F479207

General Info

Members Datasets Scaffolds Average Seq Length
753 336 1506 128

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1008753|Ga0228598_10087533
Length 132
Sequence MAKSKLKNKSAKKGKLKYIAWDSVELEDLNPLLQRQMIVGQDIMVARVLLKKGCIVPEHSHHNEQVTYILEGALKFWIDGKIIVVHAGEVLTIPPHMPHKAEAVADTVDLDIFTPPRADWLNRTDQYLRGDK

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
292 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
313 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
314 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
315 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 15.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1008753 3300024227 Bacteria 2037
2 JGI25406J46586_10006144 3300003203 Bacteria 5547
3 Ga0058863_11525647 3300004799 Unclassified 593
4 Ga0065714_10288131 3300005288 Bacteria 712
5 Ga0065715_10012615 3300005293 Bacteria 2981
6 Ga0065715_10616884 3300005293 Unclassified 698
7 Ga0065707_10017763 3300005295 Bacteria 1732
8 Ga0070658_10141222 3300005327 Bacteria 2012
9 Ga0070676_10196594 3300005328 Bacteria 1320
10 Ga0070683_100009225 3300005329 Bacteria 8429
11 Ga0070683_100145070 3300005329 Unclassified 2249
12 Ga0070683_100164929 3300005329 Bacteria 2102
13 Ga0070683_100360769 3300005329 Unclassified 1384
14 Ga0070690_100004747 3300005330 Bacteria 7582
15 Ga0070690_100099916 3300005330 Bacteria 1922
16 Ga0070690_100251975 3300005330 Bacteria 1249
17 Ga0070690_100296510 3300005330 Unclassified 1158
18 Ga0070670_100153275 3300005331 Bacteria 1995
19 Ga0070670_100534152 3300005331 Unclassified 1045
20 Ga0070670_100737126 3300005331 Bacteria 887
21 Ga0070677_10652821 3300005333 Unclassified 588
22 Ga0068869_100824437 3300005334 Bacteria 799
23 Ga0068869_102157683 3300005334 Unclassified 501
24 Ga0070666_10054962 3300005335 Bacteria 2686
25 Ga0070666_10202626 3300005335 Bacteria 1396
26 Ga0070680_100017414 3300005336 Bacteria 5667
27 Ga0070680_100142219 3300005336 Bacteria 2012
28 Ga0070680_100312221 3300005336 Bacteria 1334
29 Ga0070682_100587397 3300005337 Unclassified 877
30 Ga0068868_100042457 3300005338 Bacteria 3549
31 Ga0068868_100080081 3300005338 Bacteria 2617
32 Ga0068868_100401750 3300005338 Bacteria 1183
33 Ga0070660_100030411 3300005339 Bacteria 4051
34 Ga0070660_100064221 3300005339 Bacteria 2856
35 Ga0070689_100119207 3300005340 Bacteria 2106
36 Ga0070689_100157135 3300005340 Bacteria 1836
37 Ga0070689_100292834 3300005340 Bacteria 1353
38 Ga0070689_100377530 3300005340 Bacteria 1194
39 Ga0070687_100065546 3300005343 Unclassified 1933
40 Ga0070687_100082334 3300005343 Bacteria 1760
41 Ga0070687_100185597 3300005343 Bacteria 1249
42 Ga0070661_100009976 3300005344 Bacteria 6590
43 Ga0070692_10060409 3300005345 Bacteria 1995
44 Ga0070668_100094287 3300005347 Bacteria 2363
45 Ga0070669_100145231 3300005353 Bacteria 1832
46 Ga0070669_100165501 3300005353 Bacteria 1721
47 Ga0070675_100049307 3300005354 Bacteria 3456
48 Ga0070675_100074799 3300005354 Bacteria 2815
49 Ga0070675_101722677 3300005354 Bacteria 578
50 Ga0070671_100039698 3300005355 Bacteria 3908
51 Ga0070671_100373920 3300005355 Bacteria 1217
52 Ga0070671_100472797 3300005355 Bacteria 1077
53 Ga0070674_101526720 3300005356 Unclassified 601
54 Ga0070673_100605889 3300005364 Unclassified 999
55 Ga0070673_101742435 3300005364 Bacteria 590
56 Ga0070688_100021512 3300005365 Bacteria 3768
57 Ga0070688_100624776 3300005365 Bacteria 827
58 Ga0070659_100027485 3300005366 Bacteria 4383
59 Ga0070659_101146795 3300005366 Unclassified 686
60 Ga0070667_100049823 3300005367 Bacteria 3529
61 Ga0070667_100120903 3300005367 Bacteria 2278
62 Ga0070667_100182448 3300005367 Bacteria 1856
63 Ga0070709_10005729 3300005434 Bacteria 6736
64 Ga0070709_10019981 3300005434 Bacteria 3882
65 Ga0070709_10056615 3300005434 Bacteria 2480
66 Ga0070714_100001962 3300005435 Bacteria 15026
67 Ga0070714_100187190 3300005435 Bacteria 1887
68 Ga0070714_100250726 3300005435 Bacteria 1637
69 Ga0070714_100600141 3300005435 Unclassified 1057
70 Ga0070713_100000251 3300005436 Bacteria 35250
71 Ga0070713_100012085 3300005436 Bacteria 6322
72 Ga0070713_100031572 3300005436 Bacteria 4221
73 Ga0070713_100119661 3300005436 Unclassified 2308
74 Ga0070713_100850910 3300005436 Bacteria 876
75 Ga0070710_10461560 3300005437 Bacteria 863
76 Ga0070710_11128658 3300005437 Bacteria 577
77 Ga0070711_100060304 3300005439 Bacteria 2637
78 Ga0070711_100662813 3300005439 Bacteria 876
79 Ga0070705_100195713 3300005440 Bacteria 1382
80 Ga0070700_100047812 3300005441 Bacteria 2649
81 Ga0070694_100007377 3300005444 Bacteria 6704
82 Ga0070694_100105607 3300005444 Bacteria 1999
83 Ga0070694_100464709 3300005444 Bacteria 1001
84 Ga0070708_100000017 3300005445 Bacteria 120364
85 Ga0070663_100070636 3300005455 Bacteria 2540
86 Ga0070678_100181996 3300005456 Bacteria 1721
87 Ga0070662_100751756 3300005457 Bacteria 827
88 Ga0070662_101067701 3300005457 Bacteria 692
89 Ga0070681_10013489 3300005458 Bacteria 8122
90 Ga0070681_10080633 3300005458 Bacteria 3210
91 Ga0070681_10145736 3300005458 Bacteria 2297
92 Ga0070681_10189226 3300005458 Bacteria 1978
93 Ga0070681_10948999 3300005458 Unclassified 779
94 Ga0068867_100227588 3300005459 Bacteria 1506
95 Ga0068867_100870625 3300005459 Bacteria 808
96 Ga0070685_10001835 3300005466 Bacteria 11067
97 Ga0070685_10017160 3300005466 Bacteria 3871
98 Ga0070685_10020166 3300005466 Bacteria 3607
99 Ga0070706_100000576 3300005467 Bacteria 42667
100 Ga0070706_100922009 3300005467 Bacteria 807
101 Ga0070707_100028134 3300005468 Bacteria 5348
102 Ga0070707_100136774 3300005468 Bacteria 2384
103 Ga0070698_100095823 3300005471 Unclassified 2945
104 Ga0070698_100101518 3300005471 Bacteria 2848
105 Ga0070698_100698459 3300005471 Bacteria 956
106 Ga0070699_100071963 3300005518 Unclassified 3007
107 Ga0070699_100074949 3300005518 Bacteria 2945
108 Ga0070699_100368667 3300005518 Unclassified 1295
109 Ga0070699_101165329 3300005518 Bacteria 707
110 Ga0070679_100011725 3300005530 Bacteria 8355
111 Ga0070679_100026764 3300005530 Bacteria 5672
112 Ga0070679_100029615 3300005530 Bacteria 5400
113 Ga0070679_100041109 3300005530 Bacteria 4603
114 Ga0070679_100049905 3300005530 Bacteria 4168
115 Ga0070679_100064336 3300005530 Bacteria 3656
116 Ga0070679_100186011 3300005530 Bacteria 2048
117 Ga0070679_101029231 3300005530 Bacteria 768
118 Ga0070679_102196760 3300005530 Bacteria 502
119 Ga0070684_100029533 3300005535 Bacteria 4647
120 Ga0070684_100074055 3300005535 Bacteria 3002
121 Ga0070684_100123533 3300005535 Bacteria 2330
122 Ga0070684_100540601 3300005535 Bacteria 1081
123 Ga0070684_100598469 3300005535 Bacteria 1025
124 Ga0070697_100236275 3300005536 Unclassified 1560
125 Ga0070697_100274261 3300005536 Bacteria 1446
126 Ga0070697_100474937 3300005536 Bacteria 1091
127 Ga0068853_100006135 3300005539 Bacteria 9520
128 Ga0068853_100391222 3300005539 Bacteria 1300
129 Ga0070672_100196438 3300005543 Bacteria 1686
130 Ga0070672_100466509 3300005543 Bacteria 1089
131 Ga0070672_100665101 3300005543 Bacteria 910
132 Ga0070686_100010933 3300005544 Bacteria 5139
133 Ga0070686_100245156 3300005544 Unclassified 1306
134 Ga0070686_100459369 3300005544 Bacteria 981
135 Ga0070695_100011134 3300005545 Bacteria 5377
136 Ga0070695_100120456 3300005545 Unclassified 1794
137 Ga0070695_101551912 3300005545 Bacteria 552
138 Ga0070696_100005936 3300005546 Bacteria 8154
139 Ga0070696_100073689 3300005546 Bacteria 2406
140 Ga0070696_100094820 3300005546 Bacteria 2130
141 Ga0070693_100163840 3300005547 Bacteria 1418
142 Ga0070693_100435287 3300005547 Bacteria 917
143 Ga0070693_101322303 3300005547 Unclassified 558
144 Ga0070665_100236165 3300005548 Bacteria 1829
145 Ga0070665_100764437 3300005548 Bacteria 979
146 Ga0070704_100231869 3300005549 Bacteria 1506
147 Ga0068855_100008417 3300005563 Bacteria 12475
148 Ga0068855_100151408 3300005563 Bacteria 2638
149 Ga0068855_100193217 3300005563 Bacteria 2294
150 Ga0068855_100260352 3300005563 Bacteria 1932
151 Ga0068855_100306354 3300005563 Bacteria 1758
152 Ga0068855_100556394 3300005563 Unclassified 1241
153 Ga0070664_100033328 3300005564 Bacteria 4314
154 Ga0070664_100361463 3300005564 Bacteria 1322
155 Ga0068857_100764324 3300005577 Bacteria 921
156 Ga0068857_100804338 3300005577 Unclassified 898
157 Ga0068856_100017312 3300005614 Bacteria 6987
158 Ga0068856_100042250 3300005614 Bacteria 4484
159 Ga0068856_100191418 3300005614 Unclassified 2059
160 Ga0068856_100306102 3300005614 Bacteria 1607
161 Ga0068856_101108365 3300005614 Unclassified 809
162 Ga0070702_100045957 3300005615 Bacteria 2473
163 Ga0070702_100071609 3300005615 Bacteria 2049
164 Ga0070702_101066268 3300005615 Bacteria 644
165 Ga0068852_100002511 3300005616 Bacteria 12634
166 Ga0068852_100203913 3300005616 Bacteria 1872
167 Ga0068852_100446207 3300005616 Bacteria 1280
168 Ga0068859_100090416 3300005617 Bacteria 3112
169 Ga0068859_100093052 3300005617 Unclassified 3066
170 Ga0068859_100296589 3300005617 Bacteria 1710
171 Ga0068859_101757310 3300005617 Bacteria 685
172 Ga0068864_100391782 3300005618 Unclassified 1319
173 Ga0068864_100408406 3300005618 Bacteria 1292
174 Ga0068866_10502952 3300005718 Bacteria 802
175 Ga0068866_10643458 3300005718 Unclassified 721
176 Ga0068866_11213695 3300005718 Bacteria 545
177 Ga0068861_100448708 3300005719 Unclassified 1155
178 Ga0068870_10067952 3300005840 Bacteria 1935
179 Ga0068863_100354335 3300005841 Bacteria 1429
180 Ga0068863_100383417 3300005841 Unclassified 1373
181 Ga0068863_100496588 3300005841 Bacteria 1201
182 Ga0068863_100877084 3300005841 Unclassified 897
183 Ga0068858_100092173 3300005842 Unclassified 2820
184 Ga0068858_101145927 3300005842 Bacteria 764
185 Ga0068858_101495568 3300005842 Bacteria 666
186 Ga0068858_101620274 3300005842 Bacteria 639
187 Ga0068860_100092047 3300005843 Bacteria 2889
188 Ga0068860_100378043 3300005843 Bacteria 1398
189 Ga0081455_10191959 3300005937 Bacteria 1537
190 Ga0081539_10000131 3300005985 Bacteria 176467
191 Ga0070717_10023153 3300006028 Unclassified 4917
192 Ga0070717_10026154 3300006028 Bacteria 4653
193 Ga0070717_10860903 3300006028 Unclassified 825
194 Ga0070716_100062527 3300006173 Unclassified 2159
195 Ga0070716_100064005 3300006173 Bacteria 2137
196 Ga0070716_100075484 3300006173 Bacteria 1995
197 Ga0070716_100806456 3300006173 Unclassified 727
198 Ga0070712_100068751 3300006175 Bacteria 2525
199 Ga0070712_100088922 3300006175 Bacteria 2258
200 Ga0070712_100199175 3300006175 Bacteria 1572
201 Ga0097621_100206874 3300006237 Bacteria 1705
202 Ga0097621_100377414 3300006237 Bacteria 1266
203 Ga0097621_100602032 3300006237 Unclassified 1005
204 Ga0097621_101277864 3300006237 Bacteria 693
205 Ga0097621_101961713 3300006237 Unclassified 559
206 Ga0097621_102315421 3300006237 Unclassified 514
207 Ga0068871_100374525 3300006358 Bacteria 1264
208 Ga0075428_100834443 3300006844 Bacteria 979
209 Ga0075433_10010242 3300006852 Bacteria 7519
210 Ga0075433_10530270 3300006852 Unclassified 1036
211 Ga0075433_10893342 3300006852 Bacteria 775
212 Ga0075434_100008519 3300006871 Bacteria 9538
213 Ga0075434_100095955 3300006871 Bacteria 2970
214 Ga0075434_100156185 3300006871 Bacteria 2300
215 Ga0075434_100194233 3300006871 Bacteria 2050
216 Ga0075434_100903760 3300006871 Bacteria 898
217 Ga0075434_101484784 3300006871 Bacteria 687
218 Ga0075434_102030674 3300006871 Unclassified 580
219 Ga0075429_100153685 3300006880 Bacteria 2015
220 Ga0068865_100014714 3300006881 Plasmid 4978
221 Ga0068865_100051757 3300006881 Bacteria 2844
222 Ga0068865_100167103 3300006881 Bacteria 1683
223 Ga0068865_100565195 3300006881 Bacteria 957
224 Ga0068865_102008021 3300006881 Bacteria 525
225 Ga0075436_100065590 3300006914 Bacteria 2509
226 Ga0075436_100111161 3300006914 Bacteria 1913
227 Ga0075436_100551051 3300006914 Unclassified 846
228 Ga0075436_100669673 3300006914 Bacteria 767
229 Ga0097620_100090418 3300006931 Bacteria 3112
230 Ga0097620_100093056 3300006931 Unclassified 3066
231 Ga0097620_100296565 3300006931 Bacteria 1710
232 Ga0097620_101757408 3300006931 Bacteria 685
233 Ga0075435_100601269 3300007076 Bacteria 954
234 Ga0105240_10078952 3300009093 Bacteria 4052
235 Ga0105240_10218104 3300009093 Bacteria 2224
236 Ga0111539_10021019 3300009094 Bacteria 8037
237 Ga0111539_10393731 3300009094 Bacteria 1614
238 Ga0111539_12362467 3300009094 Bacteria 617
239 Ga0105245_10122193 3300009098 Bacteria 2434
240 Ga0105245_10342252 3300009098 Bacteria 1479
241 Ga0105245_10698122 3300009098 Bacteria 1048
242 Ga0105245_10754821 3300009098 Bacteria 1009
243 Ga0105247_10761725 3300009101 Bacteria 735
244 Ga0114129_10033486 3300009147 Bacteria 7262
245 Ga0114129_10168905 3300009147 Unclassified 2983
246 Ga0114129_10547504 3300009147 Unclassified 1505
247 Ga0114129_13067509 3300009147 Unclassified 547
248 Ga0105243_10034995 3300009148 Bacteria 3893
249 Ga0105243_11240538 3300009148 Bacteria 760
250 Ga0105243_12611734 3300009148 Bacteria 545
251 Ga0105241_11084772 3300009174 Unclassified 753
252 Ga0105242_10046106 3300009176 Bacteria 3536
253 Ga0105242_10197841 3300009176 Bacteria 1783
254 Ga0105248_10005266 3300009177 Bacteria 14232
255 Ga0105248_10680193 3300009177 Bacteria 1161
256 Ga0105248_10883375 3300009177 Unclassified 1009
257 Ga0105248_12906585 3300009177 Unclassified 546
258 Ga0105237_10175252 3300009545 Bacteria 2145
259 Ga0105237_11442229 3300009545 Bacteria 695
260 Ga0105238_10000003 3300009551 Bacteria 422077
261 Ga0105238_10044378 3300009551 Bacteria 4495
262 Ga0105238_10053162 3300009551 Bacteria 4070
263 Ga0105238_10072338 3300009551 Bacteria 3444
264 Ga0105238_10405009 3300009551 Bacteria 1358
265 Ga0105249_10403074 3300009553 Bacteria 1398
266 Ga0105249_10476448 3300009553 Bacteria 1290
267 Ga0105239_10092718 3300010375 Bacteria 3334
268 Ga0105239_10545549 3300010375 Bacteria 1320
269 Ga0105239_11217966 3300010375 Bacteria 868
270 Ga0105239_12923570 3300010375 Bacteria 557
271 Ga0105246_10270511 3300011119 Bacteria 1358
272 Ga0105246_10336791 3300011119 Bacteria 1231
273 Ga0157373_10101917 3300013100 Bacteria 2020
274 Ga0157373_10235960 3300013100 Bacteria 1292
275 Ga0157373_10507026 3300013100 Bacteria 872
276 Ga0157373_11020469 3300013100 Bacteria 618
277 Ga0157373_11467316 3300013100 Bacteria 520
278 Ga0157371_10207576 3300013102 Bacteria 1405
279 Ga0157370_10006059 3300013104 Bacteria 13416
280 Ga0157370_10034377 3300013104 Bacteria 4937
281 Ga0157370_10136832 3300013104 Bacteria 2283
282 Ga0157370_11026288 3300013104 Bacteria 746
283 Ga0157370_11461805 3300013104 Bacteria 615
284 Ga0157369_10004266 3300013105 Bacteria 16904
285 Ga0157369_10008871 3300013105 Bacteria 11519
286 Ga0157369_10214464 3300013105 Bacteria 2017
287 Ga0157369_11065278 3300013105 Bacteria 827
288 Ga0157369_11256968 3300013105 Bacteria 755
289 Ga0157369_11757081 3300013105 Bacteria 630
290 Ga0157374_12355411 3300013296 Bacteria 560
291 Ga0157378_10027809 3300013297 Unclassified 4988
292 Ga0163162_10199697 3300013306 Bacteria 2128
293 Ga0163162_11096262 3300013306 Bacteria 902
294 Ga0163162_11876523 3300013306 Bacteria 686
295 Ga0163162_13477815 3300013306 Unclassified 501
296 Ga0157372_10002777 3300013307 Bacteria 18923
297 Ga0157372_10003036 3300013307 Bacteria 18091
298 Ga0157372_10011030 3300013307 Bacteria 9618
299 Ga0157372_10016620 3300013307 Bacteria 7896
300 Ga0157372_10034127 3300013307 Bacteria 5592
301 Ga0157372_10119852 3300013307 Unclassified 3021
302 Ga0157372_10137008 3300013307 Bacteria 2819
303 Ga0157372_10140060 3300013307 Bacteria 2786
304 Ga0157372_10295300 3300013307 Bacteria 1885
305 Ga0157372_10887408 3300013307 Bacteria 1035
306 Ga0157372_10894397 3300013307 Bacteria 1030
307 Ga0157372_11858828 3300013307 Unclassified 692
308 Ga0157375_10072445 3300013308 Bacteria 3462
309 Ga0157375_10439243 3300013308 Bacteria 1471
310 Ga0157375_10589829 3300013308 Bacteria 1271
311 Ga0157375_10662354 3300013308 Bacteria 1199
312 Ga0163163_10003424 3300014325 Bacteria 13483
313 Ga0163163_10003837 3300014325 Bacteria 12797
314 Ga0163163_10553195 3300014325 Bacteria 1213
315 Ga0163163_10564784 3300014325 Bacteria 1201
316 Ga0157380_10091253 3300014326 Bacteria 2514
317 Ga0157380_10646106 3300014326 Bacteria 1054
318 Ga0157380_11997646 3300014326 Bacteria 642
319 Ga0157377_10138998 3300014745 Bacteria 1491
320 Ga0157379_10532243 3300014968 Bacteria 1092
321 Ga0157376_10479096 3300014969 Unclassified 1219
322 Ga0157376_10550370 3300014969 Bacteria 1142
323 Ga0157376_11028079 3300014969 Unclassified 847
324 Ga0182007_10308025 3300015262 Bacteria 583
325 Ga0182007_10311781 3300015262 Unclassified 581
326 Ga0163161_10212634 3300017792 Bacteria 1494
327 Ga0163161_10886382 3300017792 Bacteria 755
328 Ga0197907_10706279 3300020069 Bacteria 1693
329 Ga0206356_10700383 3300020070 Unclassified 784
330 Ga0213876_10000118 3300021384 Bacteria 86390
331 Ga0207692_10259614 3300025898 Bacteria 1044
332 Ga0207642_10647107 3300025899 Bacteria 662
333 Ga0207688_10135840 3300025901 Bacteria 1444
334 Ga0207680_10207047 3300025903 Bacteria 1339
335 Ga0207680_10427296 3300025903 Bacteria 939
336 Ga0207699_10006134 3300025906 Bacteria 5796
337 Ga0207699_10014007 3300025906 Bacteria 4121
338 Ga0207699_10019403 3300025906 Bacteria 3625
339 Ga0207699_10031793 3300025906 Bacteria 2967
340 Ga0207699_10333721 3300025906 Unclassified 1067
341 Ga0207645_10037994 3300025907 Bacteria 3089
342 Ga0207645_10084802 3300025907 Bacteria 2033
343 Ga0207643_10072528 3300025908 Bacteria 1983
344 Ga0207705_10001269 3300025909 Bacteria 20257
345 Ga0207705_10123002 3300025909 Bacteria 1927
346 Ga0207705_10214900 3300025909 Bacteria 1459
347 Ga0207705_11064069 3300025909 Bacteria 624
348 Ga0207684_10000605 3300025910 Bacteria 42710
349 Ga0207684_10036731 3300025910 Bacteria 4158
350 Ga0207654_10598495 3300025911 Bacteria 786
351 Ga0207707_10055294 3300025912 Bacteria 3453
352 Ga0207707_10117298 3300025912 Bacteria 2327
353 Ga0207707_10142199 3300025912 Bacteria 2098
354 Ga0207707_10253184 3300025912 Bacteria 1529
355 Ga0207707_10400585 3300025912 Bacteria 1178
356 Ga0207707_10443028 3300025912 Unclassified 1112
357 Ga0207707_11430762 3300025912 Bacteria 550
358 Ga0207695_10005288 3300025913 Bacteria 17209
359 Ga0207695_10316657 3300025913 Bacteria 1450
360 Ga0207671_10281542 3300025914 Bacteria 1311
361 Ga0207693_10001846 3300025915 Bacteria 18559
362 Ga0207693_10009978 3300025915 Bacteria 7721
363 Ga0207693_10114613 3300025915 Unclassified 2115
364 Ga0207663_10000257 3300025916 Bacteria 23123
365 Ga0207663_10104439 3300025916 Unclassified 1910
366 Ga0207663_10112451 3300025916 Bacteria 1850
367 Ga0207663_10861941 3300025916 Bacteria 723
368 Ga0207660_10004947 3300025917 Bacteria 8683
369 Ga0207660_10039316 3300025917 Bacteria 3306
370 Ga0207660_10068434 3300025917 Bacteria 2575
371 Ga0207660_10306672 3300025917 Unclassified 1265
372 Ga0207660_10359501 3300025917 Bacteria 1168
373 Ga0207660_10539774 3300025917 Bacteria 948
374 Ga0207662_10105231 3300025918 Bacteria 1753
375 Ga0207662_10313594 3300025918 Bacteria 1045
376 Ga0207657_10000732 3300025919 Bacteria 34865
377 Ga0207657_10023271 3300025919 Bacteria 5772
378 Ga0207649_10021202 3300025920 Bacteria 3736
379 Ga0207652_10017033 3300025921 Bacteria 5944
380 Ga0207652_10018716 3300025921 Bacteria 5684
381 Ga0207652_10037950 3300025921 Bacteria 4080
382 Ga0207652_10118055 3300025921 Bacteria 2357
383 Ga0207652_10155370 3300025921 Unclassified 2049
384 Ga0207652_10272678 3300025921 Bacteria 1526
385 Ga0207652_10594746 3300025921 Bacteria 992
386 Ga0207652_11561008 3300025921 Unclassified 564
387 Ga0207652_11580319 3300025921 Bacteria 560
388 Ga0207652_11669585 3300025921 Bacteria 542
389 Ga0207646_10045822 3300025922 Unclassified 3924
390 Ga0207646_10074475 3300025922 Bacteria 3033
391 Ga0207646_10213993 3300025922 Bacteria 1740
392 Ga0207681_10125679 3300025923 Bacteria 1888
393 Ga0207681_10384211 3300025923 Bacteria 1131
394 Ga0207694_10000020 3300025924 Bacteria 310240
395 Ga0207694_10079886 3300025924 Bacteria 2566
396 Ga0207694_10214528 3300025924 Bacteria 1569
397 Ga0207694_11090437 3300025924 Bacteria 676
398 Ga0207650_10893700 3300025925 Bacteria 754
399 Ga0207659_10722908 3300025926 Bacteria 853
400 Ga0207700_10008942 3300025928 Bacteria 6234
401 Ga0207700_10012780 3300025928 Bacteria 5430
402 Ga0207700_10028050 3300025928 Bacteria 3951
403 Ga0207700_10158130 3300025928 Bacteria 1880
404 Ga0207700_10888994 3300025928 Bacteria 797
405 Ga0207700_11182571 3300025928 Bacteria 683
406 Ga0207664_10007746 3300025929 Bacteria 7456
407 Ga0207664_10125121 3300025929 Bacteria 2157
408 Ga0207690_10755839 3300025932 Unclassified 802
409 Ga0207706_10949133 3300025933 Bacteria 725
410 Ga0207686_10095912 3300025934 Bacteria 1969
411 Ga0207686_10154855 3300025934 Bacteria 1600
412 Ga0207709_11242360 3300025935 Bacteria 615
413 Ga0207670_11201510 3300025936 Bacteria 642
414 Ga0207669_11619289 3300025937 Unclassified 553
415 Ga0207704_10038007 3300025938 Bacteria 2787
416 Ga0207665_10073541 3300025939 Unclassified 2338
417 Ga0207665_10122090 3300025939 Bacteria 1841
418 Ga0207665_10246198 3300025939 Bacteria 1319
419 Ga0207665_10942436 3300025939 Unclassified 686
420 Ga0207691_10074936 3300025940 Bacteria 3052
421 Ga0207691_10131348 3300025940 Bacteria 2212
422 Ga0207711_10492088 3300025941 Bacteria 1143
423 Ga0207711_10549003 3300025941 Bacteria 1078
424 Ga0207689_10786653 3300025942 Bacteria 803
425 Ga0207661_10002285 3300025944 Bacteria 13203
426 Ga0207661_10030332 3300025944 Bacteria 4165
427 Ga0207661_10044141 3300025944 Bacteria 3521
428 Ga0207661_10206559 3300025944 Bacteria 1729
429 Ga0207661_10336154 3300025944 Unclassified 1360
430 Ga0207679_10196771 3300025945 Bacteria 1681
431 Ga0207667_10015643 3300025949 Bacteria 8606
432 Ga0207667_10092991 3300025949 Bacteria 3114
433 Ga0207667_10103607 3300025949 Bacteria 2935
434 Ga0207667_10156502 3300025949 Bacteria 2344
435 Ga0207667_10211920 3300025949 Bacteria 1986
436 Ga0207667_10950716 3300025949 Unclassified 849
437 Ga0207651_10574073 3300025960 Bacteria 983
438 Ga0207712_10252144 3300025961 Bacteria 1427
439 Ga0207712_10740681 3300025961 Bacteria 860
440 Ga0207668_10411814 3300025972 Bacteria 1145
441 Ga0207668_11911339 3300025972 Unclassified 535
442 Ga0207668_12064781 3300025972 Bacteria 513
443 Ga0207640_10044082 3300025981 Bacteria 2856
444 Ga0207640_11892985 3300025981 Bacteria 540
445 Ga0207658_10044172 3300025986 Bacteria 3244
446 Ga0207658_10159032 3300025986 Bacteria 1850
447 Ga0207677_10728568 3300026023 Bacteria 882
448 Ga0207703_11286101 3300026035 Bacteria 703
449 Ga0207639_10051659 3300026041 Bacteria 3128
450 Ga0207639_11254516 3300026041 Bacteria 696
451 Ga0207639_11731087 3300026041 Unclassified 585
452 Ga0207678_10099094 3300026067 Bacteria 2489
453 Ga0207708_10400237 3300026075 Bacteria 1135
454 Ga0207702_10006559 3300026078 Bacteria 10014
455 Ga0207702_10100111 3300026078 Unclassified 2556
456 Ga0207702_10148650 3300026078 Bacteria 2129
457 Ga0207702_10273653 3300026078 Unclassified 1594
458 Ga0207702_10579412 3300026078 Bacteria 1100
459 Ga0207648_10134549 3300026089 Bacteria 2177
460 Ga0207648_10955760 3300026089 Bacteria 801
461 Ga0207648_11271873 3300026089 Bacteria 691
462 Ga0207674_10217594 3300026116 Bacteria 1858
463 Ga0207674_10751396 3300026116 Bacteria 941
464 Ga0207675_100076244 3300026118 Bacteria 3140
465 Ga0207675_100429443 3300026118 Bacteria 1306
466 Ga0207675_101646815 3300026118 Bacteria 662
467 Ga0207683_11208344 3300026121 Bacteria 701
468 Ga0207698_10009848 3300026142 Bacteria 6108
469 Ga0268266_10766653 3300028379 Bacteria 931
470 Ga0268264_11252694 3300028381 Bacteria 752
471 Ga0268264_11697116 3300028381 Unclassified 642
472 Ga0307408_102140303 3300031548 Unclassified 540
473 Ga0307405_10072667 3300031731 Bacteria 2218
474 Ga0307413_10058707 3300031824 Bacteria 2360
475 Ga0307413_10693775 3300031824 Bacteria 845
476 Ga0307413_11087954 3300031824 Unclassified 690
477 Ga0307410_10303808 3300031852 Bacteria 1260
478 Ga0307410_10437453 3300031852 Bacteria 1064
479 Ga0307406_10187134 3300031901 Bacteria 1513
480 Ga0307406_10196698 3300031901 Bacteria 1481
481 Ga0307406_10205807 3300031901 Bacteria 1452
482 Ga0307406_11018915 3300031901 Bacteria 711
483 Ga0307407_10057350 3300031903 Bacteria 2259
484 Ga0307407_10323031 3300031903 Bacteria 1084
485 Ga0307407_10346099 3300031903 Bacteria 1051
486 Ga0307412_10128176 3300031911 Bacteria 1839
487 Ga0307412_10185875 3300031911 Bacteria 1567
488 Ga0307409_100161561 3300031995 Bacteria 1960
489 Ga0307409_100162386 3300031995 Bacteria 1955
490 Ga0307409_100176950 3300031995 Bacteria 1884
491 Ga0307409_100449133 3300031995 Bacteria 1244
492 Ga0307409_100933640 3300031995 Bacteria 883
493 Ga0307409_101781864 3300031995 Bacteria 645
494 Ga0307416_100085238 3300032002 Bacteria 2688
495 Ga0307416_100227290 3300032002 Bacteria 1796
496 Ga0307416_101038871 3300032002 Bacteria 923
497 Ga0307414_10337475 3300032004 Bacteria 1289
498 Ga0307411_10169036 3300032005 Bacteria 1647
499 Ga0307411_10227589 3300032005 Bacteria 1451
500 Ga0307411_10713503 3300032005 Bacteria 875
501 Ga0307415_100005778 3300032126 Bacteria 6602
502 Ga0307415_100421281 3300032126 Bacteria 1146
503 Ga0307415_100485912 3300032126 Bacteria 1076
504 Ga0307415_100496112 3300032126 Bacteria 1066
505 Ga0373930_0059071 3300034816 Bacteria 852
506 Ga0373959_0000233 3300034820 Bacteria 12083
507 Ga0373959_0024577 3300034820 Bacteria 1178
508 Ga0373926_0027723 3300035083 Unclassified 1986
509 Ga0373934_0001604 3300035086 Bacteria 8308
510 Ga0373934_0003884 3300035086 Bacteria 5492
511 Ga0373940_0161008 3300035088 Bacteria 720
512 Ga0373944_0053970 3300035089 Bacteria 1273
513 Ga0373949_0022772 3300035090 Unclassified 1447
514 Ga0373923_0030106 3300035111 Bacteria 2181
515 Ga0373923_0032194 3300035111 Bacteria 2117
516 Ga0373932_0076672 3300035112 Bacteria 1048
517 Ga0373936_0450239 3300035113 Bacteria 595
518 Ga0373939_0016007 3300035114 Unclassified 1971
519 Ga0373941_0002876 3300035115 Bacteria 3840
520 Ga0373953_0128495 3300035117 Unclassified 1079
521 Ga0373954_0014743 3300035118 Bacteria 3487
522 Ga0373956_0016027 3300035119 Unclassified 3143
523 Ga0373956_0065807 3300035119 Bacteria 1647
524 Ga0373957_0091663 3300035120 Bacteria 1208
525 Ga0373960_0032253 3300035121 Unclassified 1470
526 Ga0373943_0001746 3300035170 Bacteria 9862
527 Ga0373943_0471652 3300035170 Bacteria 731
528 Ga0373943_0705187 3300035170 Bacteria 598
529 Ga0373946_0001768 3300035171 Bacteria 7531
530 Ga0373955_0002495 3300035172 Bacteria 8037
531 Ga0373955_0031200 3300035172 Bacteria 2790
532 Ga0373961_0005228 3300035241 Unclassified 3122
533 Ga0373924_0005492 3300035410 Unclassified 4494
534 Ga0373935_0000240 3300035692 Bacteria 27064
535 Ga0373935_0294790 3300035692 Bacteria 1145
536 Ga0373927_0004551 3300035695 Bacteria 9689
537 Ga0373927_0008018 3300035695 Bacteria 7129
538 Ga0373933_0013632 3300035724 Bacteria 4507
539 Ga0373933_0053363 3300035724 Bacteria 2421
540 Ga0373947_0000395 3300035725 Bacteria 24564
541 Ga0373947_0016145 3300035725 Bacteria 4291
542 Ga0373937_0019091 3300036401 Bacteria 6134
543 Ga0373937_0046947 3300036401 Bacteria 3950
544 Ga0373937_0096037 3300036401 Bacteria 2748
545 Ga0373925_0001604 3300037068 Bacteria 19102
546 Ga0373925_0016538 3300037068 Bacteria 5345
547 Ga0395899_0013130 3300037312 Bacteria 6336
548 Ga0395898_0225397 3300037466 Unclassified 1788
549 Ga0395905_0124153 3300037471 Unclassified 2427
550 Ga0436364_0024804 3300037853 Unclassified 832
551 Ga0395901_0001536 3300038443 Bacteria 23950
552 Ga0436365_1431913 3300039437 Bacteria 11075
553 Ga0436365_1850755 3300039437 Bacteria 1009
554 Ga0436363_1312389 3300039450 Bacteria 816
555 Ga0436362_0733517 3300039453 Bacteria 1319
556 Ga0439439_0083483 3300041406 Bacteria 866
557 Ga0439439_0256189 3300041406 Unclassified 520
558 Ga0439431_0058217 3300041997 Bacteria 1013
559 Ga0439433_0195281 3300041999 Bacteria 533
560 Ga0439457_166791 3300042014 Unclassified 534
561 Ga0439446_0121812 3300042156 Unclassified 840
562 Ga0453683_1106632 3300044673 Bacteria 528
563 Ga0453683_1183941 3300044673 Bacteria 511
564 Ga0466965_0832941 3300044683 Bacteria 535
565 Ga0466961_0197833 3300044693 Bacteria 1244
566 Ga0466963_0131501 3300044694 Bacteria 1729
567 Ga0466963_0308458 3300044694 Bacteria 1113
568 Ga0466964_0175367 3300044706 Bacteria 1013
569 Ga0466964_0237151 3300044706 Bacteria 893
570 Ga0466957_0269277 3300044842 Unclassified 1137
571 Ga0466959_0005852 3300045049 Bacteria 8463
572 Ga0466967_0025549 3300045976 Bacteria 4873
573 Ga0466967_0600450 3300045976 Unclassified 1086
574 Ga0495592_0048100 3300046454 Bacteria 3173
575 Ga0495592_0340677 3300046454 Unclassified 964
576 Ga0495603_0045140 3300046455 Bacteria 2629
577 Ga0495629_0027631 3300046459 Bacteria 4029
578 Ga0495629_0028230 3300046459 Bacteria 3984
579 Ga0495629_0549029 3300046459 Bacteria 776
580 Ga0495651_0011749 3300046462 Bacteria 6728
581 Ga0495651_0064649 3300046462 Bacteria 2795
582 Ga0495653_0035536 3300046463 Bacteria 3931
583 Ga0495580_0000036 3300046472 Bacteria 72262
584 Ga0495580_0120281 3300046472 Unclassified 1823
585 Ga0495580_0235864 3300046472 Bacteria 1255
586 Ga0495582_0000381 3300046473 Bacteria 24133
587 Ga0495582_0029917 3300046473 Bacteria 2989
588 Ga0495582_0051555 3300046473 Bacteria 2269
589 Ga0495582_0191875 3300046473 Bacteria 1166
590 Ga0495639_0000028 3300046475 Bacteria 67975
591 Ga0495639_0033625 3300046475 Bacteria 2290
592 Ga0495639_0328157 3300046475 Bacteria 766
593 Ga0495664_0002894 3300046477 Bacteria 9255
594 Ga0495594_0012775 3300046499 Bacteria 4380
595 Ga0495594_0059833 3300046499 Bacteria 2107
596 Ga0495594_0420135 3300046499 Unclassified 760
597 Ga0495596_0102036 3300046500 Bacteria 1114
598 Ga0495628_0040491 3300046516 Bacteria 3723
599 Ga0495628_0105295 3300046516 Bacteria 2173
600 Ga0495628_0121687 3300046516 Unclassified 2001
601 Ga0495630_0000452 3300046517 Bacteria 31051
602 Ga0495630_0050172 3300046517 Bacteria 3123
603 Ga0495630_0332404 3300046517 Bacteria 1162
604 Ga0495630_0430058 3300046517 Bacteria 1011
605 Ga0495630_0819786 3300046517 Bacteria 710
606 Ga0495666_0062119 3300046526 Bacteria 1784
607 Ga0495652_0003132 3300046529 Bacteria 16521
608 Ga0495652_0095357 3300046529 Bacteria 2424
609 Ga0495665_0000019 3300046531 Bacteria 61211
610 Ga0495665_0009670 3300046531 Bacteria 5222
611 Ga0495640_0276822 3300046533 Bacteria 1046
612 Ga0495586_0006643 3300046535 Bacteria 6176
613 Ga0495586_0129530 3300046535 Bacteria 1412
614 Ga0495586_0179913 3300046535 Bacteria 1196
615 Ga0495586_0273713 3300046535 Bacteria 965
616 Ga0495587_0001827 3300046536 Bacteria 14189
617 Ga0495587_0002385 3300046536 Bacteria 12534
618 Ga0495587_0003538 3300046536 Bacteria 10406
619 Ga0495645_0000651 3300046543 Bacteria 23931
620 Ga0495645_0010848 3300046543 Bacteria 6401
621 Ga0495645_0067415 3300046543 Bacteria 2584
622 Ga0495622_0077655 3300046557 Bacteria 1530
623 Ga0495622_0127456 3300046557 Bacteria 1160
624 Ga0495667_0012340 3300046559 Bacteria 5790
625 Ga0495667_0013916 3300046559 Bacteria 5433
626 Ga0495667_0016668 3300046559 Bacteria 4961
627 Ga0495635_0001636 3300046663 Bacteria 15101
628 Ga0495588_0000197 3300046674 Bacteria 62450
629 Ga0495588_0014924 3300046674 Bacteria 3729
630 Ga0495588_0303937 3300046674 Bacteria 840
631 Ga0495657_0002639 3300046675 Bacteria 15004
632 Ga0495657_0049820 3300046675 Bacteria 2819
633 Ga0495599_0000866 3300046678 Bacteria 16950
634 Ga0495599_0007021 3300046678 Bacteria 6812
635 Ga0495599_0049995 3300046678 Bacteria 2620
636 Ga0495623_0002680 3300046679 Bacteria 11747
637 Ga0495623_0051722 3300046679 Bacteria 2597
638 Ga0495623_0185221 3300046679 Bacteria 1207
639 Ga0495646_0004172 3300046680 Bacteria 9080
640 Ga0495646_0158333 3300046680 Bacteria 1255
641 Ga0495647_0025675 3300046681 Bacteria 2154
642 Ga0495647_0061986 3300046681 Bacteria 1478
643 Ga0495658_0000103 3300046683 Bacteria 44678
644 Ga0495658_0074543 3300046683 Bacteria 1978
645 Ga0495658_0475061 3300046683 Bacteria 799
646 Ga0495613_0056400 3300046689 Bacteria 2885
647 Ga0495613_0074752 3300046689 Bacteria 2468
648 Ga0495624_0840461 3300046690 Unclassified 542
649 Ga0495600_0003648 3300046809 Bacteria 9081
650 Ga0495600_0007913 3300046809 Bacteria 6515
651 Ga0495581_0000028 3300047315 Bacteria 54176
652 Ga0495581_0013516 3300047315 Bacteria 4735
653 Ga0495581_0067575 3300047315 Bacteria 2067
654 Ga0495581_0378310 3300047315 Bacteria 826
655 Ga0495604_0013495 3300047317 Bacteria 6511
656 Ga0495604_0047676 3300047317 Bacteria 3336
657 Ga0495604_0117051 3300047317 Unclassified 1933
658 Ga0495674_0039970 3300047319 Unclassified 4199
659 Ga0495674_0044987 3300047319 Bacteria 3922
660 Ga0495674_0058877 3300047319 Bacteria 3357
661 Ga0495674_0107039 3300047319 Bacteria 2374
662 Ga0495676_0430467 3300047321 Bacteria 872
663 Ga0495680_0002561 3300047322 Bacteria 18546
664 Ga0495675_0012655 3300047444 Bacteria 5309
665 Ga0495675_0061496 3300047444 Bacteria 2378
666 Ga0495684_0011424 3300047471 Bacteria 6856
667 Ga0495684_0016010 3300047471 Bacteria 5773
668 Ga0495684_0017595 3300047471 Bacteria 5504
669 Ga0495684_0028624 3300047471 Bacteria 4277
670 Ga0495684_0228603 3300047471 Bacteria 1361
671 Ga0495593_0000015 3300047673 Bacteria 80492
672 Ga0495593_0523734 3300047673 Bacteria 594
673 Ga0495602_0032585 3300048088 Bacteria 4904
674 Ga0495602_0075958 3300048088 Bacteria 2849
675 Ga0495614_0000124 3300048089 Bacteria 26668
676 Ga0496104_0068584 3300048907 Bacteria 3370
677 Ga0496105_0119316 3300048908 Bacteria 2176
678 Ga0496112_0011720 3300048915 Bacteria 8024
679 Ga0496114_0000125 3300048917 Bacteria 55784
680 Ga0501298_155928 3300049521 Bacteria 561
681 Ga0501300_015103 3300049523 Bacteria 1128
682 Ga0501034_0015081 3300049571 Bacteria 7945
683 Ga0501034_0296936 3300049571 Bacteria 1553
684 Ga0501034_0345256 3300049571 Bacteria 1418
685 Ga0501036_0054264 3300049572 Unclassified 3394
686 Ga0501036_0374552 3300049572 Bacteria 1188
687 Ga0501037_0064183 3300049573 Bacteria 2677
688 Ga0501039_1125355 3300049575 Unclassified 608
689 Ga0501040_0348189 3300049576 Unclassified 1061
690 Ga0501041_0839944 3300049577 Unclassified 589
691 Ga0501042_0089868 3300049578 Unclassified 2204
692 Ga0501043_0041701 3300049579 Bacteria 3606
693 Ga0501043_0940268 3300049579 Bacteria 618
694 Ga0501043_1176294 3300049579 Bacteria 539
695 Ga0501047_0003106 3300049581 Bacteria 15757
696 Ga0501047_1413576 3300049581 Bacteria 511
697 Ga0501048_0028302 3300049582 Bacteria 4067
698 Ga0501048_0428099 3300049582 Bacteria 947
699 Ga0501068_0626969 3300049584 Bacteria 701
700 Ga0501069_0673057 3300049585 Bacteria 623
701 Ga0501069_0777891 3300049585 Unclassified 579
702 Ga0501070_0040950 3300049586 Bacteria 3860
703 Ga0501070_0160570 3300049586 Bacteria 1853
704 Ga0501071_0033643 3300049587 Bacteria 3642
705 Ga0501072_0167352 3300049588 Bacteria 1754
706 Ga0501072_0241677 3300049588 Unclassified 1438
707 Ga0501073_0251053 3300049589 Unclassified 1221
708 Ga0501074_0833255 3300049590 Unclassified 650
709 Ga0501075_0112134 3300049591 Bacteria 2074
710 Ga0501075_0356107 3300049591 Bacteria 1115
711 Ga0501076_0076159 3300049592 Unclassified 2690
712 Ga0501076_0768003 3300049592 Bacteria 795
713 Ga0501209_057398 3300049656 Bacteria 1078
714 Ga0501217_043290 3300049661 Bacteria 1153
715 Ga0501230_046491 3300049667 Unclassified 853
716 Ga0501221_032885 3300049704 Bacteria 1092
717 Ga0501225_0271004 3300049705 Unclassified 565
718 Ga0501234_014108 3300049707 Bacteria 1254
719 Ga0501080_1845607 3300049742 Bacteria 507
720 Ga0501081_0182528 3300049743 Bacteria 1518
721 Ga0501083_0795981 3300049744 Bacteria 615
722 Ga0501035_0315957 3300049822 Bacteria 1313
723 Ga0501044_0312638 3300049823 Bacteria 1497
724 Ga0501212_102910 3300049851 Bacteria 538
725 nmdc:mga05p37_552365_c1 3300050507 Bacteria 1311
726 nmdc:mga08y16_1155687_c1 3300050511 Unclassified 747
727 nmdc:mga0n895_1106925_c1 3300050512 Bacteria 769
728 nmdc:mga0n895_201466_c1 3300050512 Unclassified 2021
729 nmdc:mga0n895_255090_c1 3300050512 Bacteria 1780
730 nmdc:mga0n895_597512_c1 3300050512 Bacteria 1106
731 nmdc:mga0n895_68834_c1 3300050512 Bacteria 3507
732 nmdc:mga0rr50_1268743_c1 3300050513 Bacteria 625
733 nmdc:mga0rr50_342620_c1 3300050513 Bacteria 1256
734 nmdc:mga0rr50_454440_c1 3300050513 Bacteria 1086
735 nmdc:mga08x19_63539_c1 3300050514 Unclassified 2395
736 nmdc:mga08x19_653844_c1 3300050514 Bacteria 746
737 nmdc:mga08x19_65509_c1 3300050514 Bacteria 2360
738 nmdc:mga0a205_12240_c1 3300050515 Bacteria 7933
739 nmdc:mga0a205_150776_c1 3300050515 Bacteria 2224
740 nmdc:mga0a205_265599_c1 3300050515 Bacteria 1593
741 nmdc:mga0a205_546267_c1 3300050515 Bacteria 1014
742 Ga0495601_0016974 3300053077 Bacteria 4417
743 Ga0495612_0026608 3300053078 Bacteria 2325
744 Ga0495595_0006366 3300053084 Bacteria 4812
745 Ga0495619_0037686 3300053085 Bacteria 3152
746 Ga0495619_0356862 3300053085 Bacteria 1011
747 Ga0495619_0360486 3300053085 Bacteria 1005
748 Ga0501084_0261782 3300054114 Bacteria 1460
749 Ga0501084_0589291 3300054114 Bacteria 939
750 Ga0501082_0085206 3300060353 Bacteria 2726
751 Ga0501082_0294145 3300060353 Bacteria 1414
752 Ga0530510_0269281 3300061734 Unclassified 1271
753 Ga0530510_0417310 3300061734 Unclassified 1013
754 Ga0228598_1008753
755 JGI25406J46586_10006144
756 Ga0058863_11525647
757 Ga0065714_10288131
758 Ga0065715_10012615
759 Ga0065715_10616884
760 Ga0065707_10017763
761 Ga0070658_10141222
762 Ga0070676_10196594
763 Ga0070683_100009225
764 Ga0070683_100145070
765 Ga0070683_100164929
766 Ga0070683_100360769
767 Ga0070690_100004747
768 Ga0070690_100099916
769 Ga0070690_100251975
770 Ga0070690_100296510
771 Ga0070670_100153275
772 Ga0070670_100534152
773 Ga0070670_100737126
774 Ga0070677_10652821
775 Ga0068869_100824437
776 Ga0068869_102157683
777 Ga0070666_10054962
778 Ga0070666_10202626
779 Ga0070680_100017414
780 Ga0070680_100142219
781 Ga0070680_100312221
782 Ga0070682_100587397
783 Ga0068868_100042457
784 Ga0068868_100080081
785 Ga0068868_100401750
786 Ga0070660_100030411
787 Ga0070660_100064221
788 Ga0070689_100119207
789 Ga0070689_100157135
790 Ga0070689_100292834
791 Ga0070689_100377530
792 Ga0070687_100065546
793 Ga0070687_100082334
794 Ga0070687_100185597
795 Ga0070661_100009976
796 Ga0070692_10060409
797 Ga0070668_100094287
798 Ga0070669_100145231
799 Ga0070669_100165501
800 Ga0070675_100049307
801 Ga0070675_100074799
802 Ga0070675_101722677
803 Ga0070671_100039698
804 Ga0070671_100373920
805 Ga0070671_100472797
806 Ga0070674_101526720
807 Ga0070673_100605889
808 Ga0070673_101742435
809 Ga0070688_100021512
810 Ga0070688_100624776
811 Ga0070659_100027485
812 Ga0070659_101146795
813 Ga0070667_100049823
814 Ga0070667_100120903
815 Ga0070667_100182448
816 Ga0070709_10005729
817 Ga0070709_10019981
818 Ga0070709_10056615
819 Ga0070714_100001962
820 Ga0070714_100187190
821 Ga0070714_100250726
822 Ga0070714_100600141
823 Ga0070713_100000251
824 Ga0070713_100012085
825 Ga0070713_100031572
826 Ga0070713_100119661
827 Ga0070713_100850910
828 Ga0070710_10461560
829 Ga0070710_11128658
830 Ga0070711_100060304
831 Ga0070711_100662813
832 Ga0070705_100195713
833 Ga0070700_100047812
834 Ga0070694_100007377
835 Ga0070694_100105607
836 Ga0070694_100464709
837 Ga0070708_100000017
838 Ga0070663_100070636
839 Ga0070678_100181996
840 Ga0070662_100751756
841 Ga0070662_101067701
842 Ga0070681_10013489
843 Ga0070681_10080633
844 Ga0070681_10145736
845 Ga0070681_10189226
846 Ga0070681_10948999
847 Ga0068867_100227588
848 Ga0068867_100870625
849 Ga0070685_10001835
850 Ga0070685_10017160
851 Ga0070685_10020166
852 Ga0070706_100000576
853 Ga0070706_100922009
854 Ga0070707_100028134
855 Ga0070707_100136774
856 Ga0070698_100095823
857 Ga0070698_100101518
858 Ga0070698_100698459
859 Ga0070699_100071963
860 Ga0070699_100074949
861 Ga0070699_100368667
862 Ga0070699_101165329
863 Ga0070679_100011725
864 Ga0070679_100026764
865 Ga0070679_100029615
866 Ga0070679_100041109
867 Ga0070679_100049905
868 Ga0070679_100064336
869 Ga0070679_100186011
870 Ga0070679_101029231
871 Ga0070679_102196760
872 Ga0070684_100029533
873 Ga0070684_100074055
874 Ga0070684_100123533
875 Ga0070684_100540601
876 Ga0070684_100598469
877 Ga0070697_100236275
878 Ga0070697_100274261
879 Ga0070697_100474937
880 Ga0068853_100006135
881 Ga0068853_100391222
882 Ga0070672_100196438
883 Ga0070672_100466509
884 Ga0070672_100665101
885 Ga0070686_100010933
886 Ga0070686_100245156
887 Ga0070686_100459369
888 Ga0070695_100011134
889 Ga0070695_100120456
890 Ga0070695_101551912
891 Ga0070696_100005936
892 Ga0070696_100073689
893 Ga0070696_100094820
894 Ga0070693_100163840
895 Ga0070693_100435287
896 Ga0070693_101322303
897 Ga0070665_100236165
898 Ga0070665_100764437
899 Ga0070704_100231869
900 Ga0068855_100008417
901 Ga0068855_100151408
902 Ga0068855_100193217
903 Ga0068855_100260352
904 Ga0068855_100306354
905 Ga0068855_100556394
906 Ga0070664_100033328
907 Ga0070664_100361463
908 Ga0068857_100764324
909 Ga0068857_100804338
910 Ga0068856_100017312
911 Ga0068856_100042250
912 Ga0068856_100191418
913 Ga0068856_100306102
914 Ga0068856_101108365
915 Ga0070702_100045957
916 Ga0070702_100071609
917 Ga0070702_101066268
918 Ga0068852_100002511
919 Ga0068852_100203913
920 Ga0068852_100446207
921 Ga0068859_100090416
922 Ga0068859_100093052
923 Ga0068859_100296589
924 Ga0068859_101757310
925 Ga0068864_100391782
926 Ga0068864_100408406
927 Ga0068866_10502952
928 Ga0068866_10643458
929 Ga0068866_11213695
930 Ga0068861_100448708
931 Ga0068870_10067952
932 Ga0068863_100354335
933 Ga0068863_100383417
934 Ga0068863_100496588
935 Ga0068863_100877084
936 Ga0068858_100092173
937 Ga0068858_101145927
938 Ga0068858_101495568
939 Ga0068858_101620274
940 Ga0068860_100092047
941 Ga0068860_100378043
942 Ga0081455_10191959
943 Ga0081539_10000131
944 Ga0070717_10023153
945 Ga0070717_10026154
946 Ga0070717_10860903
947 Ga0070716_100062527
948 Ga0070716_100064005
949 Ga0070716_100075484
950 Ga0070716_100806456
951 Ga0070712_100068751
952 Ga0070712_100088922
953 Ga0070712_100199175
954 Ga0097621_100206874
955 Ga0097621_100377414
956 Ga0097621_100602032
957 Ga0097621_101277864
958 Ga0097621_101961713
959 Ga0097621_102315421
960 Ga0068871_100374525
961 Ga0075428_100834443
962 Ga0075433_10010242
963 Ga0075433_10530270
964 Ga0075433_10893342
965 Ga0075434_100008519
966 Ga0075434_100095955
967 Ga0075434_100156185
968 Ga0075434_100194233
969 Ga0075434_100903760
970 Ga0075434_101484784
971 Ga0075434_102030674
972 Ga0075429_100153685
973 Ga0068865_100014714
974 Ga0068865_100051757
975 Ga0068865_100167103
976 Ga0068865_100565195
977 Ga0068865_102008021
978 Ga0075436_100065590
979 Ga0075436_100111161
980 Ga0075436_100551051
981 Ga0075436_100669673
982 Ga0097620_100090418
983 Ga0097620_100093056
984 Ga0097620_100296565
985 Ga0097620_101757408
986 Ga0075435_100601269
987 Ga0105240_10078952
988 Ga0105240_10218104
989 Ga0111539_10021019
990 Ga0111539_10393731
991 Ga0111539_12362467
992 Ga0105245_10122193
993 Ga0105245_10342252
994 Ga0105245_10698122
995 Ga0105245_10754821
996 Ga0105247_10761725
997 Ga0114129_10033486
998 Ga0114129_10168905
999 Ga0114129_10547504
1000 Ga0114129_13067509
1001 Ga0105243_10034995
1002 Ga0105243_11240538
1003 Ga0105243_12611734
1004 Ga0105241_11084772
1005 Ga0105242_10046106
1006 Ga0105242_10197841
1007 Ga0105248_10005266
1008 Ga0105248_10680193
1009 Ga0105248_10883375
1010 Ga0105248_12906585
1011 Ga0105237_10175252
1012 Ga0105237_11442229
1013 Ga0105238_10000003
1014 Ga0105238_10044378
1015 Ga0105238_10053162
1016 Ga0105238_10072338
1017 Ga0105238_10405009
1018 Ga0105249_10403074
1019 Ga0105249_10476448
1020 Ga0105239_10092718
1021 Ga0105239_10545549
1022 Ga0105239_11217966
1023 Ga0105239_12923570
1024 Ga0105246_10270511
1025 Ga0105246_10336791
1026 Ga0157373_10101917
1027 Ga0157373_10235960
1028 Ga0157373_10507026
1029 Ga0157373_11020469
1030 Ga0157373_11467316
1031 Ga0157371_10207576
1032 Ga0157370_10006059
1033 Ga0157370_10034377
1034 Ga0157370_10136832
1035 Ga0157370_11026288
1036 Ga0157370_11461805
1037 Ga0157369_10004266
1038 Ga0157369_10008871
1039 Ga0157369_10214464
1040 Ga0157369_11065278
1041 Ga0157369_11256968
1042 Ga0157369_11757081
1043 Ga0157374_12355411
1044 Ga0157378_10027809
1045 Ga0163162_10199697
1046 Ga0163162_11096262
1047 Ga0163162_11876523
1048 Ga0163162_13477815
1049 Ga0157372_10002777
1050 Ga0157372_10003036
1051 Ga0157372_10011030
1052 Ga0157372_10016620
1053 Ga0157372_10034127
1054 Ga0157372_10119852
1055 Ga0157372_10137008
1056 Ga0157372_10140060
1057 Ga0157372_10295300
1058 Ga0157372_10887408
1059 Ga0157372_10894397
1060 Ga0157372_11858828
1061 Ga0157375_10072445
1062 Ga0157375_10439243
1063 Ga0157375_10589829
1064 Ga0157375_10662354
1065 Ga0163163_10003424
1066 Ga0163163_10003837
1067 Ga0163163_10553195
1068 Ga0163163_10564784
1069 Ga0157380_10091253
1070 Ga0157380_10646106
1071 Ga0157380_11997646
1072 Ga0157377_10138998
1073 Ga0157379_10532243
1074 Ga0157376_10479096
1075 Ga0157376_10550370
1076 Ga0157376_11028079
1077 Ga0182007_10308025
1078 Ga0182007_10311781
1079 Ga0163161_10212634
1080 Ga0163161_10886382
1081 Ga0197907_10706279
1082 Ga0206356_10700383
1083 Ga0213876_10000118
1084 Ga0207692_10259614
1085 Ga0207642_10647107
1086 Ga0207688_10135840
1087 Ga0207680_10207047
1088 Ga0207680_10427296
1089 Ga0207699_10006134
1090 Ga0207699_10014007
1091 Ga0207699_10019403
1092 Ga0207699_10031793
1093 Ga0207699_10333721
1094 Ga0207645_10037994
1095 Ga0207645_10084802
1096 Ga0207643_10072528
1097 Ga0207705_10001269
1098 Ga0207705_10123002
1099 Ga0207705_10214900
1100 Ga0207705_11064069
1101 Ga0207684_10000605
1102 Ga0207684_10036731
1103 Ga0207654_10598495
1104 Ga0207707_10055294
1105 Ga0207707_10117298
1106 Ga0207707_10142199
1107 Ga0207707_10253184
1108 Ga0207707_10400585
1109 Ga0207707_10443028
1110 Ga0207707_11430762
1111 Ga0207695_10005288
1112 Ga0207695_10316657
1113 Ga0207671_10281542
1114 Ga0207693_10001846
1115 Ga0207693_10009978
1116 Ga0207693_10114613
1117 Ga0207663_10000257
1118 Ga0207663_10104439
1119 Ga0207663_10112451
1120 Ga0207663_10861941
1121 Ga0207660_10004947
1122 Ga0207660_10039316
1123 Ga0207660_10068434
1124 Ga0207660_10306672
1125 Ga0207660_10359501
1126 Ga0207660_10539774
1127 Ga0207662_10105231
1128 Ga0207662_10313594
1129 Ga0207657_10000732
1130 Ga0207657_10023271
1131 Ga0207649_10021202
1132 Ga0207652_10017033
1133 Ga0207652_10018716
1134 Ga0207652_10037950
1135 Ga0207652_10118055
1136 Ga0207652_10155370
1137 Ga0207652_10272678
1138 Ga0207652_10594746
1139 Ga0207652_11561008
1140 Ga0207652_11580319
1141 Ga0207652_11669585
1142 Ga0207646_10045822
1143 Ga0207646_10074475
1144 Ga0207646_10213993
1145 Ga0207681_10125679
1146 Ga0207681_10384211
1147 Ga0207694_10000020
1148 Ga0207694_10079886
1149 Ga0207694_10214528
1150 Ga0207694_11090437
1151 Ga0207650_10893700
1152 Ga0207659_10722908
1153 Ga0207700_10008942
1154 Ga0207700_10012780
1155 Ga0207700_10028050
1156 Ga0207700_10158130
1157 Ga0207700_10888994
1158 Ga0207700_11182571
1159 Ga0207664_10007746
1160 Ga0207664_10125121
1161 Ga0207690_10755839
1162 Ga0207706_10949133
1163 Ga0207686_10095912
1164 Ga0207686_10154855
1165 Ga0207709_11242360
1166 Ga0207670_11201510
1167 Ga0207669_11619289
1168 Ga0207704_10038007
1169 Ga0207665_10073541
1170 Ga0207665_10122090
1171 Ga0207665_10246198
1172 Ga0207665_10942436
1173 Ga0207691_10074936
1174 Ga0207691_10131348
1175 Ga0207711_10492088
1176 Ga0207711_10549003
1177 Ga0207689_10786653
1178 Ga0207661_10002285
1179 Ga0207661_10030332
1180 Ga0207661_10044141
1181 Ga0207661_10206559
1182 Ga0207661_10336154
1183 Ga0207679_10196771
1184 Ga0207667_10015643
1185 Ga0207667_10092991
1186 Ga0207667_10103607
1187 Ga0207667_10156502
1188 Ga0207667_10211920
1189 Ga0207667_10950716
1190 Ga0207651_10574073
1191 Ga0207712_10252144
1192 Ga0207712_10740681
1193 Ga0207668_10411814
1194 Ga0207668_11911339
1195 Ga0207668_12064781
1196 Ga0207640_10044082
1197 Ga0207640_11892985
1198 Ga0207658_10044172
1199 Ga0207658_10159032
1200 Ga0207677_10728568
1201 Ga0207703_11286101
1202 Ga0207639_10051659
1203 Ga0207639_11254516
1204 Ga0207639_11731087
1205 Ga0207678_10099094
1206 Ga0207708_10400237
1207 Ga0207702_10006559
1208 Ga0207702_10100111
1209 Ga0207702_10148650
1210 Ga0207702_10273653
1211 Ga0207702_10579412
1212 Ga0207648_10134549
1213 Ga0207648_10955760
1214 Ga0207648_11271873
1215 Ga0207674_10217594
1216 Ga0207674_10751396
1217 Ga0207675_100076244
1218 Ga0207675_100429443
1219 Ga0207675_101646815
1220 Ga0207683_11208344
1221 Ga0207698_10009848
1222 Ga0268266_10766653
1223 Ga0268264_11252694
1224 Ga0268264_11697116
1225 Ga0307408_102140303
1226 Ga0307405_10072667
1227 Ga0307413_10058707
1228 Ga0307413_10693775
1229 Ga0307413_11087954
1230 Ga0307410_10303808
1231 Ga0307410_10437453
1232 Ga0307406_10187134
1233 Ga0307406_10196698
1234 Ga0307406_10205807
1235 Ga0307406_11018915
1236 Ga0307407_10057350
1237 Ga0307407_10323031
1238 Ga0307407_10346099
1239 Ga0307412_10128176
1240 Ga0307412_10185875
1241 Ga0307409_100161561
1242 Ga0307409_100162386
1243 Ga0307409_100176950
1244 Ga0307409_100449133
1245 Ga0307409_100933640
1246 Ga0307409_101781864
1247 Ga0307416_100085238
1248 Ga0307416_100227290
1249 Ga0307416_101038871
1250 Ga0307414_10337475
1251 Ga0307411_10169036
1252 Ga0307411_10227589
1253 Ga0307411_10713503
1254 Ga0307415_100005778
1255 Ga0307415_100421281
1256 Ga0307415_100485912
1257 Ga0307415_100496112
1258 Ga0373930_0059071
1259 Ga0373959_0000233
1260 Ga0373959_0024577
1261 Ga0373926_0027723
1262 Ga0373934_0001604
1263 Ga0373934_0003884
1264 Ga0373940_0161008
1265 Ga0373944_0053970
1266 Ga0373949_0022772
1267 Ga0373923_0030106
1268 Ga0373923_0032194
1269 Ga0373932_0076672
1270 Ga0373936_0450239
1271 Ga0373939_0016007
1272 Ga0373941_0002876
1273 Ga0373953_0128495
1274 Ga0373954_0014743
1275 Ga0373956_0016027
1276 Ga0373956_0065807
1277 Ga0373957_0091663
1278 Ga0373960_0032253
1279 Ga0373943_0001746
1280 Ga0373943_0471652
1281 Ga0373943_0705187
1282 Ga0373946_0001768
1283 Ga0373955_0002495
1284 Ga0373955_0031200
1285 Ga0373961_0005228
1286 Ga0373924_0005492
1287 Ga0373935_0000240
1288 Ga0373935_0294790
1289 Ga0373927_0004551
1290 Ga0373927_0008018
1291 Ga0373933_0013632
1292 Ga0373933_0053363
1293 Ga0373947_0000395
1294 Ga0373947_0016145
1295 Ga0373937_0019091
1296 Ga0373937_0046947
1297 Ga0373937_0096037
1298 Ga0373925_0001604
1299 Ga0373925_0016538
1300 Ga0395899_0013130
1301 Ga0395898_0225397
1302 Ga0395905_0124153
1303 Ga0436364_0024804
1304 Ga0395901_0001536
1305 Ga0436365_1431913
1306 Ga0436365_1850755
1307 Ga0436363_1312389
1308 Ga0436362_0733517
1309 Ga0439439_0083483
1310 Ga0439439_0256189
1311 Ga0439431_0058217
1312 Ga0439433_0195281
1313 Ga0439457_166791
1314 Ga0439446_0121812
1315 Ga0453683_1106632
1316 Ga0453683_1183941
1317 Ga0466965_0832941
1318 Ga0466961_0197833
1319 Ga0466963_0131501
1320 Ga0466963_0308458
1321 Ga0466964_0175367
1322 Ga0466964_0237151
1323 Ga0466957_0269277
1324 Ga0466959_0005852
1325 Ga0466967_0025549
1326 Ga0466967_0600450
1327 Ga0495592_0048100
1328 Ga0495592_0340677
1329 Ga0495603_0045140
1330 Ga0495629_0027631
1331 Ga0495629_0028230
1332 Ga0495629_0549029
1333 Ga0495651_0011749
1334 Ga0495651_0064649
1335 Ga0495653_0035536
1336 Ga0495580_0000036
1337 Ga0495580_0120281
1338 Ga0495580_0235864
1339 Ga0495582_0000381
1340 Ga0495582_0029917
1341 Ga0495582_0051555
1342 Ga0495582_0191875
1343 Ga0495639_0000028
1344 Ga0495639_0033625
1345 Ga0495639_0328157
1346 Ga0495664_0002894
1347 Ga0495594_0012775
1348 Ga0495594_0059833
1349 Ga0495594_0420135
1350 Ga0495596_0102036
1351 Ga0495628_0040491
1352 Ga0495628_0105295
1353 Ga0495628_0121687
1354 Ga0495630_0000452
1355 Ga0495630_0050172
1356 Ga0495630_0332404
1357 Ga0495630_0430058
1358 Ga0495630_0819786
1359 Ga0495666_0062119
1360 Ga0495652_0003132
1361 Ga0495652_0095357
1362 Ga0495665_0000019
1363 Ga0495665_0009670
1364 Ga0495640_0276822
1365 Ga0495586_0006643
1366 Ga0495586_0129530
1367 Ga0495586_0179913
1368 Ga0495586_0273713
1369 Ga0495587_0001827
1370 Ga0495587_0002385
1371 Ga0495587_0003538
1372 Ga0495645_0000651
1373 Ga0495645_0010848
1374 Ga0495645_0067415
1375 Ga0495622_0077655
1376 Ga0495622_0127456
1377 Ga0495667_0012340
1378 Ga0495667_0013916
1379 Ga0495667_0016668
1380 Ga0495635_0001636
1381 Ga0495588_0000197
1382 Ga0495588_0014924
1383 Ga0495588_0303937
1384 Ga0495657_0002639
1385 Ga0495657_0049820
1386 Ga0495599_0000866
1387 Ga0495599_0007021
1388 Ga0495599_0049995
1389 Ga0495623_0002680
1390 Ga0495623_0051722
1391 Ga0495623_0185221
1392 Ga0495646_0004172
1393 Ga0495646_0158333
1394 Ga0495647_0025675
1395 Ga0495647_0061986
1396 Ga0495658_0000103
1397 Ga0495658_0074543
1398 Ga0495658_0475061
1399 Ga0495613_0056400
1400 Ga0495613_0074752
1401 Ga0495624_0840461
1402 Ga0495600_0003648
1403 Ga0495600_0007913
1404 Ga0495581_0000028
1405 Ga0495581_0013516
1406 Ga0495581_0067575
1407 Ga0495581_0378310
1408 Ga0495604_0013495
1409 Ga0495604_0047676
1410 Ga0495604_0117051
1411 Ga0495674_0039970
1412 Ga0495674_0044987
1413 Ga0495674_0058877
1414 Ga0495674_0107039
1415 Ga0495676_0430467
1416 Ga0495680_0002561
1417 Ga0495675_0012655
1418 Ga0495675_0061496
1419 Ga0495684_0011424
1420 Ga0495684_0016010
1421 Ga0495684_0017595
1422 Ga0495684_0028624
1423 Ga0495684_0228603
1424 Ga0495593_0000015
1425 Ga0495593_0523734
1426 Ga0495602_0032585
1427 Ga0495602_0075958
1428 Ga0495614_0000124
1429 Ga0496104_0068584
1430 Ga0496105_0119316
1431 Ga0496112_0011720
1432 Ga0496114_0000125
1433 Ga0501298_155928
1434 Ga0501300_015103
1435 Ga0501034_0015081
1436 Ga0501034_0296936
1437 Ga0501034_0345256
1438 Ga0501036_0054264
1439 Ga0501036_0374552
1440 Ga0501037_0064183
1441 Ga0501039_1125355
1442 Ga0501040_0348189
1443 Ga0501041_0839944
1444 Ga0501042_0089868
1445 Ga0501043_0041701
1446 Ga0501043_0940268
1447 Ga0501043_1176294
1448 Ga0501047_0003106
1449 Ga0501047_1413576
1450 Ga0501048_0028302
1451 Ga0501048_0428099
1452 Ga0501068_0626969
1453 Ga0501069_0673057
1454 Ga0501069_0777891
1455 Ga0501070_0040950
1456 Ga0501070_0160570
1457 Ga0501071_0033643
1458 Ga0501072_0167352
1459 Ga0501072_0241677
1460 Ga0501073_0251053
1461 Ga0501074_0833255
1462 Ga0501075_0112134
1463 Ga0501075_0356107
1464 Ga0501076_0076159
1465 Ga0501076_0768003
1466 Ga0501209_057398
1467 Ga0501217_043290
1468 Ga0501230_046491
1469 Ga0501221_032885
1470 Ga0501225_0271004
1471 Ga0501234_014108
1472 Ga0501080_1845607
1473 Ga0501081_0182528
1474 Ga0501083_0795981
1475 Ga0501035_0315957
1476 Ga0501044_0312638
1477 Ga0501212_102910
1478 nmdc:mga05p37_552365_c1
1479 nmdc:mga08y16_1155687_c1
1480 nmdc:mga0n895_1106925_c1
1481 nmdc:mga0n895_201466_c1
1482 nmdc:mga0n895_255090_c1
1483 nmdc:mga0n895_597512_c1
1484 nmdc:mga0n895_68834_c1
1485 nmdc:mga0rr50_1268743_c1
1486 nmdc:mga0rr50_342620_c1
1487 nmdc:mga0rr50_454440_c1
1488 nmdc:mga08x19_63539_c1
1489 nmdc:mga08x19_653844_c1
1490 nmdc:mga08x19_65509_c1
1491 nmdc:mga0a205_12240_c1
1492 nmdc:mga0a205_150776_c1
1493 nmdc:mga0a205_265599_c1
1494 nmdc:mga0a205_546267_c1
1495 Ga0495601_0016974
1496 Ga0495612_0026608
1497 Ga0495595_0006366
1498 Ga0495619_0037686
1499 Ga0495619_0356862
1500 Ga0495619_0360486
1501 Ga0501084_0261782
1502 Ga0501084_0589291
1503 Ga0501082_0085206
1504 Ga0501082_0294145
1505 Ga0530510_0269281
1506 Ga0530510_0417310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

53

120

0.93

PF07883

Cupin_2

Cupin domain

46

114

0.91

PF00190

Cupin_1

Cupin

20

114

0.89

PF06249

EutQ

Ethanolamine utilisation protein EutQ

4

122

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9344 6 115
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.929 25 109
4e2g-assembly3.cif.gz_E crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9271 4 115
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9243 5 114
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9237 25 110
ID Description Score Start End Superfamily
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9266 5 113 2.60.120.10
af_Q9W0M3_161_400_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9199 33 106 2.60.120.650
af_Q17765_350_577_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9193 33 106 2.60.120.650
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9131 37 109 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9097 5 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A838T0J1-F1-model_v4 Cupin domain-containing protein 1.003 4 123
AF-A0A7Y2GZV9-F1-model_v4 Cupin domain-containing protein 1.001 6 122
AF-A0A2A4VYL0-F1-model_v4 Cupin 1.001 14 123
AF-A0A2V7EW52-F1-model_v4 Cupin domain-containing protein 0.9992 3 123
AF-A0A2V7R241-F1-model_v4 Cupin domain-containing protein 0.9982 2 123

Map