F479243

General Info

Members Datasets Scaffolds Average Seq Length
754 369 701 394

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100097254|Ga0070713_1000972542
Length 429
Sequence VSTPVERLPARLATPETELTVSAPTNPLHLAVALDGAGWHPAAWREPDAQPNRLFTPGYWVDLAQQAERGLLDFVTIEDGLDLQSDDRFRHDERTDRVRGRLDAVLIAARVAPATRRIGLIPTAVTTHTEPFHLSKAIATVDYASTGRAGVRVQIGGRADTAAHFGRREIGQLDAARYNEPEVQRQIAAHFDEAADYVEVLRRLWDSWEDDAEIRDVATGRFIDREKLHYIDFAGRWFAVKGPSITPRPPQGQPVVAALGHASVPYGLIASSADVGFVTPRDRSHAAEIVTEIRVAQEKAGRPDVHLFGDVVVFLDDSADLARARRQRMDERAGAEYTSDARIFTGTAAQLADLLLDLSEAGLTGFRLRPAALPHDLTQITDALVPELQRRSAFRAAYPDSASGGGWSATLRGLLGLPRPANRYSRDVA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2626541554 Frankia sp. AvcI.1 Isolate Nodule
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221692 Nocardia sp. Root136 Isolate Unclassified
6 2643221711 Terrabacter sp. Root85 Isolate Unclassified
7 2643221714 Streptomyces sp. Root264 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
10 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
11 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
12 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
13 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
14 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
15 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
16 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
17 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
18 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
19 2773857933 Frankia sp. BMG5.30 Isolate Nodule
20 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
21 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
22 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
23 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
24 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
25 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
26 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
27 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
28 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
29 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
30 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
31 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
32 2891562705 Microbispora tritici MT50 Isolate Unclassified
33 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
34 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
35 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
36 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
37 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
38 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
39 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
40 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
41 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
42 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
43 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
44 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
45 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
46 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
349 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
350 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
358 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
359 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
360 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
364 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
365 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
366 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
367 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
368 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
369 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.84
Metatranscriptomes 0.13
Isolates 7.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 6.76
Nodule 0.53
Rhizoplane 8.89
Rhizosphere 69.23
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10013366 3300002067 Bacteria 2583
2 rootH1_10108066 3300003316 Bacteria 1396
3 JGI25160J50197_1005722 3300003354 Bacteria 5133
4 Ga0006562J51391_1086760 3300003578 Bacteria 1700
5 Ga0055540_1000036 3300003792 Bacteria 164285
6 Ga0055540_1000710 3300003792 Bacteria 22736
7 Ga0055540_1000951 3300003792 Bacteria 18813
8 Ga0055540_1001570 3300003792 Bacteria 13325
9 Ga0065714_10006054 3300005288 Bacteria 4507
10 Ga0070658_10042920 3300005327 Bacteria 3653
11 Ga0070683_100028208 3300005329 Bacteria 5071
12 Ga0070683_100084928 3300005329 Bacteria 2966
13 Ga0070683_100171871 3300005329 Bacteria 2057
14 Ga0070683_100280320 3300005329 Bacteria 1585
15 Ga0070666_10011772 3300005335 Bacteria 5500
16 Ga0070682_100004731 3300005337 Bacteria 7564
17 Ga0070682_100027560 3300005337 Bacteria 3410
18 Ga0070682_100063083 3300005337 Bacteria 2348
19 Ga0068868_100008432 3300005338 Bacteria 7380
20 Ga0068868_100099272 3300005338 Bacteria 2355
21 Ga0068868_100254550 3300005338 Bacteria 1479
22 Ga0068868_100264652 3300005338 Bacteria 1451
23 Ga0070689_100015610 3300005340 Bacteria 5543
24 Ga0070689_100048702 3300005340 Bacteria 3269
25 Ga0070692_10010302 3300005345 Bacteria 4248
26 Ga0070668_100000347 3300005347 Bacteria 30543
27 Ga0070668_100012548 3300005347 Bacteria 6310
28 Ga0070668_100033452 3300005347 Bacteria 3915
29 Ga0070668_100095059 3300005347 Bacteria 2354
30 Ga0070668_100137698 3300005347 Bacteria 1965
31 Ga0070668_100153723 3300005347 Bacteria 1863
32 Ga0070669_100001706 3300005353 Bacteria 15898
33 Ga0070671_100001367 3300005355 Bacteria 18280
34 Ga0070688_100198379 3300005365 Bacteria 1403
35 Ga0070667_100000056 3300005367 Bacteria 150952
36 Ga0070667_100001523 3300005367 Bacteria 20742
37 Ga0070709_10073610 3300005434 Bacteria 2212
38 Ga0070714_100023229 3300005435 Bacteria 5091
39 Ga0070714_100155884 3300005435 Bacteria 2061
40 Ga0070714_100168788 3300005435 Bacteria 1985
41 Ga0070714_100205231 3300005435 Bacteria 1804
42 Ga0070713_100018089 3300005436 Bacteria 5352
43 Ga0070713_100097254 3300005436 Bacteria 2543
44 Ga0070713_100336854 3300005436 Bacteria 1397
45 Ga0070713_100354071 3300005436 Bacteria 1363
46 Ga0070710_10005431 3300005437 Bacteria 6053
47 Ga0070710_10011306 3300005437 Bacteria 4409
48 Ga0070710_10035164 3300005437 Bacteria 2730
49 Ga0070711_100204898 3300005439 Bacteria 1524
50 Ga0070711_100271176 3300005439 Bacteria 1339
51 Ga0070663_100006011 3300005455 Bacteria 7263
52 Ga0070663_100025352 3300005455 Bacteria 4002
53 Ga0070663_100279563 3300005455 Bacteria 1330
54 Ga0070662_100053940 3300005457 Bacteria 2912
55 Ga0070707_100040022 3300005468 Bacteria 4483
56 Ga0070697_100202792 3300005536 Bacteria 1686
57 Ga0068853_100032974 3300005539 Bacteria 4391
58 Ga0068853_100106781 3300005539 Bacteria 2482
59 Ga0070686_100047935 3300005544 Bacteria 2704
60 Ga0070665_100003950 3300005548 Bacteria 15646
61 Ga0070665_100005830 3300005548 Bacteria 12634
62 Ga0070665_100025431 3300005548 Bacteria 5965
63 Ga0070665_100083145 3300005548 Bacteria 3207
64 Ga0070665_100175099 3300005548 Bacteria 2146
65 Ga0070665_100244543 3300005548 Bacteria 1795
66 Ga0068855_100242562 3300005563 Bacteria 2013
67 Ga0070664_100013642 3300005564 Bacteria 6621
68 Ga0070664_100096882 3300005564 Bacteria 2560
69 Ga0070664_100249873 3300005564 Bacteria 1594
70 Ga0068857_100064410 3300005577 Bacteria 3259
71 Ga0068857_100176977 3300005577 Bacteria 1941
72 Ga0068856_100083313 3300005614 Bacteria 3175
73 Ga0068856_100191822 3300005614 Bacteria 2057
74 Ga0070702_100081959 3300005615 Bacteria 1934
75 Ga0068852_100030669 3300005616 Bacteria 4429
76 Ga0068859_100000751 3300005617 Bacteria 32654
77 Ga0068864_100020731 3300005618 Bacteria 5501
78 Ga0068864_100067107 3300005618 Bacteria 3114
79 Ga0068864_100196688 3300005618 Bacteria 1850
80 Ga0068870_10006476 3300005840 Bacteria 5164
81 Ga0068863_100003061 3300005841 Bacteria 16532
82 Ga0068863_100004393 3300005841 Bacteria 13902
83 Ga0068863_100058432 3300005841 Bacteria 3649
84 Ga0068863_100190384 3300005841 Bacteria 1971
85 Ga0068858_100021321 3300005842 Bacteria 6051
86 Ga0068858_100043454 3300005842 Bacteria 4166
87 Ga0068858_100063112 3300005842 Bacteria 3428
88 Ga0068858_100239850 3300005842 Bacteria 1720
89 Ga0068860_100000092 3300005843 Bacteria 150190
90 Ga0068860_100065619 3300005843 Bacteria 3447
91 Ga0068860_100099535 3300005843 Bacteria 2773
92 Ga0068862_100000035 3300005844 Bacteria 174953
93 Ga0068862_100009803 3300005844 Bacteria 7916
94 Ga0081455_10000090 3300005937 Bacteria 97813
95 Ga0081455_10002986 3300005937 Bacteria 19737
96 Ga0070717_10067102 3300006028 Bacteria 2984
97 Ga0070717_10200230 3300006028 Bacteria 1749
98 Ga0070717_10212387 3300006028 Bacteria 1699
99 Ga0075365_10004991 3300006038 Bacteria 7107
100 Ga0075365_10043575 3300006038 Bacteria 2937
101 Ga0075363_100008182 3300006048 Bacteria 4857
102 Ga0075364_10006220 3300006051 Bacteria 7002
103 Ga0075364_10055815 3300006051 Bacteria 2585
104 Ga0070712_100015368 3300006175 Bacteria 4928
105 Ga0075369_10004266 3300006186 Bacteria 5268
106 Ga0075369_10027494 3300006186 Bacteria 2378
107 Ga0097621_100133059 3300006237 Bacteria 2118
108 Ga0097621_100172750 3300006237 Bacteria 1864
109 Ga0075430_100173757 3300006846 Bacteria 1792
110 Ga0075434_100313343 3300006871 Bacteria 1589
111 Ga0097620_100000751 3300006931 Bacteria 32654
112 Ga0075435_100106709 3300007076 Bacteria 2326
113 Ga0105251_10030879 3300009011 Bacteria 2686
114 Ga0105245_10007000 3300009098 Bacteria 9894
115 Ga0105245_10020466 3300009098 Bacteria 5802
116 Ga0105247_10000062 3300009101 Bacteria 126437
117 Ga0105243_10040570 3300009148 Bacteria 3636
118 Ga0105243_10187234 3300009148 Bacteria 1805
119 Ga0105241_10000239 3300009174 Bacteria 41568
120 Ga0105248_10000036 3300009177 Bacteria 187421
121 Ga0105248_10192652 3300009177 Bacteria 2297
122 Ga0105248_10218510 3300009177 Bacteria 2146
123 Ga0105248_10322508 3300009177 Bacteria 1740
124 Ga0105237_10012977 3300009545 Bacteria 8748
125 Ga0105237_10052218 3300009545 Bacteria 4104
126 Ga0105237_10123088 3300009545 Bacteria 2588
127 Ga0105238_10043053 3300009551 Bacteria 4569
128 Ga0105238_10049757 3300009551 Bacteria 4220
129 Ga0105238_10101783 3300009551 Bacteria 2855
130 Ga0105249_10000046 3300009553 Bacteria 176363
131 Ga0105249_10024832 3300009553 Bacteria 5389
132 Ga0105239_10009798 3300010375 Bacteria 10764
133 Ga0105239_10063452 3300010375 Bacteria 4056
134 Ga0105239_10164326 3300010375 Bacteria 2481
135 Ga0157369_10091263 3300013105 Bacteria 3252
136 Ga0157369_10138995 3300013105 Bacteria 2571
137 Ga0157369_10222774 3300013105 Bacteria 1974
138 Ga0157374_10018011 3300013296 Bacteria 6228
139 Ga0157374_10103464 3300013296 Bacteria 2732
140 Ga0157372_10177069 3300013307 Bacteria 2469
