F479209

General Info

Members Datasets Scaffolds Average Seq Length
753 426 684 401

Family's Representative Sequence

Representative Sequence 3300025711|Ga0207696_1000315|Ga0207696_100031522
Length 395
Sequence MALPLEGLRVIEMGQLIAGPMAGRMLAEFGADVIKIEPPGKGDPLRKWRMLHNGTSVWWAAQSRNKRSVTVDLRQPEGQQIAMSLLNSADVLIENFRPGTLEKWGLSWETLHANNPRLIVLSVSGYGQTGPYRDRPGFGVIGEAMGGLRHLSGEPNRTPVRVGVSIGDSLSALHGVIGVLLALQSRETTDQGQQIDVALYESVFNMMESLIPEYSVFDHIRQPAGSSLPGIAPTNAYRCKDGKYALVAGNGDSIFQRLMQIIDRPDLAADPALAHNDGRVKQVEMLDAAIGEWTSQRSLQEVLASLNEGGIPAGKIYDAADIANDPHYKARDMLLPAQLSDGTPVTLPGIVPKLLSTPGSVRHAAPELGQHTEEVLSELGIDAKQRMVLKEKGAV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
10 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
13 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
14 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
18 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
19 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
20 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
21 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
22 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
23 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
24 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
25 2765235841 Pseudomonas putida AA7 Isolate Unclassified
26 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
27 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
28 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
29 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
30 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
31 2818991452 Burkholderia cepacia 561 Isolate Unclassified
32 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
33 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
34 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
35 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
36 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
37 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
38 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
39 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
40 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
41 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
42 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
43 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
44 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
45 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
46 2904564687 Burkholderia sp. 571 Isolate Unclassified
47 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
48 2928058823 Ralstonia sp. 1138 Isolate Unclassified
49 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
50 2928163908 Burkholderia sp. 567 Isolate Unclassified
51 2928170801 Burkholderia sp. 572 Isolate Unclassified
52 2928536128 Burkholderia sola 565 Isolate Unclassified
53 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
54 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
55 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
58 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
62 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
63 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
64 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
65 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
72 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
108 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
173 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
351 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
352 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
353 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
374 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
409 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
416 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
417 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
418 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
419 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
420 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
421 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
422 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
423 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
424 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
425 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
426 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.84
Metatranscriptomes 0
Isolates 9.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.08
Nodule 1.33
Rhizoplane 4.12
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003791 3300001915 Bacteria 3504
2 JGI24740J21852_10000337 3300001979 Bacteria 19914
3 JGI24740J21852_10003034 3300001979 Bacteria 7429
4 JGI24735J21928_10002372 3300002067 Bacteria 6558
5 JGI25156J39149_1004600 3300002705 Bacteria 4165
6 JGI25156J39149_1009239 3300002705 Bacteria 2411
7 JGI25154J39366_1002132 3300002738 Bacteria 5539
8 JGI25151J46595_10001217 3300003187 Bacteria 18394
9 Ga0055539_1000172 3300003752 Bacteria 56105
10 Ga0055533_1003919 3300003756 Bacteria 2824
11 Ga0055532_1000002 3300003758 Bacteria 576000
12 Ga0055532_1000029 3300003758 Bacteria 232900
13 Ga0055532_1000190 3300003758 Bacteria 51412
14 Ga0055532_1000529 3300003758 Bacteria 16669
15 Ga0055527_1000291 3300003760 Bacteria 29060
16 Ga0055527_1002226 3300003760 Bacteria 3399
17 Ga0055535_1000506 3300003761 Bacteria 34557
18 Ga0055542_1000502 3300003762 Bacteria 35790
19 Ga0055542_1000698 3300003762 Bacteria 26527
20 Ga0055529_1000062 3300003763 Bacteria 183782
21 Ga0055529_1000495 3300003763 Bacteria 35799
22 Ga0055526_1006276 3300003771 Bacteria 6503
23 Ga0055526_1006341 3300003771 Bacteria 6450
24 Ga0055526_1015551 3300003771 Bacteria 3048
25 Ga0055524_1001369 3300003775 Bacteria 14151
26 Ga0055536_1001508 3300003781 Bacteria 13983
27 Ga0055534_1000957 3300003784 Bacteria 12821
28 Ga0055534_1001648 3300003784 Bacteria 8615
29 Ga0055528_1001289 3300003790 Bacteria 15738
30 Ga0055540_1017091 3300003792 Bacteria 2036
31 Ga0055531_10000103 3300003794 Bacteria 92298
32 Ga0055541_1001062 3300003841 Bacteria 6341
33 Ga0055541_1001256 3300003841 Bacteria 5595
34 Ga0065715_10111222 3300005293 Bacteria 2583
35 Ga0070658_10057021 3300005327 Bacteria 3177
36 Ga0070683_100108050 3300005329 Bacteria 2623
37 Ga0070670_100026828 3300005331 Bacteria 4955
38 Ga0070677_10006985 3300005333 Bacteria 3754
39 Ga0070677_10008896 3300005333 Bacteria 3392
40 Ga0068869_100012126 3300005334 Bacteria 5684
41 Ga0070666_10005794 3300005335 Bacteria 7591
42 Ga0068868_100023978 3300005338 Bacteria 4624
43 Ga0070660_100001233 3300005339 Bacteria 17366
44 Ga0070689_100001884 3300005340 Bacteria 13536
45 Ga0070661_100000139 3300005344 Bacteria 60942
46 Ga0070661_100098567 3300005344 Bacteria 2171
47 Ga0070675_100003197 3300005354 Bacteria 12414
48 Ga0070671_100001524 3300005355 Bacteria 17379
49 Ga0070671_100003066 3300005355 Bacteria 12990
50 Ga0070674_100003404 3300005356 Bacteria 8917
51 Ga0070674_100084719 3300005356 Bacteria 2273
52 Ga0070674_100250000 3300005356 Bacteria 1392
53 Ga0070673_100013700 3300005364 Bacteria 5621
54 Ga0070688_100001410 3300005365 Bacteria 11981
55 Ga0070659_100000055 3300005366 Bacteria 88573
56 Ga0070667_100023292 3300005367 Bacteria 5136
57 Ga0070713_100002763 3300005436 Bacteria 11475
58 Ga0070713_100038587 3300005436 Bacteria 3871
59 Ga0070708_100089422 3300005445 Bacteria 2802
60 Ga0070663_100000006 3300005455 Bacteria 208068
61 Ga0070678_100020790 3300005456 Bacteria 4312
62 Ga0070681_10281856 3300005458 Bacteria 1572
63 Ga0068867_100018155 3300005459 Bacteria 4999
64 Ga0070685_10003558 3300005466 Bacteria 7906
65 Ga0070706_100067089 3300005467 Bacteria 3318
66 Ga0070699_100071995 3300005518 Bacteria 3006
67 Ga0070699_100118904 3300005518 Bacteria 2323
68 Ga0070679_100028419 3300005530 Bacteria 5513
69 Ga0070679_100215154 3300005530 Bacteria 1884
70 Ga0070697_100028101 3300005536 Bacteria 4502
71 Ga0070672_100000953 3300005543 Bacteria 17436
72 Ga0070686_100034566 3300005544 Bacteria 3116
73 Ga0070696_100067834 3300005546 Bacteria 2503
74 Ga0070693_100003097 3300005547 Bacteria 7716
75 Ga0070693_100155354 3300005547 Bacteria 1452
76 Ga0070665_100009891 3300005548 Bacteria 9644
77 Ga0070665_100331014 3300005548 Bacteria 1528
78 Ga0068855_100034447 3300005563 Bacteria 6039
79 Ga0068855_100046124 3300005563 Bacteria 5153
80 Ga0068855_100146546 3300005563 Bacteria 2687
81 Ga0070664_100000002 3300005564 Bacteria 458815
82 Ga0068857_100063245 3300005577 Bacteria 3289
83 Ga0068854_100005888 3300005578 Bacteria 7765
84 Ga0068856_100000028 3300005614 Bacteria 131498
85 Ga0068852_100280880 3300005616 Bacteria 1605
86 Ga0068859_100003773 3300005617 Bacteria 15457
87 Ga0068864_100048425 3300005618 Bacteria 3654
88 Ga0068864_100083801 3300005618 Bacteria 2800
89 Ga0068866_10001012 3300005718 Bacteria 12361
90 Ga0068851_10005934 3300005834 Bacteria 5559
91 Ga0068870_10005349 3300005840 Bacteria 5601
92 Ga0068863_100045739 3300005841 Bacteria 4154
93 Ga0068858_100074430 3300005842 Bacteria 3153
94 Ga0068860_100050284 3300005843 Bacteria 3968
95 Ga0075364_10004775 3300006051 Bacteria 7835
96 Ga0075364_10007506 3300006051 Bacteria 6482
97 Ga0075364_10052558 3300006051 Bacteria 2662
98 Ga0075364_10064415 3300006051 Bacteria 2406
99 Ga0075432_10007080 3300006058 Bacteria 3820
100 Ga0075362_10040477 3300006177 Bacteria 2052
101 Ga0075369_10059343 3300006186 Bacteria 1667
102 Ga0075366_10087875 3300006195 Bacteria 1861
103 Ga0097621_100004800 3300006237 Bacteria 9461
104 Ga0097621_100056426 3300006237 Bacteria 3209
105 Ga0097621_100197600 3300006237 Bacteria 1744
106 Ga0068871_100043084 3300006358 Bacteria 3625
107 Ga0097620_100003773 3300006931 Bacteria 15457
108 Ga0099826_10000020 3300006948 Bacteria 183920
109 Ga0105251_10000066 3300009011 Bacteria 99856
110 Ga0105251_10000193 3300009011 Bacteria 61489
111 Ga0105251_10012171 3300009011 Bacteria 4881
112 Ga0105244_10057966 3300009036 Bacteria 1956
113 Ga0105250_10000033 3300009092 Bacteria 157956
114 Ga0105250_10000676 3300009092 Bacteria 21455
115 Ga0105240_10000229 3300009093 Bacteria 111182
116 Ga0105240_10023042 3300009093 Bacteria 8247
117 Ga0105245_10220655 3300009098 Bacteria 1829
118 Ga0105243_10044088 3300009148 Bacteria 3498
119 Ga0105248_10126581 3300009177 Bacteria 2882
120 Ga0105237_10180336 3300009545 Bacteria 2112
121 Ga0105238_10134059 3300009551 Bacteria 2455
122 Ga0105249_10201881 3300009553 Bacteria 1946
123 Ga0105239_10007284 3300010375 Bacteria 12699
124 Ga0105239_10350890 3300010375 Bacteria 1666
125 Ga0157371_10000204 3300013102 Bacteria 86751
