F479209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 426 | 684 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300025711|Ga0207696_1000315|Ga0207696_100031522 |
| Length | 395 |
| Sequence | MALPLEGLRVIEMGQLIAGPMAGRMLAEFGADVIKIEPPGKGDPLRKWRMLHNGTSVWWAAQSRNKRSVTVDLRQPEGQQIAMSLLNSADVLIENFRPGTLEKWGLSWETLHANNPRLIVLSVSGYGQTGPYRDRPGFGVIGEAMGGLRHLSGEPNRTPVRVGVSIGDSLSALHGVIGVLLALQSRETTDQGQQIDVALYESVFNMMESLIPEYSVFDHIRQPAGSSLPGIAPTNAYRCKDGKYALVAGNGDSIFQRLMQIIDRPDLAADPALAHNDGRVKQVEMLDAAIGEWTSQRSLQEVLASLNEGGIPAGKIYDAADIANDPHYKARDMLLPAQLSDGTPVTLPGIVPKLLSTPGSVRHAAPELGQHTEEVLSELGIDAKQRMVLKEKGAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 8 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 9 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 10 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 13 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 14 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 15 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 18 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 19 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 20 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 21 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 22 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 23 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 24 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 25 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 26 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 27 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 28 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 29 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 30 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 31 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 32 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 33 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 34 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 35 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 36 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 37 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 38 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 39 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 40 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 41 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 42 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 43 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 44 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 45 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 46 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 47 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 48 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 49 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 50 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 51 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 52 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 53 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 54 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 55 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 56 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 57 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 58 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 59 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 82 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 111 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 113 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 260 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 261 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 262 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 374 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 375 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 410 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 416 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 417 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 418 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 419 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 420 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 421 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 422 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 423 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 424 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 425 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 426 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.84 |
| Metatranscriptomes | 0 |
| Isolates | 9.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.08 |
| Nodule | 1.33 |
| Rhizoplane | 4.12 |
| Rhizosphere | 72.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1003791 | 3300001915 | Bacteria | 3504 |
| 2 | JGI24740J21852_10000337 | 3300001979 | Bacteria | 19914 |
| 3 | JGI24740J21852_10003034 | 3300001979 | Bacteria | 7429 |
| 4 | JGI24735J21928_10002372 | 3300002067 | Bacteria | 6558 |
| 5 | JGI25156J39149_1004600 | 3300002705 | Bacteria | 4165 |
| 6 | JGI25156J39149_1009239 | 3300002705 | Bacteria | 2411 |
| 7 | JGI25154J39366_1002132 | 3300002738 | Bacteria | 5539 |
| 8 | JGI25151J46595_10001217 | 3300003187 | Bacteria | 18394 |
| 9 | Ga0055539_1000172 | 3300003752 | Bacteria | 56105 |
| 10 | Ga0055533_1003919 | 3300003756 | Bacteria | 2824 |
| 11 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 12 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 13 | Ga0055532_1000190 | 3300003758 | Bacteria | 51412 |
| 14 | Ga0055532_1000529 | 3300003758 | Bacteria | 16669 |
| 15 | Ga0055527_1000291 | 3300003760 | Bacteria | 29060 |
| 16 | Ga0055527_1002226 | 3300003760 | Bacteria | 3399 |
| 17 | Ga0055535_1000506 | 3300003761 | Bacteria | 34557 |
| 18 | Ga0055542_1000502 | 3300003762 | Bacteria | 35790 |
| 19 | Ga0055542_1000698 | 3300003762 | Bacteria | 26527 |
| 20 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 21 | Ga0055529_1000495 | 3300003763 | Bacteria | 35799 |
| 22 | Ga0055526_1006276 | 3300003771 | Bacteria | 6503 |
| 23 | Ga0055526_1006341 | 3300003771 | Bacteria | 6450 |
| 24 | Ga0055526_1015551 | 3300003771 | Bacteria | 3048 |
| 25 | Ga0055524_1001369 | 3300003775 | Bacteria | 14151 |
| 26 | Ga0055536_1001508 | 3300003781 | Bacteria | 13983 |
| 27 | Ga0055534_1000957 | 3300003784 | Bacteria | 12821 |
| 28 | Ga0055534_1001648 | 3300003784 | Bacteria | 8615 |
| 29 | Ga0055528_1001289 | 3300003790 | Bacteria | 15738 |
| 30 | Ga0055540_1017091 | 3300003792 | Bacteria | 2036 |
| 31 | Ga0055531_10000103 | 3300003794 | Bacteria | 92298 |
| 32 | Ga0055541_1001062 | 3300003841 | Bacteria | 6341 |
| 33 | Ga0055541_1001256 | 3300003841 | Bacteria | 5595 |
| 34 | Ga0065715_10111222 | 3300005293 | Bacteria | 2583 |
| 35 | Ga0070658_10057021 | 3300005327 | Bacteria | 3177 |
| 36 | Ga0070683_100108050 | 3300005329 | Bacteria | 2623 |
| 37 | Ga0070670_100026828 | 3300005331 | Bacteria | 4955 |
| 38 | Ga0070677_10006985 | 3300005333 | Bacteria | 3754 |
| 39 | Ga0070677_10008896 | 3300005333 | Bacteria | 3392 |
| 40 | Ga0068869_100012126 | 3300005334 | Bacteria | 5684 |
| 41 | Ga0070666_10005794 | 3300005335 | Bacteria | 7591 |
| 42 | Ga0068868_100023978 | 3300005338 | Bacteria | 4624 |
| 43 | Ga0070660_100001233 | 3300005339 | Bacteria | 17366 |
| 44 | Ga0070689_100001884 | 3300005340 | Bacteria | 13536 |
| 45 | Ga0070661_100000139 | 3300005344 | Bacteria | 60942 |
| 46 | Ga0070661_100098567 | 3300005344 | Bacteria | 2171 |
| 47 | Ga0070675_100003197 | 3300005354 | Bacteria | 12414 |
| 48 | Ga0070671_100001524 | 3300005355 | Bacteria | 17379 |
| 49 | Ga0070671_100003066 | 3300005355 | Bacteria | 12990 |
| 50 | Ga0070674_100003404 | 3300005356 | Bacteria | 8917 |
| 51 | Ga0070674_100084719 | 3300005356 | Bacteria | 2273 |
| 52 | Ga0070674_100250000 | 3300005356 | Bacteria | 1392 |
| 53 | Ga0070673_100013700 | 3300005364 | Bacteria | 5621 |
| 54 | Ga0070688_100001410 | 3300005365 | Bacteria | 11981 |
| 55 | Ga0070659_100000055 | 3300005366 | Bacteria | 88573 |
| 56 | Ga0070667_100023292 | 3300005367 | Bacteria | 5136 |
| 57 | Ga0070713_100002763 | 3300005436 | Bacteria | 11475 |
| 58 | Ga0070713_100038587 | 3300005436 | Bacteria | 3871 |
| 59 | Ga0070708_100089422 | 3300005445 | Bacteria | 2802 |
| 60 | Ga0070663_100000006 | 3300005455 | Bacteria | 208068 |
| 61 | Ga0070678_100020790 | 3300005456 | Bacteria | 4312 |
| 62 | Ga0070681_10281856 | 3300005458 | Bacteria | 1572 |
| 63 | Ga0068867_100018155 | 3300005459 | Bacteria | 4999 |
| 64 | Ga0070685_10003558 | 3300005466 | Bacteria | 7906 |
| 65 | Ga0070706_100067089 | 3300005467 | Bacteria | 3318 |
| 66 | Ga0070699_100071995 | 3300005518 | Bacteria | 3006 |
| 67 | Ga0070699_100118904 | 3300005518 | Bacteria | 2323 |
| 68 | Ga0070679_100028419 | 3300005530 | Bacteria | 5513 |
| 69 | Ga0070679_100215154 | 3300005530 | Bacteria | 1884 |
| 70 | Ga0070697_100028101 | 3300005536 | Bacteria | 4502 |
| 71 | Ga0070672_100000953 | 3300005543 | Bacteria | 17436 |
| 72 | Ga0070686_100034566 | 3300005544 | Bacteria | 3116 |
| 73 | Ga0070696_100067834 | 3300005546 | Bacteria | 2503 |
| 74 | Ga0070693_100003097 | 3300005547 | Bacteria | 7716 |
| 75 | Ga0070693_100155354 | 3300005547 | Bacteria | 1452 |
| 76 | Ga0070665_100009891 | 3300005548 | Bacteria | 9644 |
| 77 | Ga0070665_100331014 | 3300005548 | Bacteria | 1528 |
| 78 | Ga0068855_100034447 | 3300005563 | Bacteria | 6039 |
| 79 | Ga0068855_100046124 | 3300005563 | Bacteria | 5153 |
| 80 | Ga0068855_100146546 | 3300005563 | Bacteria | 2687 |
| 81 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 82 | Ga0068857_100063245 | 3300005577 | Bacteria | 3289 |
| 83 | Ga0068854_100005888 | 3300005578 | Bacteria | 7765 |
| 84 | Ga0068856_100000028 | 3300005614 | Bacteria | 131498 |
| 85 | Ga0068852_100280880 | 3300005616 | Bacteria | 1605 |
| 86 | Ga0068859_100003773 | 3300005617 | Bacteria | 15457 |
| 87 | Ga0068864_100048425 | 3300005618 | Bacteria | 3654 |
| 88 | Ga0068864_100083801 | 3300005618 | Bacteria | 2800 |
| 89 | Ga0068866_10001012 | 3300005718 | Bacteria | 12361 |
| 90 | Ga0068851_10005934 | 3300005834 | Bacteria | 5559 |
| 91 | Ga0068870_10005349 | 3300005840 | Bacteria | 5601 |
| 92 | Ga0068863_100045739 | 3300005841 | Bacteria | 4154 |
| 93 | Ga0068858_100074430 | 3300005842 | Bacteria | 3153 |
| 94 | Ga0068860_100050284 | 3300005843 | Bacteria | 3968 |
| 95 | Ga0075364_10004775 | 3300006051 | Bacteria | 7835 |
| 96 | Ga0075364_10007506 | 3300006051 | Bacteria | 6482 |
| 97 | Ga0075364_10052558 | 3300006051 | Bacteria | 2662 |
| 98 | Ga0075364_10064415 | 3300006051 | Bacteria | 2406 |
| 99 | Ga0075432_10007080 | 3300006058 | Bacteria | 3820 |
| 100 | Ga0075362_10040477 | 3300006177 | Bacteria | 2052 |
| 101 | Ga0075369_10059343 | 3300006186 | Bacteria | 1667 |
| 102 | Ga0075366_10087875 | 3300006195 | Bacteria | 1861 |
| 103 | Ga0097621_100004800 | 3300006237 | Bacteria | 9461 |
| 104 | Ga0097621_100056426 | 3300006237 | Bacteria | 3209 |
| 105 | Ga0097621_100197600 | 3300006237 | Bacteria | 1744 |
| 106 | Ga0068871_100043084 | 3300006358 | Bacteria | 3625 |
| 107 | Ga0097620_100003773 | 3300006931 | Bacteria | 15457 |
| 108 | Ga0099826_10000020 | 3300006948 | Bacteria | 183920 |
| 109 | Ga0105251_10000066 | 3300009011 | Bacteria | 99856 |
| 110 | Ga0105251_10000193 | 3300009011 | Bacteria | 61489 |
| 111 | Ga0105251_10012171 | 3300009011 | Bacteria | 4881 |
| 112 | Ga0105244_10057966 | 3300009036 | Bacteria | 1956 |
| 113 | Ga0105250_10000033 | 3300009092 | Bacteria | 157956 |
| 114 | Ga0105250_10000676 | 3300009092 | Bacteria | 21455 |
| 115 | Ga0105240_10000229 | 3300009093 | Bacteria | 111182 |
| 116 | Ga0105240_10023042 | 3300009093 | Bacteria | 8247 |
| 117 | Ga0105245_10220655 | 3300009098 | Bacteria | 1829 |
| 118 | Ga0105243_10044088 | 3300009148 | Bacteria | 3498 |
| 119 | Ga0105248_10126581 | 3300009177 | Bacteria | 2882 |
| 120 | Ga0105237_10180336 | 3300009545 | Bacteria | 2112 |
| 121 | Ga0105238_10134059 | 3300009551 | Bacteria | 2455 |
| 122 | Ga0105249_10201881 | 3300009553 | Bacteria | 1946 |
| 123 | Ga0105239_10007284 | 3300010375 | Bacteria | 12699 |
| 124 | Ga0105239_10350890 | 3300010375 | Bacteria | 1666 |
| 125 | Ga0157371_10000204 | 3300013102 | Bacteria | 86751 |
| 126 | Ga0157370_10000013 | 3300013104 | Bacteria | 198861 |
| 127 | Ga0157369_10000268 | 3300013105 | Bacteria | 70336 |
| 128 | Ga0157369_10002173 | 3300013105 | Bacteria | 23616 |
| 129 | Ga0157374_10000738 | 3300013296 | Bacteria | 28535 |
| 130 | Ga0157378_10037531 | 3300013297 | Bacteria | 4292 |
| 131 | Ga0163162_10022743 | 3300013306 | Bacteria | 6180 |
| 132 | Ga0163162_10036327 | 3300013306 | Bacteria | 4909 |
| 133 | Ga0163162_10106478 | 3300013306 | Bacteria | 2899 |