141 Ga0157372_10277705 3300013307 Bacteria 1947
142 Ga0157375_10016532 3300013308 Bacteria 6633
143 Ga0157375_10150564 3300013308 Bacteria 2462
144 Ga0157375_10179549 3300013308 Bacteria 2268
145 Ga0163163_10030509 3300014325 Bacteria 5195
146 Ga0163163_10083421 3300014325 Bacteria 3201
147 Ga0157377_10026174 3300014745 Bacteria 3119
148 Ga0157377_10139477 3300014745 Bacteria 1489
149 Ga0157379_10007317 3300014968 Bacteria 9553
150 Ga0157379_10020562 3300014968 Bacteria 5839
151 Ga0157379_10098581 3300014968 Bacteria 2624
152 Ga0157379_10139072 3300014968 Bacteria 2189
153 Ga0213876_10001397 3300021384 Bacteria 15068
154 Ga0213875_10000235 3300021388 Bacteria 56070
155 Ga0213875_10000634 3300021388 Bacteria 28091
156 Ga0213875_10006833 3300021388 Bacteria 5955
157 Ga0213875_10011514 3300021388 Bacteria 4399
158 Ga0213875_10015450 3300021388 Bacteria 3714
159 Ga0213875_10051837 3300021388 Bacteria 1922
160 Ga0209455_1001859 3300025272 Bacteria 8827
161 Ga0209673_1014992 3300025273 Bacteria 2969
162 Ga0207426_1000920 3300025302 Bacteria 29413
163 Ga0207426_1005429 3300025302 Bacteria 5817
164 Ga0209051_1000021 3300025303 Bacteria 507633
165 Ga0209051_1000466 3300025303 Bacteria 53034
166 Ga0209051_1002017 3300025303 Bacteria 15468
167 Ga0209051_1057088 3300025303 Bacteria 1253
168 Ga0207710_10000060 3300025900 Bacteria 168230
169 Ga0207688_10002529 3300025901 Bacteria 9864
170 Ga0207688_10045250 3300025901 Bacteria 2455
171 Ga0207699_10035924 3300025906 Bacteria 2822
172 Ga0207699_10058887 3300025906 Bacteria 2300
173 Ga0207643_10027244 3300025908 Bacteria 3167
174 Ga0207705_10080049 3300025909 Bacteria 2380
175 Ga0207705_10096431 3300025909 Bacteria 2171
176 Ga0207654_10041372 3300025911 Bacteria 2602
177 Ga0207671_10000365 3300025914 Bacteria 64530
178 Ga0207671_10113842 3300025914 Bacteria 2061
179 Ga0207693_10030363 3300025915 Bacteria 4268
180 Ga0207662_10023219 3300025918 Bacteria 3562
181 Ga0207646_10065677 3300025922 Bacteria 3240
182 Ga0207681_10001181 3300025923 Bacteria 16820
183 Ga0207694_10001761 3300025924 Bacteria 18157
184 Ga0207694_10075529 3300025924 Bacteria 2638
185 Ga0207687_10012002 3300025927 Bacteria 5666
186 Ga0207687_10026927 3300025927 Bacteria 3854
187 Ga0207700_10063526 3300025928 Bacteria 2808
188 Ga0207664_10054885 3300025929 Bacteria 3159
189 Ga0207664_10077458 3300025929 Bacteria 2694
190 Ga0207664_10097014 3300025929 Bacteria 2428
191 Ga0207664_10323351 3300025929 Bacteria 1361
192 Ga0207644_10000916 3300025931 Bacteria 18706
193 Ga0207690_10127050 3300025932 Bacteria 1860
194 Ga0207706_10021851 3300025933 Bacteria 5744
195 Ga0207706_10121169 3300025933 Bacteria 2300
196 Ga0207670_10034083 3300025936 Bacteria 3286
197 Ga0207665_10008824 3300025939 Bacteria 6626
198 Ga0207665_10026153 3300025939 Bacteria 3851
199 Ga0207665_10040401 3300025939 Bacteria 3112
200 Ga0207691_10104049 3300025940 Bacteria 2531
201 Ga0207711_10000073 3300025941 Bacteria 107878
202 Ga0207711_10108029 3300025941 Bacteria 2471
203 Ga0207689_10006694 3300025942 Bacteria 10166
204 Ga0207689_10056012 3300025942 Bacteria 3244
205 Ga0207661_10114848 3300025944 Bacteria 2283
206 Ga0207661_10126342 3300025944 Bacteria 2185
207 Ga0207679_10029836 3300025945 Bacteria 3801
208 Ga0207679_10069586 3300025945 Bacteria 2649
209 Ga0207679_10141600 3300025945 Bacteria 1945
210 Ga0207651_10223183 3300025960 Bacteria 1525
211 Ga0207712_10000042 3300025961 Bacteria 176338
212 Ga0207668_10003758 3300025972 Bacteria 8942
213 Ga0207668_10012725 3300025972 Bacteria 5160
214 Ga0207668_10016784 3300025972 Bacteria 4577
215 Ga0207668_10036567 3300025972 Bacteria 3278
216 Ga0207658_10000611 3300025986 Bacteria 31714
217 Ga0207658_10000664 3300025986 Bacteria 30027
218 Ga0207677_10133668 3300026023 Bacteria 1888
219 Ga0207677_10243608 3300026023 Bacteria 1456
220 Ga0207703_10059827 3300026035 Bacteria 3113
221 Ga0207703_10126774 3300026035 Bacteria 2199
222 Ga0207639_10020125 3300026041 Bacteria 4775
223 Ga0207678_10000318 3300026067 Bacteria 43470
224 Ga0207678_10022477 3300026067 Bacteria 5523
225 Ga0207678_10029113 3300026067 Bacteria 4820
226 Ga0207678_10031395 3300026067 Bacteria 4634
227 Ga0207678_10076531 3300026067 Bacteria 2866
228 Ga0207678_10124428 3300026067 Bacteria 2200
229 Ga0207702_10095896 3300026078 Bacteria 2607
230 Ga0207702_10111872 3300026078 Bacteria 2429
231 Ga0207702_10155960 3300026078 Bacteria 2081
232 Ga0207641_10003278 3300026088 Bacteria 14399
233 Ga0207641_10003364 3300026088 Bacteria 14205
234 Ga0207641_10210600 3300026088 Bacteria 1797
235 Ga0207676_10082498 3300026095 Bacteria 2615
236 Ga0207676_10093470 3300026095 Bacteria 2476
237 Ga0207674_10008338 3300026116 Bacteria 11991
238 Ga0207674_10016576 3300026116 Bacteria 8058
239 Ga0207683_10063268 3300026121 Bacteria 3259
240 Ga0207683_10266922 3300026121 Bacteria 1563
241 Ga0207698_10021930 3300026142 Bacteria 4427
242 Ga0207698_10046169 3300026142 Bacteria 3287
243 Ga0207698_10221136 3300026142 Bacteria 1711
244 Ga0268266_10015163 3300028379 Bacteria 6617
245 Ga0268266_10027084 3300028379 Bacteria 4877
246 Ga0268266_10028517 3300028379 Bacteria 4744
247 Ga0268266_10061022 3300028379 Bacteria 3251
248 Ga0268266_10121114 3300028379 Bacteria 2329
249 Ga0268266_10206495 3300028379 Bacteria 1800
250 Ga0268265_10000051 3300028380 Bacteria 174968
251 Ga0268265_10011636 3300028380 Bacteria 5950
252 Ga0268264_10000108 3300028381 Bacteria 208791
253 Ga0268264_10004745 3300028381 Bacteria 11545
254 Ga0268264_10067008 3300028381 Bacteria 3029
255 Ga0268264_10111430 3300028381 Bacteria 2397
256 Ga0265337_1000404 3300028556 Bacteria 23232
257 Ga0265334_10007863 3300028573 Bacteria 4560
258 Ga0265336_10003483 3300028666 Bacteria 6157
259 Ga0265336_10009230 3300028666 Bacteria 3416
260 Ga0307517_10012361 3300028786 Bacteria 11727
261 Ga0307515_10036520 3300028794 Bacteria 7945
262 Ga0265338_10002127 3300028800 Bacteria 30414
263 Ga0265338_10003375 3300028800 Bacteria 22553
264 Ga0265338_10004287 3300028800 Bacteria 19361
265 Ga0265338_10065466 3300028800 Bacteria 3152
266 Ga0307511_10000191 3300030521 Bacteria 60992
267 Ga0307512_10010989 3300030522 Bacteria 8602
268 Ga0307512_10011774 3300030522 Bacteria 8271
269 Ga0307512_10110013 3300030522 Bacteria 1820
270 Ga0265332_10026063 3300031238 Bacteria 2565
271 Ga0265327_10000177 3300031251 Bacteria 136559
272 Ga0265316_10046074 3300031344 Bacteria 3457
273 Ga0307513_10000248 3300031456 Bacteria 78312
274 Ga0307513_10005780 3300031456 Bacteria 16269
275 Ga0307513_10060487 3300031456 Bacteria 4016
276 Ga0307508_10017127 3300031616 Bacteria 6590
277 Ga0307508_10219578 3300031616 Bacteria 1501
278 Ga0307514_10018424 3300031649 Bacteria 5724
279 Ga0307514_10051472 3300031649 Bacteria 3191
280 Ga0265314_10043522 3300031711 Bacteria 3191
281 Ga0265342_10040486 3300031712 Bacteria 2825
282 Ga0307516_10028531 3300031730 Bacteria 5647
283 Ga0307407_10095384 3300031903 Bacteria 1834
284 Ga0307416_100197060 3300032002 Bacteria 1906
285 Ga0307507_10020556 3300033179 Bacteria 7389
286 Ga0373926_0001427 3300035083 Bacteria 7259
287 Ga0373944_0000291 3300035089 Bacteria 11152
288 Ga0373949_0024732 3300035090 Bacteria 1398
289 Ga0373951_0000001 3300035091 Bacteria 119231
290 Ga0373923_0020939 3300035111 Bacteria 2547
291 Ga0373936_0000195 3300035113 Bacteria 20212
292 Ga0373936_0027486 3300035113 Bacteria 2231
293 Ga0373945_0000055 3300035116 Bacteria 24558
294 Ga0373945_0063736 3300035116 Bacteria 1380
295 Ga0373954_0014483 3300035118 Bacteria 3516
296 Ga0373956_0009965 3300035119 Bacteria 3876
297 Ga0373943_0000041 3300035170 Bacteria 43691
298 Ga0373943_0072571 3300035170 Bacteria 1746
299 Ga0373943_0110819 3300035170 Bacteria 1447
300 Ga0373946_0001009 3300035171 Bacteria 9657
301 Ga0373955_0005335 3300035172 Bacteria 5773
302 Ga0373924_0074223 3300035410 Bacteria 1438
303 Ga0373935_0000404 3300035692 Bacteria 22444
304 Ga0373935_0032787 3300035692 Bacteria 3229
305 Ga0373935_0089967 3300035692 Bacteria 2008
306 Ga0373927_0001129 3300035695 Bacteria 20211
307 Ga0373933_0021427 3300035724 Bacteria 3671
308 Ga0373933_0064036 3300035724 Bacteria 2223
309 Ga0373947_0000535 3300035725 Bacteria 22232
310 Ga0373937_0053708 3300036401 Bacteria 3695
311 Ga0373937_0102443 3300036401 Bacteria 2658
312 Ga0373925_0000592 3300037068 Bacteria 34869
313 Ga0373925_0004534 3300037068 Bacteria 10495
314 Ga0373925_0076296 3300037068 Bacteria 2541
315 Ga0373925_0253242 3300037068 Bacteria 1412
316 Ga0395900_0153964 3300037418 Bacteria 2349
317 Ga0395898_0025057 3300037466 Bacteria 6014
318 Ga0395898_0059610 3300037466 Bacteria 3712
319 Ga0436364_0256666 3300037853 Bacteria 3569
320 Ga0436364_0256931 3300037853 Bacteria 1575
321 Ga0436364_0282469 3300037853 Bacteria 49422
322 Ga0436364_0507746 3300037853 Bacteria 25113
323 Ga0436364_0633952 3300037853 Bacteria 26538
324 Ga0436364_0691418 3300037853 Bacteria 23018
325 Ga0436364_1009099 3300037853 Bacteria 3966
326 Ga0436364_1034848 3300037853 Bacteria 1922
327 Ga0395901_0018525 3300038443 Bacteria 7108
328 Ga0436365_0514921 3300039437 Bacteria 2737
329 Ga0436365_0931839 3300039437 Bacteria 121124
330 Ga0439461_0008187 3300041410 Bacteria 1868
331 Ga0439466_0012279 3300041411 Bacteria 3158
332 Ga0451807_1774657 3300041486 Bacteria 1807
333 Ga0451845_0999523 3300041501 Bacteria 1311
334 Ga0439431_0001647 3300041997 Bacteria 4936
335 Ga0439445_0005083 3300042004 Bacteria 2989
336 Ga0450903_004971 3300042138 Bacteria 2240
337 Ga0439434_0022683 3300042435 Bacteria 1887
338 Ga0466969_0005780 3300044656 Bacteria 6572
339 Ga0466969_0066241 3300044656 Bacteria 1744
340 Ga0466972_0004530 3300044658 Bacteria 6957
341 Ga0466965_0001210 3300044683 Bacteria 10199
342 Ga0466965_0006039 3300044683 Bacteria 5473
343 Ga0466965_0037292 3300044683 Bacteria 2387
344 Ga0466965_0094844 3300044683 Bacteria 1521
345 Ga0466966_0007160 3300044684 Bacteria 7392
346 Ga0466966_0116310 3300044684 Bacteria 1646
347 Ga0466961_0016771 3300044693 Bacteria 4708
348 Ga0466961_0141162 3300044693 Bacteria 1508
349 Ga0466963_0149218 3300044694 Bacteria 1623
350 Ga0466971_0011830 3300044719 Bacteria 3823
351 Ga0466971_0021849 3300044719 Bacteria 2848
352 Ga0466971_0052020 3300044719 Bacteria 1845
353 Ga0466970_0012016 3300044765 Bacteria 4421
354 Ga0466970_0016852 3300044765 Bacteria 3772
355 Ga0466970_0018071 3300044765 Bacteria 3650
356 Ga0466970_0045069 3300044765 Bacteria 2348
357 Ga0466970_0061415 3300044765 Bacteria 2013
358 Ga0466957_0010103 3300044842 Bacteria 5403
359 Ga0466960_0000354 3300044901 Bacteria 15670
360 Ga0466960_0004305 3300044901 Bacteria 5549
361 Ga0466960_0056896 3300044901 Bacteria 1905
362 Ga0466960_0106329 3300044901 Bacteria 1451
363 Ga0466959_0001342 3300045049 Bacteria 14996
364 Ga0466959_0005746 3300045049 Bacteria 8533
365 Ga0466959_0005769 3300045049 Bacteria 8523
366 Ga0466959_0029424 3300045049 Bacteria 4069
367 Ga0466958_0049375 3300045836 Bacteria 2545
368 Ga0466967_0003959 3300045976 Bacteria 9856
369 Ga0466967_0011767 3300045976 Bacteria 6652
370 Ga0466967_0056906 3300045976 Bacteria 3450
371 Ga0466967_0062679 3300045976 Bacteria 3301
372 Ga0466967_0077240 3300045976 Bacteria 2997
373 Ga0466967_0117346 3300045976 Bacteria 2453
374 Ga0466967_0179104 3300045976 Bacteria 1998
375 Ga0466967_0219203 3300045976 Bacteria 1807
376 Ga0495592_0000533 3300046454 Bacteria 27280
377 Ga0495592_0022151 3300046454 Bacteria 4834
378 Ga0495592_0044771 3300046454 Bacteria 3305
379 Ga0495592_0061583 3300046454 Bacteria 2757
380 Ga0495603_0028858 3300046455 Bacteria 3347
381 Ga0495629_0019402 3300046459 Bacteria 4857
382 Ga0495629_0033843 3300046459 Bacteria 3614
383 Ga0495629_0108593 3300046459 Bacteria 1935
384 Ga0495638_0000563 3300046460 Bacteria 42248
385 Ga0495638_0003192 3300046460 Bacteria 12956
386 Ga0495638_0016872 3300046460 Bacteria 4883
387 Ga0495641_0017895 3300046461 Bacteria 3673
388 Ga0495641_0019964 3300046461 Bacteria 3414
389 Ga0495641_0064723 3300046461 Bacteria 1646
390 Ga0495651_0000122 3300046462 Bacteria 57344
391 Ga0495651_0009308 3300046462 Bacteria 7538
392 Ga0495651_0012823 3300046462 Bacteria 6472
393 Ga0495653_0001396 3300046463 Bacteria 18786
394 Ga0495653_0016189 3300046463 Bacteria 6074
395 Ga0495582_0003116 3300046473 Bacteria 9297
396 Ga0495582_0112530 3300046473 Bacteria 1529
397 Ga0495662_0000937 3300046476 Bacteria 14286
398 Ga0495662_0030153 3300046476 Bacteria 2618
399 Ga0495664_0000524 3300046477 Bacteria 19225
400 Ga0495664_0002583 3300046477 Bacteria 9740
401 Ga0495664_0033208 3300046477 Bacteria 3032
402 Ga0495664_0133968 3300046477 Bacteria 1501
403 Ga0495585_0069283 3300046492 Bacteria 1925
404 Ga0495608_0001351 3300046511 Bacteria 17478
405 Ga0495610_0089467 3300046512 Bacteria 1398
406 Ga0495616_0026004 3300046513 Bacteria 3120
407 Ga0495618_0038890 3300046514 Bacteria 2990
408 Ga0495620_0016695 3300046515 Bacteria 3677
409 Ga0495628_0004846 3300046516 Bacteria 11839
410 Ga0495628_0040917 3300046516 Bacteria 3700
411 Ga0495630_0022340 3300046517 Bacteria 4671
412 Ga0495631_0008239 3300046518 Bacteria 5254
413 Ga0495648_0028691 3300046524 Bacteria 3702
414 Ga0495648_0112331 3300046524 Bacteria 1480
415 Ga0495666_0000566 3300046526 Bacteria 16543
416 Ga0495666_0069062 3300046526 Bacteria 1681
417 Ga0495666_0107626 3300046526 Bacteria 1311
418 Ga0495652_0000719 3300046529 Bacteria 38479
419 Ga0495652_0027316 3300046529 Bacteria 5029
420 Ga0495652_0031218 3300046529 Bacteria 4667
421 Ga0495652_0136573 3300046529 Bacteria 1934
422 Ga0495654_0038015 3300046530 Bacteria 2409
423 Ga0495665_0005751 3300046531 Bacteria 6692
424 Ga0495665_0020537 3300046531 Bacteria 3546
425 Ga0495640_0104594 3300046533 Bacteria 1855
426 Ga0495640_0152436 3300046533 Bacteria 1484
427 Ga0495587_0003107 3300046536 Bacteria 11100
428 Ga0495587_0014543 3300046536 Bacteria 4933
429 Ga0495587_0132275 3300046536 Bacteria 1426
430 Ga0495609_0013107 3300046538 Bacteria 3920
431 Ga0495645_0005319 3300046543 Bacteria 8817
432 Ga0495667_0004249 3300046559 Bacteria 9651
433 Ga0495667_0053430 3300046559 Bacteria 2660
434 Ga0495667_0232827 3300046559 Bacteria 1174
435 Ga0495668_0114260 3300046616 Bacteria 1476
436 Ga0495634_0030978 3300046642 Bacteria 3687
437 Ga0495625_0119662 3300046660 Bacteria 1793
438 Ga0495635_0000353 3300046663 Bacteria 29160
439 Ga0495635_0106007 3300046663 Bacteria 1920
440 Ga0495661_0031457 3300046665 Bacteria 3367
441 Ga0495588_0019465 3300046674 Bacteria 3324
442 Ga0495657_0005834 3300046675 Bacteria 9691
443 Ga0495657_0016427 3300046675 Bacteria 5394
444 Ga0495657_0023808 3300046675 Bacteria 4371
445 Ga0495657_0026610 3300046675 Bacteria 4094
446 Ga0495657_0102330 3300046675 Bacteria 1823
447 Ga0495599_0004312 3300046678 Bacteria 8415
448 Ga0495599_0011835 3300046678 Bacteria 5364
449 Ga0495623_0070073 3300046679 Bacteria 2184
450 Ga0495646_0085505 3300046680 Bacteria 1830
451 Ga0495613_0005276 3300046689 Bacteria 9706
452 Ga0495624_0001681 3300046690 Bacteria 16953
453 Ga0495670_0002891 3300046691 Bacteria 8465
454 Ga0495589_0033338 3300046794 Bacteria 2587
455 Ga0495589_0046187 3300046794 Bacteria 2162
456 Ga0495600_0010944 3300046809 Bacteria 5643
457 Ga0495600_0071881 3300046809 Bacteria 2260
458 Ga0495660_0043997 3300046810 Bacteria 2458
459 Ga0495660_0092770 3300046810 Bacteria 1566
460 Ga0495581_0010688 3300047315 Bacteria 5308
461 Ga0495581_0086198 3300047315 Bacteria 1821
462 Ga0495604_0003940 3300047317 Bacteria 11818
463 Ga0495636_0051845 3300047318 Bacteria 1720
464 Ga0495674_0002196 3300047319 Bacteria 19187
465 Ga0495674_0013653 3300047319 Bacteria 7632
466 Ga0495672_0006161 3300047320 Bacteria 9354
467 Ga0495676_0047009 3300047321 Bacteria 3495
468 Ga0495680_0008327 3300047322 Bacteria 9434
469 Ga0495680_0024787 3300047322 Bacteria 4970
470 Ga0495680_0042489 3300047322 Bacteria 3606
471 Ga0495683_0086602 3300047323 Bacteria 1522
472 Ga0495687_002365 3300047443 Bacteria 15262
473 Ga0495687_011320 3300047443 Bacteria 4809
474 Ga0495687_019284 3300047443 Bacteria 3352
475 Ga0495687_027845 3300047443 Bacteria 2638
476 Ga0495685_000392 3300047447 Bacteria 13913
477 Ga0495685_008655 3300047447 Bacteria 3385
478 Ga0495673_0016923 3300047469 Bacteria 3716
479 Ga0495681_0002275 3300047470 Bacteria 13803
480 Ga0495684_0001427 3300047471 Bacteria 19151
481 Ga0495686_0003209 3300047472 Bacteria 14397
482 Ga0495593_0004801 3300047673 Bacteria 8020
483 Ga0495593_0039521 3300047673 Bacteria 2543
484 Ga0495593_0068950 3300047673 Bacteria 1840
485 Ga0495602_0019844 3300048088 Bacteria 6659
486 Ga0495602_0067885 3300048088 Bacteria 3065
487 Ga0495602_0204549 3300048088 Bacteria 1503
488 Ga0496100_0000011 3300048903 Bacteria 190969
489 Ga0496100_0002517 3300048903 Bacteria 9332
490 Ga0496100_0011912 3300048903 Bacteria 4966
491 Ga0496100_0038132 3300048903 Bacteria 3043
492 Ga0496101_0000011 3300048904 Bacteria 272153
493 Ga0496101_0000017 3300048904 Bacteria 239153
494 Ga0496101_0033560 3300048904 Bacteria 3620
495 Ga0496101_0048830 3300048904 Bacteria 3042
496 Ga0496101_0166707 3300048904 Bacteria 1691
497 Ga0496102_0000012 3300048905 Bacteria 315470
498 Ga0496102_0000089 3300048905 Bacteria 128594
499 Ga0496102_0000390 3300048905 Bacteria 51759
500 Ga0496102_0003154 3300048905 Bacteria 13980
501 Ga0496102_0034561 3300048905 Bacteria 4546
502 Ga0496102_0100401 3300048905 Bacteria 2688
503 Ga0496103_0000005 3300048906 Bacteria 505416
504 Ga0496103_0000065 3300048906 Bacteria 128496
505 Ga0496103_0000388 3300048906 Bacteria 39328
506 Ga0496103_0001526 3300048906 Bacteria 15464
507 Ga0496103_0010622 3300048906 Bacteria 5448
508 Ga0496103_0052104 3300048906 Bacteria 2534
509 Ga0496104_0001045 3300048907 Bacteria 23660
510 Ga0496104_0032787 3300048907 Bacteria 4835
511 Ga0496104_0093862 3300048907 Bacteria 2870
512 Ga0496104_0176118 3300048907 Bacteria 2049
513 Ga0496104_0256180 3300048907 Bacteria 1662
514 Ga0496105_0010160 3300048908 Bacteria 7396
515 Ga0496105_0012641 3300048908 Bacteria 6685
516 Ga0496105_0013023 3300048908 Bacteria 6590
517 Ga0496106_0001106 3300048909 Bacteria 19947
518 Ga0496106_0003523 3300048909 Bacteria 11667
519 Ga0496106_0024279 3300048909 Bacteria 4506
520 Ga0496107_0000139 3300048910 Bacteria 35977
521 Ga0496107_0022520 3300048910 Bacteria 4452
522 Ga0496107_0040038 3300048910 Bacteria 3363
523 Ga0496107_0154267 3300048910 Bacteria 1700
524 Ga0496108_0000075 3300048911 Bacteria 105616
525 Ga0496108_0011376 3300048911 Bacteria 7232
526 Ga0496108_0036415 3300048911 Bacteria 4094
527 Ga0496108_0076901 3300048911 Bacteria 2822
528 Ga0496108_0116875 3300048911 Bacteria 2285
529 Ga0496108_0207570 3300048911 Bacteria 1700
530 Ga0496108_0292952 3300048911 Bacteria 1417
531 Ga0496109_0000041 3300048912 Bacteria 141346
532 Ga0496109_0018148 3300048912 Bacteria 6178
533 Ga0496109_0039196 3300048912 Bacteria 4287
534 Ga0496109_0101402 3300048912 Bacteria 2671
535 Ga0496110_0012986 3300048913 Bacteria 6869
536 Ga0496110_0014998 3300048913 Bacteria 6444
537 Ga0496110_0180121 3300048913 Bacteria 1919
538 Ga0496110_0259339 3300048913 Bacteria 1582
539 Ga0496111_0000841 3300048914 Bacteria 16565
540 Ga0496111_0012250 3300048914 Bacteria 5801
541 Ga0496111_0073581 3300048914 Bacteria 2488
542 Ga0496111_0172915 3300048914 Bacteria 1605
543 Ga0496112_0021619 3300048915 Bacteria 6119
544 Ga0496112_0058297 3300048915 Bacteria 3802
545 Ga0496113_0053253 3300048916 Bacteria 3025
546 Ga0496113_0103495 3300048916 Bacteria 2208
547 Ga0496114_0001890 3300048917 Bacteria 15902
548 Ga0496114_0003226 3300048917 Bacteria 12505
549 Ga0496114_0010589 3300048917 Bacteria 7337
550 Ga0496114_0011531 3300048917 Bacteria 7063
551 Ga0496114_0013230 3300048917 Bacteria 6615
552 Ga0496115_0015617 3300048918 Bacteria 5764
553 Ga0496115_0347387 3300048918 Bacteria 1210
554 Ga0496116_0000050 3300048919 Bacteria 311670
555 Ga0496116_0000208 3300048919 Bacteria 111165
556 Ga0496116_0002861 3300048919 Bacteria 17688
557 Ga0496117_0000042 3300048920 Bacteria 315470
558 Ga0496117_0000191 3300048920 Bacteria 124489
559 Ga0496117_0000430 3300048920 Bacteria 70406
560 Ga0496117_0031727 3300048920 Bacteria 4029
561 Ga0496117_0054303 3300048920 Bacteria 2807
562 Ga0496118_0000029 3300048921 Bacteria 340978
563 Ga0496118_0000037 3300048921 Bacteria 315470
564 Ga0496118_0000165 3300048921 Bacteria 119376
565 Ga0496118_0002013 3300048921 Bacteria 28760
566 Ga0496119_0000181 3300048922 Bacteria 88025
567 Ga0496119_0000539 3300048922 Bacteria 51578
568 Ga0496119_0000634 3300048922 Bacteria 47422
569 Ga0496119_0045876 3300048922 Bacteria 2735
570 Ga0496119_0087609 3300048922 Bacteria 1777
571 Ga0496120_0000121 3300048923 Bacteria 131612
572 Ga0496120_0013827 3300048923 Bacteria 5409
573 Ga0496120_0019535 3300048923 Bacteria 4331
574 Ga0496120_0039049 3300048923 Bacteria 2805
575 Ga0496121_0000014 3300048924 Bacteria 609379
576 Ga0496121_0000250 3300048924 Bacteria 114145
577 Ga0496121_0001920 3300048924 Bacteria 33194
578 Ga0496121_0009581 3300048924 Bacteria 11094
579 Ga0496122_0000084 3300048925 Bacteria 208740
580 Ga0496122_0012560 3300048925 Bacteria 8410
581 Ga0496123_0001922 3300048926 Bacteria 27126
582 Ga0496124_0000019 3300048927 Bacteria 436995
583 Ga0496124_0070236 3300048927 Bacteria 2905
584 Ga0496124_0206152 3300048927 Bacteria 1491
585 Ga0496125_0000014 3300048928 Bacteria 610124
586 Ga0496125_0015484 3300048928 Bacteria 7371
587 Ga0496125_0081930 3300048928 Bacteria 2462
588 Ga0496126_0000017 3300048929 Bacteria 610676
589 Ga0496126_0000090 3300048929 Bacteria 210538
590 Ga0496126_0000317 3300048929 Bacteria 102866
591 Ga0496126_0000807 3300048929 Bacteria 56090
592 Ga0496126_0002505 3300048929 Bacteria 24639
593 Ga0496126_0023449 3300048929 Bacteria 5980
594 Ga0496126_0034019 3300048929 Bacteria 4791
595 Ga0496126_0113046 3300048929 Bacteria 2364
596 Ga0501032_0001282 3300049569 Bacteria 20142
597 Ga0501032_0011027 3300049569 Bacteria 6497
598 Ga0501032_0021656 3300049569 Bacteria 4467
599 Ga0501033_0008524 3300049570 Bacteria 7932
600 Ga0501033_0016575 3300049570 Bacteria 5575
601 Ga0501034_0006280 3300049571 Bacteria 12789
602 Ga0501034_0014524 3300049571 Bacteria 8108
603 Ga0501034_0018107 3300049571 Bacteria 7229
604 Ga0501034_0045164 3300049571 Bacteria 4452
605 Ga0501034_0052324 3300049571 Bacteria 4114
606 Ga0501034_0101386 3300049571 Bacteria 2872
607 Ga0501034_0170809 3300049571 Bacteria 2141
608 Ga0501036_0003289 3300049572 Bacteria 12889
609 Ga0501036_0003690 3300049572 Bacteria 12262
610 Ga0501036_0005010 3300049572 Bacteria 10721
611 Ga0501036_0030059 3300049572 Bacteria 4589
612 Ga0501036_0032699 3300049572 Bacteria 4397
613 Ga0501036_0101468 3300049572 Bacteria 2434
614 Ga0501036_0168700 3300049572 Bacteria 1844
615 Ga0501037_0000475 3300049573 Bacteria 32426
616 Ga0501037_0146465 3300049573 Bacteria 1689
617 Ga0501038_0000993 3300049574 Bacteria 25525
618 Ga0501038_0007390 3300049574 Bacteria 10134
619 Ga0501038_0014975 3300049574 Bacteria 7062
620 Ga0501038_0020374 3300049574 Bacteria 5962
621 Ga0501038_0039094 3300049574 Bacteria 4151
622 Ga0501038_0051215 3300049574 Bacteria 3565
623 Ga0501039_0000450 3300049575 Bacteria 29852
624 Ga0501039_0014528 3300049575 Bacteria 6028
625 Ga0501039_0042197 3300049575 Bacteria 3525
626 Ga0501039_0076713 3300049575 Bacteria 2598
627 Ga0501042_0012037 3300049578 Bacteria 5851
628 Ga0501042_0013605 3300049578 Bacteria 5541
629 Ga0501043_0000358 3300049579 Bacteria 41459
630 Ga0501043_0001171 3300049579 Bacteria 23059
631 Ga0501043_0006736 3300049579 Bacteria 9171
632 Ga0501043_0008776 3300049579 Bacteria 7960
633 Ga0501043_0022918 3300049579 Bacteria 4896
634 Ga0501047_0000036 3300049581 Bacteria 195504
635 Ga0501047_0006080 3300049581 Bacteria 11346
636 Ga0501047_0017843 3300049581 Bacteria 6798
637 Ga0501047_0058299 3300049581 Bacteria 3730
638 Ga0501047_0102471 3300049581 Bacteria 2742
639 Ga0501047_0149958 3300049581 Bacteria 2208
640 Ga0501047_0219591 3300049581 Bacteria 1757
641 Ga0501047_0240166 3300049581 Bacteria 1662
642 Ga0501048_0014537 3300049582 Bacteria 5825
643 Ga0501070_0000136 3300049586 Bacteria 66212
644 Ga0501070_0001563 3300049586 Bacteria 20351
645 Ga0501070_0002257 3300049586 Bacteria 16940
646 Ga0501070_0028862 3300049586 Bacteria 4651
647 Ga0501074_0009064 3300049590 Bacteria 7226
648 Ga0501074_0013224 3300049590 Bacteria 6001
649 Ga0501035_0005197 3300049822 Bacteria 12315
650 Ga0501035_0009695 3300049822 Bacteria 8957
651 Ga0501035_0013357 3300049822 Bacteria 7580
652 Ga0501035_0026526 3300049822 Bacteria 5300
653 Ga0501035_0079284 3300049822 Bacteria 2901
654 Ga0501044_0019751 3300049823 Bacteria 7198
655 Ga0501044_0038044 3300049823 Bacteria 5024
656 Ga0501044_0039319 3300049823 Bacteria 4935
657 Ga0501044_0054980 3300049823 Bacteria 4090
658 Ga0501044_0123582 3300049823 Bacteria 2586
659 Ga0501044_0160161 3300049823 Bacteria 2228
660 Ga0501044_0227744 3300049823 Bacteria 1813
661 Ga0501044_0316755 3300049823 Bacteria 1485
662 Ga0501045_0134898 3300049824 Bacteria 1835
663 Ga0501045_0218570 3300049824 Bacteria 1419
664 nmdc:mga03n38_65661_c1 3300050490 Bacteria 1664
665 nmdc:mga00v17_851_c1 3300050491 Bacteria 16535
666 nmdc:mga0yw44_595_c1 3300050492 Bacteria 11915
667 nmdc:mga0qj67_196701_c1 3300050509 Bacteria 1638
668 nmdc:mga0qj67_247246_c1 3300050509 Bacteria 1447
669 nmdc:mga0n895_311622_c1 3300050512 Bacteria 1595
670 nmdc:mga0sz30_31343_c1 3300050516 Bacteria 2199
671 Ga0500635_0009368 3300053080 Bacteria 2718
672 Ga0495655_0011334 3300053083 Bacteria 1789
673 Ga0495595_0006578 3300053084 Bacteria 4744
674 Ga0495619_0020510 3300053085 Bacteria 4211
675 Ga0495619_0051391 3300053085 Bacteria 2723
676 Ga0500578_0008906 3300053086 Bacteria 6540
677 Ga0500643_003250 3300053087 Bacteria 7917
678 Ga0500643_015982 3300053087 Bacteria 2559
679 Ga0500566_0042913 3300053094 Bacteria 2607
680 Ga0500641_0043924 3300053096 Bacteria 1816
681 Ga0500654_016403 3300053099 Bacteria 4864
682 Ga0500562_001428 3300053108 Bacteria 5876
683 Ga0500594_0009004 3300053118 Bacteria 2288
684 Ga0500628_002455 3300053129 Bacteria 3064
685 Ga0500652_000656 3300053131 Bacteria 11779
686 Ga0500652_001499 3300053131 Bacteria 7177
687 Ga0500658_0003539 3300053134 Bacteria 5895
688 Ga0500559_0009433 3300053136 Bacteria 4224
689 Ga0500561_0000193 3300053137 Bacteria 11059
690 Ga0500573_0044559 3300053140 Bacteria 2559
691 Ga0500573_0053749 3300053140 Bacteria 2314
692 Ga0500579_059051 3300053143 Bacteria 2291
693 Ga0500600_0017781 3300053149 Bacteria 4294
694 Ga0500616_0000081 3300053153 Bacteria 199653
695 Ga0500616_0000822 3300053153 Bacteria 35169
696 Ga0500616_0008951 3300053153 Bacteria 6136
697 Ga0500616_0014012 3300053153 Bacteria 4623
698 Ga0500616_0030361 3300053153 Bacteria 2968
699 Ga0500645_000031 3300053730 Bacteria 119643
700 Ga0500645_015782 3300053730 Bacteria 2388
701 Ga0500656_000058 3300053732 Bacteria 6360

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10043053 Ga0105238_100430535 323
2 3300044765 Ga0466970_0061415 Ga0466970_0061415_579_1574 325
3 3300044693 Ga0466961_0016771 Ga0466961_0016771_2022_3086 331
4 3300045049 Ga0466959_0005769 Ga0466959_0005769_262_1326 331
5 3300006846 Ga0075430_100173757 Ga0075430_1001737572 335
6 3300050509 nmdc:mga0qj67_196701_c1 nmdc:mga0qj67_196701_c1_428_1543 335
7 3300048911 Ga0496108_0116875 Ga0496108_0116875_1142_2272 343
8 3300003316 rootH1_10108066 rootH1_101080662 344
9 3300042004 Ga0439445_0005083 Ga0439445_0005083_68_1201 344
10 3300042435 Ga0439434_0022683 Ga0439434_0022683_658_1791 344
11 3300030521 Ga0307511_10000191 Ga0307511_1000019142 347
12 iso_pu_bacteria 2558860280 2559432802 347
13 3300050492 nmdc:mga0yw44_595_c1 nmdc:mga0yw44_595_c1_2393_3481 348
14 3300006186 Ga0075369_10027494 Ga0075369_100274942 349
15 3300044901 Ga0466960_0106329 Ga0466960_0106329_20_1093 349
16 3300049823 Ga0501044_0054980 Ga0501044_0054980_1473_2654 350
17 3300005329 Ga0070683_100171871 Ga0070683_1001718711 352
18 3300005337 Ga0070682_100027560 Ga0070682_1000275602 352
19 3300005338 Ga0068868_100264652 Ga0068868_1002646522 352
20 3300005455 Ga0070663_100025352 Ga0070663_1000253522 352
21 3300005564 Ga0070664_100249873 Ga0070664_1002498732 352
22 3300006048 Ga0075363_100008182 Ga0075363_1000081824 352
23 3300009177 Ga0105248_10322508 Ga0105248_103225082 352
24 3300025932 Ga0207690_10127050 Ga0207690_101270502 352
25 3300025945 Ga0207679_10141600 Ga0207679_101416002 352
26 3300026023 Ga0207677_10243608 Ga0207677_102436082 352
27 3300045976 Ga0466967_0219203 Ga0466967_0219203_58_1146 352
28 3300046459 Ga0495629_0033843 Ga0495629_0033843_1942_3030 352
29 3300046461 Ga0495641_0019964 Ga0495641_0019964_1150_2238 352
30 3300047319 Ga0495674_0013653 Ga0495674_0013653_6182_7270 352
31 3300047323 Ga0495683_0086602 Ga0495683_0086602_12_1139 352
32 3300047443 Ga0495687_027845 Ga0495687_027845_126_1253 352
33 3300047673 Ga0495593_0039521 Ga0495593_0039521_577_1665 352
34 3300048910 Ga0496107_0154267 Ga0496107_0154267_519_1607 352
35 3300048911 Ga0496108_0036415 Ga0496108_0036415_2300_3385 352
36 3300048912 Ga0496109_0018148 Ga0496109_0018148_1984_3069 352
37 3300048915 Ga0496112_0021619 Ga0496112_0021619_955_2040 352
38 3300048916 Ga0496113_0103495 Ga0496113_0103495_559_1644 352
39 3300053083 Ga0495655_0011334 Ga0495655_0011334_657_1742 352
40 3300046460 Ga0495638_0003192 Ga0495638_0003192_3119_4222 353
41 3300053087 Ga0500643_015982 Ga0500643_015982_743_1846 353
42 3300053730 Ga0500645_000031 Ga0500645_000031_2850_3953 353
43 3300053730 Ga0500645_015782 Ga0500645_015782_128_1231 353
44 iso_pu_bacteria 2738541274 2738702548 353
45 iso_pu_bacteria 2738543028 2739329457 353
46 3300003578 Ga0006562J51391_1086760 Ga0006562J51391_10867602 354
47 3300048929 Ga0496126_0034019 Ga0496126_0034019_2218_3315 354
48 3300049822 Ga0501035_0026526 Ga0501035_0026526_1651_2853 354
49 3300048918 Ga0496115_0347387 Ga0496115_0347387_32_1198 356
50 iso_pu_bacteria 2917736166 2917737999 356
51 3300035724 Ga0373933_0064036 Ga0373933_0064036_10_1116 357
52 3300046559 Ga0495667_0232827 Ga0495667_0232827_43_1149 357
53 3300053153 Ga0500616_0008951 Ga0500616_0008951_2418_3527 357
54 iso_pu_bacteria 2775506925 2776374634 357
55 3300030522 Ga0307512_10011774 Ga0307512_100117744 358
56 3300044694 Ga0466963_0149218 Ga0466963_0149218_216_1331 358
57 3300045976 Ga0466967_0062679 Ga0466967_0062679_345_1460 358
58 3300046459 Ga0495629_0019402 Ga0495629_0019402_3297_4544 358
59 3300048912 Ga0496109_0101402 Ga0496109_0101402_1087_2217 358
60 3300053094 Ga0500566_0042913 Ga0500566_0042913_1159_2406 358
61 3300033179 Ga0307507_10020556 Ga0307507_100205562 359
62 3300048903 Ga0496100_0000011 Ga0496100_0000011_37691_38830 359
63 3300048904 Ga0496101_0000017 Ga0496101_0000017_139820_140959 359
64 3300048909 Ga0496106_0001106 Ga0496106_0001106_12394_13533 359
65 3300048910 Ga0496107_0000139 Ga0496107_0000139_30947_32086 359
66 3300048912 Ga0496109_0000041 Ga0496109_0000041_59509_60648 359
67 3300048913 Ga0496110_0012986 Ga0496110_0012986_2205_3344 359
68 3300048914 Ga0496111_0000841 Ga0496111_0000841_6530_7669 359
69 3300048917 Ga0496114_0001890 Ga0496114_0001890_13741_14880 359
70 3300048919 Ga0496116_0002861 Ga0496116_0002861_13024_14163 359
71 3300048923 Ga0496120_0013827 Ga0496120_0013827_1957_3096 359
72 3300048924 Ga0496121_0000014 Ga0496121_0000014_292301_293440 359
73 3300048925 Ga0496122_0000084 Ga0496122_0000084_93052_94191 359
74 3300048926 Ga0496123_0001922 Ga0496123_0001922_17107_18246 359
75 3300048927 Ga0496124_0000019 Ga0496124_0000019_292301_293440 359
76 3300048928 Ga0496125_0000014 Ga0496125_0000014_292301_293440 359
77 3300048929 Ga0496126_0000017 Ga0496126_0000017_317237_318376 359
78 3300005937 Ga0081455_10002986 Ga0081455_100029868 361
79 3300006038 Ga0075365_10043575 Ga0075365_100435752 361
80 3300006051 Ga0075364_10055815 Ga0075364_100558152 361
81 3300021388 Ga0213875_10000634 Ga0213875_1000063421 361
82 3300037853 Ga0436364_0507746 Ga0436364_0507746_3700_4797 361
83 3300048922 Ga0496119_0045876 Ga0496119_0045876_841_2007 361
84 iso_pu_bacteria 2915358134 2915362721 361
85 3300005435 Ga0070714_100155884 Ga0070714_1001558843 362
86 3300005436 Ga0070713_100336854 Ga0070713_1003368541 362
87 3300005437 Ga0070710_10011306 Ga0070710_100113064 362
88 3300005439 Ga0070711_100271176 Ga0070711_1002711761 362
89 3300025929 Ga0207664_10323351 Ga0207664_103233512 362
90 3300046663 Ga0495635_0106007 Ga0495635_0106007_651_1889 363
91 3300047322 Ga0495680_0042489 Ga0495680_0042489_2337_3575 363
92 iso_pu_bacteria 2863067949 2863075411 363
93 3300005347 Ga0070668_100033452 Ga0070668_1000334522 364
94 3300005841 Ga0068863_100003061 Ga0068863_1000030613 364
95 3300005937 Ga0081455_10000090 Ga0081455_1000009058 364
96 3300014968 Ga0157379_10020562 Ga0157379_100205622 364
97 3300021388 Ga0213875_10011514 Ga0213875_100115142 364
98 3300025972 Ga0207668_10036567 Ga0207668_100365671 364
99 3300026088 Ga0207641_10003364 Ga0207641_1000336410 364
100 3300037853 Ga0436364_1009099 Ga0436364_1009099_2318_3421 364
101 3300048905 Ga0496102_0000089 Ga0496102_0000089_107924_109042 364
102 3300048906 Ga0496103_0000065 Ga0496103_0000065_19553_20671 364
103 3300048911 Ga0496108_0076901 Ga0496108_0076901_1523_2641 364
104 3300048914 Ga0496111_0172915 Ga0496111_0172915_159_1277 364
105 3300048919 Ga0496116_0000208 Ga0496116_0000208_107889_109007 364
106 3300048920 Ga0496117_0000191 Ga0496117_0000191_107855_108973 364
107 3300048921 Ga0496118_0002013 Ga0496118_0002013_8090_9208 364
108 3300048922 Ga0496119_0000634 Ga0496119_0000634_15537_16655 364
109 3300048923 Ga0496120_0019535 Ga0496120_0019535_1263_2381 364
110 3300048924 Ga0496121_0009581 Ga0496121_0009581_768_1886 364
111 3300048927 Ga0496124_0070236 Ga0496124_0070236_1271_2389 364
112 3300048928 Ga0496125_0081930 Ga0496125_0081930_724_1842 364
113 3300048929 Ga0496126_0002505 Ga0496126_0002505_15498_16616 364
114 3300005367 Ga0070667_100001523 Ga0070667_1000015237 365
115 3300025986 Ga0207658_10000611 Ga0207658_1000061128 365
116 3300030522 Ga0307512_10010989 Ga0307512_100109897 365
117 3300048905 Ga0496102_0034561 Ga0496102_0034561_2531_3709 365
118 3300048906 Ga0496103_0000388 Ga0496103_0000388_25126_26304 365
119 3300048911 Ga0496108_0000075 Ga0496108_0000075_32926_34065 365
120 3300048922 Ga0496119_0000539 Ga0496119_0000539_1730_2908 365
121 3300053096 Ga0500641_0043924 Ga0500641_0043924_198_1397 365
122 3300053118 Ga0500594_0009004 Ga0500594_0009004_403_1602 365
123 3300031903 Ga0307407_10095384 Ga0307407_100953842 366
124 3300032002 Ga0307416_100197060 Ga0307416_1001970602 366
125 3300044683 Ga0466965_0094844 Ga0466965_0094844_150_1346 366
126 3300044719 Ga0466971_0021849 Ga0466971_0021849_941_2119 366
127 3300045049 Ga0466959_0029424 Ga0466959_0029424_1449_2615 366
128 3300045836 Ga0466958_0049375 Ga0466958_0049375_703_1869 366
129 3300025933 Ga0207706_10121169 Ga0207706_101211692 367
130 3300025960 Ga0207651_10223183 Ga0207651_102231832 367
131 3300045976 Ga0466967_0003959 Ga0466967_0003959_7641_8786 367
132 3300048929 Ga0496126_0000090 Ga0496126_0000090_13949_15169 367
133 iso_pu_bacteria 2915358134 2915363450 367
134 3300005347 Ga0070668_100153723 Ga0070668_1001537232 368
135 3300005355 Ga0070671_100001367 Ga0070671_10000136712 368
136 3300005548 Ga0070665_100003950 Ga0070665_10000395011 368
137 3300005841 Ga0068863_100190384 Ga0068863_1001903842 368
138 3300005843 Ga0068860_100065619 Ga0068860_1000656193 368
139 3300025931 Ga0207644_10000916 Ga0207644_1000091612 368
140 3300026088 Ga0207641_10210600 Ga0207641_102106002 368
141 3300026095 Ga0207676_10093470 Ga0207676_100934702 368
142 3300028379 Ga0268266_10015163 Ga0268266_100151634 368
143 3300028381 Ga0268264_10004745 Ga0268264_100047459 368
144 3300030522 Ga0307512_10110013 Ga0307512_101100132 368
145 3300031456 Ga0307513_10000248 Ga0307513_100002482 368
146 3300045976 Ga0466967_0011767 Ga0466967_0011767_4034_5185 368
147 3300049586 Ga0501070_0000136 Ga0501070_0000136_18425_19597 368
148 iso_pu_bacteria 2643221715 2644637675 368
149 iso_pu_bacteria 2902810491 2902815247 368
150 3300003792 Ga0055540_1001570 Ga0055540_10015705 369
151 3300005288 Ga0065714_10006054 Ga0065714_100060543 369
152 3300005337 Ga0070682_100063083 Ga0070682_1000630832 369
153 3300006028 Ga0070717_10067102 Ga0070717_100671022 369
154 3300006051 Ga0075364_10006220 Ga0075364_100062202 369
155 3300025303 Ga0209051_1002017 Ga0209051_100201710 369
156 3300025303 Ga0209051_1057088 Ga0209051_10570882 369
157 3300028556 Ga0265337_1000404 Ga0265337_100040438 369
158 3300028800 Ga0265338_10004287 Ga0265338_100042877 369
159 3300031238 Ga0265332_10026063 Ga0265332_100260632 369
160 3300031711 Ga0265314_10043522 Ga0265314_100435222 369
161 3300031712 Ga0265342_10040486 Ga0265342_100404862 369
162 3300037853 Ga0436364_0256931 Ga0436364_0256931_78_1250 369
163 3300041410 Ga0439461_0008187 Ga0439461_0008187_369_1502 369
164 3300041411 Ga0439466_0012279 Ga0439466_0012279_828_1961 369
165 3300041486 Ga0451807_1774657 Ga0451807_1774657_331_1488 369
166 3300041501 Ga0451845_0999523 Ga0451845_0999523_119_1276 369
167 3300041997 Ga0439431_0001647 Ga0439431_0001647_1102_2235 369
168 3300044683 Ga0466965_0037292 Ga0466965_0037292_568_1731 369
169 3300048928 Ga0496125_0015484 Ga0496125_0015484_1300_2517 369
170 3300050491 nmdc:mga00v17_851_c1 nmdc:mga00v17_851_c1_14420_15553 369
171 3300050516 nmdc:mga0sz30_31343_c1 nmdc:mga0sz30_31343_c1_224_1414 369
172 iso_pu_bacteria 2643221687 2644486187 369
173 iso_pu_bacteria 2675903060 2676492288 369
174 3300046680 Ga0495646_0085505 Ga0495646_0085505_218_1450 370
175 3300053136 Ga0500559_0009433 Ga0500559_0009433_2318_3472 370
176 iso_pu_bacteria 2791354901 2791910285 370
177 3300003792 Ga0055540_1000951 Ga0055540_100095112 371
178 3300006186 Ga0075369_10004266 Ga0075369_100042666 371
179 3300025273 Ga0209673_1014992 Ga0209673_10149922 371
180 3300047472 Ga0495686_0003209 Ga0495686_0003209_12108_13262 371
181 3300048920 Ga0496117_0031727 Ga0496117_0031727_1113_2243 371
182 3300048921 Ga0496118_0000029 Ga0496118_0000029_237644_238774 371
183 3300050509 nmdc:mga0qj67_247246_c1 nmdc:mga0qj67_247246_c1_103_1272 371
184 iso_pu_bacteria 2895427314 2895434412 371
185 iso_pu_bacteria 2902837492 2902840468 371
186 iso_pu_bacteria 8056207758 8056214313 371
187 3300003792 Ga0055540_1000710 Ga0055540_10007109 372
188 3300005329 Ga0070683_100280320 Ga0070683_1002803202 372
189 3300005548 Ga0070665_100175099 Ga0070665_1001750992 372
190 3300005618 Ga0068864_100020731 Ga0068864_1000207312 372
191 3300005840 Ga0068870_10006476 Ga0068870_100064765 372
192 3300014745 Ga0157377_10139477 Ga0157377_101394772 372
193 3300025303 Ga0209051_1000466 Ga0209051_100046649 372
194 3300025908 Ga0207643_10027244 Ga0207643_100272443 372
195 3300025942 Ga0207689_10056012 Ga0207689_100560123 372
196 3300026067 Ga0207678_10031395 Ga0207678_100313952 372
197 3300046455 Ga0495603_0028858 Ga0495603_0028858_2079_3275 372
198 3300046460 Ga0495638_0016872 Ga0495638_0016872_2091_3326 372
199 3300046477 Ga0495664_0133968 Ga0495664_0133968_130_1365 372
200 3300046492 Ga0495585_0069283 Ga0495585_0069283_521_1756 372
201 3300046512 Ga0495610_0089467 Ga0495610_0089467_102_1337 372
202 3300046515 Ga0495620_0016695 Ga0495620_0016695_2136_3371 372
203 3300046518 Ga0495631_0008239 Ga0495631_0008239_3427_4662 372
204 3300046524 Ga0495648_0112331 Ga0495648_0112331_69_1304 372
205 3300046530 Ga0495654_0038015 Ga0495654_0038015_737_1972 372
206 3300046538 Ga0495609_0013107 Ga0495609_0013107_827_2062 372
207 3300046616 Ga0495668_0114260 Ga0495668_0114260_182_1417 372
208 3300046675 Ga0495657_0026610 Ga0495657_0026610_1234_2469 372
209 3300046794 Ga0495589_0033338 Ga0495589_0033338_92_1327 372
210 3300046810 Ga0495660_0092770 Ga0495660_0092770_212_1447 372
211 3300047443 Ga0495687_019284 Ga0495687_019284_1936_3171 372
212 3300047447 Ga0495685_008655 Ga0495685_008655_274_1509 372
213 3300005347 Ga0070668_100137698 Ga0070668_1001376982 373
214 3300005435 Ga0070714_100023229 Ga0070714_1000232292 373
215 3300005437 Ga0070710_10005431 Ga0070710_100054313 373
216 3300006038 Ga0075365_10004991 Ga0075365_100049911 373
217 3300013307 Ga0157372_10277705 Ga0157372_102777052 373
218 3300025928 Ga0207700_10063526 Ga0207700_100635262 373
219 3300048927 Ga0496124_0206152 Ga0496124_0206152_30_1163 373
220 3300048929 Ga0496126_0113046 Ga0496126_0113046_870_2054 373
221 3300053153 Ga0500616_0000081 Ga0500616_0000081_163264_164427 373
222 iso_pu_bacteria 2852677369 2852678536 373
223 iso_pu_bacteria 2939582691 2939587656 373
224 3300025929 Ga0207664_10097014 Ga0207664_100970142 374
225 3300046660 Ga0495625_0119662 Ga0495625_0119662_409_1683 374
226 3300046794 Ga0495589_0046187 Ga0495589_0046187_818_2008 374
227 3300047443 Ga0495687_002365 Ga0495687_002365_12089_13300 374
228 iso_pu_bacteria 8054472261 8054473124 374
229 3300005563 Ga0068855_100242562 Ga0068855_1002425622 375
230 3300009545 Ga0105237_10012977 Ga0105237_100129773 375
231 3300010375 Ga0105239_10063452 Ga0105239_100634523 375
232 3300021384 Ga0213876_10001397 Ga0213876_1000139713 375
233 3300021388 Ga0213875_10006833 Ga0213875_100068334 375
234 3300025272 Ga0209455_1001859 Ga0209455_10018594 375
235 3300025909 Ga0207705_10096431 Ga0207705_100964313 375
236 3300025914 Ga0207671_10113842 Ga0207671_101138422 375
237 3300026142 Ga0207698_10221136 Ga0207698_102211362 375
238 3300028381 Ga0268264_10111430 Ga0268264_101114302 375
239 3300031344 Ga0265316_10046074 Ga0265316_100460742 375
240 3300031456 Ga0307513_10060487 Ga0307513_100604872 375
241 3300037418 Ga0395900_0153964 Ga0395900_0153964_137_1288 375
242 3300037466 Ga0395898_0025057 Ga0395898_0025057_2641_3792 375
243 3300037853 Ga0436364_0633952 Ga0436364_0633952_17183_18343 375
244 3300038443 Ga0395901_0018525 Ga0395901_0018525_1843_2994 375
245 3300039437 Ga0436365_0931839 Ga0436365_0931839_95603_96763 375
246 3300044658 Ga0466972_0004530 Ga0466972_0004530_1573_2727 375
247 3300044683 Ga0466965_0001210 Ga0466965_0001210_3239_4393 375
248 3300044901 Ga0466960_0000354 Ga0466960_0000354_9931_11097 375
249 3300044901 Ga0466960_0056896 Ga0466960_0056896_410_1564 375
250 3300045049 Ga0466959_0001342 Ga0466959_0001342_8869_10035 375
251 3300046524 Ga0495648_0028691 Ga0495648_0028691_1667_2836 375
252 3300047320 Ga0495672_0006161 Ga0495672_0006161_5816_6985 375
253 3300047469 Ga0495673_0016923 Ga0495673_0016923_817_1986 375
254 3300048903 Ga0496100_0002517 Ga0496100_0002517_1944_3113 375
255 3300048904 Ga0496101_0000011 Ga0496101_0000011_42083_43252 375
256 3300048904 Ga0496101_0166707 Ga0496101_0166707_449_1672 375
257 3300048905 Ga0496102_0000012 Ga0496102_0000012_264410_265579 375
258 3300048906 Ga0496103_0000005 Ga0496103_0000005_49884_51053 375
259 3300048907 Ga0496104_0093862 Ga0496104_0093862_739_1965 375
260 3300048908 Ga0496105_0012641 Ga0496105_0012641_4167_5393 375
261 3300048909 Ga0496106_0003523 Ga0496106_0003523_7052_8221 375
262 3300048917 Ga0496114_0010589 Ga0496114_0010589_4722_5948 375
263 3300048919 Ga0496116_0000050 Ga0496116_0000050_260631_261800 375
264 3300048920 Ga0496117_0000042 Ga0496117_0000042_49892_51061 375
265 3300048921 Ga0496118_0000037 Ga0496118_0000037_49892_51061 375
266 3300048922 Ga0496119_0000181 Ga0496119_0000181_42509_43678 375
267 3300048923 Ga0496120_0000121 Ga0496120_0000121_31822_32991 375
268 3300048923 Ga0496120_0039049 Ga0496120_0039049_1232_2398 375
269 3300048924 Ga0496121_0000250 Ga0496121_0000250_63085_64254 375
270 3300048929 Ga0496126_0000317 Ga0496126_0000317_42330_43499 375
271 3300048929 Ga0496126_0023449 Ga0496126_0023449_210_1376 375
272 3300049569 Ga0501032_0001282 Ga0501032_0001282_8596_9753 375
273 3300049571 Ga0501034_0014524 Ga0501034_0014524_4295_5452 375
274 3300049572 Ga0501036_0032699 Ga0501036_0032699_3082_4239 375
275 3300049573 Ga0501037_0000475 Ga0501037_0000475_10982_12139 375
276 3300049574 Ga0501038_0000993 Ga0501038_0000993_10393_11550 375
277 3300049575 Ga0501039_0000450 Ga0501039_0000450_22256_23413 375
278 3300049579 Ga0501043_0001171 Ga0501043_0001171_12649_13806 375
279 3300049586 Ga0501070_0001563 Ga0501070_0001563_8599_9756 375
280 3300049823 Ga0501044_0038044 Ga0501044_0038044_1690_2847 375
281 3300053087 Ga0500643_003250 Ga0500643_003250_6570_7739 375
282 iso_pu_bacteria 2902792274 2902796177 375
283 iso_pu_bacteria 8055172936 8055176249 375
284 3300003792 Ga0055540_1000036 Ga0055540_100003616 376
285 3300013105 Ga0157369_10222774 Ga0157369_102227741 376
286 3300025303 Ga0209051_1000021 Ga0209051_1000021366 376
287 3300044683 Ga0466965_0006039 Ga0466965_0006039_424_1593 376
288 3300045976 Ga0466967_0179104 Ga0466967_0179104_165_1334 376
289 3300046513 Ga0495616_0026004 Ga0495616_0026004_256_1491 376
290 3300046665 Ga0495661_0031457 Ga0495661_0031457_432_1667 376
291 3300046810 Ga0495660_0043997 Ga0495660_0043997_580_1815 376
292 3300048920 Ga0496117_0054303 Ga0496117_0054303_1517_2689 376
293 iso_pu_bacteria 2738541264 2738668252 376
294 iso_pu_bacteria 2738541356 2739147322 376
295 iso_pu_bacteria 2773857933 2774903643 376
296 iso_pu_bacteria 2935409751 2935411974 376
297 3300025939 Ga0207665_10026153 Ga0207665_100261532 377
298 3300044656 Ga0466969_0066241 Ga0466969_0066241_281_1462 377
299 3300044693 Ga0466961_0141162 Ga0466961_0141162_34_1215 377
300 3300044765 Ga0466970_0018071 Ga0466970_0018071_1551_2744 377
301 3300048907 Ga0496104_0256180 Ga0496104_0256180_162_1379 377
302 3300048910 Ga0496107_0022520 Ga0496107_0022520_2348_3565 377
303 3300048911 Ga0496108_0207570 Ga0496108_0207570_383_1600 377
304 3300048913 Ga0496110_0180121 Ga0496110_0180121_323_1540 377
305 3300048915 Ga0496112_0058297 Ga0496112_0058297_907_2124 377
306 3300048916 Ga0496113_0053253 Ga0496113_0053253_641_1858 377
307 3300048918 Ga0496115_0015617 Ga0496115_0015617_980_2197 377
308 3300048922 Ga0496119_0087609 Ga0496119_0087609_411_1628 377
309 3300049572 Ga0501036_0101468 Ga0501036_0101468_1018_2214 377
310 3300049822 Ga0501035_0013357 Ga0501035_0013357_3622_4818 377
311 3300049823 Ga0501044_0039319 Ga0501044_0039319_1323_2519 377
312 3300053080 Ga0500635_0009368 Ga0500635_0009368_1112_2290 377
313 3300053131 Ga0500652_000656 Ga0500652_000656_5865_7043 377
314 iso_pu_bacteria 2929212328 2929212804 377
315 iso_pu_bacteria 8055066027 8055069853 377
316 3300005614 Ga0068856_100191822 Ga0068856_1001918222 378
317 3300042138 Ga0450903_004971 Ga0450903_004971_385_1569 378
318 3300045976 Ga0466967_0117346 Ga0466967_0117346_743_1927 378
319 3300049571 Ga0501034_0170809 Ga0501034_0170809_197_1504 378
320 3300049574 Ga0501038_0039094 Ga0501038_0039094_1419_2726 378
321 3300049581 Ga0501047_0006080 Ga0501047_0006080_1491_2798 378
322 3300049586 Ga0501070_0028862 Ga0501070_0028862_1336_2643 378
323 3300049823 Ga0501044_0019751 Ga0501044_0019751_342_1649 378
324 iso_pu_bacteria 2799112218 2799184508 378
325 3300005329 Ga0070683_100028208 Ga0070683_1000282084 379
326 3300005337 Ga0070682_100004731 Ga0070682_1000047313 379
327 3300005338 Ga0068868_100008432 Ga0068868_1000084326 379
328 3300005340 Ga0070689_100048702 Ga0070689_1000487022 379
329 3300005345 Ga0070692_10010302 Ga0070692_100103024 379
330 3300005347 Ga0070668_100095059 Ga0070668_1000950591 379
331 3300005455 Ga0070663_100006011 Ga0070663_1000060112 379
332 3300005457 Ga0070662_100053940 Ga0070662_1000539401 379
333 3300005548 Ga0070665_100025431 Ga0070665_1000254313 379
334 3300005548 Ga0070665_100083145 Ga0070665_1000831452 379
335 3300005564 Ga0070664_100013642 Ga0070664_1000136422 379
336 3300005577 Ga0068857_100064410 Ga0068857_1000644102 379
337 3300005615 Ga0070702_100081959 Ga0070702_1000819591 379
338 3300005616 Ga0068852_100030669 Ga0068852_1000306694 379
339 3300005618 Ga0068864_100067107 Ga0068864_1000671073 379
340 3300005842 Ga0068858_100239850 Ga0068858_1002398502 379
341 3300005843 Ga0068860_100099535 Ga0068860_1000995353 379
342 3300005844 Ga0068862_100009803 Ga0068862_1000098034 379
343 3300009098 Ga0105245_10007000 Ga0105245_1000700010 379
344 3300009148 Ga0105243_10040570 Ga0105243_100405702 379
345 3300009545 Ga0105237_10052218 Ga0105237_100522183 379
346 3300009553 Ga0105249_10024832 Ga0105249_100248322 379
347 3300010375 Ga0105239_10009798 Ga0105239_1000979814 379
348 3300013105 Ga0157369_10138995 Ga0157369_101389952 379
349 3300013308 Ga0157375_10016532 Ga0157375_100165326 379
350 3300014745 Ga0157377_10026174 Ga0157377_100261742 379
351 3300014968 Ga0157379_10098581 Ga0157379_100985813 379
352 3300025901 Ga0207688_10002529 Ga0207688_100025293 379
353 3300025909 Ga0207705_10080049 Ga0207705_100800492 379
354 3300025927 Ga0207687_10012002 Ga0207687_100120024 379
355 3300025933 Ga0207706_10021851 Ga0207706_100218516 379
356 3300025936 Ga0207670_10034083 Ga0207670_100340832 379
357 3300025944 Ga0207661_10114848 Ga0207661_101148482 379
358 3300025945 Ga0207679_10029836 Ga0207679_100298363 379
359 3300025972 Ga0207668_10012725 Ga0207668_100127254 379
360 3300026035 Ga0207703_10126774 Ga0207703_101267742 379
361 3300026067 Ga0207678_10022477 Ga0207678_100224775 379
362 3300026095 Ga0207676_10082498 Ga0207676_100824983 379
363 3300026121 Ga0207683_10063268 Ga0207683_100632683 379
364 3300026142 Ga0207698_10046169 Ga0207698_100461693 379
365 3300028379 Ga0268266_10027084 Ga0268266_100270842 379
366 3300028379 Ga0268266_10121114 Ga0268266_101211142 379
367 3300028380 Ga0268265_10011636 Ga0268265_100116364 379
368 3300028381 Ga0268264_10067008 Ga0268264_100670083 379
369 3300036401 Ga0373937_0102443 Ga0373937_0102443_1291_2481 379
370 3300037853 Ga0436364_0256666 Ga0436364_0256666_1624_2817 379
371 3300046536 Ga0495587_0132275 Ga0495587_0132275_122_1312 379
372 3300048913 Ga0496110_0014998 Ga0496110_0014998_2905_4110 379
373 3300005347 Ga0070668_100000347 Ga0070668_10000034714 380
374 3300025972 Ga0207668_10003758 Ga0207668_100037583 380
375 3300031251 Ga0265327_10000177 Ga0265327_1000017728 380
376 3300048925 Ga0496122_0012560 Ga0496122_0012560_638_1855 380
377 3300050490 nmdc:mga03n38_65661_c1 nmdc:mga03n38_65661_c1_63_1265 380
378 3300053108 Ga0500562_001428 Ga0500562_001428_2918_4099 380
379 iso_pu_bacteria 2856741275 2856746426 380
380 iso_pu_bacteria 2857723135 2857725896 380
381 iso_pu_bacteria 2891562705 2891567998 380
382 iso_pu_bacteria 2904509784 2904510695 380
383 iso_pu_bacteria 2977236895 2977237970 380
384 iso_pu_bacteria 2984542743 2984544249 380
385 3300005435 Ga0070714_100168788 Ga0070714_1001687881 381
386 3300005435 Ga0070714_100205231 Ga0070714_1002052312 381
387 3300005436 Ga0070713_100097254 Ga0070713_1000972542 381
388 3300014968 Ga0157379_10139072 Ga0157379_101390722 381
389 3300021388 Ga0213875_10000235 Ga0213875_1000023517 381
390 3300025906 Ga0207699_10058887 Ga0207699_100588872 381
391 3300025924 Ga0207694_10075529 Ga0207694_100755291 381
392 3300025929 Ga0207664_10077458 Ga0207664_100774582 381
393 3300026067 Ga0207678_10124428 Ga0207678_101244282 381
394 3300026121 Ga0207683_10266922 Ga0207683_102669222 381
395 3300028800 Ga0265338_10003375 Ga0265338_100033754 381
396 3300031649 Ga0307514_10018424 Ga0307514_100184243 381
397 3300037853 Ga0436364_0282469 Ga0436364_0282469_3616_4806 381
398 3300044719 Ga0466971_0052020 Ga0466971_0052020_456_1658 381
399 3300046460 Ga0495638_0000563 Ga0495638_0000563_28752_29948 381
400 3300048903 Ga0496100_0011912 Ga0496100_0011912_2818_4044 381
401 3300048904 Ga0496101_0048830 Ga0496101_0048830_854_2080 381
402 3300048905 Ga0496102_0003154 Ga0496102_0003154_3909_5135 381
403 3300048905 Ga0496102_0100401 Ga0496102_0100401_1143_2339 381
404 3300048906 Ga0496103_0010622 Ga0496103_0010622_1830_3056 381
405 3300048907 Ga0496104_0001045 Ga0496104_0001045_16176_17402 381
406 3300048908 Ga0496105_0010160 Ga0496105_0010160_4748_5944 381
407 3300048909 Ga0496106_0024279 Ga0496106_0024279_2568_3764 381
408 3300048911 Ga0496108_0292952 Ga0496108_0292952_175_1371 381
409 3300048917 Ga0496114_0003226 Ga0496114_0003226_860_2086 381
410 3300048917 Ga0496114_0013230 Ga0496114_0013230_3822_5018 381
411 3300053153 Ga0500616_0000822 Ga0500616_0000822_3569_4768 381
412 iso_pu_bacteria 2643221692 2644511974 381
413 iso_pu_bacteria 2643221711 2644609338 381
414 3300005340 Ga0070689_100015610 Ga0070689_1000156102 382
415 3300006028 Ga0070717_10212387 Ga0070717_102123872 382
416 3300028573 Ga0265334_10007863 Ga0265334_100078634 382
417 3300049570 Ga0501033_0008524 Ga0501033_0008524_4469_5674 382
418 3300049571 Ga0501034_0045164 Ga0501034_0045164_2336_3541 382
419 3300049571 Ga0501034_0052324 Ga0501034_0052324_1575_2780 382
420 3300049572 Ga0501036_0003690 Ga0501036_0003690_6188_7393 382
421 3300049572 Ga0501036_0168700 Ga0501036_0168700_218_1423 382
422 3300049574 Ga0501038_0014975 Ga0501038_0014975_4550_5755 382
423 3300049575 Ga0501039_0014528 Ga0501039_0014528_1855_3060 382
424 3300049579 Ga0501043_0000358 Ga0501043_0000358_7905_9110 382
425 3300049581 Ga0501047_0219591 Ga0501047_0219591_19_1224 382
426 3300049586 Ga0501070_0002257 Ga0501070_0002257_2849_4054 382
427 3300049590 Ga0501074_0009064 Ga0501074_0009064_1455_2660 382
428 3300049822 Ga0501035_0005197 Ga0501035_0005197_912_2117 382
429 3300049822 Ga0501035_0079284 Ga0501035_0079284_1483_2694 382
430 3300049823 Ga0501044_0160161 Ga0501044_0160161_155_1360 382
431 iso_pu_bacteria 2728369276 2729908467 382
432 iso_pu_bacteria 2786546132 2786674661 382
433 iso_pu_bacteria 2862382967 2862387986 382
434 3300005338 Ga0068868_100254550 Ga0068868_1002545501 383
435 3300005436 Ga0070713_100018089 Ga0070713_1000180894 383
436 3300005436 Ga0070713_100354071 Ga0070713_1003540711 383
437 3300005455 Ga0070663_100279563 Ga0070663_1002795631 383
438 3300006175 Ga0070712_100015368 Ga0070712_1000153684 383
439 3300009011 Ga0105251_10030879 Ga0105251_100308792 383
440 3300021388 Ga0213875_10051837 Ga0213875_100518372 383
441 3300025915 Ga0207693_10030363 Ga0207693_100303633 383
442 3300028666 Ga0265336_10009230 Ga0265336_100092303 383
443 3300028800 Ga0265338_10002127 Ga0265338_1000212719 383
444 3300031616 Ga0307508_10219578 Ga0307508_102195781 383
445 3300035083 Ga0373926_0001427 Ga0373926_0001427_4942_6144 383
446 3300035089 Ga0373944_0000291 Ga0373944_0000291_2958_4160 383
447 3300035113 Ga0373936_0000195 Ga0373936_0000195_9237_10439 383
448 3300035116 Ga0373945_0000055 Ga0373945_0000055_1661_2863 383
449 3300035119 Ga0373956_0009965 Ga0373956_0009965_1775_2980 383
450 3300035170 Ga0373943_0000041 Ga0373943_0000041_20046_21248 383
451 3300035170 Ga0373943_0072571 Ga0373943_0072571_15_1196 383
452 3300035171 Ga0373946_0001009 Ga0373946_0001009_1965_3167 383
453 3300035172 Ga0373955_0005335 Ga0373955_0005335_1811_3022 383
454 3300035692 Ga0373935_0000404 Ga0373935_0000404_8592_9794 383
455 3300035692 Ga0373935_0089967 Ga0373935_0089967_161_1366 383
456 3300035695 Ga0373927_0001129 Ga0373927_0001129_7332_8534 383
457 3300035724 Ga0373933_0021427 Ga0373933_0021427_308_1519 383
458 3300035725 Ga0373947_0000535 Ga0373947_0000535_10616_11818 383
459 3300036401 Ga0373937_0053708 Ga0373937_0053708_777_1982 383
460 3300037068 Ga0373925_0004534 Ga0373925_0004534_8657_9859 383
461 3300037068 Ga0373925_0076296 Ga0373925_0076296_721_1995 383
462 3300037466 Ga0395898_0059610 Ga0395898_0059610_326_1591 383
463 3300037853 Ga0436364_1034848 Ga0436364_1034848_261_1466 383
464 3300045976 Ga0466967_0056906 Ga0466967_0056906_120_1325 383
465 3300046454 Ga0495592_0044771 Ga0495592_0044771_1933_3144 383
466 3300046454 Ga0495592_0061583 Ga0495592_0061583_1092_2297 383
467 3300046461 Ga0495641_0017895 Ga0495641_0017895_1408_2610 383
468 3300046463 Ga0495653_0001396 Ga0495653_0001396_13629_14831 383
469 3300046463 Ga0495653_0016189 Ga0495653_0016189_2041_3252 383
470 3300046473 Ga0495582_0003116 Ga0495582_0003116_436_1638 383
471 3300046477 Ga0495664_0000524 Ga0495664_0000524_6297_7499 383
472 3300046477 Ga0495664_0033208 Ga0495664_0033208_609_1814 383
473 3300046516 Ga0495628_0040917 Ga0495628_0040917_1090_2295 383
474 3300046526 Ga0495666_0107626 Ga0495666_0107626_41_1246 383
475 3300046529 Ga0495652_0027316 Ga0495652_0027316_2489_3694 383
476 3300046529 Ga0495652_0031218 Ga0495652_0031218_1753_2955 383
477 3300046529 Ga0495652_0136573 Ga0495652_0136573_436_1647 383
478 3300046531 Ga0495665_0020537 Ga0495665_0020537_728_1930 383
479 3300046533 Ga0495640_0104594 Ga0495640_0104594_498_1703 383
480 3300046536 Ga0495587_0014543 Ga0495587_0014543_1183_2388 383
481 3300046559 Ga0495667_0004249 Ga0495667_0004249_3708_4910 383
482 3300046663 Ga0495635_0000353 Ga0495635_0000353_12880_14082 383
483 3300046675 Ga0495657_0023808 Ga0495657_0023808_1820_3025 383
484 3300046675 Ga0495657_0102330 Ga0495657_0102330_315_1526 383
485 3300046690 Ga0495624_0001681 Ga0495624_0001681_10690_11892 383
486 3300046809 Ga0495600_0071881 Ga0495600_0071881_965_2176 383
487 3300047315 Ga0495581_0086198 Ga0495581_0086198_545_1750 383
488 3300047319 Ga0495674_0002196 Ga0495674_0002196_6291_7493 383
489 3300047321 Ga0495676_0047009 Ga0495676_0047009_757_1959 383
490 3300047322 Ga0495680_0008327 Ga0495680_0008327_1576_2778 383
491 3300047322 Ga0495680_0024787 Ga0495680_0024787_1158_2363 383
492 3300047471 Ga0495684_0001427 Ga0495684_0001427_6256_7458 383
493 3300047673 Ga0495593_0068950 Ga0495593_0068950_545_1729 383
494 3300048088 Ga0495602_0019844 Ga0495602_0019844_2842_4047 383
495 3300048088 Ga0495602_0067885 Ga0495602_0067885_1648_2859 383
496 3300048913 Ga0496110_0259339 Ga0496110_0259339_256_1458 383
497 3300049569 Ga0501032_0011027 Ga0501032_0011027_1920_3131 383
498 3300049570 Ga0501033_0016575 Ga0501033_0016575_221_1432 383
499 3300049572 Ga0501036_0003289 Ga0501036_0003289_11644_12855 383
500 3300049575 Ga0501039_0076713 Ga0501039_0076713_1214_2425 383
501 3300049581 Ga0501047_0017843 Ga0501047_0017843_4116_5327 383
502 3300049581 Ga0501047_0058299 Ga0501047_0058299_2133_3338 383
503 3300049581 Ga0501047_0102471 Ga0501047_0102471_513_1781 383
504 3300049823 Ga0501044_0227744 Ga0501044_0227744_589_1794 383
505 3300049824 Ga0501045_0218570 Ga0501045_0218570_164_1375 383
506 iso_pu_bacteria 2547132424 2548697715 383
507 iso_pu_bacteria 2626541554 2626637059 383
508 iso_pu_bacteria 2862290372 2862293003 383
509 iso_pu_bacteria 2997451912 2997455605 383
510 iso_pu_bacteria 8003314358 8003317682 383
511 iso_pu_bacteria 8055157932 8055161478 383
512 3300003354 JGI25160J50197_1005722 JGI25160J50197_10057224 384
513 3300005327 Ga0070658_10042920 Ga0070658_100429203 384
514 3300005329 Ga0070683_100084928 Ga0070683_1000849283 384
515 3300005335 Ga0070666_10011772 Ga0070666_100117723 384
516 3300005338 Ga0068868_100099272 Ga0068868_1000992722 384
517 3300005347 Ga0070668_100012548 Ga0070668_1000125483 384
518 3300005353 Ga0070669_100001706 Ga0070669_10000170610 384
519 3300005365 Ga0070688_100198379 Ga0070688_1001983791 384
520 3300005367 Ga0070667_100000056 Ga0070667_100000056129 384
521 3300005434 Ga0070709_10073610 Ga0070709_100736103 384
522 3300005437 Ga0070710_10035164 Ga0070710_100351643 384
523 3300005439 Ga0070711_100204898 Ga0070711_1002048981 384
524 3300005468 Ga0070707_100040022 Ga0070707_1000400224 384
525 3300005536 Ga0070697_100202792 Ga0070697_1002027921 384
526 3300005539 Ga0068853_100032974 Ga0068853_1000329744 384
527 3300005539 Ga0068853_100106781 Ga0068853_1001067812 384
528 3300005544 Ga0070686_100047935 Ga0070686_1000479352 384
529 3300005548 Ga0070665_100005830 Ga0070665_1000058309 384
530 3300005548 Ga0070665_100244543 Ga0070665_1002445432 384
531 3300005564 Ga0070664_100096882 Ga0070664_1000968822 384
532 3300005577 Ga0068857_100176977 Ga0068857_1001769772 384
533 3300005614 Ga0068856_100083313 Ga0068856_1000833132 384
534 3300005617 Ga0068859_100000751 Ga0068859_10000075129 384
535 3300005618 Ga0068864_100196688 Ga0068864_1001966882 384
536 3300005841 Ga0068863_100004393 Ga0068863_1000043938 384
537 3300005841 Ga0068863_100058432 Ga0068863_1000584322 384
538 3300005842 Ga0068858_100021321 Ga0068858_1000213216 384
539 3300005842 Ga0068858_100043454 Ga0068858_1000434543 384
540 3300005842 Ga0068858_100063112 Ga0068858_1000631123 384
541 3300005843 Ga0068860_100000092 Ga0068860_10000009227 384
542 3300005844 Ga0068862_100000035 Ga0068862_10000003531 384
543 3300006028 Ga0070717_10200230 Ga0070717_102002302 384
544 3300006237 Ga0097621_100133059 Ga0097621_1001330592 384
545 3300006237 Ga0097621_100172750 Ga0097621_1001727503 384
546 3300006871 Ga0075434_100313343 Ga0075434_1003133432 384
547 3300006931 Ga0097620_100000751 Ga0097620_10000075129 384
548 3300007076 Ga0075435_100106709 Ga0075435_1001067092 384
549 3300009098 Ga0105245_10020466 Ga0105245_100204662 384
550 3300009101 Ga0105247_10000062 Ga0105247_1000006281 384
551 3300009148 Ga0105243_10187234 Ga0105243_101872342 384
552 3300009174 Ga0105241_10000239 Ga0105241_1000023925 384
553 3300009177 Ga0105248_10000036 Ga0105248_10000036128 384
554 3300009177 Ga0105248_10192652 Ga0105248_101926522 384
555 3300009177 Ga0105248_10218510 Ga0105248_102185102 384
556 3300009545 Ga0105237_10123088 Ga0105237_101230882 384
557 3300009551 Ga0105238_10049757 Ga0105238_100497571 384
558 3300009551 Ga0105238_10101783 Ga0105238_101017832 384
559 3300009553 Ga0105249_10000046 Ga0105249_10000046150 384
560 3300010375 Ga0105239_10164326 Ga0105239_101643263 384
561 3300013105 Ga0157369_10091263 Ga0157369_100912632 384
562 3300013296 Ga0157374_10018011 Ga0157374_100180112 384
563 3300013296 Ga0157374_10103464 Ga0157374_101034642 384
564 3300013307 Ga0157372_10177069 Ga0157372_101770692 384
565 3300013308 Ga0157375_10150564 Ga0157375_101505642 384
566 3300013308 Ga0157375_10179549 Ga0157375_101795492 384
567 3300014325 Ga0163163_10030509 Ga0163163_100305096 384
568 3300014325 Ga0163163_10083421 Ga0163163_100834212 384
569 3300014968 Ga0157379_10007317 Ga0157379_100073173 384
570 3300021388 Ga0213875_10015450 Ga0213875_100154501 384
571 3300025302 Ga0207426_1000920 Ga0207426_100092014 384
572 3300025900 Ga0207710_10000060 Ga0207710_1000006080 384
573 3300025901 Ga0207688_10045250 Ga0207688_100452502 384
574 3300025906 Ga0207699_10035924 Ga0207699_100359243 384
575 3300025911 Ga0207654_10041372 Ga0207654_100413722 384
576 3300025914 Ga0207671_10000365 Ga0207671_1000036549 384
577 3300025918 Ga0207662_10023219 Ga0207662_100232192 384
578 3300025922 Ga0207646_10065677 Ga0207646_100656772 384
579 3300025923 Ga0207681_10001181 Ga0207681_1000118110 384
580 3300025924 Ga0207694_10001761 Ga0207694_100017612 384
581 3300025927 Ga0207687_10026927 Ga0207687_100269273 384
582 3300025929 Ga0207664_10054885 Ga0207664_100548852 384
583 3300025939 Ga0207665_10008824 Ga0207665_100088245 384
584 3300025939 Ga0207665_10040401 Ga0207665_100404012 384
585 3300025940 Ga0207691_10104049 Ga0207691_101040492 384
586 3300025941 Ga0207711_10000073 Ga0207711_10000073112 384
587 3300025941 Ga0207711_10108029 Ga0207711_101080293 384
588 3300025942 Ga0207689_10006694 Ga0207689_100066946 384
589 3300025944 Ga0207661_10126342 Ga0207661_101263422 384
590 3300025945 Ga0207679_10069586 Ga0207679_100695862 384
591 3300025961 Ga0207712_10000042 Ga0207712_1000004231 384
592 3300025972 Ga0207668_10016784 Ga0207668_100167844 384
593 3300025986 Ga0207658_10000664 Ga0207658_1000066427 384
594 3300026023 Ga0207677_10133668 Ga0207677_101336682 384
595 3300026035 Ga0207703_10059827 Ga0207703_100598272 384
596 3300026041 Ga0207639_10020125 Ga0207639_100201253 384
597 3300026067 Ga0207678_10000318 Ga0207678_1000031829 384
598 3300026067 Ga0207678_10029113 Ga0207678_100291134 384
599 3300026067 Ga0207678_10076531 Ga0207678_100765312 384
600 3300026078 Ga0207702_10095896 Ga0207702_100958962 384
601 3300026078 Ga0207702_10111872 Ga0207702_101118722 384
602 3300026078 Ga0207702_10155960 Ga0207702_101559602 384
603 3300026088 Ga0207641_10003278 Ga0207641_100032788 384
604 3300026116 Ga0207674_10008338 Ga0207674_1000833810 384
605 3300026116 Ga0207674_10016576 Ga0207674_100165766 384
606 3300026142 Ga0207698_10021930 Ga0207698_100219301 384
607 3300028379 Ga0268266_10028517 Ga0268266_100285174 384
608 3300028379 Ga0268266_10061022 Ga0268266_100610222 384
609 3300028379 Ga0268266_10206495 Ga0268266_102064952 384
610 3300028380 Ga0268265_10000051 Ga0268265_10000051149 384
611 3300028381 Ga0268264_10000108 Ga0268264_1000010856 384
612 3300028666 Ga0265336_10003483 Ga0265336_100034832 384
613 3300028786 Ga0307517_10012361 Ga0307517_100123613 384
614 3300028794 Ga0307515_10036520 Ga0307515_100365204 384
615 3300028800 Ga0265338_10065466 Ga0265338_100654663 384
616 3300031456 Ga0307513_10005780 Ga0307513_1000578016 384
617 3300031616 Ga0307508_10017127 Ga0307508_100171272 384
618 3300031649 Ga0307514_10051472 Ga0307514_100514722 384
619 3300031730 Ga0307516_10028531 Ga0307516_100285314 384
620 3300035090 Ga0373949_0024732 Ga0373949_0024732_29_1249 384
621 3300035111 Ga0373923_0020939 Ga0373923_0020939_41_1246 384
622 3300035113 Ga0373936_0027486 Ga0373936_0027486_977_2182 384
623 3300035116 Ga0373945_0063736 Ga0373945_0063736_149_1354 384
624 3300035118 Ga0373954_0014483 Ga0373954_0014483_37_1242 384
625 3300035170 Ga0373943_0110819 Ga0373943_0110819_28_1233 384
626 3300035410 Ga0373924_0074223 Ga0373924_0074223_138_1343 384
627 3300035692 Ga0373935_0032787 Ga0373935_0032787_1288_2493 384
628 3300037068 Ga0373925_0000592 Ga0373925_0000592_6338_7627 384
629 3300037068 Ga0373925_0253242 Ga0373925_0253242_131_1336 384
630 3300037853 Ga0436364_0691418 Ga0436364_0691418_15131_16339 384
631 3300039437 Ga0436365_0514921 Ga0436365_0514921_630_1823 384
632 3300044656 Ga0466969_0005780 Ga0466969_0005780_4117_5415 384
633 3300044684 Ga0466966_0007160 Ga0466966_0007160_5760_7058 384
634 3300044684 Ga0466966_0116310 Ga0466966_0116310_336_1547 384
635 3300044719 Ga0466971_0011830 Ga0466971_0011830_2151_3362 384
636 3300044765 Ga0466970_0016852 Ga0466970_0016852_733_1938 384
637 3300045049 Ga0466959_0005746 Ga0466959_0005746_760_1971 384
638 3300046454 Ga0495592_0000533 Ga0495592_0000533_11692_12975 384
639 3300046454 Ga0495592_0022151 Ga0495592_0022151_1272_2477 384
640 3300046459 Ga0495629_0108593 Ga0495629_0108593_198_1403 384
641 3300046461 Ga0495641_0064723 Ga0495641_0064723_276_1481 384
642 3300046462 Ga0495651_0000122 Ga0495651_0000122_52824_54056 384
643 3300046462 Ga0495651_0009308 Ga0495651_0009308_4301_5506 384
644 3300046462 Ga0495651_0012823 Ga0495651_0012823_4193_5488 384
645 3300046473 Ga0495582_0112530 Ga0495582_0112530_262_1467 384
646 3300046476 Ga0495662_0000937 Ga0495662_0000937_4070_5353 384
647 3300046476 Ga0495662_0030153 Ga0495662_0030153_863_2068 384
648 3300046477 Ga0495664_0002583 Ga0495664_0002583_3708_4991 384
649 3300046511 Ga0495608_0001351 Ga0495608_0001351_7080_8363 384
650 3300046514 Ga0495618_0038890 Ga0495618_0038890_286_1491 384
651 3300046516 Ga0495628_0004846 Ga0495628_0004846_4174_5406 384
652 3300046517 Ga0495630_0022340 Ga0495630_0022340_1312_2517 384
653 3300046526 Ga0495666_0000566 Ga0495666_0000566_2835_4118 384
654 3300046526 Ga0495666_0069062 Ga0495666_0069062_27_1232 384
655 3300046529 Ga0495652_0000719 Ga0495652_0000719_31325_32557 384
656 3300046531 Ga0495665_0005751 Ga0495665_0005751_2367_3662 384
657 3300046533 Ga0495640_0152436 Ga0495640_0152436_115_1320 384
658 3300046536 Ga0495587_0003107 Ga0495587_0003107_3504_4709 384
659 3300046543 Ga0495645_0005319 Ga0495645_0005319_6750_8033 384
660 3300046559 Ga0495667_0053430 Ga0495667_0053430_1238_2533 384
661 3300046642 Ga0495634_0030978 Ga0495634_0030978_2149_3432 384
662 3300046674 Ga0495588_0019465 Ga0495588_0019465_1952_3157 384
663 3300046675 Ga0495657_0005834 Ga0495657_0005834_2509_3804 384
664 3300046675 Ga0495657_0016427 Ga0495657_0016427_1961_3166 384
665 3300046678 Ga0495599_0004312 Ga0495599_0004312_2940_4223 384
666 3300046678 Ga0495599_0011835 Ga0495599_0011835_1434_2639 384
667 3300046679 Ga0495623_0070073 Ga0495623_0070073_774_2057 384
668 3300046689 Ga0495613_0005276 Ga0495613_0005276_8073_9368 384
669 3300046691 Ga0495670_0002891 Ga0495670_0002891_2854_4101 384
670 3300046809 Ga0495600_0010944 Ga0495600_0010944_3332_4564 384
671 3300047315 Ga0495581_0010688 Ga0495581_0010688_336_1619 384
672 3300047317 Ga0495604_0003940 Ga0495604_0003940_4193_5476 384
673 3300047318 Ga0495636_0051845 Ga0495636_0051845_396_1619 384
674 3300047443 Ga0495687_011320 Ga0495687_011320_96_1343 384
675 3300047447 Ga0495685_000392 Ga0495685_000392_7041_8288 384
676 3300047470 Ga0495681_0002275 Ga0495681_0002275_4136_5383 384
677 3300047673 Ga0495593_0004801 Ga0495593_0004801_2031_3314 384
678 3300048088 Ga0495602_0204549 Ga0495602_0204549_81_1376 384
679 3300048903 Ga0496100_0038132 Ga0496100_0038132_515_1717 384
680 3300048904 Ga0496101_0033560 Ga0496101_0033560_558_1760 384
681 3300048905 Ga0496102_0000390 Ga0496102_0000390_38226_39428 384
682 3300048906 Ga0496103_0001526 Ga0496103_0001526_1206_2408 384
683 3300048906 Ga0496103_0052104 Ga0496103_0052104_1134_2354 384
684 3300048907 Ga0496104_0032787 Ga0496104_0032787_150_1379 384
685 3300048907 Ga0496104_0176118 Ga0496104_0176118_696_1916 384
686 3300048908 Ga0496105_0013023 Ga0496105_0013023_4940_6169 384
687 3300048910 Ga0496107_0040038 Ga0496107_0040038_1841_3043 384
688 3300048911 Ga0496108_0011376 Ga0496108_0011376_2557_3786 384
689 3300048912 Ga0496109_0039196 Ga0496109_0039196_2055_3284 384
690 3300048914 Ga0496111_0012250 Ga0496111_0012250_3918_5138 384
691 3300048914 Ga0496111_0073581 Ga0496111_0073581_66_1295 384
692 3300048917 Ga0496114_0011531 Ga0496114_0011531_5366_6580 384
693 3300048920 Ga0496117_0000430 Ga0496117_0000430_15055_16257 384
694 3300048921 Ga0496118_0000165 Ga0496118_0000165_54552_55754 384
695 3300048924 Ga0496121_0001920 Ga0496121_0001920_22956_24158 384
696 3300048929 Ga0496126_0000807 Ga0496126_0000807_49326_50528 384
697 3300049569 Ga0501032_0021656 Ga0501032_0021656_2928_4118 384
698 3300049571 Ga0501034_0006280 Ga0501034_0006280_4098_5297 384
699 3300049571 Ga0501034_0018107 Ga0501034_0018107_3875_5065 384
700 3300049571 Ga0501034_0101386 Ga0501034_0101386_1160_2431 384
701 3300049572 Ga0501036_0005010 Ga0501036_0005010_1548_2747 384
702 3300049572 Ga0501036_0030059 Ga0501036_0030059_56_1246 384
703 3300049573 Ga0501037_0146465 Ga0501037_0146465_300_1490 384
704 3300049574 Ga0501038_0007390 Ga0501038_0007390_4344_5534 384
705 3300049574 Ga0501038_0020374 Ga0501038_0020374_2419_3618 384
706 3300049574 Ga0501038_0051215 Ga0501038_0051215_1741_3012 384
707 3300049575 Ga0501039_0042197 Ga0501039_0042197_1695_2894 384
708 3300049578 Ga0501042_0012037 Ga0501042_0012037_1359_2558 384
709 3300049578 Ga0501042_0013605 Ga0501042_0013605_3202_4416 384
710 3300049579 Ga0501043_0006736 Ga0501043_0006736_2374_3573 384
711 3300049579 Ga0501043_0008776 Ga0501043_0008776_200_1540 384
712 3300049579 Ga0501043_0022918 Ga0501043_0022918_394_1665 384
713 3300049581 Ga0501047_0000036 Ga0501047_0000036_190524_191738 384
714 3300049581 Ga0501047_0149958 Ga0501047_0149958_705_1976 384
715 3300049581 Ga0501047_0240166 Ga0501047_0240166_259_1458 384
716 3300049582 Ga0501048_0014537 Ga0501048_0014537_1244_2443 384
717 3300049590 Ga0501074_0013224 Ga0501074_0013224_799_1998 384
718 3300049822 Ga0501035_0009695 Ga0501035_0009695_5443_6633 384
719 3300049823 Ga0501044_0123582 Ga0501044_0123582_1151_2341 384
720 3300049823 Ga0501044_0316755 Ga0501044_0316755_149_1348 384
721 3300049824 Ga0501045_0134898 Ga0501045_0134898_254_1444 384
722 3300050512 nmdc:mga0n895_311622_c1 nmdc:mga0n895_311622_c1_82_1290 384
723 3300053084 Ga0495595_0006578 Ga0495595_0006578_2448_3653 384
724 3300053085 Ga0495619_0020510 Ga0495619_0020510_817_2112 384
725 3300053085 Ga0495619_0051391 Ga0495619_0051391_281_1486 384
726 3300053086 Ga0500578_0008906 Ga0500578_0008906_2001_3248 384
727 3300053099 Ga0500654_016403 Ga0500654_016403_752_1999 384
728 3300053129 Ga0500628_002455 Ga0500628_002455_1619_2866 384
729 3300053131 Ga0500652_001499 Ga0500652_001499_3826_5073 384
730 3300053134 Ga0500658_0003539 Ga0500658_0003539_2983_4230 384
731 3300053137 Ga0500561_0000193 Ga0500561_0000193_5448_6695 384
732 3300053140 Ga0500573_0044559 Ga0500573_0044559_924_2147 384
733 3300053140 Ga0500573_0053749 Ga0500573_0053749_357_1565 384
734 3300053143 Ga0500579_059051 Ga0500579_059051_135_1382 384
735 3300053149 Ga0500600_0017781 Ga0500600_0017781_1611_2858 384
736 3300053153 Ga0500616_0014012 Ga0500616_0014012_1559_2806 384
737 3300053153 Ga0500616_0030361 Ga0500616_0030361_352_1563 384
738 3300053732 Ga0500656_000058 Ga0500656_000058_4294_5541 384
739 iso_pu_bacteria 2643221714 2644626223 384
740 iso_pu_bacteria 2744054611 2744955509 384
741 iso_pu_bacteria 2818991472 2819746613 384
742 3300025302 Ga0207426_1005429 Ga0207426_10054293 385
743 3300044765 Ga0466970_0012016 Ga0466970_0012016_2563_3777 385
744 3300044765 Ga0466970_0045069 Ga0466970_0045069_1008_2219 385
745 3300044842 Ga0466957_0010103 Ga0466957_0010103_2651_3865 385
746 3300044901 Ga0466960_0004305 Ga0466960_0004305_1930_3144 385
747 3300045976 Ga0466967_0077240 Ga0466967_0077240_1680_2894 385
748 iso_pu_bacteria 2751185725 2753038906 385
749 iso_pu_bacteria 2751185792 2753327554 385
750 iso_pu_bacteria 2773857762 2774394573 385
751 iso_pu_bacteria 2811994878 2812349324 385
752 iso_pu_bacteria 2891968417 2891972973 385
753 3300002067 JGI24735J21928_10013366 JGI24735J21928_100133662 386
754 3300035091 Ga0373951_0000001 Ga0373951_0000001_43191_44399 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

37

366

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tlc-assembly1.cif.gz_C crystal structure of bdsa from bacillus subtilis wu-s2b 0.8788 1 377
1yw1-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis in complex with fmn 0.8656 1 379
1tvl-assembly1.cif.gz_A-2 structure of ytnj from bacillus subtilis 0.865 1 380
5tlc-assembly1.cif.gz_A crystal structure of bdsa from bacillus subtilis wu-s2b 0.8611 1 377
5xkd-assembly1.cif.gz_B crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom 0.8607 1 379
ID Description Score Start End Superfamily
3b9oB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8649 1 375 3.20.20.30
6aslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8627 1 380 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8589 1 384 3.20.20.30
5w4zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8569 1 374 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8567 1 377 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4D4MJE8-F1-model_v4 Luciferase-like domain-containing protein 0.9746 225 386 GO:0016705
AF-A0A2N0EJI5-F1-model_v4 deleted 0.9739 1 386
AF-A0A2N0EJI5-F1-model_v4 deleted 0.9714 1 386
AF-A0A4D4KQ35-F1-model_v4 Luciferase-like domain-containing protein 0.9655 153 386 GO:0016705
AF-D5SKF5-F1-model_v4 Putative FMNH2-utilizing oxygenase 0.9646 1 383 GO:0004497
GO:0016705

Feature Viewer

pLDDT pTM Quality
92.67 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map