126 Ga0157370_10000013 3300013104 Bacteria 198861
127 Ga0157369_10000268 3300013105 Bacteria 70336
128 Ga0157369_10002173 3300013105 Bacteria 23616
129 Ga0157374_10000738 3300013296 Bacteria 28535
130 Ga0157378_10037531 3300013297 Bacteria 4292
131 Ga0163162_10022743 3300013306 Bacteria 6180
132 Ga0163162_10036327 3300013306 Bacteria 4909
133 Ga0163162_10106478 3300013306 Bacteria 2899
134 Ga0157372_10000067 3300013307 Bacteria 111621
135 Ga0157372_10003463 3300013307 Bacteria 17027
136 Ga0157375_10005538 3300013308 Bacteria 10989
137 Ga0157375_10046595 3300013308 Bacteria 4229
138 Ga0163163_10055183 3300014325 Bacteria 3927
139 Ga0157380_10040298 3300014326 Bacteria 3637
140 Ga0182008_10000089 3300014497 Bacteria 69969
141 Ga0182008_10007326 3300014497 Bacteria 6101
142 Ga0157377_10065508 3300014745 Bacteria 2087
143 Ga0157379_10049696 3300014968 Bacteria 3744
144 Ga0157376_10038338 3300014969 Bacteria 3898
145 Ga0157376_10260176 3300014969 Bacteria 1625
146 Ga0182006_1005940 3300015261 Bacteria 5739
147 Ga0182006_1024466 3300015261 Bacteria 2490
148 Ga0182007_10000583 3300015262 Bacteria 21488
149 Ga0182005_1004316 3300015265 Bacteria 4619
150 Ga0163161_10084311 3300017792 Bacteria 2343
151 Ga0209784_100003 3300025224 Bacteria 1379451
152 Ga0209784_100343 3300025224 Bacteria 22887
153 Ga0209566_100002 3300025225 Bacteria 2614868
154 Ga0209566_100258 3300025225 Bacteria 50542
155 Ga0209566_100385 3300025225 Bacteria 35723
156 Ga0209566_101097 3300025225 Bacteria 10503
157 Ga0209674_100008 3300025226 Bacteria 1076909
158 Ga0209674_100217 3300025226 Bacteria 55436
159 Ga0209672_100052 3300025228 Bacteria 231179
160 Ga0209672_100080 3300025228 Bacteria 143481
161 Ga0209672_100190 3300025228 Bacteria 49762
162 Ga0209147_100002 3300025229 Bacteria 2158988
163 Ga0209147_100071 3300025229 Bacteria 215861
164 Ga0209147_100091 3300025229 Bacteria 168353
165 Ga0209563_100004 3300025230 Bacteria 1814108
166 Ga0209258_100002 3300025242 Bacteria 2158988
167 Ga0209258_100082 3300025242 Bacteria 247739
168 Ga0209646_1000022 3300025246 Bacteria 446621
169 Ga0209677_100009 3300025253 Bacteria 749530
170 Ga0209148_1000021 3300025254 Bacteria 714645
171 Ga0209148_1000195 3300025254 Bacteria 109654
172 Ga0209148_1003376 3300025254 Bacteria 4465
173 Ga0209759_1004919 3300025256 Bacteria 4836
174 Ga0209759_1005957 3300025256 Bacteria 4165
175 Ga0209759_1006874 3300025256 Bacteria 3759
176 Ga0209759_1010101 3300025256 Bacteria 2791
177 Ga0209565_1000092 3300025263 Bacteria 141563
178 Ga0209565_1006597 3300025263 Bacteria 3234
179 Ga0209565_1007190 3300025263 Bacteria 3029
180 Ga0209455_1000021 3300025272 Bacteria 699993
181 Ga0209455_1000172 3300025272 Bacteria 109654
182 Ga0209673_1000076 3300025273 Bacteria 230907
183 Ga0209673_1014539 3300025273 Bacteria 3041
184 Ga0209675_1000809 3300025291 Bacteria 20627
185 Ga0209675_1000951 3300025291 Bacteria 18424
186 Ga0209676_1000012 3300025292 Bacteria 841431
187 Ga0209025_1000892 3300025294 Bacteria 46436
188 Ga0209025_1001159 3300025294 Bacteria 37305
189 Ga0209025_1001484 3300025294 Bacteria 30443
190 Ga0209564_1001095 3300025295 Bacteria 32240
191 Ga0209564_1002067 3300025295 Bacteria 17262
192 Ga0209564_1002203 3300025295 Bacteria 16266
193 Ga0209050_1001574 3300025298 Bacteria 23699
194 Ga0209256_1000804 3300025299 Bacteria 40181
195 Ga0209256_1001280 3300025299 Bacteria 27204
196 Ga0209051_1007991 3300025303 Bacteria 5680
197 Ga0209051_1012352 3300025303 Bacteria 4139
198 Ga0209051_1051666 3300025303 Bacteria 1365
199 Ga0209257_1000131 3300025304 Bacteria 211464
200 Ga0207696_1000006 3300025711 Bacteria 616498
201 Ga0207696_1000011 3300025711 Bacteria 530614
202 Ga0207696_1000315 3300025711 Bacteria 53471
203 Ga0207655_1006992 3300025728 Bacteria 7392
204 Ga0207655_1018924 3300025728 Bacteria 3628
205 Ga0207655_1051550 3300025728 Bacteria 1663
206 Ga0207713_1000193 3300025735 Bacteria 85067
207 Ga0207713_1000220 3300025735 Bacteria 76897
208 Ga0207713_1000724 3300025735 Bacteria 30902
209 Ga0207713_1021020 3300025735 Bacteria 3139
210 Ga0207682_10004153 3300025893 Bacteria 6131
211 Ga0207692_10007836 3300025898 Bacteria 4396
212 Ga0207692_10036111 3300025898 Bacteria 2406
213 Ga0207688_10023056 3300025901 Bacteria 3406
214 Ga0207647_10001075 3300025904 Bacteria 21061
215 Ga0207643_10046640 3300025908 Bacteria 2450
216 Ga0207654_10011228 3300025911 Bacteria 4565
217 Ga0207695_10000268 3300025913 Bacteria 130752
218 Ga0207695_10000887 3300025913 Bacteria 54367
219 Ga0207695_10020055 3300025913 Bacteria 7672
220 Ga0207695_10321155 3300025913 Bacteria 1438
221 Ga0207671_10028223 3300025914 Bacteria 4195
222 Ga0207693_10002196 3300025915 Bacteria 17012
223 Ga0207657_10000087 3300025919 Bacteria 88335
224 Ga0207657_10011384 3300025919 Bacteria 8835
225 Ga0207649_10000193 3300025920 Bacteria 50158
226 Ga0207646_10105089 3300025922 Bacteria 2532
227 Ga0207681_10020045 3300025923 Bacteria 4234
228 Ga0207694_10053281 3300025924 Bacteria 3137
229 Ga0207650_10006798 3300025925 Bacteria 7799
230 Ga0207659_10014205 3300025926 Bacteria 5126
231 Ga0207687_10002320 3300025927 Bacteria 12955
232 Ga0207687_10020309 3300025927 Bacteria 4406
233 Ga0207700_10032497 3300025928 Bacteria 3723
234 Ga0207700_10155982 3300025928 Bacteria 1892
235 Ga0207664_10002534 3300025929 Bacteria 12077
236 Ga0207644_10002683 3300025931 Bacteria 11462
237 Ga0207690_10000071 3300025932 Bacteria 88665
238 Ga0207706_10100452 3300025933 Bacteria 2545
239 Ga0207686_10002219 3300025934 Bacteria 10675
240 Ga0207670_10001236 3300025936 Bacteria 13493
241 Ga0207670_10206634 3300025936 Bacteria 1495
242 Ga0207669_10024534 3300025937 Bacteria 3243
243 Ga0207669_10226601 3300025937 Bacteria 1376
244 Ga0207691_10002659 3300025940 Bacteria 17461
245 Ga0207691_10065039 3300025940 Bacteria 3302
246 Ga0207711_10000575 3300025941 Bacteria 37379
247 Ga0207689_10029614 3300025942 Bacteria 4569
248 Ga0207679_10000001 3300025945 Bacteria 777444
249 Ga0207667_10013868 3300025949 Bacteria 9207
250 Ga0207667_10033641 3300025949 Bacteria 5510
251 Ga0207667_10034860 3300025949 Bacteria 5402
252 Ga0207667_10141406 3300025949 Bacteria 2478
253 Ga0207667_10146335 3300025949 Bacteria 2432
254 Ga0207651_10011371 3300025960 Bacteria 4981
255 Ga0207640_10004206 3300025981 Bacteria 7787
256 Ga0207658_10030107 3300025986 Bacteria 3840
257 Ga0207677_10001768 3300026023 Bacteria 11425
258 Ga0207703_10000698 3300026035 Bacteria 33208
259 Ga0207639_10024300 3300026041 Bacteria 4384
260 Ga0207678_10000001 3300026067 Bacteria 433184
261 Ga0207702_10000009 3300026078 Bacteria 305906
262 Ga0207702_10048011 3300026078 Bacteria 3599
263 Ga0207641_10007478 3300026088 Bacteria 9091
264 Ga0207648_10004573 3300026089 Bacteria 14185
265 Ga0207676_10000116 3300026095 Bacteria 71614
266 Ga0207674_10013504 3300026116 Bacteria 9056
267 Ga0207674_10034484 3300026116 Bacteria 5289
268 Ga0207675_100217128 3300026118 Bacteria 1841
269 Ga0207683_10002532 3300026121 Bacteria 15950
270 Ga0207683_10003557 3300026121 Bacteria 13592
271 Ga0207698_10009359 3300026142 Bacteria 6244
272 Ga0207698_10056534 3300026142 Bacteria 3030
273 Ga0207698_10166004 3300026142 Bacteria 1937
274 Ga0207698_10306960 3300026142 Bacteria 1480
275 Ga0209371_1000713 3300027312 Bacteria 28089
276 Ga0209282_1000045 3300027666 Bacteria 118401
277 Ga0207428_10001135 3300027907 Bacteria 28911
278 Ga0207428_10086747 3300027907 Bacteria 2436
279 Ga0268266_10304791 3300028379 Bacteria 1487
280 Ga0268264_10035740 3300028381 Bacteria 4090
281 Ga0265338_10000191 3300028800 Bacteria 115408
282 Ga0265338_10000708 3300028800 Bacteria 56942
283 Ga0268256_1000608 3300030500 Bacteria 28089
284 Ga0307511_10062662 3300030521 Bacteria 2819
285 Ga0265330_10077406 3300031235 Bacteria 1435
286 Ga0307513_10005621 3300031456 Bacteria 16528
287 Ga0307408_100067387 3300031548 Bacteria 2632
288 Ga0373934_0002351 3300035086 Bacteria 6962
289 Ga0373956_0017678 3300035119 Bacteria 3010
290 Ga0373957_0005251 3300035120 Bacteria 4010
291 Ga0373943_0053725 3300035170 Bacteria 1990
292 Ga0373955_0033709 3300035172 Bacteria 2699
293 Ga0373935_0066948 3300035692 Bacteria 2308
294 Ga0373927_0107920 3300035695 Bacteria 1813
295 Ga0373947_0062862 3300035725 Bacteria 2260
296 Ga0373947_0063369 3300035725 Bacteria 2252
297 Ga0373937_0155057 3300036401 Bacteria 2146
298 Ga0373925_0032256 3300037068 Bacteria 3855
299 Ga0373925_0118780 3300037068 Bacteria 2050
300 Ga0395899_0016095 3300037312 Bacteria 5701
301 Ga0395899_0020452 3300037312 Bacteria 5017
302 Ga0395899_0027741 3300037312 Bacteria 4266
303 Ga0395899_0066258 3300037312 Bacteria 2652
304 Ga0395900_0000015 3300037418 Bacteria 384313
305 Ga0395900_0028321 3300037418 Bacteria 5737
306 Ga0395900_0032503 3300037418 Bacteria 5366
307 Ga0395900_0051302 3300037418 Bacteria 4250
308 Ga0395900_0071864 3300037418 Bacteria 3557
309 Ga0395900_0083714 3300037418 Bacteria 3277
310 Ga0395900_0112904 3300037418 Bacteria 2789
311 Ga0395898_0000346 3300037466 Bacteria 104661
312 Ga0395898_0011051 3300037466 Bacteria 9405
313 Ga0395898_0037403 3300037466 Bacteria 4814
314 Ga0395905_0014748 3300037471 Bacteria 7451
315 Ga0395905_0039553 3300037471 Bacteria 4424
316 Ga0395901_0000121 3300038443 Bacteria 100690
317 Ga0395901_0000769 3300038443 Bacteria 35972
318 Ga0395901_0002848 3300038443 Bacteria 17463
319 Ga0395901_0033333 3300038443 Bacteria 5317
320 Ga0439436_0009175 3300041404 Bacteria 3035
321 Ga0439438_011366 3300041405 Bacteria 2777
322 Ga0439447_009243 3300041407 Bacteria 3002
323 Ga0439452_004263 3300042010 Bacteria 4833
324 Ga0439463_000427 3300042016 Bacteria 11745
325 Ga0451577_0021281 3300042876 Bacteria 5937
326 Ga0451577_0206717 3300042876 Bacteria 1773
327 Ga0466969_0006727 3300044656 Bacteria 6112
328 Ga0466969_0010542 3300044656 Bacteria 4898
329 Ga0466972_0014184 3300044658 Bacteria 3994
330 Ga0466965_0002678 3300044683 Bacteria 7620
331 Ga0466966_0000834 3300044684 Bacteria 19673
332 Ga0466966_0029902 3300044684 Bacteria 3541
333 Ga0466966_0089514 3300044684 Bacteria 1912
334 Ga0466961_0001499 3300044693 Bacteria 14488
335 Ga0466961_0036305 3300044693 Bacteria 3164
336 Ga0466961_0105456 3300044693 Bacteria 1774
337 Ga0466963_0004481 3300044694 Bacteria 8126
338 Ga0466964_0003807 3300044706 Bacteria 5531
339 Ga0453684_0081161 3300044712 Bacteria 4046
340 Ga0466971_0002200 3300044719 Bacteria 8246
341 Ga0466971_0007873 3300044719 Bacteria 4640
342 Ga0466970_0043193 3300044765 Bacteria 2398
343 Ga0466957_0012407 3300044842 Bacteria 4932
344 Ga0466957_0037623 3300044842 Bacteria 2914
345 Ga0466959_0008133 3300045049 Bacteria 7399
346 Ga0466959_0089778 3300045049 Bacteria 2207
347 Ga0466959_0093675 3300045049 Bacteria 2155
348 Ga0466958_0010655 3300045836 Bacteria 5156
349 Ga0466967_0211915 3300045976 Bacteria 1838
350 Ga0495627_000062 3300046453 Bacteria 138772
351 Ga0495627_001467 3300046453 Bacteria 13747
352 Ga0495627_006765 3300046453 Bacteria 4460
353 Ga0495603_0042619 3300046455 Bacteria 2713
354 Ga0495590_0006547 3300046457 Bacteria 4541
355 Ga0495590_0016766 3300046457 Bacteria 2643
356 Ga0495591_006793 3300046458 Bacteria 4981
357 Ga0495591_015464 3300046458 Bacteria 2695
358 Ga0495629_0000456 3300046459 Bacteria 34095
359 Ga0495629_0001254 3300046459 Bacteria 19924
360 Ga0495638_0072088 3300046460 Bacteria 2112
361 Ga0495653_0000101 3300046463 Bacteria 70919
362 Ga0495653_0001150 3300046463 Bacteria 20361
363 Ga0495653_0007814 3300046463 Bacteria 8756
364 Ga0495653_0015560 3300046463 Bacteria 6200
365 Ga0495653_0237613 3300046463 Bacteria 1216
366 Ga0495650_0001466 3300046471 Bacteria 22642
367 Ga0495650_0001616 3300046471 Bacteria 21026
368 Ga0495650_0014091 3300046471 Bacteria 4186
369 Ga0495580_0004305 3300046472 Bacteria 11969
370 Ga0495580_0014143 3300046472 Bacteria 6065
371 Ga0495580_0062038 3300046472 Bacteria 2623
372 Ga0495580_0184304 3300046472 Bacteria 1441
373 Ga0495605_0000007 3300046474 Bacteria 358289
374 Ga0495605_0000470 3300046474 Bacteria 35866
375 Ga0495605_0002522 3300046474 Bacteria 11299
376 Ga0495605_0002620 3300046474 Bacteria 11041
377 Ga0495605_0003778 3300046474 Bacteria 8983
378 Ga0495605_0004037 3300046474 Bacteria 8664
379 Ga0495605_0041490 3300046474 Bacteria 2292
380 Ga0495662_0018336 3300046476 Bacteria 3387
381 Ga0495664_0001452 3300046477 Bacteria 12555
382 Ga0495664_0008403 3300046477 Bacteria 5760
383 Ga0495584_0000686 3300046491 Bacteria 22477
384 Ga0495584_0001410 3300046491 Bacteria 14471
385 Ga0495584_0020394 3300046491 Bacteria 3368
386 Ga0495585_0000282 3300046492 Bacteria 50936
387 Ga0495585_0004671 3300046492 Bacteria 8828
388 Ga0495594_0001267 3300046499 Bacteria 13203
389 Ga0495594_0007442 3300046499 Bacteria 5632
390 Ga0495594_0127623 3300046499 Bacteria 1440
391 Ga0495596_0000835 3300046500 Bacteria 18636
392 Ga0495596_0003319 3300046500 Bacteria 8199
393 Ga0495607_0000047 3300046501 Bacteria 121696
394 Ga0495607_0000702 3300046501 Bacteria 32246
395 Ga0495607_0005502 3300046501 Bacteria 9045
396 Ga0495607_0007690 3300046501 Bacteria 7428
397 Ga0495607_0008631 3300046501 Bacteria 6949
398 Ga0495607_0009093 3300046501 Bacteria 6753
399 Ga0495607_0020035 3300046501 Bacteria 4235
400 Ga0495583_0000007 3300046506 Bacteria 434661
401 Ga0495583_0000008 3300046506 Bacteria 411092
402 Ga0495583_0000045 3300046506 Bacteria 220503
403 Ga0495583_0000281 3300046506 Bacteria 82123
404 Ga0495583_0004924 3300046506 Bacteria 9285
405 Ga0495583_0042761 3300046506 Bacteria 2114
406 Ga0495606_0000360 3300046507 Bacteria 77832
407 Ga0495606_0036255 3300046507 Bacteria 3361
408 Ga0495610_0000402 3300046512 Bacteria 44548
409 Ga0495610_0006856 3300046512 Bacteria 7722
410 Ga0495610_0011451 3300046512 Bacteria 5421
411 Ga0495610_0015787 3300046512 Bacteria 4374
412 Ga0495616_0000456 3300046513 Bacteria 31180
413 Ga0495616_0000941 3300046513 Bacteria 20925
414 Ga0495616_0002483 3300046513 Bacteria 12208
415 Ga0495616_0008459 3300046513 Bacteria 6096
416 Ga0495620_0000399 3300046515 Bacteria 29177
417 Ga0495620_0012381 3300046515 Bacteria 4410
418 Ga0495628_0001033 3300046516 Bacteria 25478
419 Ga0495628_0001082 3300046516 Bacteria 24897
420 Ga0495630_0000888 3300046517 Bacteria 20976
421 Ga0495630_0002736 3300046517 Bacteria 12234
422 Ga0495631_0000921 3300046518 Bacteria 18335
423 Ga0495631_0003741 3300046518 Bacteria 8286
424 Ga0495632_0000037 3300046519 Bacteria 158699
425 Ga0495632_0001836 3300046519 Bacteria 17116
426 Ga0495632_0002620 3300046519 Bacteria 13548
427 Ga0495632_0010910 3300046519 Bacteria 5336
428 Ga0495632_0029184 3300046519 Bacteria 2874
429 Ga0495637_0025016 3300046520 Bacteria 2696
430 Ga0495643_0003881 3300046522 Bacteria 10742
431 Ga0495643_0005109 3300046522 Bacteria 8974
432 Ga0495643_0008753 3300046522 Bacteria 6380
433 Ga0495643_0067853 3300046522 Bacteria 1878
434 Ga0495643_0069472 3300046522 Bacteria 1851
435 Ga0495644_0000054 3300046523 Bacteria 55331
436 Ga0495648_0001650 3300046524 Bacteria 21659
437 Ga0495648_0004197 3300046524 Bacteria 12375
438 Ga0495648_0010340 3300046524 Bacteria 7115
439 Ga0495642_0001123 3300046528 Bacteria 12315
440 Ga0495642_0022089 3300046528 Bacteria 2505
441 Ga0495652_0001426 3300046529 Bacteria 26537
442 Ga0495654_0000112 3300046530 Bacteria 92528
443 Ga0495654_0000192 3300046530 Bacteria 59720
444 Ga0495654_0004712 3300046530 Bacteria 8035
445 Ga0495654_0011370 3300046530 Bacteria 4818
446 Ga0495654_0012772 3300046530 Bacteria 4507
447 Ga0495654_0016135 3300046530 Bacteria 3953
448 Ga0495665_0000030 3300046531 Bacteria 54150
449 Ga0495665_0009558 3300046531 Bacteria 5253
450 Ga0495665_0021857 3300046531 Bacteria 3440
451 Ga0495586_0037752 3300046535 Bacteria 2594
452 Ga0495587_0000835 3300046536 Bacteria 20361
453 Ga0495609_0000004 3300046538 Bacteria 697346
454 Ga0495609_0000157 3300046538 Bacteria 70102
455 Ga0495609_0000552 3300046538 Bacteria 29569
456 Ga0495609_0000681 3300046538 Bacteria 26243
457 Ga0495609_0000990 3300046538 Bacteria 20295
458 Ga0495609_0005556 3300046538 Bacteria 6583
459 Ga0495621_0001548 3300046539 Bacteria 5990
460 Ga0495621_0008601 3300046539 Bacteria 3069
461 Ga0495597_0000095 3300046542 Bacteria 78512
462 Ga0495597_0000649 3300046542 Bacteria 28252
463 Ga0495597_0003203 3300046542 Bacteria 9746
464 Ga0495597_0004447 3300046542 Bacteria 7701
465 Ga0495597_0018420 3300046542 Bacteria 3276
466 Ga0495645_0002165 3300046543 Bacteria 13342
467 Ga0495645_0053245 3300046543 Bacteria 2942
468 Ga0495622_0045432 3300046557 Bacteria 2041
469 Ga0495633_0000020 3300046558 Bacteria 227180
470 Ga0495656_0001551 3300046615 Bacteria 7510
471 Ga0495668_0019409 3300046616 Bacteria 3920
472 Ga0495668_0024153 3300046616 Bacteria 3459
473 Ga0495668_0036502 3300046616 Bacteria 2753
474 Ga0495668_0037073 3300046616 Bacteria 2730
475 Ga0495634_0000347 3300046642 Bacteria 44864
476 Ga0495611_0002446 3300046648 Bacteria 8484
477 Ga0495611_0016690 3300046648 Bacteria 3138
478 Ga0495625_0001919 3300046660 Bacteria 23507
479 Ga0495625_0002739 3300046660 Bacteria 18665
480 Ga0495625_0044650 3300046660 Bacteria 3207
481 Ga0495635_0000402 3300046663 Bacteria 27473
482 Ga0495635_0015624 3300046663 Bacteria 5303
483 Ga0495659_0000002 3300046664 Bacteria 176698
484 Ga0495659_0000864 3300046664 Bacteria 10784
485 Ga0495659_0005499 3300046664 Bacteria 3986
486 Ga0495661_0000009 3300046665 Bacteria 291327
487 Ga0495661_0000057 3300046665 Bacteria 135044
488 Ga0495661_0000154 3300046665 Bacteria 80795
489 Ga0495661_0001421 3300046665 Bacteria 20076
490 Ga0495661_0005142 3300046665 Bacteria 9326
491 Ga0495661_0016364 3300046665 Bacteria 4918
492 Ga0495661_0024161 3300046665 Bacteria 3935
493 Ga0495661_0049158 3300046665 Bacteria 2559
494 Ga0495588_0000444 3300046674 Bacteria 20968
495 Ga0495646_0000541 3300046680 Bacteria 20361
496 Ga0495646_0001894 3300046680 Bacteria 12577
497 Ga0495646_0037165 3300046680 Bacteria 3014
498 Ga0495647_0004494 3300046681 Bacteria 4535
499 Ga0495658_0055941 3300046683 Bacteria 2248
500 Ga0495669_0000798 3300046684 Bacteria 13461
501 Ga0495613_0044673 3300046689 Bacteria 3276
502 Ga0495613_0068317 3300046689 Bacteria 2592
503 Ga0495624_0001025 3300046690 Bacteria 22116
504 Ga0495624_0001534 3300046690 Bacteria 17859
505 Ga0495670_0001337 3300046691 Bacteria 12033
506 Ga0495670_0003007 3300046691 Bacteria 8314
507 Ga0495670_0014073 3300046691 Bacteria 3937
508 Ga0495671_0000949 3300046692 Bacteria 20400
509 Ga0495671_0001474 3300046692 Bacteria 15778
510 Ga0495671_0015710 3300046692 Bacteria 4050
511 Ga0495671_0046217 3300046692 Bacteria 2177
512 Ga0495671_0099905 3300046692 Bacteria 1419
513 Ga0495649_0000106 3300046694 Bacteria 74615
514 Ga0495649_0000811 3300046694 Bacteria 25193
515 Ga0495649_0053268 3300046694 Bacteria 2190
516 Ga0495589_0000790 3300046794 Bacteria 20076
517 Ga0495589_0008080 3300046794 Bacteria 5499
518 Ga0495589_0009149 3300046794 Bacteria 5151
519 Ga0495589_0013424 3300046794 Bacteria 4227
520 Ga0495600_0019540 3300046809 Bacteria 4327
521 Ga0495600_0019853 3300046809 Bacteria 4296
522 Ga0495600_0051453 3300046809 Bacteria 2689
523 Ga0495660_0000868 3300046810 Bacteria 22348
524 Ga0495660_0020126 3300046810 Bacteria 3825
525 Ga0495660_0047120 3300046810 Bacteria 2362
526 Ga0495660_0088647 3300046810 Bacteria 1611
527 Ga0495604_0008855 3300047317 Bacteria 7954
528 Ga0495604_0032162 3300047317 Bacteria 4160
529 Ga0495636_0000215 3300047318 Bacteria 22666
530 Ga0495636_0000825 3300047318 Bacteria 11427
531 Ga0495674_0000146 3300047319 Bacteria 54437
532 Ga0495674_0003028 3300047319 Bacteria 16365
533 Ga0495674_0053182 3300047319 Bacteria 3561
534 Ga0495674_0130549 3300047319 Bacteria 2117
535 Ga0495672_0000987 3300047320 Bacteria 29395
536 Ga0495672_0001850 3300047320 Bacteria 20186
537 Ga0495672_0008680 3300047320 Bacteria 7460
538 Ga0495672_0015774 3300047320 Bacteria 5117
539 Ga0495672_0074498 3300047320 Bacteria 1911
540 Ga0495672_0081539 3300047320 Bacteria 1801
541 Ga0495676_0039479 3300047321 Bacteria 3909
542 Ga0495676_0102670 3300047321 Bacteria 2112
543 Ga0495680_0094551 3300047322 Bacteria 2236
544 Ga0495683_0000003 3300047323 Bacteria 383992
545 Ga0495683_0001830 3300047323 Bacteria 13370
546 Ga0495683_0002983 3300047323 Bacteria 9991
547 Ga0495683_0006620 3300047323 Bacteria 6317
548 Ga0495683_0011307 3300047323 Bacteria 4699
549 Ga0495683_0014523 3300047323 Bacteria 4103
550 Ga0495687_000343 3300047443 Bacteria 59599
551 Ga0495687_000760 3300047443 Bacteria 34853
552 Ga0495687_001473 3300047443 Bacteria 21559
553 Ga0495687_001864 3300047443 Bacteria 18327
554 Ga0495687_003928 3300047443 Bacteria 10415
555 Ga0495677_0000158 3300047445 Bacteria 32488
556 Ga0495677_0001108 3300047445 Bacteria 10764
557 Ga0495679_000066 3300047446 Bacteria 100641
558 Ga0495679_034263 3300047446 Bacteria 1617
559 Ga0495685_000182 3300047447 Bacteria 20849
560 Ga0495685_016487 3300047447 Bacteria 2523
561 Ga0495673_0001831 3300047469 Bacteria 16045
562 Ga0495673_0017369 3300047469 Bacteria 3657
563 Ga0495673_0033721 3300047469 Bacteria 2373
564 Ga0495673_0039148 3300047469 Bacteria 2152
565 Ga0495681_0006226 3300047470 Bacteria 7867
566 Ga0495681_0006555 3300047470 Bacteria 7627
567 Ga0495681_0007514 3300047470 Bacteria 6945
568 Ga0495684_0055026 3300047471 Bacteria 3034
569 Ga0495593_0000065 3300047673 Bacteria 44613
570 Ga0495593_0000536 3300047673 Bacteria 21520
571 Ga0495593_0002680 3300047673 Bacteria 10711
572 Ga0495593_0014008 3300047673 Bacteria 4566
573 Ga0495602_0001309 3300048088 Bacteria 24538
574 Ga0495602_0035033 3300048088 Bacteria 4686
575 Ga0495602_0078149 3300048088 Bacteria 2796
576 Ga0495614_0028152 3300048089 Bacteria 2422
577 Ga0495614_0060217 3300048089 Bacteria 1631
578 Ga0495615_0015452 3300048090 Bacteria 1631
579 Ga0495626_0003714 3300048091 Bacteria 9645
580 Ga0495626_0006569 3300048091 Bacteria 6598
581 Ga0496100_0014726 3300048903 Bacteria 4548
582 Ga0496100_0039069 3300048903 Bacteria 3012
583 Ga0496101_0010506 3300048904 Bacteria 6114
584 Ga0496101_0030360 3300048904 Bacteria 3789
585 Ga0496101_0198540 3300048904 Bacteria 1550
586 Ga0496102_0000444 3300048905 Bacteria 47025
587 Ga0496102_0002302 3300048905 Bacteria 16319
588 Ga0496102_0058052 3300048905 Bacteria 3535
589 Ga0496102_0081766 3300048905 Bacteria 2979
590 Ga0496102_0149480 3300048905 Bacteria 2194
591 Ga0496103_0000290 3300048906 Bacteria 47006
592 Ga0496104_0003437 3300048907 Bacteria 13658
593 Ga0496104_0326307 3300048907 Bacteria 1448
594 Ga0496106_0000140 3300048909 Bacteria 53893
595 Ga0496106_0169118 3300048909 Bacteria 1732
596 Ga0496107_0138468 3300048910 Bacteria 1799
597 Ga0496108_0028033 3300048911 Bacteria 4658
598 Ga0496108_0064726 3300048911 Bacteria 3081
599 Ga0496109_0049325 3300048912 Bacteria 3832
600 Ga0496110_0078281 3300048913 Bacteria 2943
601 Ga0496111_0033305 3300048914 Bacteria 3674
602 Ga0496113_0062201 3300048916 Bacteria 2819
603 Ga0496114_0016737 3300048917 Bacteria 5914
604 Ga0496116_0000231 3300048919 Bacteria 103493
605 Ga0496116_0012327 3300048919 Bacteria 6990
606 Ga0496116_0044676 3300048919 Bacteria 3007
607 Ga0496117_0002099 3300048920 Bacteria 26226
608 Ga0496117_0005335 3300048920 Bacteria 13552
609 Ga0496117_0053201 3300048920 Bacteria 2847
610 Ga0496117_0055939 3300048920 Bacteria 2753
611 Ga0496118_0000106 3300048921 Bacteria 155884
612 Ga0496118_0004391 3300048921 Bacteria 16756
613 Ga0496118_0007473 3300048921 Bacteria 11565
614 Ga0496118_0011493 3300048921 Bacteria 8631
615 Ga0496118_0047266 3300048921 Bacteria 3337
616 Ga0496121_0000540 3300048924 Bacteria 72033
617 Ga0496121_0001323 3300048924 Bacteria 42412
618 Ga0496121_0002437 3300048924 Bacteria 28448
619 Ga0496121_0008909 3300048924 Bacteria 11651
620 Ga0496121_0020875 3300048924 Bacteria 6451
621 Ga0496121_0027429 3300048924 Bacteria 5330
622 Ga0496121_0031859 3300048924 Bacteria 4808
623 Ga0496121_0065624 3300048924 Bacteria 2952
624 Ga0496121_0066924 3300048924 Bacteria 2914
625 Ga0496122_0000175 3300048925 Bacteria 153295
626 Ga0496122_0000834 3300048925 Bacteria 58431
627 Ga0496122_0001089 3300048925 Bacteria 47126
628 Ga0496122_0002004 3300048925 Bacteria 30310
629 Ga0496122_0090727 3300048925 Bacteria 2084
630 Ga0496123_0000079 3300048926 Bacteria 191201
631 Ga0496123_0001361 3300048926 Bacteria 34420
632 Ga0496123_0003257 3300048926 Bacteria 18434
633 Ga0496124_0000013 3300048927 Bacteria 484884
634 Ga0496124_0013054 3300048927 Bacteria 8136
635 Ga0496124_0167304 3300048927 Bacteria 1707
636 Ga0496125_0000038 3300048928 Bacteria 328120
637 Ga0496125_0001350 3300048928 Bacteria 36190
638 Ga0496125_0020538 3300048928 Bacteria 6197
639 Ga0496126_0000098 3300048929 Bacteria 205129
640 Ga0496126_0000122 3300048929 Bacteria 182785
641 Ga0496126_0004422 3300048929 Bacteria 16821
642 Ga0496126_0015419 3300048929 Bacteria 7689
643 Ga0496126_0051271 3300048929 Bacteria 3757
644 Ga0495678_000007 3300049459 Bacteria 448039
645 Ga0495678_000646 3300049459 Bacteria 32026
646 Ga0495678_002416 3300049459 Bacteria 12718
647 Ga0495682_0000496 3300049460 Bacteria 27218
648 Ga0495682_0000755 3300049460 Bacteria 20873
649 Ga0495682_0003020 3300049460 Bacteria 7649
650 Ga0501034_0000530 3300049571 Bacteria 60898
651 Ga0501036_0092645 3300049572 Bacteria 2553
652 Ga0501037_0007335 3300049573 Bacteria 8064
653 Ga0501040_0020294 3300049576 Bacteria 4428
654 Ga0501041_0000529 3300049577 Bacteria 19751
655 Ga0501046_0080824 3300049580 Bacteria 2511
656 Ga0501048_0132935 3300049582 Bacteria 1758
657 Ga0501070_0290581 3300049586 Bacteria 1332
658 Ga0501071_0009628 3300049587 Bacteria 6448
659 Ga0501075_0001724 3300049591 Bacteria 14360
660 Ga0501076_0003131 3300049592 Bacteria 11528
661 Ga0501079_0011452 3300049741 Bacteria 6770
662 Ga0501080_0107623 3300049742 Bacteria 2584
663 Ga0501081_0000560 3300049743 Bacteria 21149
664 Ga0501035_0013106 3300049822 Bacteria 7651
665 Ga0501044_0006710 3300049823 Bacteria 12686
666 nmdc:mga03683_7532_c1 3300050489 Bacteria 2586
667 nmdc:mga00v17_11365_c1 3300050491 Bacteria 4893
668 nmdc:mga00v17_129_c1 3300050491 Bacteria 44201
669 nmdc:mga00v17_142241_c1 3300050491 Bacteria 1539
670 nmdc:mga00v17_27043_c1 3300050491 Bacteria 3346
671 nmdc:mga0k408_6302_c1 3300050493 Bacteria 6330
672 nmdc:mga07m45_34409_c1 3300050496 Bacteria 2816
673 nmdc:mga05p37_47390_c1 3300050507 Bacteria 5285
674 nmdc:mga0a205_234993_c1 3300050515 Bacteria 1715
675 nmdc:mga0sz30_27782_c1 3300050516 Bacteria 2325
676 Ga0495601_0112602 3300053077 Bacteria 1763
677 Ga0500644_0003641 3300053088 Bacteria 3823
678 Ga0500646_0005097 3300053090 Bacteria 3328
679 Ga0500562_007741 3300053108 Bacteria 2710
680 Ga0500618_000762 3300053125 Bacteria 18214
681 Ga0500618_001214 3300053125 Bacteria 12186
682 Ga0500616_0012519 3300053153 Bacteria 4962
683 Ga0501082_0005297 3300060353 Bacteria 11213
684 Ga0466962_0001124 3300061719 Bacteria 12347

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0000038 Ga0496125_0000038_150436_151545 369
2 3300025933 Ga0207706_10100452 Ga0207706_101004522 372
3 3300044693 Ga0466961_0105456 Ga0466961_0105456_21_1139 372
4 3300046463 Ga0495653_0237613 Ga0495653_0237613_35_1153 372
5 3300046472 Ga0495580_0184304 Ga0495580_0184304_270_1388 372
6 3300046522 Ga0495643_0069472 Ga0495643_0069472_16_1134 372
7 3300046528 Ga0495642_0022089 Ga0495642_0022089_25_1143 372
8 3300046664 Ga0495659_0005499 Ga0495659_0005499_52_1170 372
9 3300046794 Ga0495589_0013424 Ga0495589_0013424_3095_4213 372
10 3300047321 Ga0495676_0039479 Ga0495676_0039479_18_1136 372
11 3300048904 Ga0496101_0198540 Ga0496101_0198540_23_1141 372
12 3300048907 Ga0496104_0326307 Ga0496104_0326307_320_1438 372
13 3300036401 Ga0373937_0155057 Ga0373937_0155057_99_1247 382
14 3300005530 Ga0070679_100028419 Ga0070679_1000284194 384
15 3300037471 Ga0395905_0039553 Ga0395905_0039553_3259_4413 384
16 3300044765 Ga0466970_0043193 Ga0466970_0043193_826_1980 384
17 3300046457 Ga0495590_0016766 Ga0495590_0016766_311_1465 384
18 3300046524 Ga0495648_0010340 Ga0495648_0010340_5713_6867 384
19 3300046542 Ga0495597_0004447 Ga0495597_0004447_1691_2845 384
20 3300046665 Ga0495661_0049158 Ga0495661_0049158_1057_2250 384
21 3300046694 Ga0495649_0053268 Ga0495649_0053268_930_2123 384
22 3300047673 Ga0495593_0014008 Ga0495593_0014008_2040_3194 384
23 3300048903 Ga0496100_0014726 Ga0496100_0014726_211_1365 384
24 3300048905 Ga0496102_0002302 Ga0496102_0002302_10538_11692 384
25 3300048916 Ga0496113_0062201 Ga0496113_0062201_940_2094 384
26 3300048924 Ga0496121_0065624 Ga0496121_0065624_1663_2817 384
27 3300003792 Ga0055540_1017091 Ga0055540_10170912 385
28 3300003794 Ga0055531_10000103 Ga0055531_1000010350 385
29 3300025298 Ga0209050_1001574 Ga0209050_100157412 385
30 3300025303 Ga0209051_1012352 Ga0209051_10123524 385
31 3300025304 Ga0209257_1000131 Ga0209257_1000131179 385
32 3300028800 Ga0265338_10000708 Ga0265338_1000070814 385
33 3300037418 Ga0395900_0083714 Ga0395900_0083714_723_1913 385
34 3300042876 Ga0451577_0021281 Ga0451577_0021281_3849_5006 385
35 iso_pu_bacteria 2904479285 2904480841 385
36 3300005293 Ga0065715_10111222 Ga0065715_101112222 386
37 3300005331 Ga0070670_100026828 Ga0070670_1000268282 386
38 3300005333 Ga0070677_10008896 Ga0070677_100088963 386
39 3300005354 Ga0070675_100003197 Ga0070675_10000319711 386
40 3300005355 Ga0070671_100001524 Ga0070671_10000152414 386
41 3300005356 Ga0070674_100003404 Ga0070674_1000034045 386
42 3300005356 Ga0070674_100084719 Ga0070674_1000847191 386
43 3300005364 Ga0070673_100013700 Ga0070673_1000137003 386
44 3300005456 Ga0070678_100020790 Ga0070678_1000207901 386
45 3300005459 Ga0068867_100018155 Ga0068867_1000181552 386
46 3300005543 Ga0070672_100000953 Ga0070672_10000095314 386
47 3300005548 Ga0070665_100331014 Ga0070665_1003310141 386
48 3300005618 Ga0068864_100048425 Ga0068864_1000484252 386
49 3300005834 Ga0068851_10005934 Ga0068851_100059342 386
50 3300005840 Ga0068870_10005349 Ga0068870_100053492 386
51 3300006177 Ga0075362_10040477 Ga0075362_100404771 386
52 3300006195 Ga0075366_10087875 Ga0075366_100878752 386
53 3300006237 Ga0097621_100004800 Ga0097621_1000048007 386
54 3300013308 Ga0157375_10005538 Ga0157375_100055388 386
55 3300014326 Ga0157380_10040298 Ga0157380_100402982 386
56 3300017792 Ga0163161_10084311 Ga0163161_100843112 386
57 3300025893 Ga0207682_10004153 Ga0207682_100041533 386
58 3300025901 Ga0207688_10023056 Ga0207688_100230562 386
59 3300025923 Ga0207681_10020045 Ga0207681_100200456 386
60 3300025925 Ga0207650_10006798 Ga0207650_100067984 386
61 3300025926 Ga0207659_10014205 Ga0207659_100142054 386
62 3300025936 Ga0207670_10206634 Ga0207670_102066341 386
63 3300025940 Ga0207691_10002659 Ga0207691_100026596 386
64 3300025960 Ga0207651_10011371 Ga0207651_100113712 386
65 3300026089 Ga0207648_10004573 Ga0207648_100045732 386
66 3300026118 Ga0207675_100217128 Ga0207675_1002171282 386
67 3300026121 Ga0207683_10003557 Ga0207683_100035576 386
68 3300026142 Ga0207698_10306960 Ga0207698_103069601 386
69 3300028379 Ga0268266_10304791 Ga0268266_103047912 386
70 3300044656 Ga0466969_0010542 Ga0466969_0010542_2113_3273 386
71 3300044683 Ga0466965_0002678 Ga0466965_0002678_5902_7062 386
72 3300044684 Ga0466966_0029902 Ga0466966_0029902_1565_2725 386
73 3300044719 Ga0466971_0007873 Ga0466971_0007873_1683_2843 386
74 3300044842 Ga0466957_0012407 Ga0466957_0012407_2957_4117 386
75 3300045049 Ga0466959_0008133 Ga0466959_0008133_976_2136 386
76 3300048925 Ga0496122_0090727 Ga0496122_0090727_902_2062 386
77 3300050489 nmdc:mga03683_7532_c1 nmdc:mga03683_7532_c1_227_1387 386
78 3300050493 nmdc:mga0k408_6302_c1 nmdc:mga0k408_6302_c1_3806_4966 386
79 3300050496 nmdc:mga07m45_34409_c1 nmdc:mga07m45_34409_c1_183_1343 386
80 3300005333 Ga0070677_10006985 Ga0070677_100069853 387
81 3300005356 Ga0070674_100250000 Ga0070674_1002500001 387
82 3300025949 Ga0207667_10033641 Ga0207667_100336412 387
83 3300046539 Ga0495621_0001548 Ga0495621_0001548_2441_3604 387
84 3300050507 nmdc:mga05p37_47390_c1 nmdc:mga05p37_47390_c1_2280_3443 387
85 3300053088 Ga0500644_0003641 Ga0500644_0003641_1638_2801 387
86 3300025928 Ga0207700_10155982 Ga0207700_101559821 388
87 iso_pu_bacteria 2808606395 2809034232 388
88 3300005518 Ga0070699_100118904 Ga0070699_1001189042 389
89 3300005563 Ga0068855_100046124 Ga0068855_1000461246 389
90 3300010375 Ga0105239_10350890 Ga0105239_103508902 389
91 3300025937 Ga0207669_10226601 Ga0207669_102266012 389
92 3300025940 Ga0207691_10065039 Ga0207691_100650393 389
93 3300025949 Ga0207667_10034860 Ga0207667_100348606 389
94 3300031235 Ga0265330_10077406 Ga0265330_100774061 389
95 3300050515 nmdc:mga0a205_234993_c1 nmdc:mga0a205_234993_c1_49_1218 389
96 3300042876 Ga0451577_0206717 Ga0451577_0206717_554_1735 390
97 3300005563 Ga0068855_100034447 Ga0068855_1000344473 391
98 3300013307 Ga0157372_10003463 Ga0157372_1000346319 391
99 3300025924 Ga0207694_10053281 Ga0207694_100532814 391
100 3300025949 Ga0207667_10141406 Ga0207667_101414063 391
101 3300026041 Ga0207639_10024300 Ga0207639_100243005 391
102 3300037466 Ga0395898_0000346 Ga0395898_0000346_9142_10332 391
103 3300005344 Ga0070661_100098567 Ga0070661_1000985672 392
104 3300013105 Ga0157369_10000268 Ga0157369_1000026811 392
105 3300046542 Ga0495597_0000095 Ga0495597_0000095_44311_45489 392
106 iso_pu_bacteria 2501025501 2501076113 392
107 iso_pu_bacteria 2501025502 2501085823 392
108 iso_pu_bacteria 2501025504 2501411944 392
109 iso_pu_bacteria 2510917013 2511088444 392
110 iso_pu_bacteria 2510917014 2511100942 392
111 iso_pu_bacteria 2510917015 2511107293 392
112 iso_pu_bacteria 2511231015 2511318937 392
113 iso_pu_bacteria 2511231017 2511333798 392
114 iso_pu_bacteria 2515154189 2516020557 392
115 iso_pu_bacteria 2562617112 2563060101 392
116 iso_pu_bacteria 2562617112 2563064083 392
117 iso_pu_bacteria 2599185239 2599741550 392
118 iso_pu_bacteria 2599185240 2599746721 392
119 iso_pu_bacteria 2599185307 2599970976 392
120 iso_pu_bacteria 2599185355 2600208627 392
121 iso_pu_bacteria 2600255283 2601624124 392
122 iso_pu_bacteria 2600255283 2601628108 392
123 iso_pu_bacteria 2675903129 2676744283 392
124 iso_pu_bacteria 2711768613 2713472358 392
125 iso_pu_bacteria 2711768613 2713475277 392
126 iso_pu_bacteria 2721755763 2723876076 392
127 iso_pu_bacteria 2738543015 2739256991 392
128 iso_pu_bacteria 2739367655 2739612895 392
129 iso_pu_bacteria 2765235841 2765584457 392
130 iso_pu_bacteria 2791355137 2792839118 392
131 iso_pu_bacteria 2808606384 2808973810 392
132 iso_pu_bacteria 2808606390 2809008748 392
133 iso_pu_bacteria 2808606391 2809015746 392
134 iso_pu_bacteria 2818991452 2819630774 392
135 iso_pu_bacteria 2842324504 2842326690 392
136 iso_pu_bacteria 2842348783 2842350294 392
137 iso_pu_bacteria 2842454564 2842456933 392
138 iso_pu_bacteria 2856287931 2856294526 392
139 iso_pu_bacteria 2857357740 2857367899 392
140 iso_pu_bacteria 2863421361 2863424615 392
141 iso_pu_bacteria 2870068957 2870071451 392
142 iso_pu_bacteria 2883087390 2883089463 392
143 iso_pu_bacteria 2904564687 2904568597 392
144 iso_pu_bacteria 2904571731 2904575639 392
145 iso_pu_bacteria 2928157003 2928160388 392
146 iso_pu_bacteria 2928163908 2928170634 392
147 iso_pu_bacteria 2928170801 2928172569 392
148 iso_pu_bacteria 2928536128 2928540660 392
149 iso_pu_bacteria 2931396565 2931401274 392
150 iso_pu_bacteria 2981990288 2981996302 392
151 iso_pu_bacteria 641736154 642418206 392
152 iso_pu_bacteria 8018845410 8018846747 392
153 iso_pu_bacteria 8020938398 8020941433 392
154 iso_pu_bacteria 8020945358 8020949373 392
155 iso_pu_bacteria 8020953355 8020957778 392
156 iso_pu_bacteria 8021120328 8021128002 392
157 iso_pu_bacteria 8039098773 8039104850 392
158 iso_pu_bacteria 8055225921 8055228824 392
159 3300005616 Ga0068852_100280880 Ga0068852_1002808801 393
160 3300026142 Ga0207698_10056534 Ga0207698_100565342 393
161 3300037312 Ga0395899_0066258 Ga0395899_0066258_91_1272 393
162 3300037418 Ga0395900_0051302 Ga0395900_0051302_2670_3851 393
163 3300037471 Ga0395905_0014748 Ga0395905_0014748_393_1574 393
164 3300038443 Ga0395901_0033333 Ga0395901_0033333_641_1822 393
165 3300044684 Ga0466966_0089514 Ga0466966_0089514_234_1421 393
166 3300044693 Ga0466961_0036305 Ga0466961_0036305_940_2127 393
167 3300044712 Ga0453684_0081161 Ga0453684_0081161_1806_2993 393
168 3300045836 Ga0466958_0010655 Ga0466958_0010655_931_2118 393
169 iso_pu_bacteria 2887375801 2887380982 393
170 iso_pu_bacteria 2513237150 2513954964 394
171 iso_pu_bacteria 2513237165 2514041457 394
172 iso_pu_bacteria 2834641062 2834643744 394
173 iso_pu_bacteria 2857542790 2857543064 394
174 iso_pu_bacteria 2881927736 2881929145 394
175 iso_pu_bacteria 644736347 644748237 394
176 iso_pu_bacteria 8003400568 8003403227 394
177 iso_pu_bacteria 8048746797 8048748779 394
178 3300009092 Ga0105250_10000676 Ga0105250_100006766 395
179 3300025711 Ga0207696_1000315 Ga0207696_100031522 395
180 3300002067 JGI24735J21928_10002372 JGI24735J21928_100023724 396
181 3300003758 Ga0055532_1000190 Ga0055532_100019055 396
182 3300003758 Ga0055532_1000529 Ga0055532_100052916 396
183 3300003760 Ga0055527_1000291 Ga0055527_10002916 396
184 3300003761 Ga0055535_1000506 Ga0055535_100050617 396
185 3300003762 Ga0055542_1000502 Ga0055542_100050225 396
186 3300003763 Ga0055529_1000495 Ga0055529_100049517 396
187 3300003790 Ga0055528_1001289 Ga0055528_10012893 396
188 3300005327 Ga0070658_10057021 Ga0070658_100570213 396
189 3300005339 Ga0070660_100001233 Ga0070660_1000012338 396
190 3300005366 Ga0070659_100000055 Ga0070659_10000005585 396
191 3300005563 Ga0068855_100146546 Ga0068855_1001465462 396
192 3300006051 Ga0075364_10007506 Ga0075364_100075065 396
193 3300006058 Ga0075432_10007080 Ga0075432_100070802 396
194 3300009011 Ga0105251_10000066 Ga0105251_1000006677 396
195 3300009011 Ga0105251_10000193 Ga0105251_1000019327 396
196 3300009011 Ga0105251_10012171 Ga0105251_100121712 396
197 3300009036 Ga0105244_10057966 Ga0105244_100579661 396
198 3300009092 Ga0105250_10000033 Ga0105250_100000337 396
199 3300009093 Ga0105240_10000229 Ga0105240_10000229101 396
200 3300009093 Ga0105240_10023042 Ga0105240_100230423 396
201 3300009148 Ga0105243_10044088 Ga0105243_100440882 396
202 3300009551 Ga0105238_10134059 Ga0105238_101340592 396
203 3300010375 Ga0105239_10007284 Ga0105239_1000728412 396
204 3300013306 Ga0163162_10022743 Ga0163162_100227435 396
205 3300013306 Ga0163162_10036327 Ga0163162_100363274 396
206 3300014497 Ga0182008_10000089 Ga0182008_1000008964 396
207 3300014497 Ga0182008_10007326 Ga0182008_100073267 396
208 3300015262 Ga0182007_10000583 Ga0182007_1000058322 396
209 3300015265 Ga0182005_1004316 Ga0182005_10043163 396
210 3300025225 Ga0209566_100258 Ga0209566_10025813 396
211 3300025228 Ga0209672_100080 Ga0209672_10008017 396
212 3300025229 Ga0209147_100071 Ga0209147_100071193 396
213 3300025229 Ga0209147_100091 Ga0209147_10009155 396
214 3300025242 Ga0209258_100082 Ga0209258_10008217 396
215 3300025254 Ga0209148_1000195 Ga0209148_100019577 396
216 3300025256 Ga0209759_1004919 Ga0209759_10049194 396
217 3300025263 Ga0209565_1006597 Ga0209565_10065973 396
218 3300025272 Ga0209455_1000172 Ga0209455_100017277 396
219 3300025273 Ga0209673_1000076 Ga0209673_1000076106 396
220 3300025711 Ga0207696_1000006 Ga0207696_1000006191 396
221 3300025711 Ga0207696_1000011 Ga0207696_1000011321 396
222 3300025728 Ga0207655_1006992 Ga0207655_10069922 396
223 3300025728 Ga0207655_1018924 Ga0207655_10189242 396
224 3300025728 Ga0207655_1051550 Ga0207655_10515501 396
225 3300025735 Ga0207713_1000193 Ga0207713_100019328 396
226 3300025735 Ga0207713_1000220 Ga0207713_10002204 396
227 3300025735 Ga0207713_1000724 Ga0207713_100072415 396
228 3300025735 Ga0207713_1021020 Ga0207713_10210202 396
229 3300025904 Ga0207647_10001075 Ga0207647_1000107513 396
230 3300025913 Ga0207695_10000268 Ga0207695_10000268114 396
231 3300025913 Ga0207695_10020055 Ga0207695_100200555 396
232 3300025914 Ga0207671_10028223 Ga0207671_100282231 396
233 3300025919 Ga0207657_10000087 Ga0207657_1000008782 396
234 3300025932 Ga0207690_10000071 Ga0207690_1000007183 396
235 3300025949 Ga0207667_10013868 Ga0207667_100138685 396
236 3300026142 Ga0207698_10009359 Ga0207698_100093594 396
237 3300027312 Ga0209371_1000713 Ga0209371_100071317 396
238 3300027907 Ga0207428_10001135 Ga0207428_100011358 396
239 3300027907 Ga0207428_10086747 Ga0207428_100867472 396
240 3300028800 Ga0265338_10000191 Ga0265338_1000019155 396
241 3300030500 Ga0268256_1000608 Ga0268256_100060816 396
242 3300031548 Ga0307408_100067387 Ga0307408_1000673872 396
243 3300037312 Ga0395899_0016095 Ga0395899_0016095_2900_4090 396
244 3300037312 Ga0395899_0020452 Ga0395899_0020452_2194_3480 396
245 3300037312 Ga0395899_0027741 Ga0395899_0027741_380_1603 396
246 3300037418 Ga0395900_0000015 Ga0395900_0000015_327363_328553 396
247 3300037418 Ga0395900_0028321 Ga0395900_0028321_3181_4383 396
248 3300037418 Ga0395900_0071864 Ga0395900_0071864_91_1281 396
249 3300037418 Ga0395900_0112904 Ga0395900_0112904_335_1558 396
250 3300037466 Ga0395898_0011051 Ga0395898_0011051_3188_4390 396
251 3300037466 Ga0395898_0037403 Ga0395898_0037403_1449_2639 396
252 3300038443 Ga0395901_0000121 Ga0395901_0000121_62666_63868 396
253 3300038443 Ga0395901_0000769 Ga0395901_0000769_16429_17619 396
254 3300041405 Ga0439438_011366 Ga0439438_011366_1528_2718 396
255 3300041407 Ga0439447_009243 Ga0439447_009243_1485_2810 396
256 3300042010 Ga0439452_004263 Ga0439452_004263_2559_3884 396
257 3300042016 Ga0439463_000427 Ga0439463_000427_3265_4455 396
258 3300044656 Ga0466969_0006727 Ga0466969_0006727_724_1914 396
259 3300044658 Ga0466972_0014184 Ga0466972_0014184_98_1288 396
260 3300044684 Ga0466966_0000834 Ga0466966_0000834_16472_17662 396
261 3300044694 Ga0466963_0004481 Ga0466963_0004481_3674_4864 396
262 3300044719 Ga0466971_0002200 Ga0466971_0002200_5288_6478 396
263 3300044842 Ga0466957_0037623 Ga0466957_0037623_782_1972 396
264 3300045049 Ga0466959_0089778 Ga0466959_0089778_426_1616 396
265 3300046453 Ga0495627_000062 Ga0495627_000062_52668_53858 396
266 3300046453 Ga0495627_001467 Ga0495627_001467_3823_5013 396
267 3300046453 Ga0495627_006765 Ga0495627_006765_2947_4137 396
268 3300046457 Ga0495590_0006547 Ga0495590_0006547_1776_3101 396
269 3300046458 Ga0495591_006793 Ga0495591_006793_3543_4733 396
270 3300046459 Ga0495629_0001254 Ga0495629_0001254_14220_15410 396
271 3300046460 Ga0495638_0072088 Ga0495638_0072088_456_1646 396
272 3300046463 Ga0495653_0000101 Ga0495653_0000101_40630_41889 396
273 3300046463 Ga0495653_0001150 Ga0495653_0001150_14801_16126 396
274 3300046463 Ga0495653_0007814 Ga0495653_0007814_4494_5684 396
275 3300046471 Ga0495650_0001466 Ga0495650_0001466_4308_5498 396
276 3300046471 Ga0495650_0014091 Ga0495650_0014091_135_1325 396
277 3300046472 Ga0495580_0004305 Ga0495580_0004305_3658_4896 396
278 3300046472 Ga0495580_0014143 Ga0495580_0014143_830_2020 396
279 3300046474 Ga0495605_0000007 Ga0495605_0000007_78770_79960 396
280 3300046474 Ga0495605_0000470 Ga0495605_0000470_12594_13784 396
281 3300046474 Ga0495605_0002522 Ga0495605_0002522_8353_9678 396
282 3300046474 Ga0495605_0003778 Ga0495605_0003778_970_2295 396
283 3300046474 Ga0495605_0004037 Ga0495605_0004037_7055_8245 396
284 3300046474 Ga0495605_0041490 Ga0495605_0041490_450_1688 396
285 3300046477 Ga0495664_0008403 Ga0495664_0008403_3318_4577 396
286 3300046491 Ga0495584_0000686 Ga0495584_0000686_6596_7786 396
287 3300046491 Ga0495584_0001410 Ga0495584_0001410_10118_11443 396
288 3300046491 Ga0495584_0020394 Ga0495584_0020394_1710_2900 396
289 3300046492 Ga0495585_0000282 Ga0495585_0000282_37786_38976 396
290 3300046492 Ga0495585_0004671 Ga0495585_0004671_3103_4293 396
291 3300046499 Ga0495594_0001267 Ga0495594_0001267_11171_12361 396
292 3300046499 Ga0495594_0007442 Ga0495594_0007442_4003_5193 396
293 3300046499 Ga0495594_0127623 Ga0495594_0127623_194_1384 396
294 3300046500 Ga0495596_0000835 Ga0495596_0000835_12931_14121 396
295 3300046501 Ga0495607_0000047 Ga0495607_0000047_106396_107586 396
296 3300046501 Ga0495607_0000702 Ga0495607_0000702_16227_17417 396
297 3300046501 Ga0495607_0005502 Ga0495607_0005502_2035_3360 396
298 3300046501 Ga0495607_0007690 Ga0495607_0007690_2646_3836 396
299 3300046501 Ga0495607_0008631 Ga0495607_0008631_4793_5983 396
300 3300046501 Ga0495607_0009093 Ga0495607_0009093_2796_3986 396
301 3300046501 Ga0495607_0020035 Ga0495607_0020035_1931_3121 396
302 3300046506 Ga0495583_0000007 Ga0495583_0000007_37472_38662 396
303 3300046506 Ga0495583_0000008 Ga0495583_0000008_162628_163818 396
304 3300046506 Ga0495583_0000045 Ga0495583_0000045_148009_149199 396
305 3300046506 Ga0495583_0000281 Ga0495583_0000281_58000_59190 396
306 3300046506 Ga0495583_0004924 Ga0495583_0004924_6118_7443 396
307 3300046507 Ga0495606_0000360 Ga0495606_0000360_18111_19301 396
308 3300046507 Ga0495606_0036255 Ga0495606_0036255_1510_2700 396
309 3300046512 Ga0495610_0006856 Ga0495610_0006856_4050_5240 396
310 3300046512 Ga0495610_0011451 Ga0495610_0011451_2610_3800 396
311 3300046512 Ga0495610_0015787 Ga0495610_0015787_1222_2412 396
312 3300046513 Ga0495616_0000456 Ga0495616_0000456_12090_13415 396
313 3300046513 Ga0495616_0000941 Ga0495616_0000941_9053_10243 396
314 3300046513 Ga0495616_0002483 Ga0495616_0002483_8377_9567 396
315 3300046513 Ga0495616_0008459 Ga0495616_0008459_4219_5409 396
316 3300046515 Ga0495620_0000399 Ga0495620_0000399_15285_16475 396
317 3300046515 Ga0495620_0012381 Ga0495620_0012381_451_1641 396
318 3300046516 Ga0495628_0001033 Ga0495628_0001033_13187_14446 396
319 3300046516 Ga0495628_0001082 Ga0495628_0001082_23035_24225 396
320 3300046517 Ga0495630_0000888 Ga0495630_0000888_19571_20830 396
321 3300046517 Ga0495630_0002736 Ga0495630_0002736_5818_7143 396
322 3300046518 Ga0495631_0000921 Ga0495631_0000921_12478_13668 396
323 3300046518 Ga0495631_0003741 Ga0495631_0003741_5409_6599 396
324 3300046519 Ga0495632_0000037 Ga0495632_0000037_149015_150205 396
325 3300046519 Ga0495632_0001836 Ga0495632_0001836_9301_10626 396
326 3300046519 Ga0495632_0002620 Ga0495632_0002620_3740_4930 396
327 3300046519 Ga0495632_0010910 Ga0495632_0010910_1339_2529 396
328 3300046519 Ga0495632_0029184 Ga0495632_0029184_1166_2356 396
329 3300046520 Ga0495637_0025016 Ga0495637_0025016_310_1500 396
330 3300046522 Ga0495643_0003881 Ga0495643_0003881_6109_7311 396
331 3300046522 Ga0495643_0005109 Ga0495643_0005109_6024_7349 396
332 3300046522 Ga0495643_0067853 Ga0495643_0067853_19_1209 396
333 3300046523 Ga0495644_0000054 Ga0495644_0000054_44113_45303 396
334 3300046524 Ga0495648_0001650 Ga0495648_0001650_14079_15269 396
335 3300046524 Ga0495648_0004197 Ga0495648_0004197_1194_2384 396
336 3300046528 Ga0495642_0001123 Ga0495642_0001123_9130_10455 396
337 3300046529 Ga0495652_0001426 Ga0495652_0001426_6587_7846 396
338 3300046530 Ga0495654_0000112 Ga0495654_0000112_62316_63506 396
339 3300046530 Ga0495654_0000192 Ga0495654_0000192_11811_13001 396
340 3300046530 Ga0495654_0004712 Ga0495654_0004712_3515_4705 396
341 3300046530 Ga0495654_0011370 Ga0495654_0011370_608_1933 396
342 3300046530 Ga0495654_0012772 Ga0495654_0012772_1599_2789 396
343 3300046531 Ga0495665_0000030 Ga0495665_0000030_18059_19318 396
344 3300046531 Ga0495665_0009558 Ga0495665_0009558_2583_3773 396
345 3300046535 Ga0495586_0037752 Ga0495586_0037752_1258_2517 396
346 3300046536 Ga0495587_0000835 Ga0495587_0000835_4236_5561 396
347 3300046538 Ga0495609_0000004 Ga0495609_0000004_81247_82437 396
348 3300046538 Ga0495609_0000157 Ga0495609_0000157_43698_44888 396
349 3300046538 Ga0495609_0000552 Ga0495609_0000552_22026_23351 396
350 3300046538 Ga0495609_0000681 Ga0495609_0000681_20160_21350 396
351 3300046538 Ga0495609_0000990 Ga0495609_0000990_10683_11873 396
352 3300046538 Ga0495609_0005556 Ga0495609_0005556_936_2126 396
353 3300046542 Ga0495597_0000649 Ga0495597_0000649_12141_13331 396
354 3300046542 Ga0495597_0003203 Ga0495597_0003203_906_2096 396
355 3300046542 Ga0495597_0018420 Ga0495597_0018420_1457_2659 396
356 3300046557 Ga0495622_0045432 Ga0495622_0045432_398_1588 396
357 3300046558 Ga0495633_0000020 Ga0495633_0000020_145031_146221 396
358 3300046615 Ga0495656_0001551 Ga0495656_0001551_1062_2252 396
359 3300046616 Ga0495668_0019409 Ga0495668_0019409_2459_3661 396
360 3300046616 Ga0495668_0024153 Ga0495668_0024153_418_1608 396
361 3300046616 Ga0495668_0036502 Ga0495668_0036502_1367_2557 396
362 3300046642 Ga0495634_0000347 Ga0495634_0000347_11385_12710 396
363 3300046648 Ga0495611_0002446 Ga0495611_0002446_3703_4893 396
364 3300046648 Ga0495611_0016690 Ga0495611_0016690_1607_2797 396
365 3300046660 Ga0495625_0001919 Ga0495625_0001919_14099_15289 396
366 3300046660 Ga0495625_0002739 Ga0495625_0002739_16236_17426 396
367 3300046660 Ga0495625_0044650 Ga0495625_0044650_1956_3146 396
368 3300046663 Ga0495635_0000402 Ga0495635_0000402_15301_16626 396
369 3300046664 Ga0495659_0000002 Ga0495659_0000002_6020_7345 396
370 3300046664 Ga0495659_0000864 Ga0495659_0000864_7467_8657 396
371 3300046665 Ga0495661_0000009 Ga0495661_0000009_37748_38938 396
372 3300046665 Ga0495661_0000057 Ga0495661_0000057_114584_115774 396
373 3300046665 Ga0495661_0000154 Ga0495661_0000154_75275_76546 396
374 3300046665 Ga0495661_0001421 Ga0495661_0001421_8204_9394 396
375 3300046665 Ga0495661_0005142 Ga0495661_0005142_6472_7674 396
376 3300046665 Ga0495661_0016364 Ga0495661_0016364_1842_3032 396
377 3300046674 Ga0495588_0000444 Ga0495588_0000444_16129_17319 396
378 3300046680 Ga0495646_0000541 Ga0495646_0000541_4236_5561 396
379 3300046680 Ga0495646_0001894 Ga0495646_0001894_4723_5982 396
380 3300046680 Ga0495646_0037165 Ga0495646_0037165_1051_2241 396
381 3300046684 Ga0495669_0000798 Ga0495669_0000798_539_1729 396
382 3300046689 Ga0495613_0068317 Ga0495613_0068317_409_1599 396
383 3300046690 Ga0495624_0001025 Ga0495624_0001025_10942_12201 396
384 3300046690 Ga0495624_0001534 Ga0495624_0001534_4515_5705 396
385 3300046691 Ga0495670_0001337 Ga0495670_0001337_2463_3653 396
386 3300046691 Ga0495670_0003007 Ga0495670_0003007_5290_6480 396
387 3300046691 Ga0495670_0014073 Ga0495670_0014073_80_1270 396
388 3300046692 Ga0495671_0001474 Ga0495671_0001474_5914_7104 396
389 3300046692 Ga0495671_0015710 Ga0495671_0015710_93_1283 396
390 3300046692 Ga0495671_0046217 Ga0495671_0046217_69_1394 396
391 3300046692 Ga0495671_0099905 Ga0495671_0099905_31_1221 396
392 3300046694 Ga0495649_0000106 Ga0495649_0000106_22035_23360 396
393 3300046694 Ga0495649_0000811 Ga0495649_0000811_4986_6311 396
394 3300046794 Ga0495589_0000790 Ga0495589_0000790_10683_11873 396
395 3300046794 Ga0495589_0009149 Ga0495589_0009149_2393_3583 396
396 3300046809 Ga0495600_0019540 Ga0495600_0019540_25_1215 396
397 3300046810 Ga0495660_0000868 Ga0495660_0000868_10427_11623 396
398 3300046810 Ga0495660_0020126 Ga0495660_0020126_1813_3138 396
399 3300046810 Ga0495660_0047120 Ga0495660_0047120_958_2148 396
400 3300046810 Ga0495660_0088647 Ga0495660_0088647_257_1447 396
401 3300047317 Ga0495604_0008855 Ga0495604_0008855_5071_6330 396
402 3300047317 Ga0495604_0032162 Ga0495604_0032162_1335_2660 396
403 3300047318 Ga0495636_0000215 Ga0495636_0000215_15809_16999 396
404 3300047318 Ga0495636_0000825 Ga0495636_0000825_2112_3437 396
405 3300047319 Ga0495674_0000146 Ga0495674_0000146_17416_18675 396
406 3300047319 Ga0495674_0003028 Ga0495674_0003028_6417_7742 396
407 3300047320 Ga0495672_0000987 Ga0495672_0000987_21852_23177 396
408 3300047320 Ga0495672_0001850 Ga0495672_0001850_8948_10138 396
409 3300047320 Ga0495672_0008680 Ga0495672_0008680_5864_7054 396
410 3300047320 Ga0495672_0015774 Ga0495672_0015774_3400_4590 396
411 3300047320 Ga0495672_0074498 Ga0495672_0074498_704_1894 396
412 3300047321 Ga0495676_0102670 Ga0495676_0102670_308_1498 396
413 3300047323 Ga0495683_0000003 Ga0495683_0000003_135967_137157 396
414 3300047323 Ga0495683_0001830 Ga0495683_0001830_18_1208 396
415 3300047323 Ga0495683_0002983 Ga0495683_0002983_3631_4869 396
416 3300047323 Ga0495683_0006620 Ga0495683_0006620_3378_4568 396
417 3300047323 Ga0495683_0011307 Ga0495683_0011307_2599_3924 396
418 3300047323 Ga0495683_0014523 Ga0495683_0014523_18_1208 396
419 3300047443 Ga0495687_000343 Ga0495687_000343_30207_31532 396
420 3300047443 Ga0495687_000760 Ga0495687_000760_10683_11873 396
421 3300047443 Ga0495687_001473 Ga0495687_001473_16029_17219 396
422 3300047443 Ga0495687_001864 Ga0495687_001864_7790_9115 396
423 3300047443 Ga0495687_003928 Ga0495687_003928_3594_4832 396
424 3300047445 Ga0495677_0000158 Ga0495677_0000158_10683_11873 396
425 3300047445 Ga0495677_0001108 Ga0495677_0001108_3794_4984 396
426 3300047446 Ga0495679_000066 Ga0495679_000066_54604_55794 396
427 3300047447 Ga0495685_000182 Ga0495685_000182_18221_19411 396
428 3300047447 Ga0495685_016487 Ga0495685_016487_779_1969 396
429 3300047469 Ga0495673_0001831 Ga0495673_0001831_11791_13116 396
430 3300047469 Ga0495673_0017369 Ga0495673_0017369_2331_3521 396
431 3300047469 Ga0495673_0033721 Ga0495673_0033721_520_1710 396
432 3300047469 Ga0495673_0039148 Ga0495673_0039148_89_1279 396
433 3300047470 Ga0495681_0006226 Ga0495681_0006226_3044_4234 396
434 3300047470 Ga0495681_0006555 Ga0495681_0006555_3072_4262 396
435 3300047470 Ga0495681_0007514 Ga0495681_0007514_3761_5086 396
436 3300047673 Ga0495593_0000065 Ga0495593_0000065_29817_31076 396
437 3300047673 Ga0495593_0000536 Ga0495593_0000536_15246_16571 396
438 3300047673 Ga0495593_0002680 Ga0495593_0002680_2976_4166 396
439 3300048088 Ga0495602_0001309 Ga0495602_0001309_13495_14754 396
440 3300048088 Ga0495602_0078149 Ga0495602_0078149_160_1485 396
441 3300048090 Ga0495615_0015452 Ga0495615_0015452_207_1418 396
442 3300048091 Ga0495626_0003714 Ga0495626_0003714_6699_8024 396
443 3300048091 Ga0495626_0006569 Ga0495626_0006569_5357_6547 396
444 3300048904 Ga0496101_0010506 Ga0496101_0010506_4012_5202 396
445 3300048905 Ga0496102_0000444 Ga0496102_0000444_11072_12397 396
446 3300048905 Ga0496102_0149480 Ga0496102_0149480_482_1672 396
447 3300048906 Ga0496103_0000290 Ga0496103_0000290_10576_11901 396
448 3300048909 Ga0496106_0000140 Ga0496106_0000140_38394_39584 396
449 3300048919 Ga0496116_0000231 Ga0496116_0000231_28073_29398 396
450 3300048920 Ga0496117_0002099 Ga0496117_0002099_1768_2958 396
451 3300048920 Ga0496117_0005335 Ga0496117_0005335_1338_2663 396
452 3300048920 Ga0496117_0053201 Ga0496117_0053201_935_2125 396
453 3300048920 Ga0496117_0055939 Ga0496117_0055939_1087_2340 396
454 3300048921 Ga0496118_0000106 Ga0496118_0000106_71353_72543 396
455 3300048921 Ga0496118_0004391 Ga0496118_0004391_10903_12228 396
456 3300048921 Ga0496118_0007473 Ga0496118_0007473_1549_2739 396
457 3300048921 Ga0496118_0011493 Ga0496118_0011493_5244_6497 396
458 3300048921 Ga0496118_0047266 Ga0496118_0047266_506_1831 396
459 3300048924 Ga0496121_0000540 Ga0496121_0000540_41058_42248 396
460 3300048924 Ga0496121_0001323 Ga0496121_0001323_25217_26407 396
461 3300048924 Ga0496121_0002437 Ga0496121_0002437_24336_25526 396
462 3300048924 Ga0496121_0008909 Ga0496121_0008909_2739_3929 396
463 3300048924 Ga0496121_0020875 Ga0496121_0020875_4240_5565 396
464 3300048924 Ga0496121_0066924 Ga0496121_0066924_75_1265 396
465 3300048925 Ga0496122_0000175 Ga0496122_0000175_120803_121993 396
466 3300048925 Ga0496122_0000834 Ga0496122_0000834_31311_32501 396
467 3300048925 Ga0496122_0002004 Ga0496122_0002004_1038_2363 396
468 3300048926 Ga0496123_0000079 Ga0496123_0000079_31317_32507 396
469 3300048926 Ga0496123_0001361 Ga0496123_0001361_11474_12664 396
470 3300048927 Ga0496124_0013054 Ga0496124_0013054_2474_3670 396
471 3300048927 Ga0496124_0167304 Ga0496124_0167304_451_1641 396
472 3300048928 Ga0496125_0001350 Ga0496125_0001350_696_1886 396
473 3300048928 Ga0496125_0020538 Ga0496125_0020538_1200_2390 396
474 3300048929 Ga0496126_0000098 Ga0496126_0000098_90246_91436 396
475 3300048929 Ga0496126_0000122 Ga0496126_0000122_20959_22212 396
476 3300048929 Ga0496126_0004422 Ga0496126_0004422_2275_3465 396
477 3300048929 Ga0496126_0015419 Ga0496126_0015419_180_1370 396
478 3300048929 Ga0496126_0051271 Ga0496126_0051271_628_1818 396
479 3300049459 Ga0495678_000007 Ga0495678_000007_144705_145895 396
480 3300049459 Ga0495678_000646 Ga0495678_000646_19361_20551 396
481 3300049459 Ga0495678_002416 Ga0495678_002416_9256_10581 396
482 3300049460 Ga0495682_0000496 Ga0495682_0000496_17660_18850 396
483 3300049460 Ga0495682_0000755 Ga0495682_0000755_4366_5691 396
484 3300049460 Ga0495682_0003020 Ga0495682_0003020_828_2066 396
485 3300049822 Ga0501035_0013106 Ga0501035_0013106_4634_5824 396
486 3300049823 Ga0501044_0006710 Ga0501044_0006710_6983_8173 396
487 3300050491 nmdc:mga00v17_142241_c1 nmdc:mga00v17_142241_c1_260_1450 396
488 3300053125 Ga0500618_000762 Ga0500618_000762_5909_7099 396
489 3300061719 Ga0466962_0001124 Ga0466962_0001124_3157_4347 396
490 3300005329 Ga0070683_100108050 Ga0070683_1001080502 397
491 3300005334 Ga0068869_100012126 Ga0068869_1000121262 397
492 3300005335 Ga0070666_10005794 Ga0070666_100057946 397
493 3300005338 Ga0068868_100023978 Ga0068868_1000239783 397
494 3300005340 Ga0070689_100001884 Ga0070689_1000018843 397
495 3300005355 Ga0070671_100003066 Ga0070671_1000030664 397
496 3300005365 Ga0070688_100001410 Ga0070688_10000141011 397
497 3300005367 Ga0070667_100023292 Ga0070667_1000232922 397
498 3300005436 Ga0070713_100002763 Ga0070713_10000276311 397
499 3300005436 Ga0070713_100038587 Ga0070713_1000385873 397
500 3300005445 Ga0070708_100089422 Ga0070708_1000894222 397
501 3300005458 Ga0070681_10281856 Ga0070681_102818562 397
502 3300005466 Ga0070685_10003558 Ga0070685_100035585 397
503 3300005467 Ga0070706_100067089 Ga0070706_1000670893 397
504 3300005518 Ga0070699_100071995 Ga0070699_1000719952 397
505 3300005530 Ga0070679_100215154 Ga0070679_1002151541 397
506 3300005536 Ga0070697_100028101 Ga0070697_1000281014 397
507 3300005544 Ga0070686_100034566 Ga0070686_1000345662 397
508 3300005546 Ga0070696_100067834 Ga0070696_1000678342 397
509 3300005547 Ga0070693_100003097 Ga0070693_1000030977 397
510 3300005547 Ga0070693_100155354 Ga0070693_1001553541 397
511 3300005548 Ga0070665_100009891 Ga0070665_1000098916 397
512 3300005617 Ga0068859_100003773 Ga0068859_1000037737 397
513 3300005618 Ga0068864_100083801 Ga0068864_1000838013 397
514 3300005718 Ga0068866_10001012 Ga0068866_100010129 397
515 3300005841 Ga0068863_100045739 Ga0068863_1000457392 397
516 3300005842 Ga0068858_100074430 Ga0068858_1000744301 397
517 3300005843 Ga0068860_100050284 Ga0068860_1000502844 397
518 3300006186 Ga0075369_10059343 Ga0075369_100593432 397
519 3300006237 Ga0097621_100056426 Ga0097621_1000564263 397
520 3300006237 Ga0097621_100197600 Ga0097621_1001976002 397
521 3300006358 Ga0068871_100043084 Ga0068871_1000430841 397
522 3300006931 Ga0097620_100003773 Ga0097620_10000377311 397
523 3300009098 Ga0105245_10220655 Ga0105245_102206552 397
524 3300009177 Ga0105248_10126581 Ga0105248_101265812 397
525 3300009545 Ga0105237_10180336 Ga0105237_101803362 397
526 3300009553 Ga0105249_10201881 Ga0105249_102018812 397
527 3300013296 Ga0157374_10000738 Ga0157374_100007382 397
528 3300013297 Ga0157378_10037531 Ga0157378_100375313 397
529 3300013306 Ga0163162_10106478 Ga0163162_101064782 397
530 3300013308 Ga0157375_10046595 Ga0157375_100465953 397
531 3300014325 Ga0163163_10055183 Ga0163163_100551834 397
532 3300014745 Ga0157377_10065508 Ga0157377_100655082 397
533 3300014968 Ga0157379_10049696 Ga0157379_100496962 397
534 3300014969 Ga0157376_10038338 Ga0157376_100383383 397
535 3300014969 Ga0157376_10260176 Ga0157376_102601762 397
536 3300025898 Ga0207692_10007836 Ga0207692_100078363 397
537 3300025898 Ga0207692_10036111 Ga0207692_100361112 397
538 3300025908 Ga0207643_10046640 Ga0207643_100466402 397
539 3300025911 Ga0207654_10011228 Ga0207654_100112282 397
540 3300025913 Ga0207695_10321155 Ga0207695_103211552 397
541 3300025915 Ga0207693_10002196 Ga0207693_100021963 397
542 3300025919 Ga0207657_10011384 Ga0207657_100113846 397
543 3300025922 Ga0207646_10105089 Ga0207646_101050892 397
544 3300025927 Ga0207687_10002320 Ga0207687_1000232011 397
545 3300025927 Ga0207687_10020309 Ga0207687_100203094 397
546 3300025928 Ga0207700_10032497 Ga0207700_100324972 397
547 3300025929 Ga0207664_10002534 Ga0207664_100025347 397
548 3300025931 Ga0207644_10002683 Ga0207644_100026834 397
549 3300025934 Ga0207686_10002219 Ga0207686_100022192 397
550 3300025936 Ga0207670_10001236 Ga0207670_100012364 397
551 3300025937 Ga0207669_10024534 Ga0207669_100245343 397
552 3300025941 Ga0207711_10000575 Ga0207711_100005752 397
553 3300025942 Ga0207689_10029614 Ga0207689_100296143 397
554 3300025949 Ga0207667_10146335 Ga0207667_101463352 397
555 3300025986 Ga0207658_10030107 Ga0207658_100301073 397
556 3300026023 Ga0207677_10001768 Ga0207677_1000176810 397
557 3300026035 Ga0207703_10000698 Ga0207703_1000069829 397
558 3300026078 Ga0207702_10048011 Ga0207702_100480112 397
559 3300026088 Ga0207641_10007478 Ga0207641_100074786 397
560 3300026095 Ga0207676_10000116 Ga0207676_100001163 397
561 3300026116 Ga0207674_10034484 Ga0207674_100344842 397
562 3300026121 Ga0207683_10002532 Ga0207683_1000253212 397
563 3300026142 Ga0207698_10166004 Ga0207698_101660042 397
564 3300028381 Ga0268264_10035740 Ga0268264_100357402 397
565 3300030521 Ga0307511_10062662 Ga0307511_100626622 397
566 3300031456 Ga0307513_10005621 Ga0307513_1000562113 397
567 3300035086 Ga0373934_0002351 Ga0373934_0002351_1427_2635 397
568 3300035119 Ga0373956_0017678 Ga0373956_0017678_644_1852 397
569 3300035120 Ga0373957_0005251 Ga0373957_0005251_641_1849 397
570 3300035170 Ga0373943_0053725 Ga0373943_0053725_646_1854 397
571 3300035172 Ga0373955_0033709 Ga0373955_0033709_1282_2490 397
572 3300035692 Ga0373935_0066948 Ga0373935_0066948_363_1571 397
573 3300035695 Ga0373927_0107920 Ga0373927_0107920_474_1682 397
574 3300035725 Ga0373947_0062862 Ga0373947_0062862_883_2091 397
575 3300035725 Ga0373947_0063369 Ga0373947_0063369_249_1457 397
576 3300037068 Ga0373925_0032256 Ga0373925_0032256_274_1482 397
577 3300037068 Ga0373925_0118780 Ga0373925_0118780_822_2030 397
578 3300046455 Ga0495603_0042619 Ga0495603_0042619_521_1729 397
579 3300046458 Ga0495591_015464 Ga0495591_015464_214_1407 397
580 3300046459 Ga0495629_0000456 Ga0495629_0000456_5352_6545 397
581 3300046463 Ga0495653_0015560 Ga0495653_0015560_3660_4868 397
582 3300046471 Ga0495650_0001616 Ga0495650_0001616_1575_2768 397
583 3300046472 Ga0495580_0062038 Ga0495580_0062038_352_1545 397
584 3300046476 Ga0495662_0018336 Ga0495662_0018336_2102_3295 397
585 3300046477 Ga0495664_0001452 Ga0495664_0001452_6389_7663 397
586 3300046506 Ga0495583_0042761 Ga0495583_0042761_826_2019 397
587 3300046522 Ga0495643_0008753 Ga0495643_0008753_2341_3543 397
588 3300046530 Ga0495654_0016135 Ga0495654_0016135_2601_3794 397
589 3300046531 Ga0495665_0021857 Ga0495665_0021857_1352_2560 397
590 3300046539 Ga0495621_0008601 Ga0495621_0008601_535_1737 397
591 3300046543 Ga0495645_0002165 Ga0495645_0002165_5357_6550 397
592 3300046543 Ga0495645_0053245 Ga0495645_0053245_637_1845 397
593 3300046616 Ga0495668_0037073 Ga0495668_0037073_327_1529 397
594 3300046663 Ga0495635_0015624 Ga0495635_0015624_2827_4035 397
595 3300046681 Ga0495647_0004494 Ga0495647_0004494_1373_2581 397
596 3300046683 Ga0495658_0055941 Ga0495658_0055941_475_1683 397
597 3300046689 Ga0495613_0044673 Ga0495613_0044673_743_1951 397
598 3300046794 Ga0495589_0008080 Ga0495589_0008080_182_1375 397
599 3300046809 Ga0495600_0019853 Ga0495600_0019853_536_1744 397
600 3300046809 Ga0495600_0051453 Ga0495600_0051453_58_1251 397
601 3300047319 Ga0495674_0053182 Ga0495674_0053182_1296_2570 397
602 3300047319 Ga0495674_0130549 Ga0495674_0130549_490_1698 397
603 3300047322 Ga0495680_0094551 Ga0495680_0094551_192_1400 397
604 3300047446 Ga0495679_034263 Ga0495679_034263_163_1356 397
605 3300047471 Ga0495684_0055026 Ga0495684_0055026_1374_2582 397
606 3300048088 Ga0495602_0035033 Ga0495602_0035033_2683_3891 397
607 3300048089 Ga0495614_0028152 Ga0495614_0028152_1023_2231 397
608 3300048089 Ga0495614_0060217 Ga0495614_0060217_221_1414 397
609 3300048903 Ga0496100_0039069 Ga0496100_0039069_1260_2453 397
610 3300048904 Ga0496101_0030360 Ga0496101_0030360_922_2115 397
611 3300048905 Ga0496102_0058052 Ga0496102_0058052_1281_2483 397
612 3300048905 Ga0496102_0081766 Ga0496102_0081766_407_1609 397
613 3300048907 Ga0496104_0003437 Ga0496104_0003437_10594_11802 397
614 3300048909 Ga0496106_0169118 Ga0496106_0169118_445_1653 397
615 3300048910 Ga0496107_0138468 Ga0496107_0138468_576_1769 397
616 3300048911 Ga0496108_0028033 Ga0496108_0028033_2193_3395 397
617 3300048911 Ga0496108_0064726 Ga0496108_0064726_462_1670 397
618 3300048912 Ga0496109_0049325 Ga0496109_0049325_1282_2484 397
619 3300048913 Ga0496110_0078281 Ga0496110_0078281_1454_2656 397
620 3300048914 Ga0496111_0033305 Ga0496111_0033305_1285_2487 397
621 3300048917 Ga0496114_0016737 Ga0496114_0016737_252_1445 397
622 3300049572 Ga0501036_0092645 Ga0501036_0092645_1187_2389 397
623 3300049573 Ga0501037_0007335 Ga0501037_0007335_5963_7165 397
624 3300049576 Ga0501040_0020294 Ga0501040_0020294_920_2122 397
625 3300049577 Ga0501041_0000529 Ga0501041_0000529_8344_9546 397
626 3300049580 Ga0501046_0080824 Ga0501046_0080824_143_1345 397
627 3300049582 Ga0501048_0132935 Ga0501048_0132935_184_1386 397
628 3300049586 Ga0501070_0290581 Ga0501070_0290581_67_1272 397
629 3300049587 Ga0501071_0009628 Ga0501071_0009628_2280_3482 397
630 3300049591 Ga0501075_0001724 Ga0501075_0001724_898_2100 397
631 3300049592 Ga0501076_0003131 Ga0501076_0003131_2489_3691 397
632 3300049741 Ga0501079_0011452 Ga0501079_0011452_3217_4419 397
633 3300049742 Ga0501080_0107623 Ga0501080_0107623_916_2118 397
634 3300049743 Ga0501081_0000560 Ga0501081_0000560_3753_4955 397
635 3300050516 nmdc:mga0sz30_27782_c1 nmdc:mga0sz30_27782_c1_120_1346 397
636 3300053077 Ga0495601_0112602 Ga0495601_0112602_468_1676 397
637 3300053090 Ga0500646_0005097 Ga0500646_0005097_224_1450 397
638 3300053108 Ga0500562_007741 Ga0500562_007741_1462_2685 397
639 3300053125 Ga0500618_001214 Ga0500618_001214_7708_8901 397
640 3300053153 Ga0500616_0012519 Ga0500616_0012519_2085_3290 397
641 3300060353 Ga0501082_0005297 Ga0501082_0005297_9404_10606 397
642 3300003187 JGI25151J46595_10001217 JGI25151J46595_1000121712 398
643 3300003771 Ga0055526_1006276 Ga0055526_10062763 398
644 3300003771 Ga0055526_1006341 Ga0055526_10063415 398
645 3300003771 Ga0055526_1015551 Ga0055526_10155511 398
646 3300003775 Ga0055524_1001369 Ga0055524_10013697 398
647 3300003781 Ga0055536_1001508 Ga0055536_10015087 398
648 3300003784 Ga0055534_1000957 Ga0055534_10009577 398
649 3300003784 Ga0055534_1001648 Ga0055534_10016484 398
650 3300006051 Ga0075364_10004775 Ga0075364_100047752 398
651 3300006051 Ga0075364_10052558 Ga0075364_100525582 398
652 3300006051 Ga0075364_10064415 Ga0075364_100644152 398
653 3300006948 Ga0099826_10000020 Ga0099826_1000002021 398
654 3300025263 Ga0209565_1000092 Ga0209565_100009214 398
655 3300025263 Ga0209565_1007190 Ga0209565_10071903 398
656 3300025273 Ga0209673_1014539 Ga0209673_10145393 398
657 3300025291 Ga0209675_1000809 Ga0209675_10008099 398
658 3300025291 Ga0209675_1000951 Ga0209675_100095112 398
659 3300025292 Ga0209676_1000012 Ga0209676_1000012122 398
660 3300025294 Ga0209025_1000892 Ga0209025_100089224 398
661 3300025294 Ga0209025_1001159 Ga0209025_100115910 398
662 3300025294 Ga0209025_1001484 Ga0209025_100148424 398
663 3300025295 Ga0209564_1001095 Ga0209564_100109511 398
664 3300025295 Ga0209564_1002067 Ga0209564_10020677 398
665 3300025295 Ga0209564_1002203 Ga0209564_10022037 398
666 3300025299 Ga0209256_1000804 Ga0209256_100080422 398
667 3300025299 Ga0209256_1001280 Ga0209256_10012809 398
668 3300025303 Ga0209051_1007991 Ga0209051_10079915 398
669 3300025303 Ga0209051_1051666 Ga0209051_10516661 398
670 3300027666 Ga0209282_1000045 Ga0209282_100004556 398
671 3300038443 Ga0395901_0002848 Ga0395901_0002848_4543_5760 398
672 3300041404 Ga0439436_0009175 Ga0439436_0009175_208_1404 398
673 3300046474 Ga0495605_0002620 Ga0495605_0002620_2835_4031 398
674 3300046500 Ga0495596_0003319 Ga0495596_0003319_4119_5315 398
675 3300046512 Ga0495610_0000402 Ga0495610_0000402_27660_28856 398
676 3300046665 Ga0495661_0024161 Ga0495661_0024161_353_1549 398
677 3300046692 Ga0495671_0000949 Ga0495671_0000949_15078_16274 398
678 3300047320 Ga0495672_0081539 Ga0495672_0081539_114_1310 398
679 3300048919 Ga0496116_0012327 Ga0496116_0012327_2925_4121 398
680 3300048919 Ga0496116_0044676 Ga0496116_0044676_1403_2599 398
681 3300048924 Ga0496121_0027429 Ga0496121_0027429_2869_4065 398
682 3300048924 Ga0496121_0031859 Ga0496121_0031859_1517_2713 398
683 3300048925 Ga0496122_0001089 Ga0496122_0001089_24371_25567 398
684 3300048926 Ga0496123_0003257 Ga0496123_0003257_15540_16736 398
685 3300048927 Ga0496124_0000013 Ga0496124_0000013_97830_99026 398
686 3300049571 Ga0501034_0000530 Ga0501034_0000530_30722_31918 398
687 3300050491 nmdc:mga00v17_11365_c1 nmdc:mga00v17_11365_c1_2703_3899 398
688 3300050491 nmdc:mga00v17_129_c1 nmdc:mga00v17_129_c1_22803_23999 398
689 3300050491 nmdc:mga00v17_27043_c1 nmdc:mga00v17_27043_c1_377_1573 398
690 iso_pu_bacteria 2596583598 2597028722 398
691 iso_pu_bacteria 2599185178 2599445404 398
692 iso_pu_bacteria 2900577576 2900580097 398
693 iso_pu_bacteria 2928058823 2928062734 398
694 iso_pu_bacteria 8002392321 8002393943 399
695 3300037418 Ga0395900_0032503 Ga0395900_0032503_3848_5065 401
696 3300001915 JGI24741J21665_1003791 JGI24741J21665_10037912 402
697 3300001979 JGI24740J21852_10000337 JGI24740J21852_1000033713 402
698 3300001979 JGI24740J21852_10003034 JGI24740J21852_100030347 402
699 3300002705 JGI25156J39149_1004600 JGI25156J39149_10046003 402
700 3300002705 JGI25156J39149_1009239 JGI25156J39149_10092392 402
701 3300002738 JGI25154J39366_1002132 JGI25154J39366_10021325 402
702 3300003752 Ga0055539_1000172 Ga0055539_100017220 402
703 3300003756 Ga0055533_1003919 Ga0055533_10039193 402
704 3300003758 Ga0055532_1000002 Ga0055532_1000002136 402
705 3300003758 Ga0055532_1000029 Ga0055532_1000029183 402
706 3300003760 Ga0055527_1002226 Ga0055527_10022263 402
707 3300003762 Ga0055542_1000698 Ga0055542_10006986 402
708 3300003763 Ga0055529_1000062 Ga0055529_1000062152 402
709 3300003841 Ga0055541_1001062 Ga0055541_10010624 402
710 3300003841 Ga0055541_1001256 Ga0055541_10012564 402
711 3300005344 Ga0070661_100000139 Ga0070661_10000013934 402
712 3300005455 Ga0070663_100000006 Ga0070663_100000006178 402
713 3300005564 Ga0070664_100000002 Ga0070664_10000000287 402
714 3300005577 Ga0068857_100063245 Ga0068857_1000632453 402
715 3300005578 Ga0068854_100005888 Ga0068854_1000058888 402
716 3300005614 Ga0068856_100000028 Ga0068856_10000002820 402
717 3300013102 Ga0157371_10000204 Ga0157371_1000020432 402
718 3300013104 Ga0157370_10000013 Ga0157370_10000013144 402
719 3300013105 Ga0157369_10002173 Ga0157369_100021732 402
720 3300013307 Ga0157372_10000067 Ga0157372_100000674 402
721 3300015261 Ga0182006_1005940 Ga0182006_10059403 402
722 3300015261 Ga0182006_1024466 Ga0182006_10244662 402
723 3300025224 Ga0209784_100003 Ga0209784_100003576 402
724 3300025224 Ga0209784_100343 Ga0209784_1003437 402
725 3300025225 Ga0209566_100002 Ga0209566_1000021619 402
726 3300025225 Ga0209566_100385 Ga0209566_10038519 402
727 3300025225 Ga0209566_101097 Ga0209566_10109711 402
728 3300025226 Ga0209674_100008 Ga0209674_100008570 402
729 3300025226 Ga0209674_100217 Ga0209674_10021731 402
730 3300025228 Ga0209672_100052 Ga0209672_100052131 402
731 3300025228 Ga0209672_100190 Ga0209672_1001902 402
732 3300025229 Ga0209147_100002 Ga0209147_1000021667 402
733 3300025230 Ga0209563_100004 Ga0209563_1000041032 402
734 3300025242 Ga0209258_100002 Ga0209258_1000021667 402
735 3300025246 Ga0209646_1000022 Ga0209646_1000022391 402
736 3300025253 Ga0209677_100009 Ga0209677_100009600 402
737 3300025254 Ga0209148_1000021 Ga0209148_1000021421 402
738 3300025254 Ga0209148_1003376 Ga0209148_10033765 402
739 3300025256 Ga0209759_1005957 Ga0209759_10059572 402
740 3300025256 Ga0209759_1006874 Ga0209759_10068742 402
741 3300025256 Ga0209759_1010101 Ga0209759_10101012 402
742 3300025272 Ga0209455_1000021 Ga0209455_1000021254 402
743 3300025913 Ga0207695_10000887 Ga0207695_1000088738 402
744 3300025920 Ga0207649_10000193 Ga0207649_1000019319 402
745 3300025945 Ga0207679_10000001 Ga0207679_10000001260 402
746 3300025981 Ga0207640_10004206 Ga0207640_100042067 402
747 3300026067 Ga0207678_10000001 Ga0207678_10000001174 402
748 3300026078 Ga0207702_10000009 Ga0207702_1000000953 402
749 3300026116 Ga0207674_10013504 Ga0207674_100135043 402
750 3300044693 Ga0466961_0001499 Ga0466961_0001499_5582_6790 402
751 3300044706 Ga0466964_0003807 Ga0466964_0003807_413_1621 402
752 3300045049 Ga0466959_0093675 Ga0466959_0093675_464_1672 402
753 3300045976 Ga0466967_0211915 Ga0466967_0211915_172_1380 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

5

372

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9314 1 375
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9311 4 383
5yit-assembly2.cif.gz_C crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9284 1 376
1p5r-assembly1.cif.gz_A formyl-coa transferase in complex with coenzyme a 0.9281 3 396
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9278 2 378
ID Description Score Start End Superfamily
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9558 27 237 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9443 4 284 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9346 4 284 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9321 4 382 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9258 4 382 3.40.50.10540
ID Description Score Start End GO Terms
AF-F3GKP8-F1-model_v4 L-carnitine dehydratase/bile acid-inducible protein F 0.9868 3 150 GO:0003824
AF-A0A3M3RLL0-F1-model_v4 deleted 0.9855 3 148
AF-A0A7Y7YJD4-F1-model_v4 CoA transferase 0.9837 20 144 GO:0016740
AF-A0A536Y7Y7-F1-model_v4 Uncharacterized protein 0.9833 35 125 GO:0008410
AF-A0A7Y8C4W7-F1-model_v4 CoA transferase 0.983 3 398 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map