| 134 | Ga0157372_10000067 | 3300013307 | Bacteria | 111621 |
| 135 | Ga0157372_10003463 | 3300013307 | Bacteria | 17027 |
| 136 | Ga0157375_10005538 | 3300013308 | Bacteria | 10989 |
| 137 | Ga0157375_10046595 | 3300013308 | Bacteria | 4229 |
| 138 | Ga0163163_10055183 | 3300014325 | Bacteria | 3927 |
| 139 | Ga0157380_10040298 | 3300014326 | Bacteria | 3637 |
| 140 | Ga0182008_10000089 | 3300014497 | Bacteria | 69969 |
| 141 | Ga0182008_10007326 | 3300014497 | Bacteria | 6101 |
| 142 | Ga0157377_10065508 | 3300014745 | Bacteria | 2087 |
| 143 | Ga0157379_10049696 | 3300014968 | Bacteria | 3744 |
| 144 | Ga0157376_10038338 | 3300014969 | Bacteria | 3898 |
| 145 | Ga0157376_10260176 | 3300014969 | Bacteria | 1625 |
| 146 | Ga0182006_1005940 | 3300015261 | Bacteria | 5739 |
| 147 | Ga0182006_1024466 | 3300015261 | Bacteria | 2490 |
| 148 | Ga0182007_10000583 | 3300015262 | Bacteria | 21488 |
| 149 | Ga0182005_1004316 | 3300015265 | Bacteria | 4619 |
| 150 | Ga0163161_10084311 | 3300017792 | Bacteria | 2343 |
| 151 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 152 | Ga0209784_100343 | 3300025224 | Bacteria | 22887 |
| 153 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 154 | Ga0209566_100258 | 3300025225 | Bacteria | 50542 |
| 155 | Ga0209566_100385 | 3300025225 | Bacteria | 35723 |
| 156 | Ga0209566_101097 | 3300025225 | Bacteria | 10503 |
| 157 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 158 | Ga0209674_100217 | 3300025226 | Bacteria | 55436 |
| 159 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 160 | Ga0209672_100080 | 3300025228 | Bacteria | 143481 |
| 161 | Ga0209672_100190 | 3300025228 | Bacteria | 49762 |
| 162 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 163 | Ga0209147_100071 | 3300025229 | Bacteria | 215861 |
| 164 | Ga0209147_100091 | 3300025229 | Bacteria | 168353 |
| 165 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 166 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 167 | Ga0209258_100082 | 3300025242 | Bacteria | 247739 |
| 168 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 169 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 170 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 171 | Ga0209148_1000195 | 3300025254 | Bacteria | 109654 |
| 172 | Ga0209148_1003376 | 3300025254 | Bacteria | 4465 |
| 173 | Ga0209759_1004919 | 3300025256 | Bacteria | 4836 |
| 174 | Ga0209759_1005957 | 3300025256 | Bacteria | 4165 |
| 175 | Ga0209759_1006874 | 3300025256 | Bacteria | 3759 |
| 176 | Ga0209759_1010101 | 3300025256 | Bacteria | 2791 |
| 177 | Ga0209565_1000092 | 3300025263 | Bacteria | 141563 |
| 178 | Ga0209565_1006597 | 3300025263 | Bacteria | 3234 |
| 179 | Ga0209565_1007190 | 3300025263 | Bacteria | 3029 |
| 180 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 181 | Ga0209455_1000172 | 3300025272 | Bacteria | 109654 |
| 182 | Ga0209673_1000076 | 3300025273 | Bacteria | 230907 |
| 183 | Ga0209673_1014539 | 3300025273 | Bacteria | 3041 |
| 184 | Ga0209675_1000809 | 3300025291 | Bacteria | 20627 |
| 185 | Ga0209675_1000951 | 3300025291 | Bacteria | 18424 |
| 186 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 187 | Ga0209025_1000892 | 3300025294 | Bacteria | 46436 |
| 188 | Ga0209025_1001159 | 3300025294 | Bacteria | 37305 |
| 189 | Ga0209025_1001484 | 3300025294 | Bacteria | 30443 |
| 190 | Ga0209564_1001095 | 3300025295 | Bacteria | 32240 |
| 191 | Ga0209564_1002067 | 3300025295 | Bacteria | 17262 |
| 192 | Ga0209564_1002203 | 3300025295 | Bacteria | 16266 |
| 193 | Ga0209050_1001574 | 3300025298 | Bacteria | 23699 |
| 194 | Ga0209256_1000804 | 3300025299 | Bacteria | 40181 |
| 195 | Ga0209256_1001280 | 3300025299 | Bacteria | 27204 |
| 196 | Ga0209051_1007991 | 3300025303 | Bacteria | 5680 |
| 197 | Ga0209051_1012352 | 3300025303 | Bacteria | 4139 |
| 198 | Ga0209051_1051666 | 3300025303 | Bacteria | 1365 |
| 199 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 200 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 201 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 202 | Ga0207696_1000315 | 3300025711 | Bacteria | 53471 |
| 203 | Ga0207655_1006992 | 3300025728 | Bacteria | 7392 |
| 204 | Ga0207655_1018924 | 3300025728 | Bacteria | 3628 |
| 205 | Ga0207655_1051550 | 3300025728 | Bacteria | 1663 |
| 206 | Ga0207713_1000193 | 3300025735 | Bacteria | 85067 |
| 207 | Ga0207713_1000220 | 3300025735 | Bacteria | 76897 |
| 208 | Ga0207713_1000724 | 3300025735 | Bacteria | 30902 |
| 209 | Ga0207713_1021020 | 3300025735 | Bacteria | 3139 |
| 210 | Ga0207682_10004153 | 3300025893 | Bacteria | 6131 |
| 211 | Ga0207692_10007836 | 3300025898 | Bacteria | 4396 |
| 212 | Ga0207692_10036111 | 3300025898 | Bacteria | 2406 |
| 213 | Ga0207688_10023056 | 3300025901 | Bacteria | 3406 |
| 214 | Ga0207647_10001075 | 3300025904 | Bacteria | 21061 |
| 215 | Ga0207643_10046640 | 3300025908 | Bacteria | 2450 |
| 216 | Ga0207654_10011228 | 3300025911 | Bacteria | 4565 |
| 217 | Ga0207695_10000268 | 3300025913 | Bacteria | 130752 |
| 218 | Ga0207695_10000887 | 3300025913 | Bacteria | 54367 |
| 219 | Ga0207695_10020055 | 3300025913 | Bacteria | 7672 |
| 220 | Ga0207695_10321155 | 3300025913 | Bacteria | 1438 |
| 221 | Ga0207671_10028223 | 3300025914 | Bacteria | 4195 |
| 222 | Ga0207693_10002196 | 3300025915 | Bacteria | 17012 |
| 223 | Ga0207657_10000087 | 3300025919 | Bacteria | 88335 |
| 224 | Ga0207657_10011384 | 3300025919 | Bacteria | 8835 |
| 225 | Ga0207649_10000193 | 3300025920 | Bacteria | 50158 |
| 226 | Ga0207646_10105089 | 3300025922 | Bacteria | 2532 |
| 227 | Ga0207681_10020045 | 3300025923 | Bacteria | 4234 |
| 228 | Ga0207694_10053281 | 3300025924 | Bacteria | 3137 |
| 229 | Ga0207650_10006798 | 3300025925 | Bacteria | 7799 |
| 230 | Ga0207659_10014205 | 3300025926 | Bacteria | 5126 |
| 231 | Ga0207687_10002320 | 3300025927 | Bacteria | 12955 |
| 232 | Ga0207687_10020309 | 3300025927 | Bacteria | 4406 |
| 233 | Ga0207700_10032497 | 3300025928 | Bacteria | 3723 |
| 234 | Ga0207700_10155982 | 3300025928 | Bacteria | 1892 |
| 235 | Ga0207664_10002534 | 3300025929 | Bacteria | 12077 |
| 236 | Ga0207644_10002683 | 3300025931 | Bacteria | 11462 |
| 237 | Ga0207690_10000071 | 3300025932 | Bacteria | 88665 |
| 238 | Ga0207706_10100452 | 3300025933 | Bacteria | 2545 |
| 239 | Ga0207686_10002219 | 3300025934 | Bacteria | 10675 |
| 240 | Ga0207670_10001236 | 3300025936 | Bacteria | 13493 |
| 241 | Ga0207670_10206634 | 3300025936 | Bacteria | 1495 |
| 242 | Ga0207669_10024534 | 3300025937 | Bacteria | 3243 |
| 243 | Ga0207669_10226601 | 3300025937 | Bacteria | 1376 |
| 244 | Ga0207691_10002659 | 3300025940 | Bacteria | 17461 |
| 245 | Ga0207691_10065039 | 3300025940 | Bacteria | 3302 |
| 246 | Ga0207711_10000575 | 3300025941 | Bacteria | 37379 |
| 247 | Ga0207689_10029614 | 3300025942 | Bacteria | 4569 |
| 248 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 249 | Ga0207667_10013868 | 3300025949 | Bacteria | 9207 |
| 250 | Ga0207667_10033641 | 3300025949 | Bacteria | 5510 |
| 251 | Ga0207667_10034860 | 3300025949 | Bacteria | 5402 |
| 252 | Ga0207667_10141406 | 3300025949 | Bacteria | 2478 |
| 253 | Ga0207667_10146335 | 3300025949 | Bacteria | 2432 |
| 254 | Ga0207651_10011371 | 3300025960 | Bacteria | 4981 |
| 255 | Ga0207640_10004206 | 3300025981 | Bacteria | 7787 |
| 256 | Ga0207658_10030107 | 3300025986 | Bacteria | 3840 |
| 257 | Ga0207677_10001768 | 3300026023 | Bacteria | 11425 |
| 258 | Ga0207703_10000698 | 3300026035 | Bacteria | 33208 |
| 259 | Ga0207639_10024300 | 3300026041 | Bacteria | 4384 |
| 260 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 261 | Ga0207702_10000009 | 3300026078 | Bacteria | 305906 |
| 262 | Ga0207702_10048011 | 3300026078 | Bacteria | 3599 |
| 263 | Ga0207641_10007478 | 3300026088 | Bacteria | 9091 |
| 264 | Ga0207648_10004573 | 3300026089 | Bacteria | 14185 |
| 265 | Ga0207676_10000116 | 3300026095 | Bacteria | 71614 |
| 266 | Ga0207674_10013504 | 3300026116 | Bacteria | 9056 |
| 267 | Ga0207674_10034484 | 3300026116 | Bacteria | 5289 |
| 268 | Ga0207675_100217128 | 3300026118 | Bacteria | 1841 |
| 269 | Ga0207683_10002532 | 3300026121 | Bacteria | 15950 |
| 270 | Ga0207683_10003557 | 3300026121 | Bacteria | 13592 |
| 271 | Ga0207698_10009359 | 3300026142 | Bacteria | 6244 |
| 272 | Ga0207698_10056534 | 3300026142 | Bacteria | 3030 |
| 273 | Ga0207698_10166004 | 3300026142 | Bacteria | 1937 |
| 274 | Ga0207698_10306960 | 3300026142 | Bacteria | 1480 |
| 275 | Ga0209371_1000713 | 3300027312 | Bacteria | 28089 |
| 276 | Ga0209282_1000045 | 3300027666 | Bacteria | 118401 |
| 277 | Ga0207428_10001135 | 3300027907 | Bacteria | 28911 |
| 278 | Ga0207428_10086747 | 3300027907 | Bacteria | 2436 |
| 279 | Ga0268266_10304791 | 3300028379 | Bacteria | 1487 |
| 280 | Ga0268264_10035740 | 3300028381 | Bacteria | 4090 |
| 281 | Ga0265338_10000191 | 3300028800 | Bacteria | 115408 |
| 282 | Ga0265338_10000708 | 3300028800 | Bacteria | 56942 |
| 283 | Ga0268256_1000608 | 3300030500 | Bacteria | 28089 |
| 284 | Ga0307511_10062662 | 3300030521 | Bacteria | 2819 |
| 285 | Ga0265330_10077406 | 3300031235 | Bacteria | 1435 |
| 286 | Ga0307513_10005621 | 3300031456 | Bacteria | 16528 |
| 287 | Ga0307408_100067387 | 3300031548 | Bacteria | 2632 |
| 288 | Ga0373934_0002351 | 3300035086 | Bacteria | 6962 |
| 289 | Ga0373956_0017678 | 3300035119 | Bacteria | 3010 |
| 290 | Ga0373957_0005251 | 3300035120 | Bacteria | 4010 |
| 291 | Ga0373943_0053725 | 3300035170 | Bacteria | 1990 |
| 292 | Ga0373955_0033709 | 3300035172 | Bacteria | 2699 |
| 293 | Ga0373935_0066948 | 3300035692 | Bacteria | 2308 |
| 294 | Ga0373927_0107920 | 3300035695 | Bacteria | 1813 |
| 295 | Ga0373947_0062862 | 3300035725 | Bacteria | 2260 |
| 296 | Ga0373947_0063369 | 3300035725 | Bacteria | 2252 |
| 297 | Ga0373937_0155057 | 3300036401 | Bacteria | 2146 |
| 298 | Ga0373925_0032256 | 3300037068 | Bacteria | 3855 |
| 299 | Ga0373925_0118780 | 3300037068 | Bacteria | 2050 |
| 300 | Ga0395899_0016095 | 3300037312 | Bacteria | 5701 |
| 301 | Ga0395899_0020452 | 3300037312 | Bacteria | 5017 |
| 302 | Ga0395899_0027741 | 3300037312 | Bacteria | 4266 |
| 303 | Ga0395899_0066258 | 3300037312 | Bacteria | 2652 |
| 304 | Ga0395900_0000015 | 3300037418 | Bacteria | 384313 |
| 305 | Ga0395900_0028321 | 3300037418 | Bacteria | 5737 |
| 306 | Ga0395900_0032503 | 3300037418 | Bacteria | 5366 |
| 307 | Ga0395900_0051302 | 3300037418 | Bacteria | 4250 |
| 308 | Ga0395900_0071864 | 3300037418 | Bacteria | 3557 |
| 309 | Ga0395900_0083714 | 3300037418 | Bacteria | 3277 |
| 310 | Ga0395900_0112904 | 3300037418 | Bacteria | 2789 |
| 311 | Ga0395898_0000346 | 3300037466 | Bacteria | 104661 |
| 312 | Ga0395898_0011051 | 3300037466 | Bacteria | 9405 |
| 313 | Ga0395898_0037403 | 3300037466 | Bacteria | 4814 |
| 314 | Ga0395905_0014748 | 3300037471 | Bacteria | 7451 |
| 315 | Ga0395905_0039553 | 3300037471 | Bacteria | 4424 |
| 316 | Ga0395901_0000121 | 3300038443 | Bacteria | 100690 |
| 317 | Ga0395901_0000769 | 3300038443 | Bacteria | 35972 |
| 318 | Ga0395901_0002848 | 3300038443 | Bacteria | 17463 |
| 319 | Ga0395901_0033333 | 3300038443 | Bacteria | 5317 |
| 320 | Ga0439436_0009175 | 3300041404 | Bacteria | 3035 |
| 321 | Ga0439438_011366 | 3300041405 | Bacteria | 2777 |
| 322 | Ga0439447_009243 | 3300041407 | Bacteria | 3002 |
| 323 | Ga0439452_004263 | 3300042010 | Bacteria | 4833 |
| 324 | Ga0439463_000427 | 3300042016 | Bacteria | 11745 |
| 325 | Ga0451577_0021281 | 3300042876 | Bacteria | 5937 |
| 326 | Ga0451577_0206717 | 3300042876 | Bacteria | 1773 |
| 327 | Ga0466969_0006727 | 3300044656 | Bacteria | 6112 |
| 328 | Ga0466969_0010542 | 3300044656 | Bacteria | 4898 |
| 329 | Ga0466972_0014184 | 3300044658 | Bacteria | 3994 |
| 330 | Ga0466965_0002678 | 3300044683 | Bacteria | 7620 |
| 331 | Ga0466966_0000834 | 3300044684 | Bacteria | 19673 |
| 332 | Ga0466966_0029902 | 3300044684 | Bacteria | 3541 |
| 333 | Ga0466966_0089514 | 3300044684 | Bacteria | 1912 |
| 334 | Ga0466961_0001499 | 3300044693 | Bacteria | 14488 |
| 335 | Ga0466961_0036305 | 3300044693 | Bacteria | 3164 |
| 336 | Ga0466961_0105456 | 3300044693 | Bacteria | 1774 |
| 337 | Ga0466963_0004481 | 3300044694 | Bacteria | 8126 |
| 338 | Ga0466964_0003807 | 3300044706 | Bacteria | 5531 |
| 339 | Ga0453684_0081161 | 3300044712 | Bacteria | 4046 |
| 340 | Ga0466971_0002200 | 3300044719 | Bacteria | 8246 |
| 341 | Ga0466971_0007873 | 3300044719 | Bacteria | 4640 |
| 342 | Ga0466970_0043193 | 3300044765 | Bacteria | 2398 |
| 343 | Ga0466957_0012407 | 3300044842 | Bacteria | 4932 |
| 344 | Ga0466957_0037623 | 3300044842 | Bacteria | 2914 |
| 345 | Ga0466959_0008133 | 3300045049 | Bacteria | 7399 |
| 346 | Ga0466959_0089778 | 3300045049 | Bacteria | 2207 |
| 347 | Ga0466959_0093675 | 3300045049 | Bacteria | 2155 |
| 348 | Ga0466958_0010655 | 3300045836 | Bacteria | 5156 |
| 349 | Ga0466967_0211915 | 3300045976 | Bacteria | 1838 |
| 350 | Ga0495627_000062 | 3300046453 | Bacteria | 138772 |
| 351 | Ga0495627_001467 | 3300046453 | Bacteria | 13747 |
| 352 | Ga0495627_006765 | 3300046453 | Bacteria | 4460 |
| 353 | Ga0495603_0042619 | 3300046455 | Bacteria | 2713 |
| 354 | Ga0495590_0006547 | 3300046457 | Bacteria | 4541 |
| 355 | Ga0495590_0016766 | 3300046457 | Bacteria | 2643 |
| 356 | Ga0495591_006793 | 3300046458 | Bacteria | 4981 |
| 357 | Ga0495591_015464 | 3300046458 | Bacteria | 2695 |
| 358 | Ga0495629_0000456 | 3300046459 | Bacteria | 34095 |
| 359 | Ga0495629_0001254 | 3300046459 | Bacteria | 19924 |
| 360 | Ga0495638_0072088 | 3300046460 | Bacteria | 2112 |
| 361 | Ga0495653_0000101 | 3300046463 | Bacteria | 70919 |
| 362 | Ga0495653_0001150 | 3300046463 | Bacteria | 20361 |
| 363 | Ga0495653_0007814 | 3300046463 | Bacteria | 8756 |
| 364 | Ga0495653_0015560 | 3300046463 | Bacteria | 6200 |
| 365 | Ga0495653_0237613 | 3300046463 | Bacteria | 1216 |
| 366 | Ga0495650_0001466 | 3300046471 | Bacteria | 22642 |
| 367 | Ga0495650_0001616 | 3300046471 | Bacteria | 21026 |
| 368 | Ga0495650_0014091 | 3300046471 | Bacteria | 4186 |
| 369 | Ga0495580_0004305 | 3300046472 | Bacteria | 11969 |
| 370 | Ga0495580_0014143 | 3300046472 | Bacteria | 6065 |
| 371 | Ga0495580_0062038 | 3300046472 | Bacteria | 2623 |
| 372 | Ga0495580_0184304 | 3300046472 | Bacteria | 1441 |
| 373 | Ga0495605_0000007 | 3300046474 | Bacteria | 358289 |
| 374 | Ga0495605_0000470 | 3300046474 | Bacteria | 35866 |
| 375 | Ga0495605_0002522 | 3300046474 | Bacteria | 11299 |
| 376 | Ga0495605_0002620 | 3300046474 | Bacteria | 11041 |
| 377 | Ga0495605_0003778 | 3300046474 | Bacteria | 8983 |
| 378 | Ga0495605_0004037 | 3300046474 | Bacteria | 8664 |
| 379 | Ga0495605_0041490 | 3300046474 | Bacteria | 2292 |
| 380 | Ga0495662_0018336 | 3300046476 | Bacteria | 3387 |
| 381 | Ga0495664_0001452 | 3300046477 | Bacteria | 12555 |
| 382 | Ga0495664_0008403 | 3300046477 | Bacteria | 5760 |
| 383 | Ga0495584_0000686 | 3300046491 | Bacteria | 22477 |
| 384 | Ga0495584_0001410 | 3300046491 | Bacteria | 14471 |
| 385 | Ga0495584_0020394 | 3300046491 | Bacteria | 3368 |
| 386 | Ga0495585_0000282 | 3300046492 | Bacteria | 50936 |
| 387 | Ga0495585_0004671 | 3300046492 | Bacteria | 8828 |
| 388 | Ga0495594_0001267 | 3300046499 | Bacteria | 13203 |
| 389 | Ga0495594_0007442 | 3300046499 | Bacteria | 5632 |
| 390 | Ga0495594_0127623 | 3300046499 | Bacteria | 1440 |
| 391 | Ga0495596_0000835 | 3300046500 | Bacteria | 18636 |
| 392 | Ga0495596_0003319 | 3300046500 | Bacteria | 8199 |
| 393 | Ga0495607_0000047 | 3300046501 | Bacteria | 121696 |
| 394 | Ga0495607_0000702 | 3300046501 | Bacteria | 32246 |
| 395 | Ga0495607_0005502 | 3300046501 | Bacteria | 9045 |
| 396 | Ga0495607_0007690 | 3300046501 | Bacteria | 7428 |
| 397 | Ga0495607_0008631 | 3300046501 | Bacteria | 6949 |
| 398 | Ga0495607_0009093 | 3300046501 | Bacteria | 6753 |
| 399 | Ga0495607_0020035 | 3300046501 | Bacteria | 4235 |
| 400 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 401 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 402 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 403 | Ga0495583_0000281 | 3300046506 | Bacteria | 82123 |
| 404 | Ga0495583_0004924 | 3300046506 | Bacteria | 9285 |
| 405 | Ga0495583_0042761 | 3300046506 | Bacteria | 2114 |
| 406 | Ga0495606_0000360 | 3300046507 | Bacteria | 77832 |
| 407 | Ga0495606_0036255 | 3300046507 | Bacteria | 3361 |
| 408 | Ga0495610_0000402 | 3300046512 | Bacteria | 44548 |
| 409 | Ga0495610_0006856 | 3300046512 | Bacteria | 7722 |
| 410 | Ga0495610_0011451 | 3300046512 | Bacteria | 5421 |
| 411 | Ga0495610_0015787 | 3300046512 | Bacteria | 4374 |
| 412 | Ga0495616_0000456 | 3300046513 | Bacteria | 31180 |
| 413 | Ga0495616_0000941 | 3300046513 | Bacteria | 20925 |
| 414 | Ga0495616_0002483 | 3300046513 | Bacteria | 12208 |
| 415 | Ga0495616_0008459 | 3300046513 | Bacteria | 6096 |
| 416 | Ga0495620_0000399 | 3300046515 | Bacteria | 29177 |
| 417 | Ga0495620_0012381 | 3300046515 | Bacteria | 4410 |
| 418 | Ga0495628_0001033 | 3300046516 | Bacteria | 25478 |
| 419 | Ga0495628_0001082 | 3300046516 | Bacteria | 24897 |
| 420 | Ga0495630_0000888 | 3300046517 | Bacteria | 20976 |
| 421 | Ga0495630_0002736 | 3300046517 | Bacteria | 12234 |
| 422 | Ga0495631_0000921 | 3300046518 | Bacteria | 18335 |
| 423 | Ga0495631_0003741 | 3300046518 | Bacteria | 8286 |
| 424 | Ga0495632_0000037 | 3300046519 | Bacteria | 158699 |
| 425 | Ga0495632_0001836 | 3300046519 | Bacteria | 17116 |
| 426 | Ga0495632_0002620 | 3300046519 | Bacteria | 13548 |
| 427 | Ga0495632_0010910 | 3300046519 | Bacteria | 5336 |
| 428 | Ga0495632_0029184 | 3300046519 | Bacteria | 2874 |
| 429 | Ga0495637_0025016 | 3300046520 | Bacteria | 2696 |
| 430 | Ga0495643_0003881 | 3300046522 | Bacteria | 10742 |
| 431 | Ga0495643_0005109 | 3300046522 | Bacteria | 8974 |
| 432 | Ga0495643_0008753 | 3300046522 | Bacteria | 6380 |
| 433 | Ga0495643_0067853 | 3300046522 | Bacteria | 1878 |
| 434 | Ga0495643_0069472 | 3300046522 | Bacteria | 1851 |
| 435 | Ga0495644_0000054 | 3300046523 | Bacteria | 55331 |
| 436 | Ga0495648_0001650 | 3300046524 | Bacteria | 21659 |
| 437 | Ga0495648_0004197 | 3300046524 | Bacteria | 12375 |
| 438 | Ga0495648_0010340 | 3300046524 | Bacteria | 7115 |
| 439 | Ga0495642_0001123 | 3300046528 | Bacteria | 12315 |
| 440 | Ga0495642_0022089 | 3300046528 | Bacteria | 2505 |
| 441 | Ga0495652_0001426 | 3300046529 | Bacteria | 26537 |
| 442 | Ga0495654_0000112 | 3300046530 | Bacteria | 92528 |
| 443 | Ga0495654_0000192 | 3300046530 | Bacteria | 59720 |
| 444 | Ga0495654_0004712 | 3300046530 | Bacteria | 8035 |
| 445 | Ga0495654_0011370 | 3300046530 | Bacteria | 4818 |
| 446 | Ga0495654_0012772 | 3300046530 | Bacteria | 4507 |
| 447 | Ga0495654_0016135 | 3300046530 | Bacteria | 3953 |
| 448 | Ga0495665_0000030 | 3300046531 | Bacteria | 54150 |
| 449 | Ga0495665_0009558 | 3300046531 | Bacteria | 5253 |
| 450 | Ga0495665_0021857 | 3300046531 | Bacteria | 3440 |
| 451 | Ga0495586_0037752 | 3300046535 | Bacteria | 2594 |
| 452 | Ga0495587_0000835 | 3300046536 | Bacteria | 20361 |
| 453 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 454 | Ga0495609_0000157 | 3300046538 | Bacteria | 70102 |
| 455 | Ga0495609_0000552 | 3300046538 | Bacteria | 29569 |
| 456 | Ga0495609_0000681 | 3300046538 | Bacteria | 26243 |
| 457 | Ga0495609_0000990 | 3300046538 | Bacteria | 20295 |
| 458 | Ga0495609_0005556 | 3300046538 | Bacteria | 6583 |
| 459 | Ga0495621_0001548 | 3300046539 | Bacteria | 5990 |
| 460 | Ga0495621_0008601 | 3300046539 | Bacteria | 3069 |
| 461 | Ga0495597_0000095 | 3300046542 | Bacteria | 78512 |
| 462 | Ga0495597_0000649 | 3300046542 | Bacteria | 28252 |
| 463 | Ga0495597_0003203 | 3300046542 | Bacteria | 9746 |
| 464 | Ga0495597_0004447 | 3300046542 | Bacteria | 7701 |
| 465 | Ga0495597_0018420 | 3300046542 | Bacteria | 3276 |
| 466 | Ga0495645_0002165 | 3300046543 | Bacteria | 13342 |
| 467 | Ga0495645_0053245 | 3300046543 | Bacteria | 2942 |
| 468 | Ga0495622_0045432 | 3300046557 | Bacteria | 2041 |
| 469 | Ga0495633_0000020 | 3300046558 | Bacteria | 227180 |
| 470 | Ga0495656_0001551 | 3300046615 | Bacteria | 7510 |
| 471 | Ga0495668_0019409 | 3300046616 | Bacteria | 3920 |
| 472 | Ga0495668_0024153 | 3300046616 | Bacteria | 3459 |
| 473 | Ga0495668_0036502 | 3300046616 | Bacteria | 2753 |
| 474 | Ga0495668_0037073 | 3300046616 | Bacteria | 2730 |
| 475 | Ga0495634_0000347 | 3300046642 | Bacteria | 44864 |
| 476 | Ga0495611_0002446 | 3300046648 | Bacteria | 8484 |
| 477 | Ga0495611_0016690 | 3300046648 | Bacteria | 3138 |
| 478 | Ga0495625_0001919 | 3300046660 | Bacteria | 23507 |
| 479 | Ga0495625_0002739 | 3300046660 | Bacteria | 18665 |
| 480 | Ga0495625_0044650 | 3300046660 | Bacteria | 3207 |
| 481 | Ga0495635_0000402 | 3300046663 | Bacteria | 27473 |
| 482 | Ga0495635_0015624 | 3300046663 | Bacteria | 5303 |
| 483 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 484 | Ga0495659_0000864 | 3300046664 | Bacteria | 10784 |
| 485 | Ga0495659_0005499 | 3300046664 | Bacteria | 3986 |
| 486 | Ga0495661_0000009 | 3300046665 | Bacteria | 291327 |
| 487 | Ga0495661_0000057 | 3300046665 | Bacteria | 135044 |
| 488 | Ga0495661_0000154 | 3300046665 | Bacteria | 80795 |
| 489 | Ga0495661_0001421 | 3300046665 | Bacteria | 20076 |
| 490 | Ga0495661_0005142 | 3300046665 | Bacteria | 9326 |
| 491 | Ga0495661_0016364 | 3300046665 | Bacteria | 4918 |
| 492 | Ga0495661_0024161 | 3300046665 | Bacteria | 3935 |
| 493 | Ga0495661_0049158 | 3300046665 | Bacteria | 2559 |
| 494 | Ga0495588_0000444 | 3300046674 | Bacteria | 20968 |
| 495 | Ga0495646_0000541 | 3300046680 | Bacteria | 20361 |
| 496 | Ga0495646_0001894 | 3300046680 | Bacteria | 12577 |
| 497 | Ga0495646_0037165 | 3300046680 | Bacteria | 3014 |
| 498 | Ga0495647_0004494 | 3300046681 | Bacteria | 4535 |
| 499 | Ga0495658_0055941 | 3300046683 | Bacteria | 2248 |
| 500 | Ga0495669_0000798 | 3300046684 | Bacteria | 13461 |
| 501 | Ga0495613_0044673 | 3300046689 | Bacteria | 3276 |
| 502 | Ga0495613_0068317 | 3300046689 | Bacteria | 2592 |
| 503 | Ga0495624_0001025 | 3300046690 | Bacteria | 22116 |
| 504 | Ga0495624_0001534 | 3300046690 | Bacteria | 17859 |
| 505 | Ga0495670_0001337 | 3300046691 | Bacteria | 12033 |
| 506 | Ga0495670_0003007 | 3300046691 | Bacteria | 8314 |
| 507 | Ga0495670_0014073 | 3300046691 | Bacteria | 3937 |
| 508 | Ga0495671_0000949 | 3300046692 | Bacteria | 20400 |
| 509 | Ga0495671_0001474 | 3300046692 | Bacteria | 15778 |
| 510 | Ga0495671_0015710 | 3300046692 | Bacteria | 4050 |
| 511 | Ga0495671_0046217 | 3300046692 | Bacteria | 2177 |
| 512 | Ga0495671_0099905 | 3300046692 | Bacteria | 1419 |
| 513 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 514 | Ga0495649_0000811 | 3300046694 | Bacteria | 25193 |
| 515 | Ga0495649_0053268 | 3300046694 | Bacteria | 2190 |
| 516 | Ga0495589_0000790 | 3300046794 | Bacteria | 20076 |
| 517 | Ga0495589_0008080 | 3300046794 | Bacteria | 5499 |
| 518 | Ga0495589_0009149 | 3300046794 | Bacteria | 5151 |
| 519 | Ga0495589_0013424 | 3300046794 | Bacteria | 4227 |
| 520 | Ga0495600_0019540 | 3300046809 | Bacteria | 4327 |
| 521 | Ga0495600_0019853 | 3300046809 | Bacteria | 4296 |
| 522 | Ga0495600_0051453 | 3300046809 | Bacteria | 2689 |
| 523 | Ga0495660_0000868 | 3300046810 | Bacteria | 22348 |
| 524 | Ga0495660_0020126 | 3300046810 | Bacteria | 3825 |
| 525 | Ga0495660_0047120 | 3300046810 | Bacteria | 2362 |
| 526 | Ga0495660_0088647 | 3300046810 | Bacteria | 1611 |
| 527 | Ga0495604_0008855 | 3300047317 | Bacteria | 7954 |
| 528 | Ga0495604_0032162 | 3300047317 | Bacteria | 4160 |
| 529 | Ga0495636_0000215 | 3300047318 | Bacteria | 22666 |
| 530 | Ga0495636_0000825 | 3300047318 | Bacteria | 11427 |
| 531 | Ga0495674_0000146 | 3300047319 | Bacteria | 54437 |
| 532 | Ga0495674_0003028 | 3300047319 | Bacteria | 16365 |
| 533 | Ga0495674_0053182 | 3300047319 | Bacteria | 3561 |
| 534 | Ga0495674_0130549 | 3300047319 | Bacteria | 2117 |
| 535 | Ga0495672_0000987 | 3300047320 | Bacteria | 29395 |
| 536 | Ga0495672_0001850 | 3300047320 | Bacteria | 20186 |
| 537 | Ga0495672_0008680 | 3300047320 | Bacteria | 7460 |
| 538 | Ga0495672_0015774 | 3300047320 | Bacteria | 5117 |
| 539 | Ga0495672_0074498 | 3300047320 | Bacteria | 1911 |
| 540 | Ga0495672_0081539 | 3300047320 | Bacteria | 1801 |
| 541 | Ga0495676_0039479 | 3300047321 | Bacteria | 3909 |
| 542 | Ga0495676_0102670 | 3300047321 | Bacteria | 2112 |
| 543 | Ga0495680_0094551 | 3300047322 | Bacteria | 2236 |
| 544 | Ga0495683_0000003 | 3300047323 | Bacteria | 383992 |
| 545 | Ga0495683_0001830 | 3300047323 | Bacteria | 13370 |
| 546 | Ga0495683_0002983 | 3300047323 | Bacteria | 9991 |
| 547 | Ga0495683_0006620 | 3300047323 | Bacteria | 6317 |
| 548 | Ga0495683_0011307 | 3300047323 | Bacteria | 4699 |
| 549 | Ga0495683_0014523 | 3300047323 | Bacteria | 4103 |
| 550 | Ga0495687_000343 | 3300047443 | Bacteria | 59599 |
| 551 | Ga0495687_000760 | 3300047443 | Bacteria | 34853 |
| 552 | Ga0495687_001473 | 3300047443 | Bacteria | 21559 |
| 553 | Ga0495687_001864 | 3300047443 | Bacteria | 18327 |
| 554 | Ga0495687_003928 | 3300047443 | Bacteria | 10415 |
| 555 | Ga0495677_0000158 | 3300047445 | Bacteria | 32488 |
| 556 | Ga0495677_0001108 | 3300047445 | Bacteria | 10764 |
| 557 | Ga0495679_000066 | 3300047446 | Bacteria | 100641 |
| 558 | Ga0495679_034263 | 3300047446 | Bacteria | 1617 |
| 559 | Ga0495685_000182 | 3300047447 | Bacteria | 20849 |
| 560 | Ga0495685_016487 | 3300047447 | Bacteria | 2523 |
| 561 | Ga0495673_0001831 | 3300047469 | Bacteria | 16045 |
| 562 | Ga0495673_0017369 | 3300047469 | Bacteria | 3657 |
| 563 | Ga0495673_0033721 | 3300047469 | Bacteria | 2373 |
| 564 | Ga0495673_0039148 | 3300047469 | Bacteria | 2152 |
| 565 | Ga0495681_0006226 | 3300047470 | Bacteria | 7867 |
| 566 | Ga0495681_0006555 | 3300047470 | Bacteria | 7627 |
| 567 | Ga0495681_0007514 | 3300047470 | Bacteria | 6945 |
| 568 | Ga0495684_0055026 | 3300047471 | Bacteria | 3034 |
| 569 | Ga0495593_0000065 | 3300047673 | Bacteria | 44613 |
| 570 | Ga0495593_0000536 | 3300047673 | Bacteria | 21520 |
| 571 | Ga0495593_0002680 | 3300047673 | Bacteria | 10711 |
| 572 | Ga0495593_0014008 | 3300047673 | Bacteria | 4566 |
| 573 | Ga0495602_0001309 | 3300048088 | Bacteria | 24538 |
| 574 | Ga0495602_0035033 | 3300048088 | Bacteria | 4686 |
| 575 | Ga0495602_0078149 | 3300048088 | Bacteria | 2796 |
| 576 | Ga0495614_0028152 | 3300048089 | Bacteria | 2422 |
| 577 | Ga0495614_0060217 | 3300048089 | Bacteria | 1631 |
| 578 | Ga0495615_0015452 | 3300048090 | Bacteria | 1631 |
| 579 | Ga0495626_0003714 | 3300048091 | Bacteria | 9645 |
| 580 | Ga0495626_0006569 | 3300048091 | Bacteria | 6598 |
| 581 | Ga0496100_0014726 | 3300048903 | Bacteria | 4548 |
| 582 | Ga0496100_0039069 | 3300048903 | Bacteria | 3012 |
| 583 | Ga0496101_0010506 | 3300048904 | Bacteria | 6114 |
| 584 | Ga0496101_0030360 | 3300048904 | Bacteria | 3789 |
| 585 | Ga0496101_0198540 | 3300048904 | Bacteria | 1550 |
| 586 | Ga0496102_0000444 | 3300048905 | Bacteria | 47025 |
| 587 | Ga0496102_0002302 | 3300048905 | Bacteria | 16319 |
| 588 | Ga0496102_0058052 | 3300048905 | Bacteria | 3535 |
| 589 | Ga0496102_0081766 | 3300048905 | Bacteria | 2979 |
| 590 | Ga0496102_0149480 | 3300048905 | Bacteria | 2194 |
| 591 | Ga0496103_0000290 | 3300048906 | Bacteria | 47006 |
| 592 | Ga0496104_0003437 | 3300048907 | Bacteria | 13658 |
| 593 | Ga0496104_0326307 | 3300048907 | Bacteria | 1448 |
| 594 | Ga0496106_0000140 | 3300048909 | Bacteria | 53893 |
| 595 | Ga0496106_0169118 | 3300048909 | Bacteria | 1732 |
| 596 | Ga0496107_0138468 | 3300048910 | Bacteria | 1799 |
| 597 | Ga0496108_0028033 | 3300048911 | Bacteria | 4658 |
| 598 | Ga0496108_0064726 | 3300048911 | Bacteria | 3081 |
| 599 | Ga0496109_0049325 | 3300048912 | Bacteria | 3832 |
| 600 | Ga0496110_0078281 | 3300048913 | Bacteria | 2943 |
| 601 | Ga0496111_0033305 | 3300048914 | Bacteria | 3674 |
| 602 | Ga0496113_0062201 | 3300048916 | Bacteria | 2819 |
| 603 | Ga0496114_0016737 | 3300048917 | Bacteria | 5914 |
| 604 | Ga0496116_0000231 | 3300048919 | Bacteria | 103493 |
| 605 | Ga0496116_0012327 | 3300048919 | Bacteria | 6990 |
| 606 | Ga0496116_0044676 | 3300048919 | Bacteria | 3007 |
| 607 | Ga0496117_0002099 | 3300048920 | Bacteria | 26226 |
| 608 | Ga0496117_0005335 | 3300048920 | Bacteria | 13552 |
| 609 | Ga0496117_0053201 | 3300048920 | Bacteria | 2847 |
| 610 | Ga0496117_0055939 | 3300048920 | Bacteria | 2753 |
| 611 | Ga0496118_0000106 | 3300048921 | Bacteria | 155884 |
| 612 | Ga0496118_0004391 | 3300048921 | Bacteria | 16756 |
| 613 | Ga0496118_0007473 | 3300048921 | Bacteria | 11565 |
| 614 | Ga0496118_0011493 | 3300048921 | Bacteria | 8631 |
| 615 | Ga0496118_0047266 | 3300048921 | Bacteria | 3337 |
| 616 | Ga0496121_0000540 | 3300048924 | Bacteria | 72033 |
| 617 | Ga0496121_0001323 | 3300048924 | Bacteria | 42412 |
| 618 | Ga0496121_0002437 | 3300048924 | Bacteria | 28448 |
| 619 | Ga0496121_0008909 | 3300048924 | Bacteria | 11651 |
| 620 | Ga0496121_0020875 | 3300048924 | Bacteria | 6451 |
| 621 | Ga0496121_0027429 | 3300048924 | Bacteria | 5330 |
| 622 | Ga0496121_0031859 | 3300048924 | Bacteria | 4808 |
| 623 | Ga0496121_0065624 | 3300048924 | Bacteria | 2952 |
| 624 | Ga0496121_0066924 | 3300048924 | Bacteria | 2914 |
| 625 | Ga0496122_0000175 | 3300048925 | Bacteria | 153295 |
| 626 | Ga0496122_0000834 | 3300048925 | Bacteria | 58431 |
| 627 | Ga0496122_0001089 | 3300048925 | Bacteria | 47126 |
| 628 | Ga0496122_0002004 | 3300048925 | Bacteria | 30310 |
| 629 | Ga0496122_0090727 | 3300048925 | Bacteria | 2084 |
| 630 | Ga0496123_0000079 | 3300048926 | Bacteria | 191201 |
| 631 | Ga0496123_0001361 | 3300048926 | Bacteria | 34420 |
| 632 | Ga0496123_0003257 | 3300048926 | Bacteria | 18434 |
| 633 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 634 | Ga0496124_0013054 | 3300048927 | Bacteria | 8136 |
| 635 | Ga0496124_0167304 | 3300048927 | Bacteria | 1707 |
| 636 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 637 | Ga0496125_0001350 | 3300048928 | Bacteria | 36190 |
| 638 | Ga0496125_0020538 | 3300048928 | Bacteria | 6197 |
| 639 | Ga0496126_0000098 | 3300048929 | Bacteria | 205129 |
| 640 | Ga0496126_0000122 | 3300048929 | Bacteria | 182785 |
| 641 | Ga0496126_0004422 | 3300048929 | Bacteria | 16821 |
| 642 | Ga0496126_0015419 | 3300048929 | Bacteria | 7689 |
| 643 | Ga0496126_0051271 | 3300048929 | Bacteria | 3757 |
| 644 | Ga0495678_000007 | 3300049459 | Bacteria | 448039 |
| 645 | Ga0495678_000646 | 3300049459 | Bacteria | 32026 |
| 646 | Ga0495678_002416 | 3300049459 | Bacteria | 12718 |
| 647 | Ga0495682_0000496 | 3300049460 | Bacteria | 27218 |
| 648 | Ga0495682_0000755 | 3300049460 | Bacteria | 20873 |
| 649 | Ga0495682_0003020 | 3300049460 | Bacteria | 7649 |
| 650 | Ga0501034_0000530 | 3300049571 | Bacteria | 60898 |
| 651 | Ga0501036_0092645 | 3300049572 | Bacteria | 2553 |
| 652 | Ga0501037_0007335 | 3300049573 | Bacteria | 8064 |
| 653 | Ga0501040_0020294 | 3300049576 | Bacteria | 4428 |
| 654 | Ga0501041_0000529 | 3300049577 | Bacteria | 19751 |
| 655 | Ga0501046_0080824 | 3300049580 | Bacteria | 2511 |
| 656 | Ga0501048_0132935 | 3300049582 | Bacteria | 1758 |
| 657 | Ga0501070_0290581 | 3300049586 | Bacteria | 1332 |
| 658 | Ga0501071_0009628 | 3300049587 | Bacteria | 6448 |
| 659 | Ga0501075_0001724 | 3300049591 | Bacteria | 14360 |
| 660 | Ga0501076_0003131 | 3300049592 | Bacteria | 11528 |
| 661 | Ga0501079_0011452 | 3300049741 | Bacteria | 6770 |
| 662 | Ga0501080_0107623 | 3300049742 | Bacteria | 2584 |
| 663 | Ga0501081_0000560 | 3300049743 | Bacteria | 21149 |
| 664 | Ga0501035_0013106 | 3300049822 | Bacteria | 7651 |
| 665 | Ga0501044_0006710 | 3300049823 | Bacteria | 12686 |
| 666 | nmdc:mga03683_7532_c1 | 3300050489 | Bacteria | 2586 |
| 667 | nmdc:mga00v17_11365_c1 | 3300050491 | Bacteria | 4893 |
| 668 | nmdc:mga00v17_129_c1 | 3300050491 | Bacteria | 44201 |
| 669 | nmdc:mga00v17_142241_c1 | 3300050491 | Bacteria | 1539 |
| 670 | nmdc:mga00v17_27043_c1 | 3300050491 | Bacteria | 3346 |
| 671 | nmdc:mga0k408_6302_c1 | 3300050493 | Bacteria | 6330 |
| 672 | nmdc:mga07m45_34409_c1 | 3300050496 | Bacteria | 2816 |
| 673 | nmdc:mga05p37_47390_c1 | 3300050507 | Bacteria | 5285 |
| 674 | nmdc:mga0a205_234993_c1 | 3300050515 | Bacteria | 1715 |
| 675 | nmdc:mga0sz30_27782_c1 | 3300050516 | Bacteria | 2325 |
| 676 | Ga0495601_0112602 | 3300053077 | Bacteria | 1763 |
| 677 | Ga0500644_0003641 | 3300053088 | Bacteria | 3823 |
| 678 | Ga0500646_0005097 | 3300053090 | Bacteria | 3328 |
| 679 | Ga0500562_007741 | 3300053108 | Bacteria | 2710 |
| 680 | Ga0500618_000762 | 3300053125 | Bacteria | 18214 |
| 681 | Ga0500618_001214 | 3300053125 | Bacteria | 12186 |
| 682 | Ga0500616_0012519 | 3300053153 | Bacteria | 4962 |
| 683 | Ga0501082_0005297 | 3300060353 | Bacteria | 11213 |
| 684 | Ga0466962_0001124 | 3300061719 | Bacteria | 12347 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_150436_151545 | 369 |
| 2 | 3300025933 | Ga0207706_10100452 | Ga0207706_101004522 | 372 |
| 3 | 3300044693 | Ga0466961_0105456 | Ga0466961_0105456_21_1139 | 372 |
| 4 | 3300046463 | Ga0495653_0237613 | Ga0495653_0237613_35_1153 | 372 |
| 5 | 3300046472 | Ga0495580_0184304 | Ga0495580_0184304_270_1388 | 372 |
| 6 | 3300046522 | Ga0495643_0069472 | Ga0495643_0069472_16_1134 | 372 |
| 7 | 3300046528 | Ga0495642_0022089 | Ga0495642_0022089_25_1143 | 372 |
| 8 | 3300046664 | Ga0495659_0005499 | Ga0495659_0005499_52_1170 | 372 |
| 9 | 3300046794 | Ga0495589_0013424 | Ga0495589_0013424_3095_4213 | 372 |
| 10 | 3300047321 | Ga0495676_0039479 | Ga0495676_0039479_18_1136 | 372 |
| 11 | 3300048904 | Ga0496101_0198540 | Ga0496101_0198540_23_1141 | 372 |
| 12 | 3300048907 | Ga0496104_0326307 | Ga0496104_0326307_320_1438 | 372 |
| 13 | 3300036401 | Ga0373937_0155057 | Ga0373937_0155057_99_1247 | 382 |
| 14 | 3300005530 | Ga0070679_100028419 | Ga0070679_1000284194 | 384 |
| 15 | 3300037471 | Ga0395905_0039553 | Ga0395905_0039553_3259_4413 | 384 |
| 16 | 3300044765 | Ga0466970_0043193 | Ga0466970_0043193_826_1980 | 384 |
| 17 | 3300046457 | Ga0495590_0016766 | Ga0495590_0016766_311_1465 | 384 |
| 18 | 3300046524 | Ga0495648_0010340 | Ga0495648_0010340_5713_6867 | 384 |
| 19 | 3300046542 | Ga0495597_0004447 | Ga0495597_0004447_1691_2845 | 384 |
| 20 | 3300046665 | Ga0495661_0049158 | Ga0495661_0049158_1057_2250 | 384 |
| 21 | 3300046694 | Ga0495649_0053268 | Ga0495649_0053268_930_2123 | 384 |
| 22 | 3300047673 | Ga0495593_0014008 | Ga0495593_0014008_2040_3194 | 384 |
| 23 | 3300048903 | Ga0496100_0014726 | Ga0496100_0014726_211_1365 | 384 |
| 24 | 3300048905 | Ga0496102_0002302 | Ga0496102_0002302_10538_11692 | 384 |
| 25 | 3300048916 | Ga0496113_0062201 | Ga0496113_0062201_940_2094 | 384 |
| 26 | 3300048924 | Ga0496121_0065624 | Ga0496121_0065624_1663_2817 | 384 |
| 27 | 3300003792 | Ga0055540_1017091 | Ga0055540_10170912 | 385 |
| 28 | 3300003794 | Ga0055531_10000103 | Ga0055531_1000010350 | 385 |
| 29 | 3300025298 | Ga0209050_1001574 | Ga0209050_100157412 | 385 |
| 30 | 3300025303 | Ga0209051_1012352 | Ga0209051_10123524 | 385 |
| 31 | 3300025304 | Ga0209257_1000131 | Ga0209257_1000131179 | 385 |
| 32 | 3300028800 | Ga0265338_10000708 | Ga0265338_1000070814 | 385 |
| 33 | 3300037418 | Ga0395900_0083714 | Ga0395900_0083714_723_1913 | 385 |
| 34 | 3300042876 | Ga0451577_0021281 | Ga0451577_0021281_3849_5006 | 385 |
| 35 | iso_pu_bacteria | 2904479285 | 2904480841 | 385 |
| 36 | 3300005293 | Ga0065715_10111222 | Ga0065715_101112222 | 386 |
| 37 | 3300005331 | Ga0070670_100026828 | Ga0070670_1000268282 | 386 |
| 38 | 3300005333 | Ga0070677_10008896 | Ga0070677_100088963 | 386 |
| 39 | 3300005354 | Ga0070675_100003197 | Ga0070675_10000319711 | 386 |
| 40 | 3300005355 | Ga0070671_100001524 | Ga0070671_10000152414 | 386 |
| 41 | 3300005356 | Ga0070674_100003404 | Ga0070674_1000034045 | 386 |
| 42 | 3300005356 | Ga0070674_100084719 | Ga0070674_1000847191 | 386 |
| 43 | 3300005364 | Ga0070673_100013700 | Ga0070673_1000137003 | 386 |
| 44 | 3300005456 | Ga0070678_100020790 | Ga0070678_1000207901 | 386 |
| 45 | 3300005459 | Ga0068867_100018155 | Ga0068867_1000181552 | 386 |
| 46 | 3300005543 | Ga0070672_100000953 | Ga0070672_10000095314 | 386 |
| 47 | 3300005548 | Ga0070665_100331014 | Ga0070665_1003310141 | 386 |
| 48 | 3300005618 | Ga0068864_100048425 | Ga0068864_1000484252 | 386 |
| 49 | 3300005834 | Ga0068851_10005934 | Ga0068851_100059342 | 386 |
| 50 | 3300005840 | Ga0068870_10005349 | Ga0068870_100053492 | 386 |
| 51 | 3300006177 | Ga0075362_10040477 | Ga0075362_100404771 | 386 |
| 52 | 3300006195 | Ga0075366_10087875 | Ga0075366_100878752 | 386 |
| 53 | 3300006237 | Ga0097621_100004800 | Ga0097621_1000048007 | 386 |
| 54 | 3300013308 | Ga0157375_10005538 | Ga0157375_100055388 | 386 |
| 55 | 3300014326 | Ga0157380_10040298 | Ga0157380_100402982 | 386 |
| 56 | 3300017792 | Ga0163161_10084311 | Ga0163161_100843112 | 386 |
| 57 | 3300025893 | Ga0207682_10004153 | Ga0207682_100041533 | 386 |
| 58 | 3300025901 | Ga0207688_10023056 | Ga0207688_100230562 | 386 |
| 59 | 3300025923 | Ga0207681_10020045 | Ga0207681_100200456 | 386 |
| 60 | 3300025925 | Ga0207650_10006798 | Ga0207650_100067984 | 386 |
| 61 | 3300025926 | Ga0207659_10014205 | Ga0207659_100142054 | 386 |
| 62 | 3300025936 | Ga0207670_10206634 | Ga0207670_102066341 | 386 |
| 63 | 3300025940 | Ga0207691_10002659 | Ga0207691_100026596 | 386 |
| 64 | 3300025960 | Ga0207651_10011371 | Ga0207651_100113712 | 386 |
| 65 | 3300026089 | Ga0207648_10004573 | Ga0207648_100045732 | 386 |
| 66 | 3300026118 | Ga0207675_100217128 | Ga0207675_1002171282 | 386 |
| 67 | 3300026121 | Ga0207683_10003557 | Ga0207683_100035576 | 386 |
| 68 | 3300026142 | Ga0207698_10306960 | Ga0207698_103069601 | 386 |
| 69 | 3300028379 | Ga0268266_10304791 | Ga0268266_103047912 | 386 |
| 70 | 3300044656 | Ga0466969_0010542 | Ga0466969_0010542_2113_3273 | 386 |
| 71 | 3300044683 | Ga0466965_0002678 | Ga0466965_0002678_5902_7062 | 386 |
| 72 | 3300044684 | Ga0466966_0029902 | Ga0466966_0029902_1565_2725 | 386 |
| 73 | 3300044719 | Ga0466971_0007873 | Ga0466971_0007873_1683_2843 | 386 |
| 74 | 3300044842 | Ga0466957_0012407 | Ga0466957_0012407_2957_4117 | 386 |
| 75 | 3300045049 | Ga0466959_0008133 | Ga0466959_0008133_976_2136 | 386 |
| 76 | 3300048925 | Ga0496122_0090727 | Ga0496122_0090727_902_2062 | 386 |
| 77 | 3300050489 | nmdc:mga03683_7532_c1 | nmdc:mga03683_7532_c1_227_1387 | 386 |
| 78 | 3300050493 | nmdc:mga0k408_6302_c1 | nmdc:mga0k408_6302_c1_3806_4966 | 386 |
| 79 | 3300050496 | nmdc:mga07m45_34409_c1 | nmdc:mga07m45_34409_c1_183_1343 | 386 |
| 80 | 3300005333 | Ga0070677_10006985 | Ga0070677_100069853 | 387 |
| 81 | 3300005356 | Ga0070674_100250000 | Ga0070674_1002500001 | 387 |
| 82 | 3300025949 | Ga0207667_10033641 | Ga0207667_100336412 | 387 |
| 83 | 3300046539 | Ga0495621_0001548 | Ga0495621_0001548_2441_3604 | 387 |
| 84 | 3300050507 | nmdc:mga05p37_47390_c1 | nmdc:mga05p37_47390_c1_2280_3443 | 387 |
| 85 | 3300053088 | Ga0500644_0003641 | Ga0500644_0003641_1638_2801 | 387 |
| 86 | 3300025928 | Ga0207700_10155982 | Ga0207700_101559821 | 388 |
| 87 | iso_pu_bacteria | 2808606395 | 2809034232 | 388 |
| 88 | 3300005518 | Ga0070699_100118904 | Ga0070699_1001189042 | 389 |
| 89 | 3300005563 | Ga0068855_100046124 | Ga0068855_1000461246 | 389 |
| 90 | 3300010375 | Ga0105239_10350890 | Ga0105239_103508902 | 389 |
| 91 | 3300025937 | Ga0207669_10226601 | Ga0207669_102266012 | 389 |
| 92 | 3300025940 | Ga0207691_10065039 | Ga0207691_100650393 | 389 |
| 93 | 3300025949 | Ga0207667_10034860 | Ga0207667_100348606 | 389 |
| 94 | 3300031235 | Ga0265330_10077406 | Ga0265330_100774061 | 389 |
| 95 | 3300050515 | nmdc:mga0a205_234993_c1 | nmdc:mga0a205_234993_c1_49_1218 | 389 |
| 96 | 3300042876 | Ga0451577_0206717 | Ga0451577_0206717_554_1735 | 390 |
| 97 | 3300005563 | Ga0068855_100034447 | Ga0068855_1000344473 | 391 |
| 98 | 3300013307 | Ga0157372_10003463 | Ga0157372_1000346319 | 391 |
| 99 | 3300025924 | Ga0207694_10053281 | Ga0207694_100532814 | 391 |
| 100 | 3300025949 | Ga0207667_10141406 | Ga0207667_101414063 | 391 |
| 101 | 3300026041 | Ga0207639_10024300 | Ga0207639_100243005 | 391 |
| 102 | 3300037466 | Ga0395898_0000346 | Ga0395898_0000346_9142_10332 | 391 |
| 103 | 3300005344 | Ga0070661_100098567 | Ga0070661_1000985672 | 392 |
| 104 | 3300013105 | Ga0157369_10000268 | Ga0157369_1000026811 | 392 |
| 105 | 3300046542 | Ga0495597_0000095 | Ga0495597_0000095_44311_45489 | 392 |
| 106 | iso_pu_bacteria | 2501025501 | 2501076113 | 392 |
| 107 | iso_pu_bacteria | 2501025502 | 2501085823 | 392 |
| 108 | iso_pu_bacteria | 2501025504 | 2501411944 | 392 |
| 109 | iso_pu_bacteria | 2510917013 | 2511088444 | 392 |
| 110 | iso_pu_bacteria | 2510917014 | 2511100942 | 392 |
| 111 | iso_pu_bacteria | 2510917015 | 2511107293 | 392 |
| 112 | iso_pu_bacteria | 2511231015 | 2511318937 | 392 |
| 113 | iso_pu_bacteria | 2511231017 | 2511333798 | 392 |
| 114 | iso_pu_bacteria | 2515154189 | 2516020557 | 392 |
| 115 | iso_pu_bacteria | 2562617112 | 2563060101 | 392 |
| 116 | iso_pu_bacteria | 2562617112 | 2563064083 | 392 |
| 117 | iso_pu_bacteria | 2599185239 | 2599741550 | 392 |
| 118 | iso_pu_bacteria | 2599185240 | 2599746721 | 392 |
| 119 | iso_pu_bacteria | 2599185307 | 2599970976 | 392 |
| 120 | iso_pu_bacteria | 2599185355 | 2600208627 | 392 |
| 121 | iso_pu_bacteria | 2600255283 | 2601624124 | 392 |
| 122 | iso_pu_bacteria | 2600255283 | 2601628108 | 392 |
| 123 | iso_pu_bacteria | 2675903129 | 2676744283 | 392 |
| 124 | iso_pu_bacteria | 2711768613 | 2713472358 | 392 |
| 125 | iso_pu_bacteria | 2711768613 | 2713475277 | 392 |
| 126 | iso_pu_bacteria | 2721755763 | 2723876076 | 392 |
| 127 | iso_pu_bacteria | 2738543015 | 2739256991 | 392 |
| 128 | iso_pu_bacteria | 2739367655 | 2739612895 | 392 |
| 129 | iso_pu_bacteria | 2765235841 | 2765584457 | 392 |
| 130 | iso_pu_bacteria | 2791355137 | 2792839118 | 392 |
| 131 | iso_pu_bacteria | 2808606384 | 2808973810 | 392 |
| 132 | iso_pu_bacteria | 2808606390 | 2809008748 | 392 |
| 133 | iso_pu_bacteria | 2808606391 | 2809015746 | 392 |
| 134 | iso_pu_bacteria | 2818991452 | 2819630774 | 392 |
| 135 | iso_pu_bacteria | 2842324504 | 2842326690 | 392 |
| 136 | iso_pu_bacteria | 2842348783 | 2842350294 | 392 |
| 137 | iso_pu_bacteria | 2842454564 | 2842456933 | 392 |
| 138 | iso_pu_bacteria | 2856287931 | 2856294526 | 392 |
| 139 | iso_pu_bacteria | 2857357740 | 2857367899 | 392 |
| 140 | iso_pu_bacteria | 2863421361 | 2863424615 | 392 |
| 141 | iso_pu_bacteria | 2870068957 | 2870071451 | 392 |
| 142 | iso_pu_bacteria | 2883087390 | 2883089463 | 392 |
| 143 | iso_pu_bacteria | 2904564687 | 2904568597 | 392 |
| 144 | iso_pu_bacteria | 2904571731 | 2904575639 | 392 |
| 145 | iso_pu_bacteria | 2928157003 | 2928160388 | 392 |
| 146 | iso_pu_bacteria | 2928163908 | 2928170634 | 392 |
| 147 | iso_pu_bacteria | 2928170801 | 2928172569 | 392 |
| 148 | iso_pu_bacteria | 2928536128 | 2928540660 | 392 |
| 149 | iso_pu_bacteria | 2931396565 | 2931401274 | 392 |
| 150 | iso_pu_bacteria | 2981990288 | 2981996302 | 392 |
| 151 | iso_pu_bacteria | 641736154 | 642418206 | 392 |
| 152 | iso_pu_bacteria | 8018845410 | 8018846747 | 392 |
| 153 | iso_pu_bacteria | 8020938398 | 8020941433 | 392 |
| 154 | iso_pu_bacteria | 8020945358 | 8020949373 | 392 |
| 155 | iso_pu_bacteria | 8020953355 | 8020957778 | 392 |
| 156 | iso_pu_bacteria | 8021120328 | 8021128002 | 392 |
| 157 | iso_pu_bacteria | 8039098773 | 8039104850 | 392 |
| 158 | iso_pu_bacteria | 8055225921 | 8055228824 | 392 |
| 159 | 3300005616 | Ga0068852_100280880 | Ga0068852_1002808801 | 393 |
| 160 | 3300026142 | Ga0207698_10056534 | Ga0207698_100565342 | 393 |
| 161 | 3300037312 | Ga0395899_0066258 | Ga0395899_0066258_91_1272 | 393 |
| 162 | 3300037418 | Ga0395900_0051302 | Ga0395900_0051302_2670_3851 | 393 |
| 163 | 3300037471 | Ga0395905_0014748 | Ga0395905_0014748_393_1574 | 393 |
| 164 | 3300038443 | Ga0395901_0033333 | Ga0395901_0033333_641_1822 | 393 |
| 165 | 3300044684 | Ga0466966_0089514 | Ga0466966_0089514_234_1421 | 393 |
| 166 | 3300044693 | Ga0466961_0036305 | Ga0466961_0036305_940_2127 | 393 |
| 167 | 3300044712 | Ga0453684_0081161 | Ga0453684_0081161_1806_2993 | 393 |
| 168 | 3300045836 | Ga0466958_0010655 | Ga0466958_0010655_931_2118 | 393 |
| 169 | iso_pu_bacteria | 2887375801 | 2887380982 | 393 |
| 170 | iso_pu_bacteria | 2513237150 | 2513954964 | 394 |
| 171 | iso_pu_bacteria | 2513237165 | 2514041457 | 394 |
| 172 | iso_pu_bacteria | 2834641062 | 2834643744 | 394 |
| 173 | iso_pu_bacteria | 2857542790 | 2857543064 | 394 |
| 174 | iso_pu_bacteria | 2881927736 | 2881929145 | 394 |
| 175 | iso_pu_bacteria | 644736347 | 644748237 | 394 |
| 176 | iso_pu_bacteria | 8003400568 | 8003403227 | 394 |
| 177 | iso_pu_bacteria | 8048746797 | 8048748779 | 394 |
| 178 | 3300009092 | Ga0105250_10000676 | Ga0105250_100006766 | 395 |
| 179 | 3300025711 | Ga0207696_1000315 | Ga0207696_100031522 | 395 |
| 180 | 3300002067 | JGI24735J21928_10002372 | JGI24735J21928_100023724 | 396 |
| 181 | 3300003758 | Ga0055532_1000190 | Ga0055532_100019055 | 396 |
| 182 | 3300003758 | Ga0055532_1000529 | Ga0055532_100052916 | 396 |
| 183 | 3300003760 | Ga0055527_1000291 | Ga0055527_10002916 | 396 |
| 184 | 3300003761 | Ga0055535_1000506 | Ga0055535_100050617 | 396 |
| 185 | 3300003762 | Ga0055542_1000502 | Ga0055542_100050225 | 396 |
| 186 | 3300003763 | Ga0055529_1000495 | Ga0055529_100049517 | 396 |
| 187 | 3300003790 | Ga0055528_1001289 | Ga0055528_10012893 | 396 |
| 188 | 3300005327 | Ga0070658_10057021 | Ga0070658_100570213 | 396 |
| 189 | 3300005339 | Ga0070660_100001233 | Ga0070660_1000012338 | 396 |
| 190 | 3300005366 | Ga0070659_100000055 | Ga0070659_10000005585 | 396 |
| 191 | 3300005563 | Ga0068855_100146546 | Ga0068855_1001465462 | 396 |
| 192 | 3300006051 | Ga0075364_10007506 | Ga0075364_100075065 | 396 |
| 193 | 3300006058 | Ga0075432_10007080 | Ga0075432_100070802 | 396 |
| 194 | 3300009011 | Ga0105251_10000066 | Ga0105251_1000006677 | 396 |
| 195 | 3300009011 | Ga0105251_10000193 | Ga0105251_1000019327 | 396 |
| 196 | 3300009011 | Ga0105251_10012171 | Ga0105251_100121712 | 396 |
| 197 | 3300009036 | Ga0105244_10057966 | Ga0105244_100579661 | 396 |
| 198 | 3300009092 | Ga0105250_10000033 | Ga0105250_100000337 | 396 |
| 199 | 3300009093 | Ga0105240_10000229 | Ga0105240_10000229101 | 396 |
| 200 | 3300009093 | Ga0105240_10023042 | Ga0105240_100230423 | 396 |
| 201 | 3300009148 | Ga0105243_10044088 | Ga0105243_100440882 | 396 |
| 202 | 3300009551 | Ga0105238_10134059 | Ga0105238_101340592 | 396 |
| 203 | 3300010375 | Ga0105239_10007284 | Ga0105239_1000728412 | 396 |
| 204 | 3300013306 | Ga0163162_10022743 | Ga0163162_100227435 | 396 |
| 205 | 3300013306 | Ga0163162_10036327 | Ga0163162_100363274 | 396 |
| 206 | 3300014497 | Ga0182008_10000089 | Ga0182008_1000008964 | 396 |
| 207 | 3300014497 | Ga0182008_10007326 | Ga0182008_100073267 | 396 |
| 208 | 3300015262 | Ga0182007_10000583 | Ga0182007_1000058322 | 396 |
| 209 | 3300015265 | Ga0182005_1004316 | Ga0182005_10043163 | 396 |
| 210 | 3300025225 | Ga0209566_100258 | Ga0209566_10025813 | 396 |
| 211 | 3300025228 | Ga0209672_100080 | Ga0209672_10008017 | 396 |
| 212 | 3300025229 | Ga0209147_100071 | Ga0209147_100071193 | 396 |
| 213 | 3300025229 | Ga0209147_100091 | Ga0209147_10009155 | 396 |
| 214 | 3300025242 | Ga0209258_100082 | Ga0209258_10008217 | 396 |
| 215 | 3300025254 | Ga0209148_1000195 | Ga0209148_100019577 | 396 |
| 216 | 3300025256 | Ga0209759_1004919 | Ga0209759_10049194 | 396 |
| 217 | 3300025263 | Ga0209565_1006597 | Ga0209565_10065973 | 396 |
| 218 | 3300025272 | Ga0209455_1000172 | Ga0209455_100017277 | 396 |
| 219 | 3300025273 | Ga0209673_1000076 | Ga0209673_1000076106 | 396 |
| 220 | 3300025711 | Ga0207696_1000006 | Ga0207696_1000006191 | 396 |
| 221 | 3300025711 | Ga0207696_1000011 | Ga0207696_1000011321 | 396 |
| 222 | 3300025728 | Ga0207655_1006992 | Ga0207655_10069922 | 396 |
| 223 | 3300025728 | Ga0207655_1018924 | Ga0207655_10189242 | 396 |
| 224 | 3300025728 | Ga0207655_1051550 | Ga0207655_10515501 | 396 |
| 225 | 3300025735 | Ga0207713_1000193 | Ga0207713_100019328 | 396 |
| 226 | 3300025735 | Ga0207713_1000220 | Ga0207713_10002204 | 396 |
| 227 | 3300025735 | Ga0207713_1000724 | Ga0207713_100072415 | 396 |
| 228 | 3300025735 | Ga0207713_1021020 | Ga0207713_10210202 | 396 |
| 229 | 3300025904 | Ga0207647_10001075 | Ga0207647_1000107513 | 396 |
| 230 | 3300025913 | Ga0207695_10000268 | Ga0207695_10000268114 | 396 |
| 231 | 3300025913 | Ga0207695_10020055 | Ga0207695_100200555 | 396 |
| 232 | 3300025914 | Ga0207671_10028223 | Ga0207671_100282231 | 396 |
| 233 | 3300025919 | Ga0207657_10000087 | Ga0207657_1000008782 | 396 |
| 234 | 3300025932 | Ga0207690_10000071 | Ga0207690_1000007183 | 396 |
| 235 | 3300025949 | Ga0207667_10013868 | Ga0207667_100138685 | 396 |
| 236 | 3300026142 | Ga0207698_10009359 | Ga0207698_100093594 | 396 |
| 237 | 3300027312 | Ga0209371_1000713 | Ga0209371_100071317 | 396 |
| 238 | 3300027907 | Ga0207428_10001135 | Ga0207428_100011358 | 396 |
| 239 | 3300027907 | Ga0207428_10086747 | Ga0207428_100867472 | 396 |
| 240 | 3300028800 | Ga0265338_10000191 | Ga0265338_1000019155 | 396 |
| 241 | 3300030500 | Ga0268256_1000608 | Ga0268256_100060816 | 396 |
| 242 | 3300031548 | Ga0307408_100067387 | Ga0307408_1000673872 | 396 |
| 243 | 3300037312 | Ga0395899_0016095 | Ga0395899_0016095_2900_4090 | 396 |
| 244 | 3300037312 | Ga0395899_0020452 | Ga0395899_0020452_2194_3480 | 396 |
| 245 | 3300037312 | Ga0395899_0027741 | Ga0395899_0027741_380_1603 | 396 |
| 246 | 3300037418 | Ga0395900_0000015 | Ga0395900_0000015_327363_328553 | 396 |
| 247 | 3300037418 | Ga0395900_0028321 | Ga0395900_0028321_3181_4383 | 396 |
| 248 | 3300037418 | Ga0395900_0071864 | Ga0395900_0071864_91_1281 | 396 |
| 249 | 3300037418 | Ga0395900_0112904 | Ga0395900_0112904_335_1558 | 396 |
| 250 | 3300037466 | Ga0395898_0011051 | Ga0395898_0011051_3188_4390 | 396 |
| 251 | 3300037466 | Ga0395898_0037403 | Ga0395898_0037403_1449_2639 | 396 |
| 252 | 3300038443 | Ga0395901_0000121 | Ga0395901_0000121_62666_63868 | 396 |
| 253 | 3300038443 | Ga0395901_0000769 | Ga0395901_0000769_16429_17619 | 396 |
| 254 | 3300041405 | Ga0439438_011366 | Ga0439438_011366_1528_2718 | 396 |
| 255 | 3300041407 | Ga0439447_009243 | Ga0439447_009243_1485_2810 | 396 |
| 256 | 3300042010 | Ga0439452_004263 | Ga0439452_004263_2559_3884 | 396 |
| 257 | 3300042016 | Ga0439463_000427 | Ga0439463_000427_3265_4455 | 396 |
| 258 | 3300044656 | Ga0466969_0006727 | Ga0466969_0006727_724_1914 | 396 |
| 259 | 3300044658 | Ga0466972_0014184 | Ga0466972_0014184_98_1288 | 396 |
| 260 | 3300044684 | Ga0466966_0000834 | Ga0466966_0000834_16472_17662 | 396 |
| 261 | 3300044694 | Ga0466963_0004481 | Ga0466963_0004481_3674_4864 | 396 |
| 262 | 3300044719 | Ga0466971_0002200 | Ga0466971_0002200_5288_6478 | 396 |
| 263 | 3300044842 | Ga0466957_0037623 | Ga0466957_0037623_782_1972 | 396 |
| 264 | 3300045049 | Ga0466959_0089778 | Ga0466959_0089778_426_1616 | 396 |
| 265 | 3300046453 | Ga0495627_000062 | Ga0495627_000062_52668_53858 | 396 |
| 266 | 3300046453 | Ga0495627_001467 | Ga0495627_001467_3823_5013 | 396 |
| 267 | 3300046453 | Ga0495627_006765 | Ga0495627_006765_2947_4137 | 396 |
| 268 | 3300046457 | Ga0495590_0006547 | Ga0495590_0006547_1776_3101 | 396 |
| 269 | 3300046458 | Ga0495591_006793 | Ga0495591_006793_3543_4733 | 396 |
| 270 | 3300046459 | Ga0495629_0001254 | Ga0495629_0001254_14220_15410 | 396 |
| 271 | 3300046460 | Ga0495638_0072088 | Ga0495638_0072088_456_1646 | 396 |
| 272 | 3300046463 | Ga0495653_0000101 | Ga0495653_0000101_40630_41889 | 396 |
| 273 | 3300046463 | Ga0495653_0001150 | Ga0495653_0001150_14801_16126 | 396 |
| 274 | 3300046463 | Ga0495653_0007814 | Ga0495653_0007814_4494_5684 | 396 |
| 275 | 3300046471 | Ga0495650_0001466 | Ga0495650_0001466_4308_5498 | 396 |
| 276 | 3300046471 | Ga0495650_0014091 | Ga0495650_0014091_135_1325 | 396 |
| 277 | 3300046472 | Ga0495580_0004305 | Ga0495580_0004305_3658_4896 | 396 |
| 278 | 3300046472 | Ga0495580_0014143 | Ga0495580_0014143_830_2020 | 396 |
| 279 | 3300046474 | Ga0495605_0000007 | Ga0495605_0000007_78770_79960 | 396 |
| 280 | 3300046474 | Ga0495605_0000470 | Ga0495605_0000470_12594_13784 | 396 |
| 281 | 3300046474 | Ga0495605_0002522 | Ga0495605_0002522_8353_9678 | 396 |
| 282 | 3300046474 | Ga0495605_0003778 | Ga0495605_0003778_970_2295 | 396 |
| 283 | 3300046474 | Ga0495605_0004037 | Ga0495605_0004037_7055_8245 | 396 |
| 284 | 3300046474 | Ga0495605_0041490 | Ga0495605_0041490_450_1688 | 396 |
| 285 | 3300046477 | Ga0495664_0008403 | Ga0495664_0008403_3318_4577 | 396 |
| 286 | 3300046491 | Ga0495584_0000686 | Ga0495584_0000686_6596_7786 | 396 |
| 287 | 3300046491 | Ga0495584_0001410 | Ga0495584_0001410_10118_11443 | 396 |
| 288 | 3300046491 | Ga0495584_0020394 | Ga0495584_0020394_1710_2900 | 396 |
| 289 | 3300046492 | Ga0495585_0000282 | Ga0495585_0000282_37786_38976 | 396 |
| 290 | 3300046492 | Ga0495585_0004671 | Ga0495585_0004671_3103_4293 | 396 |
| 291 | 3300046499 | Ga0495594_0001267 | Ga0495594_0001267_11171_12361 | 396 |
| 292 | 3300046499 | Ga0495594_0007442 | Ga0495594_0007442_4003_5193 | 396 |
| 293 | 3300046499 | Ga0495594_0127623 | Ga0495594_0127623_194_1384 | 396 |
| 294 | 3300046500 | Ga0495596_0000835 | Ga0495596_0000835_12931_14121 | 396 |
| 295 | 3300046501 | Ga0495607_0000047 | Ga0495607_0000047_106396_107586 | 396 |
| 296 | 3300046501 | Ga0495607_0000702 | Ga0495607_0000702_16227_17417 | 396 |
| 297 | 3300046501 | Ga0495607_0005502 | Ga0495607_0005502_2035_3360 | 396 |
| 298 | 3300046501 | Ga0495607_0007690 | Ga0495607_0007690_2646_3836 | 396 |
| 299 | 3300046501 | Ga0495607_0008631 | Ga0495607_0008631_4793_5983 | 396 |
| 300 | 3300046501 | Ga0495607_0009093 | Ga0495607_0009093_2796_3986 | 396 |
| 301 | 3300046501 | Ga0495607_0020035 | Ga0495607_0020035_1931_3121 | 396 |
| 302 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_37472_38662 | 396 |
| 303 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_162628_163818 | 396 |
| 304 | 3300046506 | Ga0495583_0000045 | Ga0495583_0000045_148009_149199 | 396 |
| 305 | 3300046506 | Ga0495583_0000281 | Ga0495583_0000281_58000_59190 | 396 |
| 306 | 3300046506 | Ga0495583_0004924 | Ga0495583_0004924_6118_7443 | 396 |
| 307 | 3300046507 | Ga0495606_0000360 | Ga0495606_0000360_18111_19301 | 396 |
| 308 | 3300046507 | Ga0495606_0036255 | Ga0495606_0036255_1510_2700 | 396 |
| 309 | 3300046512 | Ga0495610_0006856 | Ga0495610_0006856_4050_5240 | 396 |
| 310 | 3300046512 | Ga0495610_0011451 | Ga0495610_0011451_2610_3800 | 396 |
| 311 | 3300046512 | Ga0495610_0015787 | Ga0495610_0015787_1222_2412 | 396 |
| 312 | 3300046513 | Ga0495616_0000456 | Ga0495616_0000456_12090_13415 | 396 |
| 313 | 3300046513 | Ga0495616_0000941 | Ga0495616_0000941_9053_10243 | 396 |
| 314 | 3300046513 | Ga0495616_0002483 | Ga0495616_0002483_8377_9567 | 396 |
| 315 | 3300046513 | Ga0495616_0008459 | Ga0495616_0008459_4219_5409 | 396 |
| 316 | 3300046515 | Ga0495620_0000399 | Ga0495620_0000399_15285_16475 | 396 |
| 317 | 3300046515 | Ga0495620_0012381 | Ga0495620_0012381_451_1641 | 396 |
| 318 | 3300046516 | Ga0495628_0001033 | Ga0495628_0001033_13187_14446 | 396 |
| 319 | 3300046516 | Ga0495628_0001082 | Ga0495628_0001082_23035_24225 | 396 |
| 320 | 3300046517 | Ga0495630_0000888 | Ga0495630_0000888_19571_20830 | 396 |
| 321 | 3300046517 | Ga0495630_0002736 | Ga0495630_0002736_5818_7143 | 396 |
| 322 | 3300046518 | Ga0495631_0000921 | Ga0495631_0000921_12478_13668 | 396 |
| 323 | 3300046518 | Ga0495631_0003741 | Ga0495631_0003741_5409_6599 | 396 |
| 324 | 3300046519 | Ga0495632_0000037 | Ga0495632_0000037_149015_150205 | 396 |
| 325 | 3300046519 | Ga0495632_0001836 | Ga0495632_0001836_9301_10626 | 396 |
| 326 | 3300046519 | Ga0495632_0002620 | Ga0495632_0002620_3740_4930 | 396 |
| 327 | 3300046519 | Ga0495632_0010910 | Ga0495632_0010910_1339_2529 | 396 |
| 328 | 3300046519 | Ga0495632_0029184 | Ga0495632_0029184_1166_2356 | 396 |
| 329 | 3300046520 | Ga0495637_0025016 | Ga0495637_0025016_310_1500 | 396 |
| 330 | 3300046522 | Ga0495643_0003881 | Ga0495643_0003881_6109_7311 | 396 |
| 331 | 3300046522 | Ga0495643_0005109 | Ga0495643_0005109_6024_7349 | 396 |
| 332 | 3300046522 | Ga0495643_0067853 | Ga0495643_0067853_19_1209 | 396 |
| 333 | 3300046523 | Ga0495644_0000054 | Ga0495644_0000054_44113_45303 | 396 |
| 334 | 3300046524 | Ga0495648_0001650 | Ga0495648_0001650_14079_15269 | 396 |
| 335 | 3300046524 | Ga0495648_0004197 | Ga0495648_0004197_1194_2384 | 396 |
| 336 | 3300046528 | Ga0495642_0001123 | Ga0495642_0001123_9130_10455 | 396 |
| 337 | 3300046529 | Ga0495652_0001426 | Ga0495652_0001426_6587_7846 | 396 |
| 338 | 3300046530 | Ga0495654_0000112 | Ga0495654_0000112_62316_63506 | 396 |
| 339 | 3300046530 | Ga0495654_0000192 | Ga0495654_0000192_11811_13001 | 396 |
| 340 | 3300046530 | Ga0495654_0004712 | Ga0495654_0004712_3515_4705 | 396 |
| 341 | 3300046530 | Ga0495654_0011370 | Ga0495654_0011370_608_1933 | 396 |
| 342 | 3300046530 | Ga0495654_0012772 | Ga0495654_0012772_1599_2789 | 396 |
| 343 | 3300046531 | Ga0495665_0000030 | Ga0495665_0000030_18059_19318 | 396 |
| 344 | 3300046531 | Ga0495665_0009558 | Ga0495665_0009558_2583_3773 | 396 |
| 345 | 3300046535 | Ga0495586_0037752 | Ga0495586_0037752_1258_2517 | 396 |
| 346 | 3300046536 | Ga0495587_0000835 | Ga0495587_0000835_4236_5561 | 396 |
| 347 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_81247_82437 | 396 |
| 348 | 3300046538 | Ga0495609_0000157 | Ga0495609_0000157_43698_44888 | 396 |
| 349 | 3300046538 | Ga0495609_0000552 | Ga0495609_0000552_22026_23351 | 396 |
| 350 | 3300046538 | Ga0495609_0000681 | Ga0495609_0000681_20160_21350 | 396 |
| 351 | 3300046538 | Ga0495609_0000990 | Ga0495609_0000990_10683_11873 | 396 |
| 352 | 3300046538 | Ga0495609_0005556 | Ga0495609_0005556_936_2126 | 396 |
| 353 | 3300046542 | Ga0495597_0000649 | Ga0495597_0000649_12141_13331 | 396 |
| 354 | 3300046542 | Ga0495597_0003203 | Ga0495597_0003203_906_2096 | 396 |
| 355 | 3300046542 | Ga0495597_0018420 | Ga0495597_0018420_1457_2659 | 396 |
| 356 | 3300046557 | Ga0495622_0045432 | Ga0495622_0045432_398_1588 | 396 |
| 357 | 3300046558 | Ga0495633_0000020 | Ga0495633_0000020_145031_146221 | 396 |
| 358 | 3300046615 | Ga0495656_0001551 | Ga0495656_0001551_1062_2252 | 396 |
| 359 | 3300046616 | Ga0495668_0019409 | Ga0495668_0019409_2459_3661 | 396 |
| 360 | 3300046616 | Ga0495668_0024153 | Ga0495668_0024153_418_1608 | 396 |
| 361 | 3300046616 | Ga0495668_0036502 | Ga0495668_0036502_1367_2557 | 396 |
| 362 | 3300046642 | Ga0495634_0000347 | Ga0495634_0000347_11385_12710 | 396 |
| 363 | 3300046648 | Ga0495611_0002446 | Ga0495611_0002446_3703_4893 | 396 |
| 364 | 3300046648 | Ga0495611_0016690 | Ga0495611_0016690_1607_2797 | 396 |
| 365 | 3300046660 | Ga0495625_0001919 | Ga0495625_0001919_14099_15289 | 396 |
| 366 | 3300046660 | Ga0495625_0002739 | Ga0495625_0002739_16236_17426 | 396 |
| 367 | 3300046660 | Ga0495625_0044650 | Ga0495625_0044650_1956_3146 | 396 |
| 368 | 3300046663 | Ga0495635_0000402 | Ga0495635_0000402_15301_16626 | 396 |
| 369 | 3300046664 | Ga0495659_0000002 | Ga0495659_0000002_6020_7345 | 396 |
| 370 | 3300046664 | Ga0495659_0000864 | Ga0495659_0000864_7467_8657 | 396 |
| 371 | 3300046665 | Ga0495661_0000009 | Ga0495661_0000009_37748_38938 | 396 |
| 372 | 3300046665 | Ga0495661_0000057 | Ga0495661_0000057_114584_115774 | 396 |
| 373 | 3300046665 | Ga0495661_0000154 | Ga0495661_0000154_75275_76546 | 396 |
| 374 | 3300046665 | Ga0495661_0001421 | Ga0495661_0001421_8204_9394 | 396 |
| 375 | 3300046665 | Ga0495661_0005142 | Ga0495661_0005142_6472_7674 | 396 |
| 376 | 3300046665 | Ga0495661_0016364 | Ga0495661_0016364_1842_3032 | 396 |
| 377 | 3300046674 | Ga0495588_0000444 | Ga0495588_0000444_16129_17319 | 396 |
| 378 | 3300046680 | Ga0495646_0000541 | Ga0495646_0000541_4236_5561 | 396 |
| 379 | 3300046680 | Ga0495646_0001894 | Ga0495646_0001894_4723_5982 | 396 |
| 380 | 3300046680 | Ga0495646_0037165 | Ga0495646_0037165_1051_2241 | 396 |
| 381 | 3300046684 | Ga0495669_0000798 | Ga0495669_0000798_539_1729 | 396 |
| 382 | 3300046689 | Ga0495613_0068317 | Ga0495613_0068317_409_1599 | 396 |
| 383 | 3300046690 | Ga0495624_0001025 | Ga0495624_0001025_10942_12201 | 396 |
| 384 | 3300046690 | Ga0495624_0001534 | Ga0495624_0001534_4515_5705 | 396 |
| 385 | 3300046691 | Ga0495670_0001337 | Ga0495670_0001337_2463_3653 | 396 |
| 386 | 3300046691 | Ga0495670_0003007 | Ga0495670_0003007_5290_6480 | 396 |
| 387 | 3300046691 | Ga0495670_0014073 | Ga0495670_0014073_80_1270 | 396 |
| 388 | 3300046692 | Ga0495671_0001474 | Ga0495671_0001474_5914_7104 | 396 |
| 389 | 3300046692 | Ga0495671_0015710 | Ga0495671_0015710_93_1283 | 396 |
| 390 | 3300046692 | Ga0495671_0046217 | Ga0495671_0046217_69_1394 | 396 |
| 391 | 3300046692 | Ga0495671_0099905 | Ga0495671_0099905_31_1221 | 396 |
| 392 | 3300046694 | Ga0495649_0000106 | Ga0495649_0000106_22035_23360 | 396 |
| 393 | 3300046694 | Ga0495649_0000811 | Ga0495649_0000811_4986_6311 | 396 |
| 394 | 3300046794 | Ga0495589_0000790 | Ga0495589_0000790_10683_11873 | 396 |
| 395 | 3300046794 | Ga0495589_0009149 | Ga0495589_0009149_2393_3583 | 396 |
| 396 | 3300046809 | Ga0495600_0019540 | Ga0495600_0019540_25_1215 | 396 |
| 397 | 3300046810 | Ga0495660_0000868 | Ga0495660_0000868_10427_11623 | 396 |
| 398 | 3300046810 | Ga0495660_0020126 | Ga0495660_0020126_1813_3138 | 396 |
| 399 | 3300046810 | Ga0495660_0047120 | Ga0495660_0047120_958_2148 | 396 |
| 400 | 3300046810 | Ga0495660_0088647 | Ga0495660_0088647_257_1447 | 396 |
| 401 | 3300047317 | Ga0495604_0008855 | Ga0495604_0008855_5071_6330 | 396 |
| 402 | 3300047317 | Ga0495604_0032162 | Ga0495604_0032162_1335_2660 | 396 |
| 403 | 3300047318 | Ga0495636_0000215 | Ga0495636_0000215_15809_16999 | 396 |
| 404 | 3300047318 | Ga0495636_0000825 | Ga0495636_0000825_2112_3437 | 396 |
| 405 | 3300047319 | Ga0495674_0000146 | Ga0495674_0000146_17416_18675 | 396 |
| 406 | 3300047319 | Ga0495674_0003028 | Ga0495674_0003028_6417_7742 | 396 |
| 407 | 3300047320 | Ga0495672_0000987 | Ga0495672_0000987_21852_23177 | 396 |
| 408 | 3300047320 | Ga0495672_0001850 | Ga0495672_0001850_8948_10138 | 396 |
| 409 | 3300047320 | Ga0495672_0008680 | Ga0495672_0008680_5864_7054 | 396 |
| 410 | 3300047320 | Ga0495672_0015774 | Ga0495672_0015774_3400_4590 | 396 |
| 411 | 3300047320 | Ga0495672_0074498 | Ga0495672_0074498_704_1894 | 396 |
| 412 | 3300047321 | Ga0495676_0102670 | Ga0495676_0102670_308_1498 | 396 |
| 413 | 3300047323 | Ga0495683_0000003 | Ga0495683_0000003_135967_137157 | 396 |
| 414 | 3300047323 | Ga0495683_0001830 | Ga0495683_0001830_18_1208 | 396 |
| 415 | 3300047323 | Ga0495683_0002983 | Ga0495683_0002983_3631_4869 | 396 |
| 416 | 3300047323 | Ga0495683_0006620 | Ga0495683_0006620_3378_4568 | 396 |
| 417 | 3300047323 | Ga0495683_0011307 | Ga0495683_0011307_2599_3924 | 396 |
| 418 | 3300047323 | Ga0495683_0014523 | Ga0495683_0014523_18_1208 | 396 |
| 419 | 3300047443 | Ga0495687_000343 | Ga0495687_000343_30207_31532 | 396 |
| 420 | 3300047443 | Ga0495687_000760 | Ga0495687_000760_10683_11873 | 396 |
| 421 | 3300047443 | Ga0495687_001473 | Ga0495687_001473_16029_17219 | 396 |
| 422 | 3300047443 | Ga0495687_001864 | Ga0495687_001864_7790_9115 | 396 |
| 423 | 3300047443 | Ga0495687_003928 | Ga0495687_003928_3594_4832 | 396 |
| 424 | 3300047445 | Ga0495677_0000158 | Ga0495677_0000158_10683_11873 | 396 |
| 425 | 3300047445 | Ga0495677_0001108 | Ga0495677_0001108_3794_4984 | 396 |
| 426 | 3300047446 | Ga0495679_000066 | Ga0495679_000066_54604_55794 | 396 |
| 427 | 3300047447 | Ga0495685_000182 | Ga0495685_000182_18221_19411 | 396 |
| 428 | 3300047447 | Ga0495685_016487 | Ga0495685_016487_779_1969 | 396 |
| 429 | 3300047469 | Ga0495673_0001831 | Ga0495673_0001831_11791_13116 | 396 |
| 430 | 3300047469 | Ga0495673_0017369 | Ga0495673_0017369_2331_3521 | 396 |
| 431 | 3300047469 | Ga0495673_0033721 | Ga0495673_0033721_520_1710 | 396 |
| 432 | 3300047469 | Ga0495673_0039148 | Ga0495673_0039148_89_1279 | 396 |
| 433 | 3300047470 | Ga0495681_0006226 | Ga0495681_0006226_3044_4234 | 396 |
| 434 | 3300047470 | Ga0495681_0006555 | Ga0495681_0006555_3072_4262 | 396 |
| 435 | 3300047470 | Ga0495681_0007514 | Ga0495681_0007514_3761_5086 | 396 |
| 436 | 3300047673 | Ga0495593_0000065 | Ga0495593_0000065_29817_31076 | 396 |
| 437 | 3300047673 | Ga0495593_0000536 | Ga0495593_0000536_15246_16571 | 396 |
| 438 | 3300047673 | Ga0495593_0002680 | Ga0495593_0002680_2976_4166 | 396 |
| 439 | 3300048088 | Ga0495602_0001309 | Ga0495602_0001309_13495_14754 | 396 |
| 440 | 3300048088 | Ga0495602_0078149 | Ga0495602_0078149_160_1485 | 396 |
| 441 | 3300048090 | Ga0495615_0015452 | Ga0495615_0015452_207_1418 | 396 |
| 442 | 3300048091 | Ga0495626_0003714 | Ga0495626_0003714_6699_8024 | 396 |
| 443 | 3300048091 | Ga0495626_0006569 | Ga0495626_0006569_5357_6547 | 396 |
| 444 | 3300048904 | Ga0496101_0010506 | Ga0496101_0010506_4012_5202 | 396 |
| 445 | 3300048905 | Ga0496102_0000444 | Ga0496102_0000444_11072_12397 | 396 |
| 446 | 3300048905 | Ga0496102_0149480 | Ga0496102_0149480_482_1672 | 396 |
| 447 | 3300048906 | Ga0496103_0000290 | Ga0496103_0000290_10576_11901 | 396 |
| 448 | 3300048909 | Ga0496106_0000140 | Ga0496106_0000140_38394_39584 | 396 |
| 449 | 3300048919 | Ga0496116_0000231 | Ga0496116_0000231_28073_29398 | 396 |
| 450 | 3300048920 | Ga0496117_0002099 | Ga0496117_0002099_1768_2958 | 396 |
| 451 | 3300048920 | Ga0496117_0005335 | Ga0496117_0005335_1338_2663 | 396 |
| 452 | 3300048920 | Ga0496117_0053201 | Ga0496117_0053201_935_2125 | 396 |
| 453 | 3300048920 | Ga0496117_0055939 | Ga0496117_0055939_1087_2340 | 396 |
| 454 | 3300048921 | Ga0496118_0000106 | Ga0496118_0000106_71353_72543 | 396 |
| 455 | 3300048921 | Ga0496118_0004391 | Ga0496118_0004391_10903_12228 | 396 |
| 456 | 3300048921 | Ga0496118_0007473 | Ga0496118_0007473_1549_2739 | 396 |
| 457 | 3300048921 | Ga0496118_0011493 | Ga0496118_0011493_5244_6497 | 396 |
| 458 | 3300048921 | Ga0496118_0047266 | Ga0496118_0047266_506_1831 | 396 |
| 459 | 3300048924 | Ga0496121_0000540 | Ga0496121_0000540_41058_42248 | 396 |
| 460 | 3300048924 | Ga0496121_0001323 | Ga0496121_0001323_25217_26407 | 396 |
| 461 | 3300048924 | Ga0496121_0002437 | Ga0496121_0002437_24336_25526 | 396 |
| 462 | 3300048924 | Ga0496121_0008909 | Ga0496121_0008909_2739_3929 | 396 |
| 463 | 3300048924 | Ga0496121_0020875 | Ga0496121_0020875_4240_5565 | 396 |
| 464 | 3300048924 | Ga0496121_0066924 | Ga0496121_0066924_75_1265 | 396 |
| 465 | 3300048925 | Ga0496122_0000175 | Ga0496122_0000175_120803_121993 | 396 |
| 466 | 3300048925 | Ga0496122_0000834 | Ga0496122_0000834_31311_32501 | 396 |
| 467 | 3300048925 | Ga0496122_0002004 | Ga0496122_0002004_1038_2363 | 396 |
| 468 | 3300048926 | Ga0496123_0000079 | Ga0496123_0000079_31317_32507 | 396 |
| 469 | 3300048926 | Ga0496123_0001361 | Ga0496123_0001361_11474_12664 | 396 |
| 470 | 3300048927 | Ga0496124_0013054 | Ga0496124_0013054_2474_3670 | 396 |
| 471 | 3300048927 | Ga0496124_0167304 | Ga0496124_0167304_451_1641 | 396 |
| 472 | 3300048928 | Ga0496125_0001350 | Ga0496125_0001350_696_1886 | 396 |
| 473 | 3300048928 | Ga0496125_0020538 | Ga0496125_0020538_1200_2390 | 396 |
| 474 | 3300048929 | Ga0496126_0000098 | Ga0496126_0000098_90246_91436 | 396 |
| 475 | 3300048929 | Ga0496126_0000122 | Ga0496126_0000122_20959_22212 | 396 |
| 476 | 3300048929 | Ga0496126_0004422 | Ga0496126_0004422_2275_3465 | 396 |
| 477 | 3300048929 | Ga0496126_0015419 | Ga0496126_0015419_180_1370 | 396 |
| 478 | 3300048929 | Ga0496126_0051271 | Ga0496126_0051271_628_1818 | 396 |
| 479 | 3300049459 | Ga0495678_000007 | Ga0495678_000007_144705_145895 | 396 |
| 480 | 3300049459 | Ga0495678_000646 | Ga0495678_000646_19361_20551 | 396 |
| 481 | 3300049459 | Ga0495678_002416 | Ga0495678_002416_9256_10581 | 396 |
| 482 | 3300049460 | Ga0495682_0000496 | Ga0495682_0000496_17660_18850 | 396 |
| 483 | 3300049460 | Ga0495682_0000755 | Ga0495682_0000755_4366_5691 | 396 |
| 484 | 3300049460 | Ga0495682_0003020 | Ga0495682_0003020_828_2066 | 396 |
| 485 | 3300049822 | Ga0501035_0013106 | Ga0501035_0013106_4634_5824 | 396 |
| 486 | 3300049823 | Ga0501044_0006710 | Ga0501044_0006710_6983_8173 | 396 |
| 487 | 3300050491 | nmdc:mga00v17_142241_c1 | nmdc:mga00v17_142241_c1_260_1450 | 396 |
| 488 | 3300053125 | Ga0500618_000762 | Ga0500618_000762_5909_7099 | 396 |
| 489 | 3300061719 | Ga0466962_0001124 | Ga0466962_0001124_3157_4347 | 396 |
| 490 | 3300005329 | Ga0070683_100108050 | Ga0070683_1001080502 | 397 |
| 491 | 3300005334 | Ga0068869_100012126 | Ga0068869_1000121262 | 397 |
| 492 | 3300005335 | Ga0070666_10005794 | Ga0070666_100057946 | 397 |
| 493 | 3300005338 | Ga0068868_100023978 | Ga0068868_1000239783 | 397 |
| 494 | 3300005340 | Ga0070689_100001884 | Ga0070689_1000018843 | 397 |
| 495 | 3300005355 | Ga0070671_100003066 | Ga0070671_1000030664 | 397 |
| 496 | 3300005365 | Ga0070688_100001410 | Ga0070688_10000141011 | 397 |
| 497 | 3300005367 | Ga0070667_100023292 | Ga0070667_1000232922 | 397 |
| 498 | 3300005436 | Ga0070713_100002763 | Ga0070713_10000276311 | 397 |
| 499 | 3300005436 | Ga0070713_100038587 | Ga0070713_1000385873 | 397 |
| 500 | 3300005445 | Ga0070708_100089422 | Ga0070708_1000894222 | 397 |
| 501 | 3300005458 | Ga0070681_10281856 | Ga0070681_102818562 | 397 |
| 502 | 3300005466 | Ga0070685_10003558 | Ga0070685_100035585 | 397 |
| 503 | 3300005467 | Ga0070706_100067089 | Ga0070706_1000670893 | 397 |
| 504 | 3300005518 | Ga0070699_100071995 | Ga0070699_1000719952 | 397 |
| 505 | 3300005530 | Ga0070679_100215154 | Ga0070679_1002151541 | 397 |
| 506 | 3300005536 | Ga0070697_100028101 | Ga0070697_1000281014 | 397 |
| 507 | 3300005544 | Ga0070686_100034566 | Ga0070686_1000345662 | 397 |
| 508 | 3300005546 | Ga0070696_100067834 | Ga0070696_1000678342 | 397 |
| 509 | 3300005547 | Ga0070693_100003097 | Ga0070693_1000030977 | 397 |
| 510 | 3300005547 | Ga0070693_100155354 | Ga0070693_1001553541 | 397 |
| 511 | 3300005548 | Ga0070665_100009891 | Ga0070665_1000098916 | 397 |
| 512 | 3300005617 | Ga0068859_100003773 | Ga0068859_1000037737 | 397 |
| 513 | 3300005618 | Ga0068864_100083801 | Ga0068864_1000838013 | 397 |
| 514 | 3300005718 | Ga0068866_10001012 | Ga0068866_100010129 | 397 |
| 515 | 3300005841 | Ga0068863_100045739 | Ga0068863_1000457392 | 397 |
| 516 | 3300005842 | Ga0068858_100074430 | Ga0068858_1000744301 | 397 |
| 517 | 3300005843 | Ga0068860_100050284 | Ga0068860_1000502844 | 397 |
| 518 | 3300006186 | Ga0075369_10059343 | Ga0075369_100593432 | 397 |
| 519 | 3300006237 | Ga0097621_100056426 | Ga0097621_1000564263 | 397 |
| 520 | 3300006237 | Ga0097621_100197600 | Ga0097621_1001976002 | 397 |
| 521 | 3300006358 | Ga0068871_100043084 | Ga0068871_1000430841 | 397 |
| 522 | 3300006931 | Ga0097620_100003773 | Ga0097620_10000377311 | 397 |
| 523 | 3300009098 | Ga0105245_10220655 | Ga0105245_102206552 | 397 |
| 524 | 3300009177 | Ga0105248_10126581 | Ga0105248_101265812 | 397 |
| 525 | 3300009545 | Ga0105237_10180336 | Ga0105237_101803362 | 397 |
| 526 | 3300009553 | Ga0105249_10201881 | Ga0105249_102018812 | 397 |
| 527 | 3300013296 | Ga0157374_10000738 | Ga0157374_100007382 | 397 |
| 528 | 3300013297 | Ga0157378_10037531 | Ga0157378_100375313 | 397 |
| 529 | 3300013306 | Ga0163162_10106478 | Ga0163162_101064782 | 397 |
| 530 | 3300013308 | Ga0157375_10046595 | Ga0157375_100465953 | 397 |
| 531 | 3300014325 | Ga0163163_10055183 | Ga0163163_100551834 | 397 |
| 532 | 3300014745 | Ga0157377_10065508 | Ga0157377_100655082 | 397 |
| 533 | 3300014968 | Ga0157379_10049696 | Ga0157379_100496962 | 397 |
| 534 | 3300014969 | Ga0157376_10038338 | Ga0157376_100383383 | 397 |
| 535 | 3300014969 | Ga0157376_10260176 | Ga0157376_102601762 | 397 |
| 536 | 3300025898 | Ga0207692_10007836 | Ga0207692_100078363 | 397 |
| 537 | 3300025898 | Ga0207692_10036111 | Ga0207692_100361112 | 397 |
| 538 | 3300025908 | Ga0207643_10046640 | Ga0207643_100466402 | 397 |
| 539 | 3300025911 | Ga0207654_10011228 | Ga0207654_100112282 | 397 |
| 540 | 3300025913 | Ga0207695_10321155 | Ga0207695_103211552 | 397 |
| 541 | 3300025915 | Ga0207693_10002196 | Ga0207693_100021963 | 397 |
| 542 | 3300025919 | Ga0207657_10011384 | Ga0207657_100113846 | 397 |
| 543 | 3300025922 | Ga0207646_10105089 | Ga0207646_101050892 | 397 |
| 544 | 3300025927 | Ga0207687_10002320 | Ga0207687_1000232011 | 397 |
| 545 | 3300025927 | Ga0207687_10020309 | Ga0207687_100203094 | 397 |
| 546 | 3300025928 | Ga0207700_10032497 | Ga0207700_100324972 | 397 |
| 547 | 3300025929 | Ga0207664_10002534 | Ga0207664_100025347 | 397 |
| 548 | 3300025931 | Ga0207644_10002683 | Ga0207644_100026834 | 397 |
| 549 | 3300025934 | Ga0207686_10002219 | Ga0207686_100022192 | 397 |
| 550 | 3300025936 | Ga0207670_10001236 | Ga0207670_100012364 | 397 |
| 551 | 3300025937 | Ga0207669_10024534 | Ga0207669_100245343 | 397 |
| 552 | 3300025941 | Ga0207711_10000575 | Ga0207711_100005752 | 397 |
| 553 | 3300025942 | Ga0207689_10029614 | Ga0207689_100296143 | 397 |
| 554 | 3300025949 | Ga0207667_10146335 | Ga0207667_101463352 | 397 |
| 555 | 3300025986 | Ga0207658_10030107 | Ga0207658_100301073 | 397 |
| 556 | 3300026023 | Ga0207677_10001768 | Ga0207677_1000176810 | 397 |
| 557 | 3300026035 | Ga0207703_10000698 | Ga0207703_1000069829 | 397 |
| 558 | 3300026078 | Ga0207702_10048011 | Ga0207702_100480112 | 397 |
| 559 | 3300026088 | Ga0207641_10007478 | Ga0207641_100074786 | 397 |
| 560 | 3300026095 | Ga0207676_10000116 | Ga0207676_100001163 | 397 |
| 561 | 3300026116 | Ga0207674_10034484 | Ga0207674_100344842 | 397 |
| 562 | 3300026121 | Ga0207683_10002532 | Ga0207683_1000253212 | 397 |
| 563 | 3300026142 | Ga0207698_10166004 | Ga0207698_101660042 | 397 |
| 564 | 3300028381 | Ga0268264_10035740 | Ga0268264_100357402 | 397 |
| 565 | 3300030521 | Ga0307511_10062662 | Ga0307511_100626622 | 397 |
| 566 | 3300031456 | Ga0307513_10005621 | Ga0307513_1000562113 | 397 |
| 567 | 3300035086 | Ga0373934_0002351 | Ga0373934_0002351_1427_2635 | 397 |
| 568 | 3300035119 | Ga0373956_0017678 | Ga0373956_0017678_644_1852 | 397 |
| 569 | 3300035120 | Ga0373957_0005251 | Ga0373957_0005251_641_1849 | 397 |
| 570 | 3300035170 | Ga0373943_0053725 | Ga0373943_0053725_646_1854 | 397 |
| 571 | 3300035172 | Ga0373955_0033709 | Ga0373955_0033709_1282_2490 | 397 |
| 572 | 3300035692 | Ga0373935_0066948 | Ga0373935_0066948_363_1571 | 397 |
| 573 | 3300035695 | Ga0373927_0107920 | Ga0373927_0107920_474_1682 | 397 |
| 574 | 3300035725 | Ga0373947_0062862 | Ga0373947_0062862_883_2091 | 397 |
| 575 | 3300035725 | Ga0373947_0063369 | Ga0373947_0063369_249_1457 | 397 |
| 576 | 3300037068 | Ga0373925_0032256 | Ga0373925_0032256_274_1482 | 397 |
| 577 | 3300037068 | Ga0373925_0118780 | Ga0373925_0118780_822_2030 | 397 |
| 578 | 3300046455 | Ga0495603_0042619 | Ga0495603_0042619_521_1729 | 397 |
| 579 | 3300046458 | Ga0495591_015464 | Ga0495591_015464_214_1407 | 397 |
| 580 | 3300046459 | Ga0495629_0000456 | Ga0495629_0000456_5352_6545 | 397 |
| 581 | 3300046463 | Ga0495653_0015560 | Ga0495653_0015560_3660_4868 | 397 |
| 582 | 3300046471 | Ga0495650_0001616 | Ga0495650_0001616_1575_2768 | 397 |
| 583 | 3300046472 | Ga0495580_0062038 | Ga0495580_0062038_352_1545 | 397 |
| 584 | 3300046476 | Ga0495662_0018336 | Ga0495662_0018336_2102_3295 | 397 |
| 585 | 3300046477 | Ga0495664_0001452 | Ga0495664_0001452_6389_7663 | 397 |
| 586 | 3300046506 | Ga0495583_0042761 | Ga0495583_0042761_826_2019 | 397 |
| 587 | 3300046522 | Ga0495643_0008753 | Ga0495643_0008753_2341_3543 | 397 |
| 588 | 3300046530 | Ga0495654_0016135 | Ga0495654_0016135_2601_3794 | 397 |
| 589 | 3300046531 | Ga0495665_0021857 | Ga0495665_0021857_1352_2560 | 397 |
| 590 | 3300046539 | Ga0495621_0008601 | Ga0495621_0008601_535_1737 | 397 |
| 591 | 3300046543 | Ga0495645_0002165 | Ga0495645_0002165_5357_6550 | 397 |
| 592 | 3300046543 | Ga0495645_0053245 | Ga0495645_0053245_637_1845 | 397 |
| 593 | 3300046616 | Ga0495668_0037073 | Ga0495668_0037073_327_1529 | 397 |
| 594 | 3300046663 | Ga0495635_0015624 | Ga0495635_0015624_2827_4035 | 397 |
| 595 | 3300046681 | Ga0495647_0004494 | Ga0495647_0004494_1373_2581 | 397 |
| 596 | 3300046683 | Ga0495658_0055941 | Ga0495658_0055941_475_1683 | 397 |
| 597 | 3300046689 | Ga0495613_0044673 | Ga0495613_0044673_743_1951 | 397 |
| 598 | 3300046794 | Ga0495589_0008080 | Ga0495589_0008080_182_1375 | 397 |
| 599 | 3300046809 | Ga0495600_0019853 | Ga0495600_0019853_536_1744 | 397 |
| 600 | 3300046809 | Ga0495600_0051453 | Ga0495600_0051453_58_1251 | 397 |
| 601 | 3300047319 | Ga0495674_0053182 | Ga0495674_0053182_1296_2570 | 397 |
| 602 | 3300047319 | Ga0495674_0130549 | Ga0495674_0130549_490_1698 | 397 |
| 603 | 3300047322 | Ga0495680_0094551 | Ga0495680_0094551_192_1400 | 397 |
| 604 | 3300047446 | Ga0495679_034263 | Ga0495679_034263_163_1356 | 397 |
| 605 | 3300047471 | Ga0495684_0055026 | Ga0495684_0055026_1374_2582 | 397 |
| 606 | 3300048088 | Ga0495602_0035033 | Ga0495602_0035033_2683_3891 | 397 |
| 607 | 3300048089 | Ga0495614_0028152 | Ga0495614_0028152_1023_2231 | 397 |
| 608 | 3300048089 | Ga0495614_0060217 | Ga0495614_0060217_221_1414 | 397 |
| 609 | 3300048903 | Ga0496100_0039069 | Ga0496100_0039069_1260_2453 | 397 |
| 610 | 3300048904 | Ga0496101_0030360 | Ga0496101_0030360_922_2115 | 397 |
| 611 | 3300048905 | Ga0496102_0058052 | Ga0496102_0058052_1281_2483 | 397 |
| 612 | 3300048905 | Ga0496102_0081766 | Ga0496102_0081766_407_1609 | 397 |
| 613 | 3300048907 | Ga0496104_0003437 | Ga0496104_0003437_10594_11802 | 397 |
| 614 | 3300048909 | Ga0496106_0169118 | Ga0496106_0169118_445_1653 | 397 |
| 615 | 3300048910 | Ga0496107_0138468 | Ga0496107_0138468_576_1769 | 397 |
| 616 | 3300048911 | Ga0496108_0028033 | Ga0496108_0028033_2193_3395 | 397 |
| 617 | 3300048911 | Ga0496108_0064726 | Ga0496108_0064726_462_1670 | 397 |
| 618 | 3300048912 | Ga0496109_0049325 | Ga0496109_0049325_1282_2484 | 397 |
| 619 | 3300048913 | Ga0496110_0078281 | Ga0496110_0078281_1454_2656 | 397 |
| 620 | 3300048914 | Ga0496111_0033305 | Ga0496111_0033305_1285_2487 | 397 |
| 621 | 3300048917 | Ga0496114_0016737 | Ga0496114_0016737_252_1445 | 397 |
| 622 | 3300049572 | Ga0501036_0092645 | Ga0501036_0092645_1187_2389 | 397 |
| 623 | 3300049573 | Ga0501037_0007335 | Ga0501037_0007335_5963_7165 | 397 |
| 624 | 3300049576 | Ga0501040_0020294 | Ga0501040_0020294_920_2122 | 397 |
| 625 | 3300049577 | Ga0501041_0000529 | Ga0501041_0000529_8344_9546 | 397 |
| 626 | 3300049580 | Ga0501046_0080824 | Ga0501046_0080824_143_1345 | 397 |
| 627 | 3300049582 | Ga0501048_0132935 | Ga0501048_0132935_184_1386 | 397 |
| 628 | 3300049586 | Ga0501070_0290581 | Ga0501070_0290581_67_1272 | 397 |
| 629 | 3300049587 | Ga0501071_0009628 | Ga0501071_0009628_2280_3482 | 397 |
| 630 | 3300049591 | Ga0501075_0001724 | Ga0501075_0001724_898_2100 | 397 |
| 631 | 3300049592 | Ga0501076_0003131 | Ga0501076_0003131_2489_3691 | 397 |
| 632 | 3300049741 | Ga0501079_0011452 | Ga0501079_0011452_3217_4419 | 397 |
| 633 | 3300049742 | Ga0501080_0107623 | Ga0501080_0107623_916_2118 | 397 |
| 634 | 3300049743 | Ga0501081_0000560 | Ga0501081_0000560_3753_4955 | 397 |
| 635 | 3300050516 | nmdc:mga0sz30_27782_c1 | nmdc:mga0sz30_27782_c1_120_1346 | 397 |
| 636 | 3300053077 | Ga0495601_0112602 | Ga0495601_0112602_468_1676 | 397 |
| 637 | 3300053090 | Ga0500646_0005097 | Ga0500646_0005097_224_1450 | 397 |
| 638 | 3300053108 | Ga0500562_007741 | Ga0500562_007741_1462_2685 | 397 |
| 639 | 3300053125 | Ga0500618_001214 | Ga0500618_001214_7708_8901 | 397 |
| 640 | 3300053153 | Ga0500616_0012519 | Ga0500616_0012519_2085_3290 | 397 |
| 641 | 3300060353 | Ga0501082_0005297 | Ga0501082_0005297_9404_10606 | 397 |
| 642 | 3300003187 | JGI25151J46595_10001217 | JGI25151J46595_1000121712 | 398 |
| 643 | 3300003771 | Ga0055526_1006276 | Ga0055526_10062763 | 398 |
| 644 | 3300003771 | Ga0055526_1006341 | Ga0055526_10063415 | 398 |
| 645 | 3300003771 | Ga0055526_1015551 | Ga0055526_10155511 | 398 |
| 646 | 3300003775 | Ga0055524_1001369 | Ga0055524_10013697 | 398 |
| 647 | 3300003781 | Ga0055536_1001508 | Ga0055536_10015087 | 398 |
| 648 | 3300003784 | Ga0055534_1000957 | Ga0055534_10009577 | 398 |
| 649 | 3300003784 | Ga0055534_1001648 | Ga0055534_10016484 | 398 |
| 650 | 3300006051 | Ga0075364_10004775 | Ga0075364_100047752 | 398 |
| 651 | 3300006051 | Ga0075364_10052558 | Ga0075364_100525582 | 398 |
| 652 | 3300006051 | Ga0075364_10064415 | Ga0075364_100644152 | 398 |
| 653 | 3300006948 | Ga0099826_10000020 | Ga0099826_1000002021 | 398 |
| 654 | 3300025263 | Ga0209565_1000092 | Ga0209565_100009214 | 398 |
| 655 | 3300025263 | Ga0209565_1007190 | Ga0209565_10071903 | 398 |
| 656 | 3300025273 | Ga0209673_1014539 | Ga0209673_10145393 | 398 |
| 657 | 3300025291 | Ga0209675_1000809 | Ga0209675_10008099 | 398 |
| 658 | 3300025291 | Ga0209675_1000951 | Ga0209675_100095112 | 398 |
| 659 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012122 | 398 |
| 660 | 3300025294 | Ga0209025_1000892 | Ga0209025_100089224 | 398 |
| 661 | 3300025294 | Ga0209025_1001159 | Ga0209025_100115910 | 398 |
| 662 | 3300025294 | Ga0209025_1001484 | Ga0209025_100148424 | 398 |
| 663 | 3300025295 | Ga0209564_1001095 | Ga0209564_100109511 | 398 |
| 664 | 3300025295 | Ga0209564_1002067 | Ga0209564_10020677 | 398 |
| 665 | 3300025295 | Ga0209564_1002203 | Ga0209564_10022037 | 398 |
| 666 | 3300025299 | Ga0209256_1000804 | Ga0209256_100080422 | 398 |
| 667 | 3300025299 | Ga0209256_1001280 | Ga0209256_10012809 | 398 |
| 668 | 3300025303 | Ga0209051_1007991 | Ga0209051_10079915 | 398 |
| 669 | 3300025303 | Ga0209051_1051666 | Ga0209051_10516661 | 398 |
| 670 | 3300027666 | Ga0209282_1000045 | Ga0209282_100004556 | 398 |
| 671 | 3300038443 | Ga0395901_0002848 | Ga0395901_0002848_4543_5760 | 398 |
| 672 | 3300041404 | Ga0439436_0009175 | Ga0439436_0009175_208_1404 | 398 |
| 673 | 3300046474 | Ga0495605_0002620 | Ga0495605_0002620_2835_4031 | 398 |
| 674 | 3300046500 | Ga0495596_0003319 | Ga0495596_0003319_4119_5315 | 398 |
| 675 | 3300046512 | Ga0495610_0000402 | Ga0495610_0000402_27660_28856 | 398 |
| 676 | 3300046665 | Ga0495661_0024161 | Ga0495661_0024161_353_1549 | 398 |
| 677 | 3300046692 | Ga0495671_0000949 | Ga0495671_0000949_15078_16274 | 398 |
| 678 | 3300047320 | Ga0495672_0081539 | Ga0495672_0081539_114_1310 | 398 |
| 679 | 3300048919 | Ga0496116_0012327 | Ga0496116_0012327_2925_4121 | 398 |
| 680 | 3300048919 | Ga0496116_0044676 | Ga0496116_0044676_1403_2599 | 398 |
| 681 | 3300048924 | Ga0496121_0027429 | Ga0496121_0027429_2869_4065 | 398 |
| 682 | 3300048924 | Ga0496121_0031859 | Ga0496121_0031859_1517_2713 | 398 |
| 683 | 3300048925 | Ga0496122_0001089 | Ga0496122_0001089_24371_25567 | 398 |
| 684 | 3300048926 | Ga0496123_0003257 | Ga0496123_0003257_15540_16736 | 398 |
| 685 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_97830_99026 | 398 |
| 686 | 3300049571 | Ga0501034_0000530 | Ga0501034_0000530_30722_31918 | 398 |
| 687 | 3300050491 | nmdc:mga00v17_11365_c1 | nmdc:mga00v17_11365_c1_2703_3899 | 398 |
| 688 | 3300050491 | nmdc:mga00v17_129_c1 | nmdc:mga00v17_129_c1_22803_23999 | 398 |
| 689 | 3300050491 | nmdc:mga00v17_27043_c1 | nmdc:mga00v17_27043_c1_377_1573 | 398 |
| 690 | iso_pu_bacteria | 2596583598 | 2597028722 | 398 |
| 691 | iso_pu_bacteria | 2599185178 | 2599445404 | 398 |
| 692 | iso_pu_bacteria | 2900577576 | 2900580097 | 398 |
| 693 | iso_pu_bacteria | 2928058823 | 2928062734 | 398 |
| 694 | iso_pu_bacteria | 8002392321 | 8002393943 | 399 |
| 695 | 3300037418 | Ga0395900_0032503 | Ga0395900_0032503_3848_5065 | 401 |
| 696 | 3300001915 | JGI24741J21665_1003791 | JGI24741J21665_10037912 | 402 |
| 697 | 3300001979 | JGI24740J21852_10000337 | JGI24740J21852_1000033713 | 402 |
| 698 | 3300001979 | JGI24740J21852_10003034 | JGI24740J21852_100030347 | 402 |
| 699 | 3300002705 | JGI25156J39149_1004600 | JGI25156J39149_10046003 | 402 |
| 700 | 3300002705 | JGI25156J39149_1009239 | JGI25156J39149_10092392 | 402 |
| 701 | 3300002738 | JGI25154J39366_1002132 | JGI25154J39366_10021325 | 402 |
| 702 | 3300003752 | Ga0055539_1000172 | Ga0055539_100017220 | 402 |
| 703 | 3300003756 | Ga0055533_1003919 | Ga0055533_10039193 | 402 |
| 704 | 3300003758 | Ga0055532_1000002 | Ga0055532_1000002136 | 402 |
| 705 | 3300003758 | Ga0055532_1000029 | Ga0055532_1000029183 | 402 |
| 706 | 3300003760 | Ga0055527_1002226 | Ga0055527_10022263 | 402 |
| 707 | 3300003762 | Ga0055542_1000698 | Ga0055542_10006986 | 402 |
| 708 | 3300003763 | Ga0055529_1000062 | Ga0055529_1000062152 | 402 |
| 709 | 3300003841 | Ga0055541_1001062 | Ga0055541_10010624 | 402 |
| 710 | 3300003841 | Ga0055541_1001256 | Ga0055541_10012564 | 402 |
| 711 | 3300005344 | Ga0070661_100000139 | Ga0070661_10000013934 | 402 |
| 712 | 3300005455 | Ga0070663_100000006 | Ga0070663_100000006178 | 402 |
| 713 | 3300005564 | Ga0070664_100000002 | Ga0070664_10000000287 | 402 |
| 714 | 3300005577 | Ga0068857_100063245 | Ga0068857_1000632453 | 402 |
| 715 | 3300005578 | Ga0068854_100005888 | Ga0068854_1000058888 | 402 |
| 716 | 3300005614 | Ga0068856_100000028 | Ga0068856_10000002820 | 402 |
| 717 | 3300013102 | Ga0157371_10000204 | Ga0157371_1000020432 | 402 |
| 718 | 3300013104 | Ga0157370_10000013 | Ga0157370_10000013144 | 402 |
| 719 | 3300013105 | Ga0157369_10002173 | Ga0157369_100021732 | 402 |
| 720 | 3300013307 | Ga0157372_10000067 | Ga0157372_100000674 | 402 |
| 721 | 3300015261 | Ga0182006_1005940 | Ga0182006_10059403 | 402 |
| 722 | 3300015261 | Ga0182006_1024466 | Ga0182006_10244662 | 402 |
| 723 | 3300025224 | Ga0209784_100003 | Ga0209784_100003576 | 402 |
| 724 | 3300025224 | Ga0209784_100343 | Ga0209784_1003437 | 402 |
| 725 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021619 | 402 |
| 726 | 3300025225 | Ga0209566_100385 | Ga0209566_10038519 | 402 |
| 727 | 3300025225 | Ga0209566_101097 | Ga0209566_10109711 | 402 |
| 728 | 3300025226 | Ga0209674_100008 | Ga0209674_100008570 | 402 |
| 729 | 3300025226 | Ga0209674_100217 | Ga0209674_10021731 | 402 |
| 730 | 3300025228 | Ga0209672_100052 | Ga0209672_100052131 | 402 |
| 731 | 3300025228 | Ga0209672_100190 | Ga0209672_1001902 | 402 |
| 732 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021667 | 402 |
| 733 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041032 | 402 |
| 734 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021667 | 402 |
| 735 | 3300025246 | Ga0209646_1000022 | Ga0209646_1000022391 | 402 |
| 736 | 3300025253 | Ga0209677_100009 | Ga0209677_100009600 | 402 |
| 737 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021421 | 402 |
| 738 | 3300025254 | Ga0209148_1003376 | Ga0209148_10033765 | 402 |
| 739 | 3300025256 | Ga0209759_1005957 | Ga0209759_10059572 | 402 |
| 740 | 3300025256 | Ga0209759_1006874 | Ga0209759_10068742 | 402 |
| 741 | 3300025256 | Ga0209759_1010101 | Ga0209759_10101012 | 402 |
| 742 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021254 | 402 |
| 743 | 3300025913 | Ga0207695_10000887 | Ga0207695_1000088738 | 402 |
| 744 | 3300025920 | Ga0207649_10000193 | Ga0207649_1000019319 | 402 |
| 745 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001260 | 402 |
| 746 | 3300025981 | Ga0207640_10004206 | Ga0207640_100042067 | 402 |
| 747 | 3300026067 | Ga0207678_10000001 | Ga0207678_10000001174 | 402 |
| 748 | 3300026078 | Ga0207702_10000009 | Ga0207702_1000000953 | 402 |
| 749 | 3300026116 | Ga0207674_10013504 | Ga0207674_100135043 | 402 |
| 750 | 3300044693 | Ga0466961_0001499 | Ga0466961_0001499_5582_6790 | 402 |
| 751 | 3300044706 | Ga0466964_0003807 | Ga0466964_0003807_413_1621 | 402 |
| 752 | 3300045049 | Ga0466959_0093675 | Ga0466959_0093675_464_1672 | 402 |
| 753 | 3300045976 | Ga0466967_0211915 | Ga0466967_0211915_172_1380 | 402 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yx6-assembly2.cif.gz_D | crystal structure of rv3272 from m. tuberculosis orthorhombic form | 0.9314 | 1 | 375 |
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9311 | 4 | 383 |
| 5yit-assembly2.cif.gz_C | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.9284 | 1 | 376 |
| 1p5r-assembly1.cif.gz_A | formyl-coa transferase in complex with coenzyme a | 0.9281 | 3 | 396 |
| 5yit-assembly1.cif.gz_B | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.9278 | 2 | 378 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4V9F2_1_227_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9558 | 27 | 237 | 3.40.50.10540 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9443 | 4 | 284 | 3.40.50.10540 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9346 | 4 | 284 | 3.40.50.10540 |
| 4hl6D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9321 | 4 | 382 | 3.40.50.10540 |
| 4hl6D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9258 | 4 | 382 | 3.40.50.10540 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F3GKP8-F1-model_v4 | L-carnitine dehydratase/bile acid-inducible protein F | 0.9868 | 3 | 150 |
GO:0003824
|
| AF-A0A3M3RLL0-F1-model_v4 | deleted | 0.9855 | 3 | 148 |
|
| AF-A0A7Y7YJD4-F1-model_v4 | CoA transferase | 0.9837 | 20 | 144 |
GO:0016740
|
| AF-A0A536Y7Y7-F1-model_v4 | Uncharacterized protein | 0.9833 | 35 | 125 |
GO:0008410
|
| AF-A0A7Y8C4W7-F1-model_v4 | CoA transferase | 0.983 | 3 | 398 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar