 3300003792 | Ga0055540_1000951 | Ga0055540_100095112 | 371 |
| 178 | 3300006186 | Ga0075369_10004266 | Ga0075369_100042666 | 371 |
| 179 | 3300025273 | Ga0209673_1014992 | Ga0209673_10149922 | 371 |
| 180 | 3300047472 | Ga0495686_0003209 | Ga0495686_0003209_12108_13262 | 371 |
| 181 | 3300048920 | Ga0496117_0031727 | Ga0496117_0031727_1113_2243 | 371 |
| 182 | 3300048921 | Ga0496118_0000029 | Ga0496118_0000029_237644_238774 | 371 |
| 183 | 3300050509 | nmdc:mga0qj67_247246_c1 | nmdc:mga0qj67_247246_c1_103_1272 | 371 |
| 184 | iso_pu_bacteria | 2895427314 | 2895434412 | 371 |
| 185 | iso_pu_bacteria | 2902837492 | 2902840468 | 371 |
| 186 | iso_pu_bacteria | 8056207758 | 8056214313 | 371 |
| 187 | 3300003792 | Ga0055540_1000710 | Ga0055540_10007109 | 372 |
| 188 | 3300005329 | Ga0070683_100280320 | Ga0070683_1002803202 | 372 |
| 189 | 3300005548 | Ga0070665_100175099 | Ga0070665_1001750992 | 372 |
| 190 | 3300005618 | Ga0068864_100020731 | Ga0068864_1000207312 | 372 |
| 191 | 3300005840 | Ga0068870_10006476 | Ga0068870_100064765 | 372 |
| 192 | 3300014745 | Ga0157377_10139477 | Ga0157377_101394772 | 372 |
| 193 | 3300025303 | Ga0209051_1000466 | Ga0209051_100046649 | 372 |
| 194 | 3300025908 | Ga0207643_10027244 | Ga0207643_100272443 | 372 |
| 195 | 3300025942 | Ga0207689_10056012 | Ga0207689_100560123 | 372 |
| 196 | 3300026067 | Ga0207678_10031395 | Ga0207678_100313952 | 372 |
| 197 | 3300046455 | Ga0495603_0028858 | Ga0495603_0028858_2079_3275 | 372 |
| 198 | 3300046460 | Ga0495638_0016872 | Ga0495638_0016872_2091_3326 | 372 |
| 199 | 3300046477 | Ga0495664_0133968 | Ga0495664_0133968_130_1365 | 372 |
| 200 | 3300046492 | Ga0495585_0069283 | Ga0495585_0069283_521_1756 | 372 |
| 201 | 3300046512 | Ga0495610_0089467 | Ga0495610_0089467_102_1337 | 372 |
| 202 | 3300046515 | Ga0495620_0016695 | Ga0495620_0016695_2136_3371 | 372 |
| 203 | 3300046518 | Ga0495631_0008239 | Ga0495631_0008239_3427_4662 | 372 |
| 204 | 3300046524 | Ga0495648_0112331 | Ga0495648_0112331_69_1304 | 372 |
| 205 | 3300046530 | Ga0495654_0038015 | Ga0495654_0038015_737_1972 | 372 |
| 206 | 3300046538 | Ga0495609_0013107 | Ga0495609_0013107_827_2062 | 372 |
| 207 | 3300046616 | Ga0495668_0114260 | Ga0495668_0114260_182_1417 | 372 |
| 208 | 3300046675 | Ga0495657_0026610 | Ga0495657_0026610_1234_2469 | 372 |
| 209 | 3300046794 | Ga0495589_0033338 | Ga0495589_0033338_92_1327 | 372 |
| 210 | 3300046810 | Ga0495660_0092770 | Ga0495660_0092770_212_1447 | 372 |
| 211 | 3300047443 | Ga0495687_019284 | Ga0495687_019284_1936_3171 | 372 |
| 212 | 3300047447 | Ga0495685_008655 | Ga0495685_008655_274_1509 | 372 |
| 213 | 3300005347 | Ga0070668_100137698 | Ga0070668_1001376982 | 373 |
| 214 | 3300005435 | Ga0070714_100023229 | Ga0070714_1000232292 | 373 |
| 215 | 3300005437 | Ga0070710_10005431 | Ga0070710_100054313 | 373 |
| 216 | 3300006038 | Ga0075365_10004991 | Ga0075365_100049911 | 373 |
| 217 | 3300013307 | Ga0157372_10277705 | Ga0157372_102777052 | 373 |
| 218 | 3300025928 | Ga0207700_10063526 | Ga0207700_100635262 | 373 |
| 219 | 3300048927 | Ga0496124_0206152 | Ga0496124_0206152_30_1163 | 373 |
| 220 | 3300048929 | Ga0496126_0113046 | Ga0496126_0113046_870_2054 | 373 |
| 221 | 3300053153 | Ga0500616_0000081 | Ga0500616_0000081_163264_164427 | 373 |
| 222 | iso_pu_bacteria | 2852677369 | 2852678536 | 373 |
| 223 | iso_pu_bacteria | 2939582691 | 2939587656 | 373 |
| 224 | 3300025929 | Ga0207664_10097014 | Ga0207664_100970142 | 374 |
| 225 | 3300046660 | Ga0495625_0119662 | Ga0495625_0119662_409_1683 | 374 |
| 226 | 3300046794 | Ga0495589_0046187 | Ga0495589_0046187_818_2008 | 374 |
| 227 | 3300047443 | Ga0495687_002365 | Ga0495687_002365_12089_13300 | 374 |
| 228 | iso_pu_bacteria | 8054472261 | 8054473124 | 374 |
| 229 | 3300005563 | Ga0068855_100242562 | Ga0068855_1002425622 | 375 |
| 230 | 3300009545 | Ga0105237_10012977 | Ga0105237_100129773 | 375 |
| 231 | 3300010375 | Ga0105239_10063452 | Ga0105239_100634523 | 375 |
| 232 | 3300021384 | Ga0213876_10001397 | Ga0213876_1000139713 | 375 |
| 233 | 3300021388 | Ga0213875_10006833 | Ga0213875_100068334 | 375 |
| 234 | 3300025272 | Ga0209455_1001859 | Ga0209455_10018594 | 375 |
| 235 | 3300025909 | Ga0207705_10096431 | Ga0207705_100964313 | 375 |
| 236 | 3300025914 | Ga0207671_10113842 | Ga0207671_101138422 | 375 |
| 237 | 3300026142 | Ga0207698_10221136 | Ga0207698_102211362 | 375 |
| 238 | 3300028381 | Ga0268264_10111430 | Ga0268264_101114302 | 375 |
| 239 | 3300031344 | Ga0265316_10046074 | Ga0265316_100460742 | 375 |
| 240 | 3300031456 | Ga0307513_10060487 | Ga0307513_100604872 | 375 |
| 241 | 3300037418 | Ga0395900_0153964 | Ga0395900_0153964_137_1288 | 375 |
| 242 | 3300037466 | Ga0395898_0025057 | Ga0395898_0025057_2641_3792 | 375 |
| 243 | 3300037853 | Ga0436364_0633952 | Ga0436364_0633952_17183_18343 | 375 |
| 244 | 3300038443 | Ga0395901_0018525 | Ga0395901_0018525_1843_2994 | 375 |
| 245 | 3300039437 | Ga0436365_0931839 | Ga0436365_0931839_95603_96763 | 375 |
| 246 | 3300044658 | Ga0466972_0004530 | Ga0466972_0004530_1573_2727 | 375 |
| 247 | 3300044683 | Ga0466965_0001210 | Ga0466965_0001210_3239_4393 | 375 |
| 248 | 3300044901 | Ga0466960_0000354 | Ga0466960_0000354_9931_11097 | 375 |
| 249 | 3300044901 | Ga0466960_0056896 | Ga0466960_0056896_410_1564 | 375 |
| 250 | 3300045049 | Ga0466959_0001342 | Ga0466959_0001342_8869_10035 | 375 |
| 251 | 3300046524 | Ga0495648_0028691 | Ga0495648_0028691_1667_2836 | 375 |
| 252 | 3300047320 | Ga0495672_0006161 | Ga0495672_0006161_5816_6985 | 375 |
| 253 | 3300047469 | Ga0495673_0016923 | Ga0495673_0016923_817_1986 | 375 |
| 254 | 3300048903 | Ga0496100_0002517 | Ga0496100_0002517_1944_3113 | 375 |
| 255 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_42083_43252 | 375 |
| 256 | 3300048904 | Ga0496101_0166707 | Ga0496101_0166707_449_1672 | 375 |
| 257 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_264410_265579 | 375 |
| 258 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_49884_51053 | 375 |
| 259 | 3300048907 | Ga0496104_0093862 | Ga0496104_0093862_739_1965 | 375 |
| 260 | 3300048908 | Ga0496105_0012641 | Ga0496105_0012641_4167_5393 | 375 |
| 261 | 3300048909 | Ga0496106_0003523 | Ga0496106_0003523_7052_8221 | 375 |
| 262 | 3300048917 | Ga0496114_0010589 | Ga0496114_0010589_4722_5948 | 375 |
| 263 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_260631_261800 | 375 |
| 264 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_49892_51061 | 375 |
| 265 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_49892_51061 | 375 |
| 266 | 3300048922 | Ga0496119_0000181 | Ga0496119_0000181_42509_43678 | 375 |
| 267 | 3300048923 | Ga0496120_0000121 | Ga0496120_0000121_31822_32991 | 375 |
| 268 | 3300048923 | Ga0496120_0039049 | Ga0496120_0039049_1232_2398 | 375 |
| 269 | 3300048924 | Ga0496121_0000250 | Ga0496121_0000250_63085_64254 | 375 |
| 270 | 3300048929 | Ga0496126_0000317 | Ga0496126_0000317_42330_43499 | 375 |
| 271 | 3300048929 | Ga0496126_0023449 | Ga0496126_0023449_210_1376 | 375 |
| 272 | 3300049569 | Ga0501032_0001282 | Ga0501032_0001282_8596_9753 | 375 |
| 273 | 3300049571 | Ga0501034_0014524 | Ga0501034_0014524_4295_5452 | 375 |
| 274 | 3300049572 | Ga0501036_0032699 | Ga0501036_0032699_3082_4239 | 375 |
| 275 | 3300049573 | Ga0501037_0000475 | Ga0501037_0000475_10982_12139 | 375 |
| 276 | 3300049574 | Ga0501038_0000993 | Ga0501038_0000993_10393_11550 | 375 |
| 277 | 3300049575 | Ga0501039_0000450 | Ga0501039_0000450_22256_23413 | 375 |
| 278 | 3300049579 | Ga0501043_0001171 | Ga0501043_0001171_12649_13806 | 375 |
| 279 | 3300049586 | Ga0501070_0001563 | Ga0501070_0001563_8599_9756 | 375 |
| 280 | 3300049823 | Ga0501044_0038044 | Ga0501044_0038044_1690_2847 | 375 |
| 281 | 3300053087 | Ga0500643_003250 | Ga0500643_003250_6570_7739 | 375 |
| 282 | iso_pu_bacteria | 2902792274 | 2902796177 | 375 |
| 283 | iso_pu_bacteria | 8055172936 | 8055176249 | 375 |
| 284 | 3300003792 | Ga0055540_1000036 | Ga0055540_100003616 | 376 |
| 285 | 3300013105 | Ga0157369_10222774 | Ga0157369_102227741 | 376 |
| 286 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021366 | 376 |
| 287 | 3300044683 | Ga0466965_0006039 | Ga0466965_0006039_424_1593 | 376 |
| 288 | 3300045976 | Ga0466967_0179104 | Ga0466967_0179104_165_1334 | 376 |
| 289 | 3300046513 | Ga0495616_0026004 | Ga0495616_0026004_256_1491 | 376 |
| 290 | 3300046665 | Ga0495661_0031457 | Ga0495661_0031457_432_1667 | 376 |
| 291 | 3300046810 | Ga0495660_0043997 | Ga0495660_0043997_580_1815 | 376 |
| 292 | 3300048920 | Ga0496117_0054303 | Ga0496117_0054303_1517_2689 | 376 |
| 293 | iso_pu_bacteria | 2738541264 | 2738668252 | 376 |
| 294 | iso_pu_bacteria | 2738541356 | 2739147322 | 376 |
| 295 | iso_pu_bacteria | 2773857933 | 2774903643 | 376 |
| 296 | iso_pu_bacteria | 2935409751 | 2935411974 | 376 |
| 297 | 3300025939 | Ga0207665_10026153 | Ga0207665_100261532 | 377 |
| 298 | 3300044656 | Ga0466969_0066241 | Ga0466969_0066241_281_1462 | 377 |
| 299 | 3300044693 | Ga0466961_0141162 | Ga0466961_0141162_34_1215 | 377 |
| 300 | 3300044765 | Ga0466970_0018071 | Ga0466970_0018071_1551_2744 | 377 |
| 301 | 3300048907 | Ga0496104_0256180 | Ga0496104_0256180_162_1379 | 377 |
| 302 | 3300048910 | Ga0496107_0022520 | Ga0496107_0022520_2348_3565 | 377 |
| 303 | 3300048911 | Ga0496108_0207570 | Ga0496108_0207570_383_1600 | 377 |
| 304 | 3300048913 | Ga0496110_0180121 | Ga0496110_0180121_323_1540 | 377 |
| 305 | 3300048915 | Ga0496112_0058297 | Ga0496112_0058297_907_2124 | 377 |
| 306 | 3300048916 | Ga0496113_0053253 | Ga0496113_0053253_641_1858 | 377 |
| 307 | 3300048918 | Ga0496115_0015617 | Ga0496115_0015617_980_2197 | 377 |
| 308 | 3300048922 | Ga0496119_0087609 | Ga0496119_0087609_411_1628 | 377 |
| 309 | 3300049572 | Ga0501036_0101468 | Ga0501036_0101468_1018_2214 | 377 |
| 310 | 3300049822 | Ga0501035_0013357 | Ga0501035_0013357_3622_4818 | 377 |
| 311 | 3300049823 | Ga0501044_0039319 | Ga0501044_0039319_1323_2519 | 377 |
| 312 | 3300053080 | Ga0500635_0009368 | Ga0500635_0009368_1112_2290 | 377 |
| 313 | 3300053131 | Ga0500652_000656 | Ga0500652_000656_5865_7043 | 377 |
| 314 | iso_pu_bacteria | 2929212328 | 2929212804 | 377 |
| 315 | iso_pu_bacteria | 8055066027 | 8055069853 | 377 |
| 316 | 3300005614 | Ga0068856_100191822 | Ga0068856_1001918222 | 378 |
| 317 | 3300042138 | Ga0450903_004971 | Ga0450903_004971_385_1569 | 378 |
| 318 | 3300045976 | Ga0466967_0117346 | Ga0466967_0117346_743_1927 | 378 |
| 319 | 3300049571 | Ga0501034_0170809 | Ga0501034_0170809_197_1504 | 378 |
| 320 | 3300049574 | Ga0501038_0039094 | Ga0501038_0039094_1419_2726 | 378 |
| 321 | 3300049581 | Ga0501047_0006080 | Ga0501047_0006080_1491_2798 | 378 |
| 322 | 3300049586 | Ga0501070_0028862 | Ga0501070_0028862_1336_2643 | 378 |
| 323 | 3300049823 | Ga0501044_0019751 | Ga0501044_0019751_342_1649 | 378 |
| 324 | iso_pu_bacteria | 2799112218 | 2799184508 | 378 |
| 325 | 3300005329 | Ga0070683_100028208 | Ga0070683_1000282084 | 379 |
| 326 | 3300005337 | Ga0070682_100004731 | Ga0070682_1000047313 | 379 |
| 327 | 3300005338 | Ga0068868_100008432 | Ga0068868_1000084326 | 379 |
| 328 | 3300005340 | Ga0070689_100048702 | Ga0070689_1000487022 | 379 |
| 329 | 3300005345 | Ga0070692_10010302 | Ga0070692_100103024 | 379 |
| 330 | 3300005347 | Ga0070668_100095059 | Ga0070668_1000950591 | 379 |
| 331 | 3300005455 | Ga0070663_100006011 | Ga0070663_1000060112 | 379 |
| 332 | 3300005457 | Ga0070662_100053940 | Ga0070662_1000539401 | 379 |
| 333 | 3300005548 | Ga0070665_100025431 | Ga0070665_1000254313 | 379 |
| 334 | 3300005548 | Ga0070665_100083145 | Ga0070665_1000831452 | 379 |
| 335 | 3300005564 | Ga0070664_100013642 | Ga0070664_1000136422 | 379 |
| 336 | 3300005577 | Ga0068857_100064410 | Ga0068857_1000644102 | 379 |
| 337 | 3300005615 | Ga0070702_100081959 | Ga0070702_1000819591 | 379 |
| 338 | 3300005616 | Ga0068852_100030669 | Ga0068852_1000306694 | 379 |
| 339 | 3300005618 | Ga0068864_100067107 | Ga0068864_1000671073 | 379 |
| 340 | 3300005842 | Ga0068858_100239850 | Ga0068858_1002398502 | 379 |
| 341 | 3300005843 | Ga0068860_100099535 | Ga0068860_1000995353 | 379 |
| 342 | 3300005844 | Ga0068862_100009803 | Ga0068862_1000098034 | 379 |
| 343 | 3300009098 | Ga0105245_10007000 | Ga0105245_1000700010 | 379 |
| 344 | 3300009148 | Ga0105243_10040570 | Ga0105243_100405702 | 379 |
| 345 | 3300009545 | Ga0105237_10052218 | Ga0105237_100522183 | 379 |
| 346 | 3300009553 | Ga0105249_10024832 | Ga0105249_100248322 | 379 |
| 347 | 3300010375 | Ga0105239_10009798 | Ga0105239_1000979814 | 379 |
| 348 | 3300013105 | Ga0157369_10138995 | Ga0157369_101389952 | 379 |
| 349 | 3300013308 | Ga0157375_10016532 | Ga0157375_100165326 | 379 |
| 350 | 3300014745 | Ga0157377_10026174 | Ga0157377_100261742 | 379 |
| 351 | 3300014968 | Ga0157379_10098581 | Ga0157379_100985813 | 379 |
| 352 | 3300025901 | Ga0207688_10002529 | Ga0207688_100025293 | 379 |
| 353 | 3300025909 | Ga0207705_10080049 | Ga0207705_100800492 | 379 |
| 354 | 3300025927 | Ga0207687_10012002 | Ga0207687_100120024 | 379 |
| 355 | 3300025933 | Ga0207706_10021851 | Ga0207706_100218516 | 379 |
| 356 | 3300025936 | Ga0207670_10034083 | Ga0207670_100340832 | 379 |
| 357 | 3300025944 | Ga0207661_10114848 | Ga0207661_101148482 | 379 |
| 358 | 3300025945 | Ga0207679_10029836 | Ga0207679_100298363 | 379 |
| 359 | 3300025972 | Ga0207668_10012725 | Ga0207668_100127254 | 379 |
| 360 | 3300026035 | Ga0207703_10126774 | Ga0207703_101267742 | 379 |
| 361 | 3300026067 | Ga0207678_10022477 | Ga0207678_100224775 | 379 |
| 362 | 3300026095 | Ga0207676_10082498 | Ga0207676_100824983 | 379 |
| 363 | 3300026121 | Ga0207683_10063268 | Ga0207683_100632683 | 379 |
| 364 | 3300026142 | Ga0207698_10046169 | Ga0207698_100461693 | 379 |
| 365 | 3300028379 | Ga0268266_10027084 | Ga0268266_100270842 | 379 |
| 366 | 3300028379 | Ga0268266_10121114 | Ga0268266_101211142 | 379 |
| 367 | 3300028380 | Ga0268265_10011636 | Ga0268265_100116364 | 379 |
| 368 | 3300028381 | Ga0268264_10067008 | Ga0268264_100670083 | 379 |
| 369 | 3300036401 | Ga0373937_0102443 | Ga0373937_0102443_1291_2481 | 379 |
| 370 | 3300037853 | Ga0436364_0256666 | Ga0436364_0256666_1624_2817 | 379 |
| 371 | 3300046536 | Ga0495587_0132275 | Ga0495587_0132275_122_1312 | 379 |
| 372 | 3300048913 | Ga0496110_0014998 | Ga0496110_0014998_2905_4110 | 379 |
| 373 | 3300005347 | Ga0070668_100000347 | Ga0070668_10000034714 | 380 |
| 374 | 3300025972 | Ga0207668_10003758 | Ga0207668_100037583 | 380 |
| 375 | 3300031251 | Ga0265327_10000177 | Ga0265327_1000017728 | 380 |
| 376 | 3300048925 | Ga0496122_0012560 | Ga0496122_0012560_638_1855 | 380 |
| 377 | 3300050490 | nmdc:mga03n38_65661_c1 | nmdc:mga03n38_65661_c1_63_1265 | 380 |
| 378 | 3300053108 | Ga0500562_001428 | Ga0500562_001428_2918_4099 | 380 |
| 379 | iso_pu_bacteria | 2856741275 | 2856746426 | 380 |
| 380 | iso_pu_bacteria | 2857723135 | 2857725896 | 380 |
| 381 | iso_pu_bacteria | 2891562705 | 2891567998 | 380 |
| 382 | iso_pu_bacteria | 2904509784 | 2904510695 | 380 |
| 383 | iso_pu_bacteria | 2977236895 | 2977237970 | 380 |
| 384 | iso_pu_bacteria | 2984542743 | 2984544249 | 380 |
| 385 | 3300005435 | Ga0070714_100168788 | Ga0070714_1001687881 | 381 |
| 386 | 3300005435 | Ga0070714_100205231 | Ga0070714_1002052312 | 381 |
| 387 | 3300005436 | Ga0070713_100097254 | Ga0070713_1000972542 | 381 |
| 388 | 3300014968 | Ga0157379_10139072 | Ga0157379_101390722 | 381 |
| 389 | 3300021388 | Ga0213875_10000235 | Ga0213875_1000023517 | 381 |
| 390 | 3300025906 | Ga0207699_10058887 | Ga0207699_100588872 | 381 |
| 391 | 3300025924 | Ga0207694_10075529 | Ga0207694_100755291 | 381 |
| 392 | 3300025929 | Ga0207664_10077458 | Ga0207664_100774582 | 381 |
| 393 | 3300026067 | Ga0207678_10124428 | Ga0207678_101244282 | 381 |
| 394 | 3300026121 | Ga0207683_10266922 | Ga0207683_102669222 | 381 |
| 395 | 3300028800 | Ga0265338_10003375 | Ga0265338_100033754 | 381 |
| 396 | 3300031649 | Ga0307514_10018424 | Ga0307514_100184243 | 381 |
| 397 | 3300037853 | Ga0436364_0282469 | Ga0436364_0282469_3616_4806 | 381 |
| 398 | 3300044719 | Ga0466971_0052020 | Ga0466971_0052020_456_1658 | 381 |
| 399 | 3300046460 | Ga0495638_0000563 | Ga0495638_0000563_28752_29948 | 381 |
| 400 | 3300048903 | Ga0496100_0011912 | Ga0496100_0011912_2818_4044 | 381 |
| 401 | 3300048904 | Ga0496101_0048830 | Ga0496101_0048830_854_2080 | 381 |
| 402 | 3300048905 | Ga0496102_0003154 | Ga0496102_0003154_3909_5135 | 381 |
| 403 | 3300048905 | Ga0496102_0100401 | Ga0496102_0100401_1143_2339 | 381 |
| 404 | 3300048906 | Ga0496103_0010622 | Ga0496103_0010622_1830_3056 | 381 |
| 405 | 3300048907 | Ga0496104_0001045 | Ga0496104_0001045_16176_17402 | 381 |
| 406 | 3300048908 | Ga0496105_0010160 | Ga0496105_0010160_4748_5944 | 381 |
| 407 | 3300048909 | Ga0496106_0024279 | Ga0496106_0024279_2568_3764 | 381 |
| 408 | 3300048911 | Ga0496108_0292952 | Ga0496108_0292952_175_1371 | 381 |
| 409 | 3300048917 | Ga0496114_0003226 | Ga0496114_0003226_860_2086 | 381 |
| 410 | 3300048917 | Ga0496114_0013230 | Ga0496114_0013230_3822_5018 | 381 |
| 411 | 3300053153 | Ga0500616_0000822 | Ga0500616_0000822_3569_4768 | 381 |
| 412 | iso_pu_bacteria | 2643221692 | 2644511974 | 381 |
| 413 | iso_pu_bacteria | 2643221711 | 2644609338 | 381 |
| 414 | 3300005340 | Ga0070689_100015610 | Ga0070689_1000156102 | 382 |
| 415 | 3300006028 | Ga0070717_10212387 | Ga0070717_102123872 | 382 |
| 416 | 3300028573 | Ga0265334_10007863 | Ga0265334_100078634 | 382 |
| 417 | 3300049570 | Ga0501033_0008524 | Ga0501033_0008524_4469_5674 | 382 |
| 418 | 3300049571 | Ga0501034_0045164 | Ga0501034_0045164_2336_3541 | 382 |
| 419 | 3300049571 | Ga0501034_0052324 | Ga0501034_0052324_1575_2780 | 382 |
| 420 | 3300049572 | Ga0501036_0003690 | Ga0501036_0003690_6188_7393 | 382 |
| 421 | 3300049572 | Ga0501036_0168700 | Ga0501036_0168700_218_1423 | 382 |
| 422 | 3300049574 | Ga0501038_0014975 | Ga0501038_0014975_4550_5755 | 382 |
| 423 | 3300049575 | Ga0501039_0014528 | Ga0501039_0014528_1855_3060 | 382 |
| 424 | 3300049579 | Ga0501043_0000358 | Ga0501043_0000358_7905_9110 | 382 |
| 425 | 3300049581 | Ga0501047_0219591 | Ga0501047_0219591_19_1224 | 382 |
| 426 | 3300049586 | Ga0501070_0002257 | Ga0501070_0002257_2849_4054 | 382 |
| 427 | 3300049590 | Ga0501074_0009064 | Ga0501074_0009064_1455_2660 | 382 |
| 428 | 3300049822 | Ga0501035_0005197 | Ga0501035_0005197_912_2117 | 382 |
| 429 | 3300049822 | Ga0501035_0079284 | Ga0501035_0079284_1483_2694 | 382 |
| 430 | 3300049823 | Ga0501044_0160161 | Ga0501044_0160161_155_1360 | 382 |
| 431 | iso_pu_bacteria | 2728369276 | 2729908467 | 382 |
| 432 | iso_pu_bacteria | 2786546132 | 2786674661 | 382 |
| 433 | iso_pu_bacteria | 2862382967 | 2862387986 | 382 |
| 434 | 3300005338 | Ga0068868_100254550 | Ga0068868_1002545501 | 383 |
| 435 | 3300005436 | Ga0070713_100018089 | Ga0070713_1000180894 | 383 |
| 436 | 3300005436 | Ga0070713_100354071 | Ga0070713_1003540711 | 383 |
| 437 | 3300005455 | Ga0070663_100279563 | Ga0070663_1002795631 | 383 |
| 438 | 3300006175 | Ga0070712_100015368 | Ga0070712_1000153684 | 383 |
| 439 | 3300009011 | Ga0105251_10030879 | Ga0105251_100308792 | 383 |
| 440 | 3300021388 | Ga0213875_10051837 | Ga0213875_100518372 | 383 |
| 441 | 3300025915 | Ga0207693_10030363 | Ga0207693_100303633 | 383 |
| 442 | 3300028666 | Ga0265336_10009230 | Ga0265336_100092303 | 383 |
| 443 | 3300028800 | Ga0265338_10002127 | Ga0265338_1000212719 | 383 |
| 444 | 3300031616 | Ga0307508_10219578 | Ga0307508_102195781 | 383 |
| 445 | 3300035083 | Ga0373926_0001427 | Ga0373926_0001427_4942_6144 | 383 |
| 446 | 3300035089 | Ga0373944_0000291 | Ga0373944_0000291_2958_4160 | 383 |
| 447 | 3300035113 | Ga0373936_0000195 | Ga0373936_0000195_9237_10439 | 383 |
| 448 | 3300035116 | Ga0373945_0000055 | Ga0373945_0000055_1661_2863 | 383 |
| 449 | 3300035119 | Ga0373956_0009965 | Ga0373956_0009965_1775_2980 | 383 |
| 450 | 3300035170 | Ga0373943_0000041 | Ga0373943_0000041_20046_21248 | 383 |
| 451 | 3300035170 | Ga0373943_0072571 | Ga0373943_0072571_15_1196 | 383 |
| 452 | 3300035171 | Ga0373946_0001009 | Ga0373946_0001009_1965_3167 | 383 |
| 453 | 3300035172 | Ga0373955_0005335 | Ga0373955_0005335_1811_3022 | 383 |
| 454 | 3300035692 | Ga0373935_0000404 | Ga0373935_0000404_8592_9794 | 383 |
| 455 | 3300035692 | Ga0373935_0089967 | Ga0373935_0089967_161_1366 | 383 |
| 456 | 3300035695 | Ga0373927_0001129 | Ga0373927_0001129_7332_8534 | 383 |
| 457 | 3300035724 | Ga0373933_0021427 | Ga0373933_0021427_308_1519 | 383 |
| 458 | 3300035725 | Ga0373947_0000535 | Ga0373947_0000535_10616_11818 | 383 |
| 459 | 3300036401 | Ga0373937_0053708 | Ga0373937_0053708_777_1982 | 383 |
| 460 | 3300037068 | Ga0373925_0004534 | Ga0373925_0004534_8657_9859 | 383 |
| 461 | 3300037068 | Ga0373925_0076296 | Ga0373925_0076296_721_1995 | 383 |
| 462 | 3300037466 | Ga0395898_0059610 | Ga0395898_0059610_326_1591 | 383 |
| 463 | 3300037853 | Ga0436364_1034848 | Ga0436364_1034848_261_1466 | 383 |
| 464 | 3300045976 | Ga0466967_0056906 | Ga0466967_0056906_120_1325 | 383 |
| 465 | 3300046454 | Ga0495592_0044771 | Ga0495592_0044771_1933_3144 | 383 |
| 466 | 3300046454 | Ga0495592_0061583 | Ga0495592_0061583_1092_2297 | 383 |
| 467 | 3300046461 | Ga0495641_0017895 | Ga0495641_0017895_1408_2610 | 383 |
| 468 | 3300046463 | Ga0495653_0001396 | Ga0495653_0001396_13629_14831 | 383 |
| 469 | 3300046463 | Ga0495653_0016189 | Ga0495653_0016189_2041_3252 | 383 |
| 470 | 3300046473 | Ga0495582_0003116 | Ga0495582_0003116_436_1638 | 383 |
| 471 | 3300046477 | Ga0495664_0000524 | Ga0495664_0000524_6297_7499 | 383 |
| 472 | 3300046477 | Ga0495664_0033208 | Ga0495664_0033208_609_1814 | 383 |
| 473 | 3300046516 | Ga0495628_0040917 | Ga0495628_0040917_1090_2295 | 383 |
| 474 | 3300046526 | Ga0495666_0107626 | Ga0495666_0107626_41_1246 | 383 |
| 475 | 3300046529 | Ga0495652_0027316 | Ga0495652_0027316_2489_3694 | 383 |
| 476 | 3300046529 | Ga0495652_0031218 | Ga0495652_0031218_1753_2955 | 383 |
| 477 | 3300046529 | Ga0495652_0136573 | Ga0495652_0136573_436_1647 | 383 |
| 478 | 3300046531 | Ga0495665_0020537 | Ga0495665_0020537_728_1930 | 383 |
| 479 | 3300046533 | Ga0495640_0104594 | Ga0495640_0104594_498_1703 | 383 |
| 480 | 3300046536 | Ga0495587_0014543 | Ga0495587_0014543_1183_2388 | 383 |
| 481 | 3300046559 | Ga0495667_0004249 | Ga0495667_0004249_3708_4910 | 383 |
| 482 | 3300046663 | Ga0495635_0000353 | Ga0495635_0000353_12880_14082 | 383 |
| 483 | 3300046675 | Ga0495657_0023808 | Ga0495657_0023808_1820_3025 | 383 |
| 484 | 3300046675 | Ga0495657_0102330 | Ga0495657_0102330_315_1526 | 383 |
| 485 | 3300046690 | Ga0495624_0001681 | Ga0495624_0001681_10690_11892 | 383 |
| 486 | 3300046809 | Ga0495600_0071881 | Ga0495600_0071881_965_2176 | 383 |
| 487 | 3300047315 | Ga0495581_0086198 | Ga0495581_0086198_545_1750 | 383 |
| 488 | 3300047319 | Ga0495674_0002196 | Ga0495674_0002196_6291_7493 | 383 |
| 489 | 3300047321 | Ga0495676_0047009 | Ga0495676_0047009_757_1959 | 383 |
| 490 | 3300047322 | Ga0495680_0008327 | Ga0495680_0008327_1576_2778 | 383 |
| 491 | 3300047322 | Ga0495680_0024787 | Ga0495680_0024787_1158_2363 | 383 |
| 492 | 3300047471 | Ga0495684_0001427 | Ga0495684_0001427_6256_7458 | 383 |
| 493 | 3300047673 | Ga0495593_0068950 | Ga0495593_0068950_545_1729 | 383 |
| 494 | 3300048088 | Ga0495602_0019844 | Ga0495602_0019844_2842_4047 | 383 |
| 495 | 3300048088 | Ga0495602_0067885 | Ga0495602_0067885_1648_2859 | 383 |
| 496 | 3300048913 | Ga0496110_0259339 | Ga0496110_0259339_256_1458 | 383 |
| 497 | 3300049569 | Ga0501032_0011027 | Ga0501032_0011027_1920_3131 | 383 |
| 498 | 3300049570 | Ga0501033_0016575 | Ga0501033_0016575_221_1432 | 383 |
| 499 | 3300049572 | Ga0501036_0003289 | Ga0501036_0003289_11644_12855 | 383 |
| 500 | 3300049575 | Ga0501039_0076713 | Ga0501039_0076713_1214_2425 | 383 |
| 501 | 3300049581 | Ga0501047_0017843 | Ga0501047_0017843_4116_5327 | 383 |
| 502 | 3300049581 | Ga0501047_0058299 | Ga0501047_0058299_2133_3338 | 383 |
| 503 | 3300049581 | Ga0501047_0102471 | Ga0501047_0102471_513_1781 | 383 |
| 504 | 3300049823 | Ga0501044_0227744 | Ga0501044_0227744_589_1794 | 383 |
| 505 | 3300049824 | Ga0501045_0218570 | Ga0501045_0218570_164_1375 | 383 |
| 506 | iso_pu_bacteria | 2547132424 | 2548697715 | 383 |
| 507 | iso_pu_bacteria | 2626541554 | 2626637059 | 383 |
| 508 | iso_pu_bacteria | 2862290372 | 2862293003 | 383 |
| 509 | iso_pu_bacteria | 2997451912 | 2997455605 | 383 |
| 510 | iso_pu_bacteria | 8003314358 | 8003317682 | 383 |
| 511 | iso_pu_bacteria | 8055157932 | 8055161478 | 383 |
| 512 | 3300003354 | JGI25160J50197_1005722 | JGI25160J50197_10057224 | 384 |
| 513 | 3300005327 | Ga0070658_10042920 | Ga0070658_100429203 | 384 |
| 514 | 3300005329 | Ga0070683_100084928 | Ga0070683_1000849283 | 384 |
| 515 | 3300005335 | Ga0070666_10011772 | Ga0070666_100117723 | 384 |
| 516 | 3300005338 | Ga0068868_100099272 | Ga0068868_1000992722 | 384 |
| 517 | 3300005347 | Ga0070668_100012548 | Ga0070668_1000125483 | 384 |
| 518 | 3300005353 | Ga0070669_100001706 | Ga0070669_10000170610 | 384 |
| 519 | 3300005365 | Ga0070688_100198379 | Ga0070688_1001983791 | 384 |
| 520 | 3300005367 | Ga0070667_100000056 | Ga0070667_100000056129 | 384 |
| 521 | 3300005434 | Ga0070709_10073610 | Ga0070709_100736103 | 384 |
| 522 | 3300005437 | Ga0070710_10035164 | Ga0070710_100351643 | 384 |
| 523 | 3300005439 | Ga0070711_100204898 | Ga0070711_1002048981 | 384 |
| 524 | 3300005468 | Ga0070707_100040022 | Ga0070707_1000400224 | 384 |
| 525 | 3300005536 | Ga0070697_100202792 | Ga0070697_1002027921 | 384 |
| 526 | 3300005539 | Ga0068853_100032974 | Ga0068853_1000329744 | 384 |
| 527 | 3300005539 | Ga0068853_100106781 | Ga0068853_1001067812 | 384 |
| 528 | 3300005544 | Ga0070686_100047935 | Ga0070686_1000479352 | 384 |
| 529 | 3300005548 | Ga0070665_100005830 | Ga0070665_1000058309 | 384 |
| 530 | 3300005548 | Ga0070665_100244543 | Ga0070665_1002445432 | 384 |
| 531 | 3300005564 | Ga0070664_100096882 | Ga0070664_1000968822 | 384 |
| 532 | 3300005577 | Ga0068857_100176977 | Ga0068857_1001769772 | 384 |
| 533 | 3300005614 | Ga0068856_100083313 | Ga0068856_1000833132 | 384 |
| 534 | 3300005617 | Ga0068859_100000751 | Ga0068859_10000075129 | 384 |
| 535 | 3300005618 | Ga0068864_100196688 | Ga0068864_1001966882 | 384 |
| 536 | 3300005841 | Ga0068863_100004393 | Ga0068863_1000043938 | 384 |
| 537 | 3300005841 | Ga0068863_100058432 | Ga0068863_1000584322 | 384 |
| 538 | 3300005842 | Ga0068858_100021321 | Ga0068858_1000213216 | 384 |
| 539 | 3300005842 | Ga0068858_100043454 | Ga0068858_1000434543 | 384 |
| 540 | 3300005842 | Ga0068858_100063112 | Ga0068858_1000631123 | 384 |
| 541 | 3300005843 | Ga0068860_100000092 | Ga0068860_10000009227 | 384 |
| 542 | 3300005844 | Ga0068862_100000035 | Ga0068862_10000003531 | 384 |
| 543 | 3300006028 | Ga0070717_10200230 | Ga0070717_102002302 | 384 |
| 544 | 3300006237 | Ga0097621_100133059 | Ga0097621_1001330592 | 384 |
| 545 | 3300006237 | Ga0097621_100172750 | Ga0097621_1001727503 | 384 |
| 546 | 3300006871 | Ga0075434_100313343 | Ga0075434_1003133432 | 384 |
| 547 | 3300006931 | Ga0097620_100000751 | Ga0097620_10000075129 | 384 |
| 548 | 3300007076 | Ga0075435_100106709 | Ga0075435_1001067092 | 384 |
| 549 | 3300009098 | Ga0105245_10020466 | Ga0105245_100204662 | 384 |
| 550 | 3300009101 | Ga0105247_10000062 | Ga0105247_1000006281 | 384 |
| 551 | 3300009148 | Ga0105243_10187234 | Ga0105243_101872342 | 384 |
| 552 | 3300009174 | Ga0105241_10000239 | Ga0105241_1000023925 | 384 |
| 553 | 3300009177 | Ga0105248_10000036 | Ga0105248_10000036128 | 384 |
| 554 | 3300009177 | Ga0105248_10192652 | Ga0105248_101926522 | 384 |
| 555 | 3300009177 | Ga0105248_10218510 | Ga0105248_102185102 | 384 |
| 556 | 3300009545 | Ga0105237_10123088 | Ga0105237_101230882 | 384 |
| 557 | 3300009551 | Ga0105238_10049757 | Ga0105238_100497571 | 384 |
| 558 | 3300009551 | Ga0105238_10101783 | Ga0105238_101017832 | 384 |
| 559 | 3300009553 | Ga0105249_10000046 | Ga0105249_10000046150 | 384 |
| 560 | 3300010375 | Ga0105239_10164326 | Ga0105239_101643263 | 384 |
| 561 | 3300013105 | Ga0157369_10091263 | Ga0157369_100912632 | 384 |
| 562 | 3300013296 | Ga0157374_10018011 | Ga0157374_100180112 | 384 |
| 563 | 3300013296 | Ga0157374_10103464 | Ga0157374_101034642 | 384 |
| 564 | 3300013307 | Ga0157372_10177069 | Ga0157372_101770692 | 384 |
| 565 | 3300013308 | Ga0157375_10150564 | Ga0157375_101505642 | 384 |
| 566 | 3300013308 | Ga0157375_10179549 | Ga0157375_101795492 | 384 |
| 567 | 3300014325 | Ga0163163_10030509 | Ga0163163_100305096 | 384 |
| 568 | 3300014325 | Ga0163163_10083421 | Ga0163163_100834212 | 384 |
| 569 | 3300014968 | Ga0157379_10007317 | Ga0157379_100073173 | 384 |
| 570 | 3300021388 | Ga0213875_10015450 | Ga0213875_100154501 | 384 |
| 571 | 3300025302 | Ga0207426_1000920 | Ga0207426_100092014 | 384 |
| 572 | 3300025900 | Ga0207710_10000060 | Ga0207710_1000006080 | 384 |
| 573 | 3300025901 | Ga0207688_10045250 | Ga0207688_100452502 | 384 |
| 574 | 3300025906 | Ga0207699_10035924 | Ga0207699_100359243 | 384 |
| 575 | 3300025911 | Ga0207654_10041372 | Ga0207654_100413722 | 384 |
| 576 | 3300025914 | Ga0207671_10000365 | Ga0207671_1000036549 | 384 |
| 577 | 3300025918 | Ga0207662_10023219 | Ga0207662_100232192 | 384 |
| 578 | 3300025922 | Ga0207646_10065677 | Ga0207646_100656772 | 384 |
| 579 | 3300025923 | Ga0207681_10001181 | Ga0207681_1000118110 | 384 |
| 580 | 3300025924 | Ga0207694_10001761 | Ga0207694_100017612 | 384 |
| 581 | 3300025927 | Ga0207687_10026927 | Ga0207687_100269273 | 384 |
| 582 | 3300025929 | Ga0207664_10054885 | Ga0207664_100548852 | 384 |
| 583 | 3300025939 | Ga0207665_10008824 | Ga0207665_100088245 | 384 |
| 584 | 3300025939 | Ga0207665_10040401 | Ga0207665_100404012 | 384 |
| 585 | 3300025940 | Ga0207691_10104049 | Ga0207691_101040492 | 384 |
| 586 | 3300025941 | Ga0207711_10000073 | Ga0207711_10000073112 | 384 |
| 587 | 3300025941 | Ga0207711_10108029 | Ga0207711_101080293 | 384 |
| 588 | 3300025942 | Ga0207689_10006694 | Ga0207689_100066946 | 384 |
| 589 | 3300025944 | Ga0207661_10126342 | Ga0207661_101263422 | 384 |
| 590 | 3300025945 | Ga0207679_10069586 | Ga0207679_100695862 | 384 |
| 591 | 3300025961 | Ga0207712_10000042 | Ga0207712_1000004231 | 384 |
| 592 | 3300025972 | Ga0207668_10016784 | Ga0207668_100167844 | 384 |
| 593 | 3300025986 | Ga0207658_10000664 | Ga0207658_1000066427 | 384 |
| 594 | 3300026023 | Ga0207677_10133668 | Ga0207677_101336682 | 384 |
| 595 | 3300026035 | Ga0207703_10059827 | Ga0207703_100598272 | 384 |
| 596 | 3300026041 | Ga0207639_10020125 | Ga0207639_100201253 | 384 |
| 597 | 3300026067 | Ga0207678_10000318 | Ga0207678_1000031829 | 384 |
| 598 | 3300026067 | Ga0207678_10029113 | Ga0207678_100291134 | 384 |
| 599 | 3300026067 | Ga0207678_10076531 | Ga0207678_100765312 | 384 |
| 600 | 3300026078 | Ga0207702_10095896 | Ga0207702_100958962 | 384 |
| 601 | 3300026078 | Ga0207702_10111872 | Ga0207702_101118722 | 384 |
| 602 | 3300026078 | Ga0207702_10155960 | Ga0207702_101559602 | 384 |
| 603 | 3300026088 | Ga0207641_10003278 | Ga0207641_100032788 | 384 |
| 604 | 3300026116 | Ga0207674_10008338 | Ga0207674_1000833810 | 384 |
| 605 | 3300026116 | Ga0207674_10016576 | Ga0207674_100165766 | 384 |
| 606 | 3300026142 | Ga0207698_10021930 | Ga0207698_100219301 | 384 |
| 607 | 3300028379 | Ga0268266_10028517 | Ga0268266_100285174 | 384 |
| 608 | 3300028379 | Ga0268266_10061022 | Ga0268266_100610222 | 384 |
| 609 | 3300028379 | Ga0268266_10206495 | Ga0268266_102064952 | 384 |
| 610 | 3300028380 | Ga0268265_10000051 | Ga0268265_10000051149 | 384 |
| 611 | 3300028381 | Ga0268264_10000108 | Ga0268264_1000010856 | 384 |
| 612 | 3300028666 | Ga0265336_10003483 | Ga0265336_100034832 | 384 |
| 613 | 3300028786 | Ga0307517_10012361 | Ga0307517_100123613 | 384 |
| 614 | 3300028794 | Ga0307515_10036520 | Ga0307515_100365204 | 384 |
| 615 | 3300028800 | Ga0265338_10065466 | Ga0265338_100654663 | 384 |
| 616 | 3300031456 | Ga0307513_10005780 | Ga0307513_1000578016 | 384 |
| 617 | 3300031616 | Ga0307508_10017127 | Ga0307508_100171272 | 384 |
| 618 | 3300031649 | Ga0307514_10051472 | Ga0307514_100514722 | 384 |
| 619 | 3300031730 | Ga0307516_10028531 | Ga0307516_100285314 | 384 |
| 620 | 3300035090 | Ga0373949_0024732 | Ga0373949_0024732_29_1249 | 384 |
| 621 | 3300035111 | Ga0373923_0020939 | Ga0373923_0020939_41_1246 | 384 |
| 622 | 3300035113 | Ga0373936_0027486 | Ga0373936_0027486_977_2182 | 384 |
| 623 | 3300035116 | Ga0373945_0063736 | Ga0373945_0063736_149_1354 | 384 |
| 624 | 3300035118 | Ga0373954_0014483 | Ga0373954_0014483_37_1242 | 384 |
| 625 | 3300035170 | Ga0373943_0110819 | Ga0373943_0110819_28_1233 | 384 |
| 626 | 3300035410 | Ga0373924_0074223 | Ga0373924_0074223_138_1343 | 384 |
| 627 | 3300035692 | Ga0373935_0032787 | Ga0373935_0032787_1288_2493 | 384 |
| 628 | 3300037068 | Ga0373925_0000592 | Ga0373925_0000592_6338_7627 | 384 |
| 629 | 3300037068 | Ga0373925_0253242 | Ga0373925_0253242_131_1336 | 384 |
| 630 | 3300037853 | Ga0436364_0691418 | Ga0436364_0691418_15131_16339 | 384 |
| 631 | 3300039437 | Ga0436365_0514921 | Ga0436365_0514921_630_1823 | 384 |
| 632 | 3300044656 | Ga0466969_0005780 | Ga0466969_0005780_4117_5415 | 384 |
| 633 | 3300044684 | Ga0466966_0007160 | Ga0466966_0007160_5760_7058 | 384 |
| 634 | 3300044684 | Ga0466966_0116310 | Ga0466966_0116310_336_1547 | 384 |
| 635 | 3300044719 | Ga0466971_0011830 | Ga0466971_0011830_2151_3362 | 384 |
| 636 | 3300044765 | Ga0466970_0016852 | Ga0466970_0016852_733_1938 | 384 |
| 637 | 3300045049 | Ga0466959_0005746 | Ga0466959_0005746_760_1971 | 384 |
| 638 | 3300046454 | Ga0495592_0000533 | Ga0495592_0000533_11692_12975 | 384 |
| 639 | 3300046454 | Ga0495592_0022151 | Ga0495592_0022151_1272_2477 | 384 |
| 640 | 3300046459 | Ga0495629_0108593 | Ga0495629_0108593_198_1403 | 384 |
| 641 | 3300046461 | Ga0495641_0064723 | Ga0495641_0064723_276_1481 | 384 |
| 642 | 3300046462 | Ga0495651_0000122 | Ga0495651_0000122_52824_54056 | 384 |
| 643 | 3300046462 | Ga0495651_0009308 | Ga0495651_0009308_4301_5506 | 384 |
| 644 | 3300046462 | Ga0495651_0012823 | Ga0495651_0012823_4193_5488 | 384 |
| 645 | 3300046473 | Ga0495582_0112530 | Ga0495582_0112530_262_1467 | 384 |
| 646 | 3300046476 | Ga0495662_0000937 | Ga0495662_0000937_4070_5353 | 384 |
| 647 | 3300046476 | Ga0495662_0030153 | Ga0495662_0030153_863_2068 | 384 |
| 648 | 3300046477 | Ga0495664_0002583 | Ga0495664_0002583_3708_4991 | 384 |
| 649 | 3300046511 | Ga0495608_0001351 | Ga0495608_0001351_7080_8363 | 384 |
| 650 | 3300046514 | Ga0495618_0038890 | Ga0495618_0038890_286_1491 | 384 |
| 651 | 3300046516 | Ga0495628_0004846 | Ga0495628_0004846_4174_5406 | 384 |
| 652 | 3300046517 | Ga0495630_0022340 | Ga0495630_0022340_1312_2517 | 384 |
| 653 | 3300046526 | Ga0495666_0000566 | Ga0495666_0000566_2835_4118 | 384 |
| 654 | 3300046526 | Ga0495666_0069062 | Ga0495666_0069062_27_1232 | 384 |
| 655 | 3300046529 | Ga0495652_0000719 | Ga0495652_0000719_31325_32557 | 384 |
| 656 | 3300046531 | Ga0495665_0005751 | Ga0495665_0005751_2367_3662 | 384 |
| 657 | 3300046533 | Ga0495640_0152436 | Ga0495640_0152436_115_1320 | 384 |
| 658 | 3300046536 | Ga0495587_0003107 | Ga0495587_0003107_3504_4709 | 384 |
| 659 | 3300046543 | Ga0495645_0005319 | Ga0495645_0005319_6750_8033 | 384 |
| 660 | 3300046559 | Ga0495667_0053430 | Ga0495667_0053430_1238_2533 | 384 |
| 661 | 3300046642 | Ga0495634_0030978 | Ga0495634_0030978_2149_3432 | 384 |
| 662 | 3300046674 | Ga0495588_0019465 | Ga0495588_0019465_1952_3157 | 384 |
| 663 | 3300046675 | Ga0495657_0005834 | Ga0495657_0005834_2509_3804 | 384 |
| 664 | 3300046675 | Ga0495657_0016427 | Ga0495657_0016427_1961_3166 | 384 |
| 665 | 3300046678 | Ga0495599_0004312 | Ga0495599_0004312_2940_4223 | 384 |
| 666 | 3300046678 | Ga0495599_0011835 | Ga0495599_0011835_1434_2639 | 384 |
| 667 | 3300046679 | Ga0495623_0070073 | Ga0495623_0070073_774_2057 | 384 |
| 668 | 3300046689 | Ga0495613_0005276 | Ga0495613_0005276_8073_9368 | 384 |
| 669 | 3300046691 | Ga0495670_0002891 | Ga0495670_0002891_2854_4101 | 384 |
| 670 | 3300046809 | Ga0495600_0010944 | Ga0495600_0010944_3332_4564 | 384 |
| 671 | 3300047315 | Ga0495581_0010688 | Ga0495581_0010688_336_1619 | 384 |
| 672 | 3300047317 | Ga0495604_0003940 | Ga0495604_0003940_4193_5476 | 384 |
| 673 | 3300047318 | Ga0495636_0051845 | Ga0495636_0051845_396_1619 | 384 |
| 674 | 3300047443 | Ga0495687_011320 | Ga0495687_011320_96_1343 | 384 |
| 675 | 3300047447 | Ga0495685_000392 | Ga0495685_000392_7041_8288 | 384 |
| 676 | 3300047470 | Ga0495681_0002275 | Ga0495681_0002275_4136_5383 | 384 |
| 677 | 3300047673 | Ga0495593_0004801 | Ga0495593_0004801_2031_3314 | 384 |
| 678 | 3300048088 | Ga0495602_0204549 | Ga0495602_0204549_81_1376 | 384 |
| 679 | 3300048903 | Ga0496100_0038132 | Ga0496100_0038132_515_1717 | 384 |
| 680 | 3300048904 | Ga0496101_0033560 | Ga0496101_0033560_558_1760 | 384 |
| 681 | 3300048905 | Ga0496102_0000390 | Ga0496102_0000390_38226_39428 | 384 |
| 682 | 3300048906 | Ga0496103_0001526 | Ga0496103_0001526_1206_2408 | 384 |
| 683 | 3300048906 | Ga0496103_0052104 | Ga0496103_0052104_1134_2354 | 384 |
| 684 | 3300048907 | Ga0496104_0032787 | Ga0496104_0032787_150_1379 | 384 |
| 685 | 3300048907 | Ga0496104_0176118 | Ga0496104_0176118_696_1916 | 384 |
| 686 | 3300048908 | Ga0496105_0013023 | Ga0496105_0013023_4940_6169 | 384 |
| 687 | 3300048910 | Ga0496107_0040038 | Ga0496107_0040038_1841_3043 | 384 |
| 688 | 3300048911 | Ga0496108_0011376 | Ga0496108_0011376_2557_3786 | 384 |
| 689 | 3300048912 | Ga0496109_0039196 | Ga0496109_0039196_2055_3284 | 384 |
| 690 | 3300048914 | Ga0496111_0012250 | Ga0496111_0012250_3918_5138 | 384 |
| 691 | 3300048914 | Ga0496111_0073581 | Ga0496111_0073581_66_1295 | 384 |
| 692 | 3300048917 | Ga0496114_0011531 | Ga0496114_0011531_5366_6580 | 384 |
| 693 | 3300048920 | Ga0496117_0000430 | Ga0496117_0000430_15055_16257 | 384 |
| 694 | 3300048921 | Ga0496118_0000165 | Ga0496118_0000165_54552_55754 | 384 |
| 695 | 3300048924 | Ga0496121_0001920 | Ga0496121_0001920_22956_24158 | 384 |
| 696 | 3300048929 | Ga0496126_0000807 | Ga0496126_0000807_49326_50528 | 384 |
| 697 | 3300049569 | Ga0501032_0021656 | Ga0501032_0021656_2928_4118 | 384 |
| 698 | 3300049571 | Ga0501034_0006280 | Ga0501034_0006280_4098_5297 | 384 |
| 699 | 3300049571 | Ga0501034_0018107 | Ga0501034_0018107_3875_5065 | 384 |
| 700 | 3300049571 | Ga0501034_0101386 | Ga0501034_0101386_1160_2431 | 384 |
| 701 | 3300049572 | Ga0501036_0005010 | Ga0501036_0005010_1548_2747 | 384 |
| 702 | 3300049572 | Ga0501036_0030059 | Ga0501036_0030059_56_1246 | 384 |
| 703 | 3300049573 | Ga0501037_0146465 | Ga0501037_0146465_300_1490 | 384 |
| 704 | 3300049574 | Ga0501038_0007390 | Ga0501038_0007390_4344_5534 | 384 |
| 705 | 3300049574 | Ga0501038_0020374 | Ga0501038_0020374_2419_3618 | 384 |
| 706 | 3300049574 | Ga0501038_0051215 | Ga0501038_0051215_1741_3012 | 384 |
| 707 | 3300049575 | Ga0501039_0042197 | Ga0501039_0042197_1695_2894 | 384 |
| 708 | 3300049578 | Ga0501042_0012037 | Ga0501042_0012037_1359_2558 | 384 |
| 709 | 3300049578 | Ga0501042_0013605 | Ga0501042_0013605_3202_4416 | 384 |
| 710 | 3300049579 | Ga0501043_0006736 | Ga0501043_0006736_2374_3573 | 384 |
| 711 | 3300049579 | Ga0501043_0008776 | Ga0501043_0008776_200_1540 | 384 |
| 712 | 3300049579 | Ga0501043_0022918 | Ga0501043_0022918_394_1665 | 384 |
| 713 | 3300049581 | Ga0501047_0000036 | Ga0501047_0000036_190524_191738 | 384 |
| 714 | 3300049581 | Ga0501047_0149958 | Ga0501047_0149958_705_1976 | 384 |
| 715 | 3300049581 | Ga0501047_0240166 | Ga0501047_0240166_259_1458 | 384 |
| 716 | 3300049582 | Ga0501048_0014537 | Ga0501048_0014537_1244_2443 | 384 |
| 717 | 3300049590 | Ga0501074_0013224 | Ga0501074_0013224_799_1998 | 384 |
| 718 | 3300049822 | Ga0501035_0009695 | Ga0501035_0009695_5443_6633 | 384 |
| 719 | 3300049823 | Ga0501044_0123582 | Ga0501044_0123582_1151_2341 | 384 |
| 720 | 3300049823 | Ga0501044_0316755 | Ga0501044_0316755_149_1348 | 384 |
| 721 | 3300049824 | Ga0501045_0134898 | Ga0501045_0134898_254_1444 | 384 |
| 722 | 3300050512 | nmdc:mga0n895_311622_c1 | nmdc:mga0n895_311622_c1_82_1290 | 384 |
| 723 | 3300053084 | Ga0495595_0006578 | Ga0495595_0006578_2448_3653 | 384 |
| 724 | 3300053085 | Ga0495619_0020510 | Ga0495619_0020510_817_2112 | 384 |
| 725 | 3300053085 | Ga0495619_0051391 | Ga0495619_0051391_281_1486 | 384 |
| 726 | 3300053086 | Ga0500578_0008906 | Ga0500578_0008906_2001_3248 | 384 |
| 727 | 3300053099 | Ga0500654_016403 | Ga0500654_016403_752_1999 | 384 |
| 728 | 3300053129 | Ga0500628_002455 | Ga0500628_002455_1619_2866 | 384 |
| 729 | 3300053131 | Ga0500652_001499 | Ga0500652_001499_3826_5073 | 384 |
| 730 | 3300053134 | Ga0500658_0003539 | Ga0500658_0003539_2983_4230 | 384 |
| 731 | 3300053137 | Ga0500561_0000193 | Ga0500561_0000193_5448_6695 | 384 |
| 732 | 3300053140 | Ga0500573_0044559 | Ga0500573_0044559_924_2147 | 384 |
| 733 | 3300053140 | Ga0500573_0053749 | Ga0500573_0053749_357_1565 | 384 |
| 734 | 3300053143 | Ga0500579_059051 | Ga0500579_059051_135_1382 | 384 |
| 735 | 3300053149 | Ga0500600_0017781 | Ga0500600_0017781_1611_2858 | 384 |
| 736 | 3300053153 | Ga0500616_0014012 | Ga0500616_0014012_1559_2806 | 384 |
| 737 | 3300053153 | Ga0500616_0030361 | Ga0500616_0030361_352_1563 | 384 |
| 738 | 3300053732 | Ga0500656_000058 | Ga0500656_000058_4294_5541 | 384 |
| 739 | iso_pu_bacteria | 2643221714 | 2644626223 | 384 |
| 740 | iso_pu_bacteria | 2744054611 | 2744955509 | 384 |
| 741 | iso_pu_bacteria | 2818991472 | 2819746613 | 384 |
| 742 | 3300025302 | Ga0207426_1005429 | Ga0207426_10054293 | 385 |
| 743 | 3300044765 | Ga0466970_0012016 | Ga0466970_0012016_2563_3777 | 385 |
| 744 | 3300044765 | Ga0466970_0045069 | Ga0466970_0045069_1008_2219 | 385 |
| 745 | 3300044842 | Ga0466957_0010103 | Ga0466957_0010103_2651_3865 | 385 |
| 746 | 3300044901 | Ga0466960_0004305 | Ga0466960_0004305_1930_3144 | 385 |
| 747 | 3300045976 | Ga0466967_0077240 | Ga0466967_0077240_1680_2894 | 385 |
| 748 | iso_pu_bacteria | 2751185725 | 2753038906 | 385 |
| 749 | iso_pu_bacteria | 2751185792 | 2753327554 | 385 |
| 750 | iso_pu_bacteria | 2773857762 | 2774394573 | 385 |
| 751 | iso_pu_bacteria | 2811994878 | 2812349324 | 385 |
| 752 | iso_pu_bacteria | 2891968417 | 2891972973 | 385 |
| 753 | 3300002067 | JGI24735J21928_10013366 | JGI24735J21928_100133662 | 386 |
| 754 | 3300035091 | Ga0373951_0000001 | Ga0373951_0000001_43191_44399 | 386 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tlc-assembly1.cif.gz_C | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.8788 | 1 | 377 |
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.8656 | 1 | 379 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.865 | 1 | 380 |
| 5tlc-assembly1.cif.gz_A | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.8611 | 1 | 377 |
| 5xkd-assembly1.cif.gz_B | crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom | 0.8607 | 1 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b9oB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8649 | 1 | 375 | 3.20.20.30 |
| 6aslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8627 | 1 | 380 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8589 | 1 | 384 | 3.20.20.30 |
| 5w4zA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8569 | 1 | 374 | 3.20.20.30 |
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8567 | 1 | 377 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4MJE8-F1-model_v4 | Luciferase-like domain-containing protein | 0.9746 | 225 | 386 |
GO:0016705
|
| AF-A0A2N0EJI5-F1-model_v4 | deleted | 0.9739 | 1 | 386 |
|
| AF-A0A2N0EJI5-F1-model_v4 | deleted | 0.9714 | 1 | 386 |
|
| AF-A0A4D4KQ35-F1-model_v4 | Luciferase-like domain-containing protein | 0.9655 | 153 | 386 |
GO:0016705
|
| AF-D5SKF5-F1-model_v4 | Putative FMNH2-utilizing oxygenase | 0.9646 | 1 | 383 |
GO:0004497
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar