F479176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 752 | 268 | 750 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0395773|Ga0495628_0395773_416_979 |
| Length | 187 |
| Sequence | MLQFLELVFATNRHGRTLAAAPAMVSASPPMSEPSLDRPRKFLVVVDKTPECRVAVRFAARRAQHTGGRVTLLCIAQPADFQQWRGVEEIMKDEAHQEAEALVYAAAKTVNELAGIIPELVIAQGRPAEALLELVKSDKDISILVLASGIAKEGPGPLVSLFAGGVQAIPVTIVPGNLSEAKIDQLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 2 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 260 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 262 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 263 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 264 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.53 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 93.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10027885 | 3300001989 | Bacteria | 1971 |
| 2 | JGI25151J46595_10000284 | 3300003187 | Bacteria | 57330 |
| 3 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 4 | JGI25153J46596_10000792 | 3300003215 | Bacteria | 19361 |
| 5 | JGI25153J46596_10034448 | 3300003215 | Bacteria | 1655 |
| 6 | rootH1_10046059 | 3300003316 | Bacteria | 2008 |
| 7 | JGI25160J50197_1007421 | 3300003354 | Bacteria | 4290 |
| 8 | Ga0070658_10006016 | 3300005327 | Bacteria | 9843 |
| 9 | Ga0070658_10180640 | 3300005327 | Bacteria | 1775 |
| 10 | Ga0070676_10024121 | 3300005328 | Bacteria | 3423 |
| 11 | Ga0070676_10205036 | 3300005328 | Bacteria | 1295 |
| 12 | Ga0070690_100119451 | 3300005330 | Bacteria | 1768 |
| 13 | Ga0070670_101205585 | 3300005331 | Bacteria | 692 |
| 14 | Ga0068869_100046402 | 3300005334 | Bacteria | 3133 |
| 15 | Ga0070666_10000633 | 3300005335 | Bacteria | 21182 |
| 16 | Ga0070666_10074236 | 3300005335 | Bacteria | 2318 |
| 17 | Ga0070666_10076220 | 3300005335 | Bacteria | 2287 |
| 18 | Ga0070680_100105641 | 3300005336 | Bacteria | 2341 |
| 19 | Ga0070682_100436656 | 3300005337 | Bacteria | 999 |
| 20 | Ga0068868_100069238 | 3300005338 | Bacteria | 2812 |
| 21 | Ga0068868_100081729 | 3300005338 | Bacteria | 2591 |
| 22 | Ga0068868_100153342 | 3300005338 | Bacteria | 1899 |
| 23 | Ga0068868_100440182 | 3300005338 | Bacteria | 1132 |
| 24 | Ga0070660_100032812 | 3300005339 | Bacteria | 3911 |
| 25 | Ga0070691_10168035 | 3300005341 | Bacteria | 1135 |
| 26 | Ga0070661_100059484 | 3300005344 | Bacteria | 2802 |
| 27 | Ga0070661_100335168 | 3300005344 | Bacteria | 1184 |
| 28 | Ga0070661_100534413 | 3300005344 | Unclassified | 942 |
| 29 | Ga0070675_100219111 | 3300005354 | Bacteria | 1657 |
| 30 | Ga0070671_100818029 | 3300005355 | Bacteria | 812 |
| 31 | Ga0070671_101283766 | 3300005355 | Bacteria | 645 |
| 32 | Ga0070659_100390384 | 3300005366 | Bacteria | 1174 |
| 33 | Ga0070659_100732282 | 3300005366 | Unclassified | 857 |
| 34 | Ga0070667_100110770 | 3300005367 | Bacteria | 2380 |
| 35 | Ga0070667_100325874 | 3300005367 | Bacteria | 1387 |
| 36 | Ga0070667_100552273 | 3300005367 | Bacteria | 1059 |
| 37 | Ga0070667_100829758 | 3300005367 | Bacteria | 859 |
| 38 | Ga0070703_10043000 | 3300005406 | Bacteria | 1415 |
| 39 | Ga0070709_10001252 | 3300005434 | Bacteria | 13895 |
| 40 | Ga0070709_10557283 | 3300005434 | Unclassified | 878 |
| 41 | Ga0070713_100000199 | 3300005436 | Bacteria | 40083 |
| 42 | Ga0070710_10189643 | 3300005437 | Bacteria | 1292 |
| 43 | Ga0070710_10256962 | 3300005437 | Bacteria | 1125 |
| 44 | Ga0070701_10368553 | 3300005438 | Unclassified | 902 |
| 45 | Ga0070711_100005086 | 3300005439 | Bacteria | 7829 |
| 46 | Ga0070711_100174461 | 3300005439 | Bacteria | 1641 |
| 47 | Ga0070711_100188534 | 3300005439 | Bacteria | 1583 |
| 48 | Ga0070711_100812536 | 3300005439 | Bacteria | 794 |
| 49 | Ga0070705_100031377 | 3300005440 | Bacteria | 2942 |
| 50 | Ga0070705_101241632 | 3300005440 | Unclassified | 615 |
| 51 | Ga0070678_100026666 | 3300005456 | Bacteria | 3911 |
| 52 | Ga0070678_100028400 | 3300005456 | Bacteria | 3814 |
| 53 | Ga0070678_100070242 | 3300005456 | Bacteria | 2617 |
| 54 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 55 | Ga0070681_10057249 | 3300005458 | Bacteria | 3878 |
| 56 | Ga0070681_10059268 | 3300005458 | Bacteria | 3808 |
| 57 | Ga0070681_10217568 | 3300005458 | Bacteria | 1826 |
| 58 | Ga0070681_10420405 | 3300005458 | Bacteria | 1249 |
| 59 | Ga0070681_10728190 | 3300005458 | Unclassified | 908 |
| 60 | Ga0068867_100013842 | 3300005459 | Bacteria | 5710 |
| 61 | Ga0068867_100256306 | 3300005459 | Bacteria | 1424 |
| 62 | Ga0070679_100036051 | 3300005530 | Bacteria | 4908 |
| 63 | Ga0070679_100333344 | 3300005530 | Bacteria | 1466 |
| 64 | Ga0070679_101933889 | 3300005530 | Bacteria | 539 |
| 65 | Ga0070684_100210563 | 3300005535 | Bacteria | 1772 |
| 66 | Ga0070684_100271498 | 3300005535 | Bacteria | 1552 |
| 67 | Ga0068853_100004853 | 3300005539 | Bacteria | 10451 |
| 68 | Ga0068853_100018884 | 3300005539 | Bacteria | 5710 |
| 69 | Ga0068853_100086583 | 3300005539 | Bacteria | 2748 |
| 70 | Ga0068853_100511707 | 3300005539 | Bacteria | 1134 |
| 71 | Ga0068853_100990536 | 3300005539 | Unclassified | 809 |
| 72 | Ga0068853_101090277 | 3300005539 | Bacteria | 770 |
| 73 | Ga0070695_100239615 | 3300005545 | Bacteria | 1315 |
| 74 | Ga0070696_100028958 | 3300005546 | Bacteria | 3781 |
| 75 | Ga0070696_100325619 | 3300005546 | Bacteria | 1184 |
| 76 | Ga0070693_100081443 | 3300005547 | Bacteria | 1930 |
| 77 | Ga0070693_100279638 | 3300005547 | Unclassified | 1117 |
| 78 | Ga0070665_100000728 | 3300005548 | Bacteria | 43882 |
| 79 | Ga0070665_100037182 | 3300005548 | Bacteria | 4897 |
| 80 | Ga0070665_100132277 | 3300005548 | Bacteria | 2497 |
| 81 | Ga0070665_100142381 | 3300005548 | Bacteria | 2401 |
| 82 | Ga0070665_100275066 | 3300005548 | Bacteria | 1686 |
| 83 | Ga0068855_100239980 | 3300005563 | Bacteria | 2026 |
| 84 | Ga0068855_100246552 | 3300005563 | Bacteria | 1994 |
| 85 | Ga0068855_100284299 | 3300005563 | Bacteria | 1836 |
| 86 | Ga0068855_100374770 | 3300005563 | Bacteria | 1564 |
| 87 | Ga0068855_100462369 | 3300005563 | Bacteria | 1383 |
| 88 | Ga0068855_101076563 | 3300005563 | Bacteria | 841 |
| 89 | Ga0070664_100206050 | 3300005564 | Bacteria | 1756 |
| 90 | Ga0068857_100001360 | 3300005577 | Bacteria | 19260 |
| 91 | Ga0068857_100178550 | 3300005577 | Bacteria | 1932 |
| 92 | Ga0068857_100282195 | 3300005577 | Bacteria | 1528 |
| 93 | Ga0068857_100842992 | 3300005577 | Bacteria | 877 |
| 94 | Ga0068857_101956901 | 3300005577 | Archaea | 575 |
| 95 | Ga0068854_100648616 | 3300005578 | Bacteria | 906 |
| 96 | Ga0068856_100009449 | 3300005614 | Bacteria | 9469 |
| 97 | Ga0068856_100371925 | 3300005614 | Bacteria | 1448 |
| 98 | Ga0068856_100566969 | 3300005614 | Bacteria | 1157 |
| 99 | Ga0068856_100927282 | 3300005614 | Unclassified | 890 |
| 100 | Ga0068852_100015237 | 3300005616 | Bacteria | 5953 |
| 101 | Ga0068852_100062213 | 3300005616 | Bacteria | 3246 |
| 102 | Ga0068852_100137985 | 3300005616 | Bacteria | 2253 |
| 103 | Ga0068859_100452005 | 3300005617 | Bacteria | 1381 |
| 104 | Ga0068859_102270714 | 3300005617 | Bacteria | 598 |
| 105 | Ga0068864_100076648 | 3300005618 | Bacteria | 2923 |
| 106 | Ga0068864_101421893 | 3300005618 | Unclassified | 696 |
| 107 | Ga0068866_10193593 | 3300005718 | Bacteria | 1210 |
| 108 | Ga0068870_10062015 | 3300005840 | Bacteria | 2012 |
| 109 | Ga0068863_100534874 | 3300005841 | Bacteria | 1156 |
| 110 | Ga0068858_100020784 | 3300005842 | Bacteria | 6134 |
| 111 | Ga0068858_100030997 | 3300005842 | Bacteria | 4966 |
| 112 | Ga0068858_100183267 | 3300005842 | Bacteria | 1977 |
| 113 | Ga0068858_100409572 | 3300005842 | Bacteria | 1303 |
| 114 | Ga0068858_100733696 | 3300005842 | Bacteria | 962 |
| 115 | Ga0068860_100594391 | 3300005843 | Bacteria | 1112 |
| 116 | Ga0068862_100610709 | 3300005844 | Bacteria | 1048 |
| 117 | Ga0081540_1040679 | 3300005983 | Bacteria | 2420 |
| 118 | Ga0070717_10764934 | 3300006028 | Bacteria | 878 |
| 119 | Ga0070716_100595151 | 3300006173 | Bacteria | 831 |
| 120 | Ga0070712_100000443 | 3300006175 | Bacteria | 23682 |
| 121 | Ga0070712_100133084 | 3300006175 | Bacteria | 1887 |
| 122 | Ga0070712_100269239 | 3300006175 | Bacteria | 1368 |
| 123 | Ga0070712_100660458 | 3300006175 | Bacteria | 889 |
| 124 | Ga0070712_100820723 | 3300006175 | Bacteria | 799 |
| 125 | Ga0097621_100001436 | 3300006237 | Bacteria | 16342 |
| 126 | Ga0097621_100173701 | 3300006237 | Bacteria | 1859 |
| 127 | Ga0097621_100197113 | 3300006237 | Bacteria | 1746 |
| 128 | Ga0097621_100221124 | 3300006237 | Bacteria | 1650 |
| 129 | Ga0097621_100278623 | 3300006237 | Bacteria | 1471 |
| 130 | Ga0097621_100335531 | 3300006237 | Bacteria | 1341 |
| 131 | Ga0097621_100478245 | 3300006237 | Bacteria | 1126 |
| 132 | Ga0097621_100505636 | 3300006237 | Bacteria | 1095 |
| 133 | Ga0097621_101331889 | 3300006237 | Bacteria | 679 |
| 134 | Ga0068871_100000329 | 3300006358 | Bacteria | 33127 |
| 135 | Ga0068871_100007093 | 3300006358 | Bacteria | 7987 |
| 136 | Ga0068871_100072694 | 3300006358 | Bacteria | 2833 |
| 137 | Ga0068871_100113304 | 3300006358 | Bacteria | 2284 |
| 138 | Ga0068871_100170069 | 3300006358 | Bacteria | 1867 |
| 139 | Ga0068871_100207079 | 3300006358 | Bacteria | 1695 |
| 140 | Ga0068871_100338703 | 3300006358 | Bacteria | 1328 |
| 141 | Ga0068871_100495401 | 3300006358 | Bacteria | 1101 |
| 142 | Ga0068871_101860809 | 3300006358 | Unclassified | 572 |
| 143 | Ga0075428_100225931 | 3300006844 | Bacteria | 2021 |
| 144 | Ga0075430_100536976 | 3300006846 | Bacteria | 965 |
| 145 | Ga0068865_100085499 | 3300006881 | Bacteria | 2275 |
| 146 | Ga0075436_100001475 | 3300006914 | Bacteria | 16015 |
| 147 | Ga0075436_100320300 | 3300006914 | Bacteria | 1114 |
| 148 | Ga0097620_100452012 | 3300006931 | Bacteria | 1381 |
| 149 | Ga0097620_102271705 | 3300006931 | Bacteria | 598 |
| 150 | Ga0105240_10002870 | 3300009093 | Bacteria | 27247 |
| 151 | Ga0105240_10021543 | 3300009093 | Bacteria | 8571 |
| 152 | Ga0105240_10031565 | 3300009093 | Bacteria | 6868 |
| 153 | Ga0105240_10044045 | 3300009093 | Bacteria | 5674 |
| 154 | Ga0105240_10230648 | 3300009093 | Bacteria | 2152 |
| 155 | Ga0105240_10260545 | 3300009093 | Bacteria | 2000 |
| 156 | Ga0105240_10367260 | 3300009093 | Bacteria | 1628 |
| 157 | Ga0105240_10470357 | 3300009093 | Bacteria | 1403 |
| 158 | Ga0105240_10513319 | 3300009093 | Unclassified | 1331 |
| 159 | Ga0105240_10594310 | 3300009093 | Bacteria | 1219 |
| 160 | Ga0105240_10732460 | 3300009093 | Bacteria | 1076 |
| 161 | Ga0105240_10887870 | 3300009093 | Bacteria | 960 |
| 162 | Ga0105240_11127749 | 3300009093 | Unclassified | 833 |
| 163 | Ga0105240_12110191 | 3300009093 | Bacteria | 585 |
| 164 | Ga0105245_10022596 | 3300009098 | Bacteria | 5522 |
| 165 | Ga0105245_10080647 | 3300009098 | Bacteria | 2973 |
| 166 | Ga0105245_10365033 | 3300009098 | Bacteria | 1434 |
| 167 | Ga0105245_10485349 | 3300009098 | Bacteria | 1250 |
| 168 | Ga0105245_11204084 | 3300009098 | Bacteria | 805 |
| 169 | Ga0105247_10004766 | 3300009101 | Bacteria | 8636 |
| 170 | Ga0105247_10147938 | 3300009101 | Bacteria | 1545 |
| 171 | Ga0105247_10420663 | 3300009101 | Bacteria | 956 |
| 172 | Ga0105247_10512964 | 3300009101 | Bacteria | 875 |
| 173 | Ga0105243_10529716 | 3300009148 | Bacteria | 1122 |
| 174 | Ga0105241_10021669 | 3300009174 | Bacteria | 4754 |
| 175 | Ga0105241_10029757 | 3300009174 | Bacteria | 4077 |
| 176 | Ga0105241_10114803 | 3300009174 | Bacteria | 2161 |
| 177 | Ga0105241_10191554 | 3300009174 | Bacteria | 1703 |
| 178 | Ga0105241_10324623 | 3300009174 | Bacteria | 1328 |
| 179 | Ga0105241_10446664 | 3300009174 | Bacteria | 1143 |
| 180 | Ga0105241_10822493 | 3300009174 | Unclassified | 857 |
| 181 | Ga0105241_11213678 | 3300009174 | Bacteria | 715 |
| 182 | Ga0105242_10020635 | 3300009176 | Bacteria | 5169 |
| 183 | Ga0105242_10020889 | 3300009176 | Bacteria | 5136 |
| 184 | Ga0105242_10025118 | 3300009176 | Bacteria | 4710 |
| 185 | Ga0105242_10360506 | 3300009176 | Bacteria | 1345 |
| 186 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 187 | Ga0105248_10047648 | 3300009177 | Bacteria | 4807 |
| 188 | Ga0105248_10327564 | 3300009177 | Bacteria | 1725 |
| 189 | Ga0105248_11113184 | 3300009177 | Bacteria | 893 |
| 190 | Ga0105248_11235995 | 3300009177 | Bacteria | 845 |
| 191 | Ga0105237_10012476 | 3300009545 | Bacteria | 8955 |
| 192 | Ga0105237_10239817 | 3300009545 | Bacteria | 1814 |
| 193 | Ga0105237_10251273 | 3300009545 | Bacteria | 1770 |
| 194 | Ga0105237_10706865 | 3300009545 | Unclassified | 1014 |
| 195 | Ga0105237_11157783 | 3300009545 | Unclassified | 780 |
| 196 | Ga0105237_11349646 | 3300009545 | Unclassified | 719 |
| 197 | Ga0105237_11826496 | 3300009545 | Unclassified | 615 |
| 198 | Ga0105238_10001095 | 3300009551 | Bacteria | 27380 |
| 199 | Ga0105238_10145968 | 3300009551 | Bacteria | 2342 |
| 200 | Ga0105238_10206601 | 3300009551 | Bacteria | 1940 |
| 201 | Ga0105238_10439940 | 3300009551 | Bacteria | 1300 |
| 202 | Ga0105238_10598235 | 3300009551 | Bacteria | 1110 |
| 203 | Ga0105238_10848330 | 3300009551 | Bacteria | 931 |
| 204 | Ga0105249_10524233 | 3300009553 | Bacteria | 1233 |
| 205 | Ga0105249_10761222 | 3300009553 | Bacteria | 1031 |
| 206 | Ga0105249_10816926 | 3300009553 | Bacteria | 997 |
| 207 | Ga0105249_13052870 | 3300009553 | Bacteria | 538 |
| 208 | Ga0099796_10050240 | 3300010159 | Bacteria | 1445 |
| 209 | Ga0105239_10004846 | 3300010375 | Bacteria | 15921 |
| 210 | Ga0105239_10229125 | 3300010375 | Bacteria | 2085 |
| 211 | Ga0105239_10329588 | 3300010375 | Bacteria | 1722 |
| 212 | Ga0105239_10399659 | 3300010375 | Bacteria | 1555 |
| 213 | Ga0105239_10404578 | 3300010375 | Bacteria | 1545 |
| 214 | Ga0105239_11105273 | 3300010375 | Bacteria | 913 |
| 215 | Ga0105239_12164550 | 3300010375 | Bacteria | 647 |
| 216 | Ga0105246_10039033 | 3300011119 | Bacteria | 3196 |
| 217 | Ga0105246_10103733 | 3300011119 | Bacteria | 2075 |
| 218 | Ga0105246_10259839 | 3300011119 | Bacteria | 1383 |
| 219 | Ga0105246_10617745 | 3300011119 | Unclassified | 939 |
| 220 | Ga0157370_10034135 | 3300013104 | Bacteria | 4957 |
| 221 | Ga0157369_10001844 | 3300013105 | Bacteria | 25612 |
| 222 | Ga0157369_10176423 | 3300013105 | Bacteria | 2249 |
| 223 | Ga0157369_10613293 | 3300013105 | Bacteria | 1123 |
| 224 | Ga0157369_11163159 | 3300013105 | Unclassified | 788 |
| 225 | Ga0157374_10103819 | 3300013296 | Bacteria | 2728 |
| 226 | Ga0157374_10245877 | 3300013296 | Bacteria | 1760 |
| 227 | Ga0157374_10249080 | 3300013296 | Bacteria | 1748 |
| 228 | Ga0157374_11412075 | 3300013296 | Unclassified | 719 |
| 229 | Ga0157378_10046152 | 3300013297 | Bacteria | 3873 |
| 230 | Ga0157378_10082441 | 3300013297 | Bacteria | 2908 |
| 231 | Ga0157378_10109188 | 3300013297 | Bacteria | 2534 |
| 232 | Ga0157378_10191010 | 3300013297 | Bacteria | 1931 |
| 233 | Ga0157378_10472339 | 3300013297 | Bacteria | 1248 |
| 234 | Ga0157378_10577928 | 3300013297 | Bacteria | 1132 |
| 235 | Ga0163162_10125826 | 3300013306 | Bacteria | 2669 |
| 236 | Ga0163162_12676455 | 3300013306 | Bacteria | 574 |
| 237 | Ga0157372_10191098 | 3300013307 | Bacteria | 2372 |
| 238 | Ga0157372_10254495 | 3300013307 | Bacteria | 2039 |
| 239 | Ga0157372_10377024 | 3300013307 | Bacteria | 1653 |
| 240 | Ga0157372_10531560 | 3300013307 | Bacteria | 1371 |
| 241 | Ga0157372_11201504 | 3300013307 | Unclassified | 876 |
| 242 | Ga0157372_11206619 | 3300013307 | Unclassified | 874 |
| 243 | Ga0157375_10168950 | 3300013308 | Bacteria | 2334 |
| 244 | Ga0157375_10882518 | 3300013308 | Bacteria | 1039 |
| 245 | Ga0163163_10495015 | 3300014325 | Bacteria | 1284 |
| 246 | Ga0163163_11460583 | 3300014325 | Bacteria | 745 |
| 247 | Ga0182008_10425385 | 3300014497 | Bacteria | 718 |
| 248 | Ga0157379_10002841 | 3300014968 | Bacteria | 14599 |
| 249 | Ga0157379_10002945 | 3300014968 | Bacteria | 14364 |
| 250 | Ga0157379_10014719 | 3300014968 | Bacteria | 6862 |
| 251 | Ga0157379_10015566 | 3300014968 | Bacteria | 6677 |
| 252 | Ga0157379_10106425 | 3300014968 | Bacteria | 2518 |
| 253 | Ga0157379_10212106 | 3300014968 | Bacteria | 1753 |
| 254 | Ga0157379_10234922 | 3300014968 | Bacteria | 1662 |
| 255 | Ga0157376_10108812 | 3300014969 | Bacteria | 2436 |
| 256 | Ga0157376_10342519 | 3300014969 | Bacteria | 1428 |
| 257 | Ga0157376_10418456 | 3300014969 | Bacteria | 1300 |
| 258 | Ga0157376_10546745 | 3300014969 | Bacteria | 1145 |
| 259 | Ga0157376_10699611 | 3300014969 | Bacteria | 1018 |
| 260 | Ga0157376_11513187 | 3300014969 | Unclassified | 704 |
| 261 | Ga0157376_11518183 | 3300014969 | Unclassified | 703 |
| 262 | Ga0157376_12055537 | 3300014969 | Unclassified | 609 |
| 263 | Ga0163161_10096366 | 3300017792 | Bacteria | 2196 |
| 264 | Ga0213876_10000427 | 3300021384 | Bacteria | 34873 |
| 265 | Ga0213876_10006949 | 3300021384 | Bacteria | 6168 |
| 266 | Ga0213876_10014748 | 3300021384 | Bacteria | 4141 |
| 267 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 268 | Ga0209130_1000550 | 3300025284 | Bacteria | 37462 |
| 269 | Ga0209025_1000831 | 3300025294 | Bacteria | 49044 |
| 270 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 271 | Ga0209758_1001349 | 3300025297 | Bacteria | 29561 |
| 272 | Ga0207426_1000182 | 3300025302 | Bacteria | 155724 |
| 273 | Ga0207692_10240802 | 3300025898 | Bacteria | 1080 |
| 274 | Ga0207642_10143329 | 3300025899 | Bacteria | 1262 |
| 275 | Ga0207642_10233967 | 3300025899 | Bacteria | 1034 |
| 276 | Ga0207710_10114235 | 3300025900 | Bacteria | 1284 |
| 277 | Ga0207680_10004246 | 3300025903 | Bacteria | 6784 |
| 278 | Ga0207680_10162112 | 3300025903 | Bacteria | 1500 |
| 279 | Ga0207699_10000124 | 3300025906 | Bacteria | 54948 |
| 280 | Ga0207699_10606162 | 3300025906 | Bacteria | 797 |
| 281 | Ga0207645_10016250 | 3300025907 | Bacteria | 4929 |
| 282 | Ga0207645_10188557 | 3300025907 | Bacteria | 1354 |
| 283 | Ga0207643_10020522 | 3300025908 | Bacteria | 3627 |
| 284 | Ga0207705_10010749 | 3300025909 | Bacteria | 6645 |
| 285 | Ga0207705_10233215 | 3300025909 | Bacteria | 1400 |
| 286 | Ga0207705_10547164 | 3300025909 | Unclassified | 900 |
| 287 | Ga0207654_10024438 | 3300025911 | Bacteria | 3249 |
| 288 | Ga0207654_10071613 | 3300025911 | Bacteria | 2061 |
| 289 | Ga0207654_10212429 | 3300025911 | Bacteria | 1279 |
| 290 | Ga0207654_10322641 | 3300025911 | Bacteria | 1056 |
| 291 | Ga0207654_10604457 | 3300025911 | Bacteria | 783 |
| 292 | Ga0207654_10886494 | 3300025911 | Unclassified | 646 |
| 293 | Ga0207654_11300561 | 3300025911 | Bacteria | 530 |
| 294 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 295 | Ga0207707_10052017 | 3300025912 | Bacteria | 3567 |
| 296 | Ga0207707_10133978 | 3300025912 | Bacteria | 2167 |
| 297 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 298 | Ga0207695_10019474 | 3300025913 | Bacteria | 7816 |
| 299 | Ga0207695_10022923 | 3300025913 | Bacteria | 7073 |
| 300 | Ga0207695_10047341 | 3300025913 | Bacteria | 4552 |
| 301 | Ga0207695_10070818 | 3300025913 | Bacteria | 3562 |
| 302 | Ga0207695_10193310 | 3300025913 | Bacteria | 1952 |
| 303 | Ga0207695_10230788 | 3300025913 | Bacteria | 1755 |
| 304 | Ga0207695_10377153 | 3300025913 | Bacteria | 1304 |
| 305 | Ga0207695_10991755 | 3300025913 | Bacteria | 720 |
| 306 | Ga0207671_10041130 | 3300025914 | Bacteria | 3421 |
| 307 | Ga0207671_11068211 | 3300025914 | Bacteria | 635 |
| 308 | Ga0207693_10000213 | 3300025915 | Bacteria | 53286 |
| 309 | Ga0207693_10001025 | 3300025915 | Bacteria | 25014 |
| 310 | Ga0207693_10085790 | 3300025915 | Bacteria | 2466 |
| 311 | Ga0207693_10222715 | 3300025915 | Unclassified | 1482 |
| 312 | Ga0207693_10521454 | 3300025915 | Bacteria | 927 |
| 313 | Ga0207663_10074266 | 3300025916 | Bacteria | 2203 |
| 314 | Ga0207663_10414639 | 3300025916 | Bacteria | 1033 |
| 315 | Ga0207663_10783226 | 3300025916 | Unclassified | 759 |
| 316 | Ga0207660_10000762 | 3300025917 | Bacteria | 21410 |
| 317 | Ga0207660_10196886 | 3300025917 | Bacteria | 1572 |
| 318 | Ga0207657_10042626 | 3300025919 | Bacteria | 4002 |
| 319 | Ga0207649_10000367 | 3300025920 | Bacteria | 33632 |
| 320 | Ga0207649_10243234 | 3300025920 | Bacteria | 1293 |
| 321 | Ga0207652_10950701 | 3300025921 | Bacteria | 757 |
| 322 | Ga0207681_10861965 | 3300025923 | Bacteria | 758 |
| 323 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 324 | Ga0207694_10029540 | 3300025924 | Bacteria | 4183 |
| 325 | Ga0207694_10080815 | 3300025924 | Bacteria | 2552 |
| 326 | Ga0207694_10222742 | 3300025924 | Bacteria | 1539 |
| 327 | Ga0207650_10283041 | 3300025925 | Bacteria | 1351 |
| 328 | Ga0207659_10639735 | 3300025926 | Bacteria | 908 |
| 329 | Ga0207687_10083759 | 3300025927 | Bacteria | 2310 |
| 330 | Ga0207687_10230472 | 3300025927 | Bacteria | 1463 |
| 331 | Ga0207687_11376295 | 3300025927 | Bacteria | 606 |
| 332 | Ga0207700_10000026 | 3300025928 | Bacteria | 139690 |
| 333 | Ga0207700_10015912 | 3300025928 | Bacteria | 4980 |
| 334 | Ga0207700_10247481 | 3300025928 | Bacteria | 1522 |
| 335 | Ga0207700_10355802 | 3300025928 | Bacteria | 1276 |
| 336 | Ga0207664_10010373 | 3300025929 | Bacteria | 6579 |
| 337 | Ga0207644_10098489 | 3300025931 | Bacteria | 2192 |
| 338 | Ga0207690_10668038 | 3300025932 | Bacteria | 852 |
| 339 | Ga0207690_11186803 | 3300025932 | Bacteria | 637 |
| 340 | Ga0207706_10075011 | 3300025933 | Bacteria | 2974 |
| 341 | Ga0207686_10007932 | 3300025934 | Bacteria | 5725 |
| 342 | Ga0207686_10079547 | 3300025934 | Bacteria | 2135 |
| 343 | Ga0207686_10232254 | 3300025934 | Bacteria | 1338 |
| 344 | Ga0207686_10842101 | 3300025934 | Bacteria | 737 |
| 345 | Ga0207709_10015320 | 3300025935 | Bacteria | 4251 |
| 346 | Ga0207704_10912711 | 3300025938 | Bacteria | 739 |
| 347 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 348 | Ga0207711_10154528 | 3300025941 | Bacteria | 2073 |
| 349 | Ga0207711_10179231 | 3300025941 | Unclassified | 1926 |
| 350 | Ga0207711_10293964 | 3300025941 | Bacteria | 1497 |
| 351 | Ga0207689_10066225 | 3300025942 | Bacteria | 2971 |
| 352 | Ga0207689_10308801 | 3300025942 | Bacteria | 1312 |
| 353 | Ga0207689_11079006 | 3300025942 | Unclassified | 677 |
| 354 | Ga0207661_10778526 | 3300025944 | Bacteria | 881 |
| 355 | Ga0207679_10616649 | 3300025945 | Bacteria | 979 |
| 356 | Ga0207667_10000484 | 3300025949 | Bacteria | 52691 |
| 357 | Ga0207667_10015995 | 3300025949 | Bacteria | 8495 |
| 358 | Ga0207667_10042630 | 3300025949 | Bacteria | 4822 |
| 359 | Ga0207667_10087471 | 3300025949 | Bacteria | 3223 |
| 360 | Ga0207667_10368648 | 3300025949 | Bacteria | 1464 |
| 361 | Ga0207667_11301923 | 3300025949 | Unclassified | 703 |
| 362 | Ga0207712_10034051 | 3300025961 | Bacteria | 3448 |
| 363 | Ga0207640_10423852 | 3300025981 | Bacteria | 1090 |
| 364 | Ga0207658_10056556 | 3300025986 | Bacteria | 2912 |
| 365 | Ga0207658_10101080 | 3300025986 | Bacteria | 2259 |
| 366 | Ga0207677_10139294 | 3300026023 | Bacteria | 1855 |
| 367 | Ga0207677_10386882 | 3300026023 | Bacteria | 1182 |
| 368 | Ga0207703_10042079 | 3300026035 | Bacteria | 3663 |
| 369 | Ga0207703_10077321 | 3300026035 | Bacteria | 2762 |
| 370 | Ga0207703_10339880 | 3300026035 | Bacteria | 1379 |
| 371 | Ga0207703_10362002 | 3300026035 | Bacteria | 1338 |
| 372 | Ga0207703_10909093 | 3300026035 | Bacteria | 843 |
| 373 | Ga0207639_10013412 | 3300026041 | Bacteria | 5737 |
| 374 | Ga0207639_10025732 | 3300026041 | Bacteria | 4269 |
| 375 | Ga0207639_10045148 | 3300026041 | Bacteria | 3318 |
| 376 | Ga0207639_10073293 | 3300026041 | Bacteria | 2684 |
| 377 | Ga0207639_11091975 | 3300026041 | Bacteria | 748 |
| 378 | Ga0207639_11427802 | 3300026041 | Unclassified | 649 |
| 379 | Ga0207702_10000021 | 3300026078 | Bacteria | 196115 |
| 380 | Ga0207702_10009259 | 3300026078 | Bacteria | 8275 |
| 381 | Ga0207702_10480507 | 3300026078 | Bacteria | 1209 |
| 382 | Ga0207702_10613422 | 3300026078 | Bacteria | 1068 |
| 383 | Ga0207702_10906135 | 3300026078 | Bacteria | 874 |
| 384 | Ga0207641_10220240 | 3300026088 | Bacteria | 1759 |
| 385 | Ga0207648_10005473 | 3300026089 | Bacteria | 12796 |
| 386 | Ga0207648_10255101 | 3300026089 | Bacteria | 1564 |
| 387 | Ga0207648_10648704 | 3300026089 | Bacteria | 975 |
| 388 | Ga0207676_10879723 | 3300026095 | Unclassified | 878 |
| 389 | Ga0207674_10000898 | 3300026116 | Bacteria | 38900 |
| 390 | Ga0207674_10075071 | 3300026116 | Bacteria | 3391 |
| 391 | Ga0207674_10127919 | 3300026116 | Bacteria | 2505 |
| 392 | Ga0207674_10327257 | 3300026116 | Bacteria | 1482 |
| 393 | Ga0207674_10721842 | 3300026116 | Bacteria | 962 |
| 394 | Ga0207675_100082307 | 3300026118 | Bacteria | 3019 |
| 395 | Ga0207683_10008637 | 3300026121 | Bacteria | 8710 |
| 396 | Ga0207683_10021754 | 3300026121 | Bacteria | 5498 |
| 397 | Ga0207683_10128768 | 3300026121 | Bacteria | 2276 |
| 398 | Ga0207683_10591401 | 3300026121 | Bacteria | 1027 |
| 399 | Ga0207698_10001029 | 3300026142 | Bacteria | 16220 |
| 400 | Ga0207698_10060313 | 3300026142 | Bacteria | 2950 |
| 401 | Ga0207698_10071704 | 3300026142 | Bacteria | 2750 |
| 402 | Ga0268266_10000385 | 3300028379 | Bacteria | 67236 |
| 403 | Ga0268266_10057702 | 3300028379 | Bacteria | 3341 |
| 404 | Ga0268266_10064534 | 3300028379 | Bacteria | 3164 |
| 405 | Ga0268266_10159546 | 3300028379 | Bacteria | 2039 |
| 406 | Ga0268266_10320036 | 3300028379 | Bacteria | 1451 |
| 407 | Ga0268266_10597594 | 3300028379 | Bacteria | 1060 |
| 408 | Ga0268266_10654579 | 3300028379 | Bacteria | 1011 |
| 409 | Ga0268264_10097183 | 3300028381 | Bacteria | 2552 |
| 410 | Ga0268264_10100540 | 3300028381 | Bacteria | 2512 |
| 411 | Ga0268264_10395584 | 3300028381 | Bacteria | 1327 |
| 412 | Ga0265326_10056203 | 3300028558 | Unclassified | 1113 |
| 413 | Ga0265334_10018182 | 3300028573 | Bacteria | 2899 |
| 414 | Ga0265318_10002560 | 3300028577 | Bacteria | 9639 |
| 415 | Ga0265318_10010669 | 3300028577 | Bacteria | 3991 |
| 416 | Ga0265323_10150793 | 3300028653 | Bacteria | 745 |
| 417 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 418 | Ga0265338_10007110 | 3300028800 | Bacteria | 14018 |
| 419 | Ga0265338_10010424 | 3300028800 | Bacteria | 10904 |
| 420 | Ga0265338_10013075 | 3300028800 | Bacteria | 9407 |
| 421 | Ga0265338_10066692 | 3300028800 | Bacteria | 3113 |
| 422 | Ga0265338_10714133 | 3300028800 | Bacteria | 691 |
| 423 | Ga0265330_10082572 | 3300031235 | Unclassified | 1383 |
| 424 | Ga0265330_10107120 | 3300031235 | Bacteria | 1195 |
| 425 | Ga0265332_10028790 | 3300031238 | Bacteria | 2430 |
| 426 | Ga0265332_10030345 | 3300031238 | Bacteria | 2362 |
| 427 | Ga0265332_10069078 | 3300031238 | Bacteria | 1506 |
| 428 | Ga0265332_10165921 | 3300031238 | Bacteria | 922 |
| 429 | Ga0265328_10194015 | 3300031239 | Bacteria | 770 |
| 430 | Ga0265328_10271255 | 3300031239 | Bacteria | 652 |
| 431 | Ga0265320_10000370 | 3300031240 | Bacteria | 36447 |
| 432 | Ga0265320_10107986 | 3300031240 | Bacteria | 1277 |
| 433 | Ga0265325_10000017 | 3300031241 | Bacteria | 130284 |
| 434 | Ga0265325_10000484 | 3300031241 | Bacteria | 28834 |
| 435 | Ga0265325_10000914 | 3300031241 | Bacteria | 21292 |
| 436 | Ga0265325_10004365 | 3300031241 | Bacteria | 8952 |
| 437 | Ga0265325_10024366 | 3300031241 | Bacteria | 3294 |
| 438 | Ga0265325_10082607 | 3300031241 | Bacteria | 1595 |
| 439 | Ga0265325_10090968 | 3300031241 | Bacteria | 1505 |
| 440 | Ga0265325_10154371 | 3300031241 | Bacteria | 1084 |
| 441 | Ga0265325_10231265 | 3300031241 | Unclassified | 843 |
| 442 | Ga0265325_10238021 | 3300031241 | Unclassified | 828 |
| 443 | Ga0265329_10006493 | 3300031242 | Bacteria | 4632 |
| 444 | Ga0265329_10042822 | 3300031242 | Bacteria | 1449 |
| 445 | Ga0265329_10114130 | 3300031242 | Viruses | 864 |
| 446 | Ga0265340_10000206 | 3300031247 | Bacteria | 29746 |
| 447 | Ga0265340_10003976 | 3300031247 | Bacteria | 8307 |
| 448 | Ga0265340_10024503 | 3300031247 | Bacteria | 3064 |
| 449 | Ga0265340_10033110 | 3300031247 | Bacteria | 2575 |
| 450 | Ga0265340_10074140 | 3300031247 | Bacteria | 1610 |
| 451 | Ga0265340_10274388 | 3300031247 | Bacteria | 749 |
| 452 | Ga0265339_10000895 | 3300031249 | Bacteria | 22878 |
| 453 | Ga0265339_10005604 | 3300031249 | Bacteria | 8335 |
| 454 | Ga0265339_10011784 | 3300031249 | Bacteria | 5365 |
| 455 | Ga0265339_10023415 | 3300031249 | Bacteria | 3570 |
| 456 | Ga0265339_10094579 | 3300031249 | Bacteria | 1562 |
| 457 | Ga0265339_10141253 | 3300031249 | Bacteria | 1225 |
| 458 | Ga0265339_10448011 | 3300031249 | Unclassified | 599 |
| 459 | Ga0265331_10000067 | 3300031250 | Bacteria | 158073 |
| 460 | Ga0265331_10003379 | 3300031250 | Bacteria | 10346 |
| 461 | Ga0265331_10009636 | 3300031250 | Bacteria | 5408 |
| 462 | Ga0265331_10013806 | 3300031250 | Bacteria | 4330 |
| 463 | Ga0265331_10074411 | 3300031250 | Bacteria | 1585 |
| 464 | Ga0265331_10078937 | 3300031250 | Bacteria | 1532 |
| 465 | Ga0265316_10019350 | 3300031344 | Bacteria | 5825 |
| 466 | Ga0265316_10035146 | 3300031344 | Bacteria | 4064 |
| 467 | Ga0265316_10044324 | 3300031344 | Bacteria | 3538 |
| 468 | Ga0265316_10059973 | 3300031344 | Bacteria | 2958 |
| 469 | Ga0265316_10141463 | 3300031344 | Unclassified | 1807 |
| 470 | Ga0265316_10245902 | 3300031344 | Bacteria | 1314 |
| 471 | Ga0265316_10329545 | 3300031344 | Bacteria | 1108 |
| 472 | Ga0265316_10450315 | 3300031344 | Bacteria | 923 |
| 473 | Ga0265316_10835471 | 3300031344 | Unclassified | 645 |
| 474 | Ga0265313_10004380 | 3300031595 | Bacteria | 10897 |
| 475 | Ga0265313_10005228 | 3300031595 | Bacteria | 9615 |
| 476 | Ga0265313_10005338 | 3300031595 | Bacteria | 9489 |
| 477 | Ga0265313_10007533 | 3300031595 | Bacteria | 7405 |
| 478 | Ga0265313_10010085 | 3300031595 | Bacteria | 6040 |
| 479 | Ga0265313_10112798 | 3300031595 | Bacteria | 1194 |
| 480 | Ga0265313_10124895 | 3300031595 | Bacteria | 1119 |
| 481 | Ga0265313_10256007 | 3300031595 | Bacteria | 713 |
| 482 | Ga0265314_10000918 | 3300031711 | Bacteria | 34672 |
| 483 | Ga0265314_10005990 | 3300031711 | Bacteria | 10843 |
| 484 | Ga0265314_10007494 | 3300031711 | Bacteria | 9461 |
| 485 | Ga0265314_10007742 | 3300031711 | Bacteria | 9287 |
| 486 | Ga0265314_10012633 | 3300031711 | Bacteria | 6875 |
| 487 | Ga0265314_10031435 | 3300031711 | Bacteria | 3918 |
| 488 | Ga0265314_10044308 | 3300031711 | Bacteria | 3154 |
| 489 | Ga0265314_10117540 | 3300031711 | Bacteria | 1679 |
| 490 | Ga0265314_10141869 | 3300031711 | Bacteria | 1484 |
| 491 | Ga0265314_10149776 | 3300031711 | Bacteria | 1432 |
| 492 | Ga0265314_10249566 | 3300031711 | Unclassified | 1019 |
| 493 | Ga0265314_10280133 | 3300031711 | Bacteria | 944 |
| 494 | Ga0265342_10009937 | 3300031712 | Bacteria | 6652 |
| 495 | Ga0265342_10029287 | 3300031712 | Bacteria | 3419 |
| 496 | Ga0265342_10057244 | 3300031712 | Bacteria | 2308 |
| 497 | Ga0265342_10243824 | 3300031712 | Bacteria | 961 |
| 498 | Ga0265342_10252969 | 3300031712 | Bacteria | 940 |
| 499 | Ga0307516_10030531 | 3300031730 | Bacteria | 5437 |
| 500 | Ga0307516_10444620 | 3300031730 | Unclassified | 953 |
| 501 | Ga0373926_0071222 | 3300035083 | Bacteria | 1278 |
| 502 | Ga0373932_0114490 | 3300035112 | Bacteria | 893 |
| 503 | Ga0373936_0137658 | 3300035113 | Bacteria | 1053 |
| 504 | Ga0373939_0027361 | 3300035114 | Bacteria | 1615 |
| 505 | Ga0373953_0169779 | 3300035117 | Bacteria | 939 |
| 506 | Ga0373954_0153251 | 3300035118 | Unclassified | 1126 |
| 507 | Ga0373954_0272756 | 3300035118 | Unclassified | 834 |
| 508 | Ga0373956_0305607 | 3300035119 | Unclassified | 758 |
| 509 | Ga0373955_0771102 | 3300035172 | Unclassified | 591 |
| 510 | Ga0373955_0925983 | 3300035172 | Bacteria | 536 |
| 511 | Ga0373931_0006560 | 3300035691 | Bacteria | 5443 |
| 512 | Ga0373927_0168409 | 3300035695 | Unclassified | 1436 |
| 513 | Ga0373927_0331416 | 3300035695 | Bacteria | 1003 |
| 514 | Ga0373927_0486167 | 3300035695 | Bacteria | 816 |
| 515 | Ga0373933_0018352 | 3300035724 | Bacteria | 3932 |
| 516 | Ga0373933_0272850 | 3300035724 | Unclassified | 1092 |
| 517 | Ga0373933_0472295 | 3300035724 | Unclassified | 821 |
| 518 | Ga0373947_0481430 | 3300035725 | Bacteria | 842 |
| 519 | Ga0373937_0001347 | 3300036401 | Bacteria | 20536 |
| 520 | Ga0373937_0014387 | 3300036401 | Bacteria | 6987 |
| 521 | Ga0373937_0017765 | 3300036401 | Bacteria | 6345 |
| 522 | Ga0373937_0083005 | 3300036401 | Bacteria | 2965 |
| 523 | Ga0373937_0148746 | 3300036401 | Bacteria | 2193 |
| 524 | Ga0373937_0156754 | 3300036401 | Bacteria | 2134 |
| 525 | Ga0373937_0192257 | 3300036401 | Bacteria | 1918 |
| 526 | Ga0373937_0320255 | 3300036401 | Bacteria | 1467 |
| 527 | Ga0373937_0790122 | 3300036401 | Unclassified | 897 |
| 528 | Ga0373937_1062792 | 3300036401 | Bacteria | 758 |
| 529 | Ga0373925_0368220 | 3300037068 | Bacteria | 1169 |
| 530 | Ga0395900_0039256 | 3300037418 | Bacteria | 4878 |
| 531 | Ga0395898_0074177 | 3300037466 | Bacteria | 3287 |
| 532 | Ga0395898_0220664 | 3300037466 | Bacteria | 1808 |
| 533 | Ga0395901_0010855 | 3300038443 | Bacteria | 9233 |
| 534 | Ga0395901_0094182 | 3300038443 | Bacteria | 3137 |
| 535 | Ga0436365_0285583 | 3300039437 | Unclassified | 985 |
| 536 | Ga0436365_0390587 | 3300039437 | Bacteria | 6670 |
| 537 | Ga0436365_0448800 | 3300039437 | Bacteria | 775 |
| 538 | Ga0436365_0577140 | 3300039437 | Bacteria | 27302 |
| 539 | Ga0436365_0583194 | 3300039437 | Bacteria | 93933 |
| 540 | Ga0436365_1131003 | 3300039437 | Bacteria | 990 |
| 541 | Ga0436365_1264489 | 3300039437 | Bacteria | 1507 |
| 542 | Ga0436365_1406825 | 3300039437 | Unclassified | 846 |
| 543 | Ga0436360_0524592 | 3300039438 | Bacteria | 1194 |
| 544 | Ga0436360_0558935 | 3300039438 | Bacteria | 1545 |
| 545 | Ga0436360_1278480 | 3300039438 | Bacteria | 952 |
| 546 | Ga0436361_0796701 | 3300039447 | Bacteria | 668 |
| 547 | Ga0436363_0355221 | 3300039450 | Bacteria | 1116 |
| 548 | Ga0436362_1185563 | 3300039453 | Unclassified | 1314 |
| 549 | Ga0439445_0022504 | 3300042004 | Bacteria | 1590 |
| 550 | Ga0450909_034472 | 3300042185 | Bacteria | 772 |
| 551 | Ga0466966_0351440 | 3300044684 | Unclassified | 886 |
| 552 | Ga0466958_0360239 | 3300045836 | Bacteria | 937 |
| 553 | Ga0466967_0366245 | 3300045976 | Bacteria | 1397 |
| 554 | Ga0466967_1005322 | 3300045976 | Bacteria | 830 |
| 555 | Ga0495651_0336322 | 3300046462 | Unclassified | 1002 |
| 556 | Ga0495651_0741033 | 3300046462 | Bacteria | 610 |
| 557 | Ga0495584_0243234 | 3300046491 | Bacteria | 915 |
| 558 | Ga0495610_0010194 | 3300046512 | Bacteria | 5863 |
| 559 | Ga0495628_0395773 | 3300046516 | Unclassified | 1010 |
| 560 | Ga0495648_0074879 | 3300046524 | Bacteria | 1949 |
| 561 | Ga0495652_0832461 | 3300046529 | Unclassified | 613 |
| 562 | Ga0495609_0015399 | 3300046538 | Bacteria | 3579 |
| 563 | Ga0495621_0305515 | 3300046539 | Bacteria | 660 |
| 564 | Ga0495622_0009823 | 3300046557 | Bacteria | 4424 |
| 565 | Ga0495633_0380312 | 3300046558 | Bacteria | 639 |
| 566 | Ga0495667_0475086 | 3300046559 | Bacteria | 784 |
| 567 | Ga0495611_0339948 | 3300046648 | Unclassified | 689 |
| 568 | Ga0495599_0372969 | 3300046678 | Unclassified | 853 |
| 569 | Ga0495623_0507498 | 3300046679 | Bacteria | 636 |
| 570 | Ga0495670_0326786 | 3300046691 | Bacteria | 824 |
| 571 | Ga0495581_0269866 | 3300047315 | Bacteria | 995 |
| 572 | Ga0495674_0211461 | 3300047319 | Bacteria | 1606 |
| 573 | Ga0495672_0556991 | 3300047320 | Bacteria | 502 |
| 574 | Ga0495675_0203625 | 3300047444 | Unclassified | 1204 |
| 575 | Ga0495593_0147465 | 3300047673 | Bacteria | 1191 |
| 576 | Ga0495593_0571083 | 3300047673 | Unclassified | 568 |
| 577 | Ga0496100_0748828 | 3300048903 | Bacteria | 764 |
| 578 | Ga0496102_0278391 | 3300048905 | Bacteria | 1577 |
| 579 | Ga0496106_0336546 | 3300048909 | Bacteria | 1212 |
| 580 | Ga0496106_0735284 | 3300048909 | Bacteria | 785 |
| 581 | Ga0496107_0348134 | 3300048910 | Bacteria | 1103 |
| 582 | Ga0496114_1637730 | 3300048917 | Bacteria | 532 |
| 583 | Ga0496121_0016235 | 3300048924 | Bacteria | 7704 |
| 584 | Ga0496121_0144735 | 3300048924 | Bacteria | 1758 |
| 585 | Ga0496126_0003628 | 3300048929 | Bacteria | 19298 |
| 586 | Ga0496126_0230764 | 3300048929 | Bacteria | 1551 |
| 587 | Ga0496126_0358679 | 3300048929 | Bacteria | 1191 |
| 588 | Ga0495682_0001443 | 3300049460 | Bacteria | 12841 |
| 589 | Ga0501031_0011841 | 3300049568 | Bacteria | 5688 |
| 590 | Ga0501031_0148555 | 3300049568 | Bacteria | 1531 |
| 591 | Ga0501032_0026248 | 3300049569 | Bacteria | 4009 |
| 592 | Ga0501032_0044102 | 3300049569 | Bacteria | 3019 |
| 593 | Ga0501032_0127946 | 3300049569 | Bacteria | 1677 |
| 594 | Ga0501032_0165667 | 3300049569 | Bacteria | 1450 |
| 595 | Ga0501032_0189207 | 3300049569 | Bacteria | 1345 |
| 596 | Ga0501032_0408766 | 3300049569 | Bacteria | 871 |
| 597 | Ga0501033_0007273 | 3300049570 | Bacteria | 8634 |
| 598 | Ga0501033_0317075 | 3300049570 | Bacteria | 1095 |
| 599 | Ga0501033_0355576 | 3300049570 | Bacteria | 1025 |
| 600 | Ga0501033_0444312 | 3300049570 | Unclassified | 901 |
| 601 | Ga0501034_0010803 | 3300049571 | Bacteria | 9484 |
| 602 | Ga0501034_0017594 | 3300049571 | Bacteria | 7329 |
| 603 | Ga0501034_0315936 | 3300049571 | Bacteria | 1496 |
| 604 | Ga0501034_0386353 | 3300049571 | Bacteria | 1324 |
| 605 | Ga0501034_0518932 | 3300049571 | Bacteria | 1103 |
| 606 | Ga0501036_0030777 | 3300049572 | Bacteria | 4534 |
| 607 | Ga0501036_0038275 | 3300049572 | Bacteria | 4059 |
| 608 | Ga0501036_0222010 | 3300049572 | Bacteria | 1587 |
| 609 | Ga0501036_0307612 | 3300049572 | Bacteria | 1325 |
| 610 | Ga0501036_0561928 | 3300049572 | Bacteria | 948 |
| 611 | Ga0501036_1268155 | 3300049572 | Bacteria | 599 |
| 612 | Ga0501037_0009064 | 3300049573 | Bacteria | 7292 |
| 613 | Ga0501037_0009459 | 3300049573 | Bacteria | 7155 |
| 614 | Ga0501037_0062745 | 3300049573 | Bacteria | 2709 |
| 615 | Ga0501037_0077439 | 3300049573 | Bacteria | 2413 |
| 616 | Ga0501037_0111271 | 3300049573 | Bacteria | 1973 |
| 617 | Ga0501037_0147252 | 3300049573 | Unclassified | 1684 |
| 618 | Ga0501037_0154826 | 3300049573 | Bacteria | 1636 |
| 619 | Ga0501038_0003178 | 3300049574 | Bacteria | 15314 |
| 620 | Ga0501038_0060272 | 3300049574 | Bacteria | 3248 |
| 621 | Ga0501038_0065266 | 3300049574 | Bacteria | 3102 |
| 622 | Ga0501038_0098557 | 3300049574 | Bacteria | 2437 |
| 623 | Ga0501038_0133759 | 3300049574 | Bacteria | 2033 |
| 624 | Ga0501038_0348045 | 3300049574 | Bacteria | 1154 |
| 625 | Ga0501038_0452305 | 3300049574 | Bacteria | 987 |
| 626 | Ga0501039_0003110 | 3300049575 | Bacteria | 12404 |
| 627 | Ga0501039_0406144 | 3300049575 | Bacteria | 1070 |
| 628 | Ga0501040_0145850 | 3300049576 | Bacteria | 1668 |
| 629 | Ga0501041_0235804 | 3300049577 | Bacteria | 1149 |
| 630 | Ga0501042_0002157 | 3300049578 | Bacteria | 11973 |
| 631 | Ga0501042_0232538 | 3300049578 | Bacteria | 1330 |
| 632 | Ga0501043_0014986 | 3300049579 | Bacteria | 6071 |
| 633 | Ga0501043_0022817 | 3300049579 | Bacteria | 4907 |
| 634 | Ga0501043_0037650 | 3300049579 | Bacteria | 3804 |
| 635 | Ga0501043_0041740 | 3300049579 | Bacteria | 3604 |
| 636 | Ga0501043_0146470 | 3300049579 | Bacteria | 1849 |
| 637 | Ga0501043_0243832 | 3300049579 | Bacteria | 1385 |
| 638 | Ga0501043_0247448 | 3300049579 | Bacteria | 1374 |
| 639 | Ga0501043_0277315 | 3300049579 | Bacteria | 1286 |
| 640 | Ga0501043_0786915 | 3300049579 | Bacteria | 689 |
| 641 | Ga0501046_0002292 | 3300049580 | Bacteria | 18042 |
| 642 | Ga0501046_0090783 | 3300049580 | Bacteria | 2350 |
| 643 | Ga0501046_0276044 | 3300049580 | Unclassified | 1232 |
| 644 | Ga0501047_0004588 | 3300049581 | Bacteria | 12992 |
| 645 | Ga0501047_0006654 | 3300049581 | Bacteria | 10863 |
| 646 | Ga0501047_0008138 | 3300049581 | Bacteria | 9897 |
| 647 | Ga0501047_0008920 | 3300049581 | Bacteria | 9468 |
| 648 | Ga0501047_0019060 | 3300049581 | Bacteria | 6583 |
| 649 | Ga0501047_0065424 | 3300049581 | Bacteria | 3505 |
| 650 | Ga0501047_0079440 | 3300049581 | Bacteria | 3154 |
| 651 | Ga0501047_0134245 | 3300049581 | Bacteria | 2355 |
| 652 | Ga0501047_0175170 | 3300049581 | Bacteria | 2012 |
| 653 | Ga0501047_0205133 | 3300049581 | Bacteria | 1831 |
| 654 | Ga0501047_0293014 | 3300049581 | Bacteria | 1471 |
| 655 | Ga0501047_0304483 | 3300049581 | Bacteria | 1435 |
| 656 | Ga0501047_0398451 | 3300049581 | Unclassified | 1209 |
| 657 | Ga0501047_0628720 | 3300049581 | Bacteria | 894 |
| 658 | Ga0501047_0637043 | 3300049581 | Unclassified | 886 |
| 659 | Ga0501047_0925040 | 3300049581 | Bacteria | 685 |
| 660 | Ga0501048_0016380 | 3300049582 | Bacteria | 5462 |
| 661 | Ga0501067_0000141 | 3300049583 | Bacteria | 39689 |
| 662 | Ga0501067_0000481 | 3300049583 | Bacteria | 21772 |
| 663 | Ga0501067_0101400 | 3300049583 | Bacteria | 1599 |
| 664 | Ga0501067_0432754 | 3300049583 | Bacteria | 734 |
| 665 | Ga0501068_0010448 | 3300049584 | Bacteria | 5218 |
| 666 | Ga0501069_0018054 | 3300049585 | Bacteria | 3805 |
| 667 | Ga0501069_0036606 | 3300049585 | Bacteria | 2707 |
| 668 | Ga0501070_0000014 | 3300049586 | Bacteria | 180454 |
| 669 | Ga0501070_0105824 | 3300049586 | Bacteria | 2326 |
| 670 | Ga0501070_0212138 | 3300049586 | Bacteria | 1589 |
| 671 | Ga0501070_0268843 | 3300049586 | Bacteria | 1393 |
| 672 | Ga0501070_0320123 | 3300049586 | Bacteria | 1261 |
| 673 | Ga0501070_0388186 | 3300049586 | Unclassified | 1130 |
| 674 | Ga0501070_0442930 | 3300049586 | Bacteria | 1048 |
| 675 | Ga0501072_0001282 | 3300049588 | Bacteria | 18794 |
| 676 | Ga0501072_0042938 | 3300049588 | Bacteria | 3553 |
| 677 | Ga0501072_0341187 | 3300049588 | Bacteria | 1190 |
| 678 | Ga0501073_0023514 | 3300049589 | Bacteria | 4424 |
| 679 | Ga0501073_0108059 | 3300049589 | Bacteria | 1930 |
| 680 | Ga0501073_0146914 | 3300049589 | Bacteria | 1634 |
| 681 | Ga0501073_0206832 | 3300049589 | Bacteria | 1356 |
| 682 | Ga0501073_0532040 | 3300049589 | Bacteria | 812 |
| 683 | Ga0501074_0001175 | 3300049590 | Bacteria | 17172 |
| 684 | Ga0501074_0129900 | 3300049590 | Bacteria | 1802 |
| 685 | Ga0501074_0747677 | 3300049590 | Bacteria | 690 |
| 686 | Ga0501076_0357227 | 3300049592 | Bacteria | 1200 |
| 687 | Ga0501077_0334108 | 3300049593 | Bacteria | 966 |
| 688 | Ga0501079_0002116 | 3300049741 | Bacteria | 14274 |
| 689 | Ga0501079_0098379 | 3300049741 | Bacteria | 2268 |
| 690 | Ga0501079_0141995 | 3300049741 | Bacteria | 1870 |
| 691 | Ga0501080_0001353 | 3300049742 | Bacteria | 20479 |
| 692 | Ga0501080_0027115 | 3300049742 | Bacteria | 5327 |
| 693 | Ga0501080_0036992 | 3300049742 | Bacteria | 4557 |
| 694 | Ga0501080_0122730 | 3300049742 | Bacteria | 2406 |
| 695 | Ga0501080_0207675 | 3300049742 | Bacteria | 1796 |
| 696 | Ga0501080_0227132 | 3300049742 | Bacteria | 1707 |
| 697 | Ga0501080_0309605 | 3300049742 | Bacteria | 1431 |
| 698 | Ga0501080_0415554 | 3300049742 | Bacteria | 1209 |
| 699 | Ga0501080_0577460 | 3300049742 | Bacteria | 999 |
| 700 | Ga0501080_0602828 | 3300049742 | Bacteria | 975 |
| 701 | Ga0501081_0352968 | 3300049743 | Bacteria | 1084 |
| 702 | Ga0501083_0002575 | 3300049744 | Bacteria | 12468 |
| 703 | Ga0501083_0032738 | 3300049744 | Bacteria | 3564 |
| 704 | Ga0501035_0001780 | 3300049822 | Bacteria | 21770 |
| 705 | Ga0501035_0002097 | 3300049822 | Bacteria | 19833 |
| 706 | Ga0501035_0006268 | 3300049822 | Bacteria | 11184 |
| 707 | Ga0501035_0016519 | 3300049822 | Bacteria | 6806 |
| 708 | Ga0501035_0022243 | 3300049822 | Bacteria | 5823 |
| 709 | Ga0501035_0060216 | 3300049822 | Bacteria | 3380 |
| 710 | Ga0501035_0080787 | 3300049822 | Bacteria | 2870 |
| 711 | Ga0501035_0249832 | 3300049822 | Bacteria | 1506 |
| 712 | Ga0501035_0323732 | 3300049822 | Bacteria | 1295 |
| 713 | Ga0501035_0617762 | 3300049822 | Bacteria | 882 |
| 714 | Ga0501035_0884101 | 3300049822 | Bacteria | 708 |
| 715 | Ga0501044_0000761 | 3300049823 | Bacteria | 39005 |
| 716 | Ga0501044_0022525 | 3300049823 | Bacteria | 6712 |
| 717 | Ga0501044_0025449 | 3300049823 | Bacteria | 6272 |
| 718 | Ga0501044_0071584 | 3300049823 | Bacteria | 3525 |
| 719 | Ga0501044_0084197 | 3300049823 | Bacteria | 3214 |
| 720 | Ga0501044_0118026 | 3300049823 | Bacteria | 2656 |
| 721 | Ga0501044_0119763 | 3300049823 | Bacteria | 2634 |
| 722 | Ga0501044_0150205 | 3300049823 | Bacteria | 2312 |
| 723 | Ga0501044_0187096 | 3300049823 | Bacteria | 2035 |
| 724 | Ga0501044_0216106 | 3300049823 | Bacteria | 1869 |
| 725 | Ga0501044_0267153 | 3300049823 | Bacteria | 1647 |
| 726 | Ga0501044_0637730 | 3300049823 | Bacteria | 955 |
| 727 | Ga0501044_0681044 | 3300049823 | Unclassified | 915 |
| 728 | Ga0501044_1158298 | 3300049823 | Unclassified | 642 |
| 729 | Ga0501045_0119215 | 3300049824 | Bacteria | 1959 |
| 730 | Ga0501045_0199507 | 3300049824 | Bacteria | 1491 |
| 731 | nmdc:mga08y16_625876_c1 | 3300050511 | Unclassified | 1083 |
| 732 | nmdc:mga0rr50_605926_c1 | 3300050513 | Bacteria | 934 |
| 733 | nmdc:mga08x19_37_c1 | 3300050514 | Bacteria | 163624 |
| 734 | nmdc:mga08x19_44640_c1 | 3300050514 | Bacteria | 2830 |
| 735 | nmdc:mga08x19_67234_c1 | 3300050514 | Bacteria | 2331 |
| 736 | Ga0495595_0083670 | 3300053084 | Bacteria | 1524 |
| 737 | Ga0500651_0377674 | 3300053093 | Bacteria | 800 |
| 738 | Ga0500555_004524 | 3300053103 | Bacteria | 3951 |
| 739 | Ga0500595_002039 | 3300053119 | Bacteria | 10320 |
| 740 | Ga0500595_003993 | 3300053119 | Bacteria | 6736 |
| 741 | Ga0500655_049101 | 3300053133 | Bacteria | 838 |
| 742 | Ga0500559_0185689 | 3300053136 | Bacteria | 980 |
| 743 | Ga0500619_001627 | 3300053154 | Bacteria | 4042 |
| 744 | Ga0500645_149447 | 3300053730 | Bacteria | 643 |
| 745 | Ga0501084_0000366 | 3300054114 | Bacteria | 34534 |
| 746 | Ga0501084_0003091 | 3300054114 | Bacteria | 13499 |
| 747 | Ga0501084_0006114 | 3300054114 | Bacteria | 9901 |
| 748 | Ga0501082_0085960 | 3300060353 | Bacteria | 2713 |
| 749 | Ga0501082_0171551 | 3300060353 | Bacteria | 1886 |
| 750 | Ga0530510_0346303 | 3300061734 | Bacteria | 1116 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10728190 | Ga0070681_107281902 | 147 |
| 2 | 3300005577 | Ga0068857_100842992 | Ga0068857_1008429922 | 147 |
| 3 | 3300009093 | Ga0105240_10044045 | Ga0105240_100440453 | 147 |
| 4 | 3300009545 | Ga0105237_10012476 | Ga0105237_100124762 | 147 |
| 5 | 3300009551 | Ga0105238_10145968 | Ga0105238_101459682 | 147 |
| 6 | 3300010375 | Ga0105239_10399659 | Ga0105239_103996593 | 147 |
| 7 | 3300013105 | Ga0157369_10613293 | Ga0157369_106132932 | 147 |
| 8 | 3300039438 | Ga0436360_0524592 | Ga0436360_0524592_657_1127 | 149 |
| 9 | 3300044684 | Ga0466966_0351440 | Ga0466966_0351440_180_650 | 149 |
| 10 | 3300045836 | Ga0466958_0360239 | Ga0466958_0360239_74_544 | 149 |
| 11 | 3300048929 | Ga0496126_0230764 | Ga0496126_0230764_14_496 | 150 |
| 12 | 3300009551 | Ga0105238_10439940 | Ga0105238_104399402 | 152 |
| 13 | 3300028800 | Ga0265338_10066692 | Ga0265338_100666923 | 152 |
| 14 | 3300005327 | Ga0070658_10180640 | Ga0070658_101806403 | 153 |
| 15 | 3300005328 | Ga0070676_10205036 | Ga0070676_102050362 | 153 |
| 16 | 3300005344 | Ga0070661_100335168 | Ga0070661_1003351682 | 153 |
| 17 | 3300005530 | Ga0070679_101933889 | Ga0070679_1019338891 | 153 |
| 18 | 3300005614 | Ga0068856_100371925 | Ga0068856_1003719253 | 153 |
| 19 | 3300009174 | Ga0105241_10114803 | Ga0105241_101148033 | 153 |
| 20 | 3300009553 | Ga0105249_10524233 | Ga0105249_105242332 | 153 |
| 21 | 3300013307 | Ga0157372_11201504 | Ga0157372_112015042 | 153 |
| 22 | 3300014325 | Ga0163163_11460583 | Ga0163163_114605832 | 153 |
| 23 | 3300025907 | Ga0207645_10188557 | Ga0207645_101885572 | 153 |
| 24 | 3300025909 | Ga0207705_10547164 | Ga0207705_105471641 | 153 |
| 25 | 3300025911 | Ga0207654_11300561 | Ga0207654_113005611 | 153 |
| 26 | 3300025913 | Ga0207695_10022923 | Ga0207695_100229234 | 153 |
| 27 | 3300025914 | Ga0207671_11068211 | Ga0207671_110682111 | 153 |
| 28 | 3300025924 | Ga0207694_10029540 | Ga0207694_100295402 | 153 |
| 29 | 3300025949 | Ga0207667_10368648 | Ga0207667_103686483 | 153 |
| 30 | 3300026078 | Ga0207702_10480507 | Ga0207702_104805072 | 153 |
| 31 | 3300026078 | Ga0207702_10613422 | Ga0207702_106134222 | 153 |
| 32 | 3300026089 | Ga0207648_10648704 | Ga0207648_106487043 | 153 |
| 33 | 3300026116 | Ga0207674_10127919 | Ga0207674_101279192 | 153 |
| 34 | 3300028653 | Ga0265323_10150793 | Ga0265323_101507931 | 153 |
| 35 | 3300031235 | Ga0265330_10082572 | Ga0265330_100825722 | 153 |
| 36 | 3300031235 | Ga0265330_10107120 | Ga0265330_101071202 | 153 |
| 37 | 3300031239 | Ga0265328_10271255 | Ga0265328_102712552 | 153 |
| 38 | 3300031241 | Ga0265325_10000914 | Ga0265325_1000091415 | 153 |
| 39 | 3300031241 | Ga0265325_10238021 | Ga0265325_102380211 | 153 |
| 40 | 3300031242 | Ga0265329_10114130 | Ga0265329_101141302 | 153 |
| 41 | 3300031247 | Ga0265340_10000206 | Ga0265340_1000020624 | 153 |
| 42 | 3300031247 | Ga0265340_10033110 | Ga0265340_100331102 | 153 |
| 43 | 3300031247 | Ga0265340_10074140 | Ga0265340_100741402 | 153 |
| 44 | 3300031249 | Ga0265339_10011784 | Ga0265339_100117843 | 153 |
| 45 | 3300031249 | Ga0265339_10023415 | Ga0265339_100234152 | 153 |
| 46 | 3300031249 | Ga0265339_10448011 | Ga0265339_104480111 | 153 |
| 47 | 3300031250 | Ga0265331_10074411 | Ga0265331_100744111 | 153 |
| 48 | 3300031344 | Ga0265316_10019350 | Ga0265316_100193506 | 153 |
| 49 | 3300031344 | Ga0265316_10035146 | Ga0265316_100351462 | 153 |
| 50 | 3300031344 | Ga0265316_10835471 | Ga0265316_108354711 | 153 |
| 51 | 3300031595 | Ga0265313_10005338 | Ga0265313_100053389 | 153 |
| 52 | 3300031595 | Ga0265313_10112798 | Ga0265313_101127982 | 153 |
| 53 | 3300031711 | Ga0265314_10000918 | Ga0265314_100009187 | 153 |
| 54 | 3300031711 | Ga0265314_10141869 | Ga0265314_101418692 | 153 |
| 55 | 3300031711 | Ga0265314_10280133 | Ga0265314_102801332 | 153 |
| 56 | 3300031712 | Ga0265342_10009937 | Ga0265342_100099373 | 153 |
| 57 | 3300031712 | Ga0265342_10243824 | Ga0265342_102438242 | 153 |
| 58 | 3300036401 | Ga0373937_0192257 | Ga0373937_0192257_760_1227 | 153 |
| 59 | 3300037466 | Ga0395898_0220664 | Ga0395898_0220664_941_1408 | 153 |
| 60 | 3300038443 | Ga0395901_0094182 | Ga0395901_0094182_1374_1841 | 153 |
| 61 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_100003556 | 154 |
| 62 | 3300009101 | Ga0105247_10420663 | Ga0105247_104206631 | 154 |
| 63 | 3300013297 | Ga0157378_10191010 | Ga0157378_101910102 | 154 |
| 64 | 3300017792 | Ga0163161_10096366 | Ga0163161_100963663 | 154 |
| 65 | 3300021384 | Ga0213876_10006949 | Ga0213876_100069492 | 154 |
| 66 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006550 | 154 |
| 67 | 3300025932 | Ga0207690_11186803 | Ga0207690_111868031 | 154 |
| 68 | 3300028577 | Ga0265318_10010669 | Ga0265318_100106691 | 154 |
| 69 | 3300031249 | Ga0265339_10094579 | Ga0265339_100945792 | 154 |
| 70 | 3300031730 | Ga0307516_10444620 | Ga0307516_104446202 | 154 |
| 71 | 3300049569 | Ga0501032_0127946 | Ga0501032_0127946_1197_1661 | 154 |
| 72 | 3300049570 | Ga0501033_0007273 | Ga0501033_0007273_6873_7337 | 154 |
| 73 | 3300049572 | Ga0501036_0561928 | Ga0501036_0561928_135_599 | 154 |
| 74 | 3300049573 | Ga0501037_0077439 | Ga0501037_0077439_1252_1716 | 154 |
| 75 | 3300049574 | Ga0501038_0348045 | Ga0501038_0348045_395_859 | 154 |
| 76 | 3300049579 | Ga0501043_0277315 | Ga0501043_0277315_229_693 | 154 |
| 77 | 3300049581 | Ga0501047_0019060 | Ga0501047_0019060_5694_6158 | 154 |
| 78 | 3300049822 | Ga0501035_0006268 | Ga0501035_0006268_4980_5444 | 154 |
| 79 | 3300049823 | Ga0501044_0000761 | Ga0501044_0000761_16746_17210 | 154 |
| 80 | 3300049823 | Ga0501044_0071584 | Ga0501044_0071584_1917_2381 | 154 |
| 81 | 3300003215 | JGI25153J46596_10000792 | JGI25153J46596_1000079213 | 155 |
| 82 | 3300005328 | Ga0070676_10024121 | Ga0070676_100241212 | 155 |
| 83 | 3300005334 | Ga0068869_100046402 | Ga0068869_1000464023 | 155 |
| 84 | 3300005335 | Ga0070666_10074236 | Ga0070666_100742363 | 155 |
| 85 | 3300005337 | Ga0070682_100436656 | Ga0070682_1004366562 | 155 |
| 86 | 3300005338 | Ga0068868_100153342 | Ga0068868_1001533421 | 155 |
| 87 | 3300005344 | Ga0070661_100059484 | Ga0070661_1000594842 | 155 |
| 88 | 3300005354 | Ga0070675_100219111 | Ga0070675_1002191113 | 155 |
| 89 | 3300005355 | Ga0070671_100818029 | Ga0070671_1008180291 | 155 |
| 90 | 3300005366 | Ga0070659_100732282 | Ga0070659_1007322822 | 155 |
| 91 | 3300005367 | Ga0070667_100110770 | Ga0070667_1001107703 | 155 |
| 92 | 3300005367 | Ga0070667_100325874 | Ga0070667_1003258741 | 155 |
| 93 | 3300005438 | Ga0070701_10368553 | Ga0070701_103685532 | 155 |
| 94 | 3300005439 | Ga0070711_100812536 | Ga0070711_1008125361 | 155 |
| 95 | 3300005459 | Ga0068867_100013842 | Ga0068867_1000138423 | 155 |
| 96 | 3300005539 | Ga0068853_100018884 | Ga0068853_1000188844 | 155 |
| 97 | 3300005539 | Ga0068853_100086583 | Ga0068853_1000865832 | 155 |
| 98 | 3300005548 | Ga0070665_100037182 | Ga0070665_1000371826 | 155 |
| 99 | 3300005548 | Ga0070665_100275066 | Ga0070665_1002750662 | 155 |
| 100 | 3300005563 | Ga0068855_100246552 | Ga0068855_1002465522 | 155 |
| 101 | 3300005577 | Ga0068857_100282195 | Ga0068857_1002821952 | 155 |
| 102 | 3300005578 | Ga0068854_100648616 | Ga0068854_1006486162 | 155 |
| 103 | 3300005616 | Ga0068852_100015237 | Ga0068852_1000152376 | 155 |
| 104 | 3300005616 | Ga0068852_100137985 | Ga0068852_1001379852 | 155 |
| 105 | 3300005618 | Ga0068864_100076648 | Ga0068864_1000766481 | 155 |
| 106 | 3300005718 | Ga0068866_10193593 | Ga0068866_101935932 | 155 |
| 107 | 3300005840 | Ga0068870_10062015 | Ga0068870_100620152 | 155 |
| 108 | 3300005842 | Ga0068858_100183267 | Ga0068858_1001832672 | 155 |
| 109 | 3300005843 | Ga0068860_100594391 | Ga0068860_1005943912 | 155 |
| 110 | 3300006175 | Ga0070712_100269239 | Ga0070712_1002692393 | 155 |
| 111 | 3300006175 | Ga0070712_100820723 | Ga0070712_1008207231 | 155 |
| 112 | 3300006237 | Ga0097621_100478245 | Ga0097621_1004782453 | 155 |
| 113 | 3300006358 | Ga0068871_100007093 | Ga0068871_1000070933 | 155 |
| 114 | 3300006358 | Ga0068871_100338703 | Ga0068871_1003387032 | 155 |
| 115 | 3300009093 | Ga0105240_10002870 | Ga0105240_100028704 | 155 |
| 116 | 3300009093 | Ga0105240_10031565 | Ga0105240_100315653 | 155 |
| 117 | 3300009093 | Ga0105240_10367260 | Ga0105240_103672602 | 155 |
| 118 | 3300009093 | Ga0105240_10887870 | Ga0105240_108878702 | 155 |
| 119 | 3300009093 | Ga0105240_11127749 | Ga0105240_111277492 | 155 |
| 120 | 3300009101 | Ga0105247_10004766 | Ga0105247_100047665 | 155 |
| 121 | 3300009101 | Ga0105247_10147938 | Ga0105247_101479381 | 155 |
| 122 | 3300009101 | Ga0105247_10512964 | Ga0105247_105129642 | 155 |
| 123 | 3300009174 | Ga0105241_10021669 | Ga0105241_100216696 | 155 |
| 124 | 3300009174 | Ga0105241_10029757 | Ga0105241_100297573 | 155 |
| 125 | 3300009176 | Ga0105242_10020635 | Ga0105242_100206353 | 155 |
| 126 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011443 | 155 |
| 127 | 3300009177 | Ga0105248_11235995 | Ga0105248_112359952 | 155 |
| 128 | 3300009545 | Ga0105237_10239817 | Ga0105237_102398172 | 155 |
| 129 | 3300009545 | Ga0105237_10251273 | Ga0105237_102512732 | 155 |
| 130 | 3300009545 | Ga0105237_11157783 | Ga0105237_111577832 | 155 |
| 131 | 3300009545 | Ga0105237_11349646 | Ga0105237_113496461 | 155 |
| 132 | 3300009545 | Ga0105237_11826496 | Ga0105237_118264961 | 155 |
| 133 | 3300009551 | Ga0105238_10206601 | Ga0105238_102066011 | 155 |
| 134 | 3300009551 | Ga0105238_10598235 | Ga0105238_105982352 | 155 |
| 135 | 3300009553 | Ga0105249_10816926 | Ga0105249_108169263 | 155 |
| 136 | 3300009553 | Ga0105249_13052870 | Ga0105249_130528701 | 155 |
| 137 | 3300010375 | Ga0105239_10004846 | Ga0105239_100048465 | 155 |
| 138 | 3300010375 | Ga0105239_10229125 | Ga0105239_102291253 | 155 |
| 139 | 3300010375 | Ga0105239_10329588 | Ga0105239_103295882 | 155 |
| 140 | 3300010375 | Ga0105239_10404578 | Ga0105239_104045783 | 155 |
| 141 | 3300011119 | Ga0105246_10039033 | Ga0105246_100390332 | 155 |
| 142 | 3300011119 | Ga0105246_10617745 | Ga0105246_106177452 | 155 |
| 143 | 3300013105 | Ga0157369_10001844 | Ga0157369_1000184419 | 155 |
| 144 | 3300013105 | Ga0157369_10176423 | Ga0157369_101764233 | 155 |
| 145 | 3300013297 | Ga0157378_10082441 | Ga0157378_100824413 | 155 |
| 146 | 3300013297 | Ga0157378_10472339 | Ga0157378_104723392 | 155 |
| 147 | 3300013307 | Ga0157372_11206619 | Ga0157372_112066191 | 155 |
| 148 | 3300014325 | Ga0163163_10495015 | Ga0163163_104950152 | 155 |
| 149 | 3300014969 | Ga0157376_10699611 | Ga0157376_106996111 | 155 |
| 150 | 3300014969 | Ga0157376_11518183 | Ga0157376_115181832 | 155 |
| 151 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008408 | 155 |
| 152 | 3300025899 | Ga0207642_10233967 | Ga0207642_102339672 | 155 |
| 153 | 3300025900 | Ga0207710_10114235 | Ga0207710_101142351 | 155 |
| 154 | 3300025907 | Ga0207645_10016250 | Ga0207645_100162502 | 155 |
| 155 | 3300025908 | Ga0207643_10020522 | Ga0207643_100205223 | 155 |
| 156 | 3300025911 | Ga0207654_10024438 | Ga0207654_100244382 | 155 |
| 157 | 3300025911 | Ga0207654_10604457 | Ga0207654_106044572 | 155 |
| 158 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002104 | 155 |
| 159 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012458 | 155 |
| 160 | 3300025913 | Ga0207695_10070818 | Ga0207695_100708185 | 155 |
| 161 | 3300025915 | Ga0207693_10085790 | Ga0207693_100857902 | 155 |
| 162 | 3300025916 | Ga0207663_10414639 | Ga0207663_104146392 | 155 |
| 163 | 3300025917 | Ga0207660_10000762 | Ga0207660_1000076212 | 155 |
| 164 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006210 | 155 |
| 165 | 3300025924 | Ga0207694_10080815 | Ga0207694_100808153 | 155 |
| 166 | 3300025926 | Ga0207659_10639735 | Ga0207659_106397352 | 155 |
| 167 | 3300025927 | Ga0207687_11376295 | Ga0207687_113762951 | 155 |
| 168 | 3300025932 | Ga0207690_10668038 | Ga0207690_106680382 | 155 |
| 169 | 3300025935 | Ga0207709_10015320 | Ga0207709_100153204 | 155 |
| 170 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001431 | 155 |
| 171 | 3300025941 | Ga0207711_10293964 | Ga0207711_102939642 | 155 |
| 172 | 3300025942 | Ga0207689_11079006 | Ga0207689_110790062 | 155 |
| 173 | 3300025945 | Ga0207679_10616649 | Ga0207679_106166492 | 155 |
| 174 | 3300025949 | Ga0207667_10000484 | Ga0207667_1000048410 | 155 |
| 175 | 3300025961 | Ga0207712_10034051 | Ga0207712_100340513 | 155 |
| 176 | 3300025981 | Ga0207640_10423852 | Ga0207640_104238522 | 155 |
| 177 | 3300025986 | Ga0207658_10101080 | Ga0207658_101010801 | 155 |
| 178 | 3300026035 | Ga0207703_10362002 | Ga0207703_103620022 | 155 |
| 179 | 3300026041 | Ga0207639_10013412 | Ga0207639_100134123 | 155 |
| 180 | 3300026041 | Ga0207639_10073293 | Ga0207639_100732932 | 155 |
| 181 | 3300026088 | Ga0207641_10220240 | Ga0207641_102202402 | 155 |
| 182 | 3300026089 | Ga0207648_10005473 | Ga0207648_100054737 | 155 |
| 183 | 3300026116 | Ga0207674_10327257 | Ga0207674_103272572 | 155 |
| 184 | 3300026121 | Ga0207683_10591401 | Ga0207683_105914012 | 155 |
| 185 | 3300026142 | Ga0207698_10001029 | Ga0207698_1000102918 | 155 |
| 186 | 3300026142 | Ga0207698_10060313 | Ga0207698_100603132 | 155 |
| 187 | 3300026142 | Ga0207698_10071704 | Ga0207698_100717042 | 155 |
| 188 | 3300028379 | Ga0268266_10057702 | Ga0268266_100577022 | 155 |
| 189 | 3300028379 | Ga0268266_10159546 | Ga0268266_101595463 | 155 |
| 190 | 3300028379 | Ga0268266_10597594 | Ga0268266_105975942 | 155 |
| 191 | 3300028381 | Ga0268264_10100540 | Ga0268264_101005403 | 155 |
| 192 | 3300028381 | Ga0268264_10395584 | Ga0268264_103955842 | 155 |
| 193 | 3300028558 | Ga0265326_10056203 | Ga0265326_100562032 | 155 |
| 194 | 3300028573 | Ga0265334_10018182 | Ga0265334_100181822 | 155 |
| 195 | 3300028577 | Ga0265318_10002560 | Ga0265318_100025604 | 155 |
| 196 | 3300028800 | Ga0265338_10000011 | Ga0265338_1000001177 | 155 |
| 197 | 3300028800 | Ga0265338_10010424 | Ga0265338_100104243 | 155 |
| 198 | 3300031238 | Ga0265332_10028790 | Ga0265332_100287903 | 155 |
| 199 | 3300031238 | Ga0265332_10030345 | Ga0265332_100303452 | 155 |
| 200 | 3300031239 | Ga0265328_10194015 | Ga0265328_101940151 | 155 |
| 201 | 3300031240 | Ga0265320_10107986 | Ga0265320_101079862 | 155 |
| 202 | 3300031241 | Ga0265325_10000017 | Ga0265325_1000001783 | 155 |
| 203 | 3300031241 | Ga0265325_10024366 | Ga0265325_100243664 | 155 |
| 204 | 3300031242 | Ga0265329_10006493 | Ga0265329_100064933 | 155 |
| 205 | 3300031249 | Ga0265339_10000895 | Ga0265339_1000089521 | 155 |
| 206 | 3300031250 | Ga0265331_10003379 | Ga0265331_100033797 | 155 |
| 207 | 3300031250 | Ga0265331_10013806 | Ga0265331_100138063 | 155 |
| 208 | 3300031344 | Ga0265316_10141463 | Ga0265316_101414632 | 155 |
| 209 | 3300031595 | Ga0265313_10005228 | Ga0265313_100052283 | 155 |
| 210 | 3300031595 | Ga0265313_10007533 | Ga0265313_100075333 | 155 |
| 211 | 3300031595 | Ga0265313_10010085 | Ga0265313_100100853 | 155 |
| 212 | 3300031711 | Ga0265314_10005990 | Ga0265314_100059906 | 155 |
| 213 | 3300031711 | Ga0265314_10007494 | Ga0265314_100074944 | 155 |
| 214 | 3300031711 | Ga0265314_10031435 | Ga0265314_100314353 | 155 |
| 215 | 3300031712 | Ga0265342_10029287 | Ga0265342_100292872 | 155 |
| 216 | 3300031730 | Ga0307516_10030531 | Ga0307516_100305312 | 155 |
| 217 | 3300039437 | Ga0436365_0448800 | Ga0436365_0448800_197_670 | 155 |
| 218 | 3300039437 | Ga0436365_0577140 | Ga0436365_0577140_7112_7585 | 155 |
| 219 | 3300039437 | Ga0436365_1264489 | Ga0436365_1264489_848_1315 | 155 |
| 220 | 3300039447 | Ga0436361_0796701 | Ga0436361_0796701_134_607 | 155 |
| 221 | 3300039450 | Ga0436363_0355221 | Ga0436363_0355221_116_589 | 155 |
| 222 | 3300046462 | Ga0495651_0741033 | Ga0495651_0741033_54_524 | 155 |
| 223 | 3300046524 | Ga0495648_0074879 | Ga0495648_0074879_524_997 | 155 |
| 224 | 3300046538 | Ga0495609_0015399 | Ga0495609_0015399_2418_2891 | 155 |
| 225 | 3300046539 | Ga0495621_0305515 | Ga0495621_0305515_131_604 | 155 |
| 226 | 3300046557 | Ga0495622_0009823 | Ga0495622_0009823_2750_3223 | 155 |
| 227 | 3300046558 | Ga0495633_0380312 | Ga0495633_0380312_133_606 | 155 |
| 228 | 3300047320 | Ga0495672_0556991 | Ga0495672_0556991_17_490 | 155 |
| 229 | 3300048903 | Ga0496100_0748828 | Ga0496100_0748828_169_639 | 155 |
| 230 | 3300048924 | Ga0496121_0016235 | Ga0496121_0016235_2178_2648 | 155 |
| 231 | 3300048929 | Ga0496126_0358679 | Ga0496126_0358679_592_1065 | 155 |
| 232 | 3300049460 | Ga0495682_0001443 | Ga0495682_0001443_7653_8123 | 155 |
| 233 | 3300049571 | Ga0501034_0315936 | Ga0501034_0315936_251_721 | 155 |
| 234 | 3300049579 | Ga0501043_0247448 | Ga0501043_0247448_35_502 | 155 |
| 235 | 3300049580 | Ga0501046_0090783 | Ga0501046_0090783_1202_1675 | 155 |
| 236 | 3300049580 | Ga0501046_0276044 | Ga0501046_0276044_498_968 | 155 |
| 237 | 3300049581 | Ga0501047_0006654 | Ga0501047_0006654_8288_8761 | 155 |
| 238 | 3300049581 | Ga0501047_0008920 | Ga0501047_0008920_4430_4897 | 155 |
| 239 | 3300049581 | Ga0501047_0065424 | Ga0501047_0065424_3011_3478 | 155 |
| 240 | 3300049581 | Ga0501047_0205133 | Ga0501047_0205133_995_1465 | 155 |
| 241 | 3300049583 | Ga0501067_0000481 | Ga0501067_0000481_11971_12438 | 155 |
| 242 | 3300049583 | Ga0501067_0432754 | Ga0501067_0432754_224_691 | 155 |
| 243 | 3300049586 | Ga0501070_0212138 | Ga0501070_0212138_167_637 | 155 |
| 244 | 3300049588 | Ga0501072_0001282 | Ga0501072_0001282_4634_5101 | 155 |
| 245 | 3300049589 | Ga0501073_0206832 | Ga0501073_0206832_478_945 | 155 |
| 246 | 3300049742 | Ga0501080_0036992 | Ga0501080_0036992_478_948 | 155 |
| 247 | 3300049742 | Ga0501080_0207675 | Ga0501080_0207675_200_673 | 155 |
| 248 | 3300049742 | Ga0501080_0227132 | Ga0501080_0227132_1058_1531 | 155 |
| 249 | 3300049742 | Ga0501080_0309605 | Ga0501080_0309605_56_523 | 155 |
| 250 | 3300049742 | Ga0501080_0415554 | Ga0501080_0415554_53_523 | 155 |
| 251 | 3300049822 | Ga0501035_0323732 | Ga0501035_0323732_365_832 | 155 |
| 252 | 3300049823 | Ga0501044_0187096 | Ga0501044_0187096_1373_1843 | 155 |
| 253 | 3300049823 | Ga0501044_0637730 | Ga0501044_0637730_461_934 | 155 |
| 254 | 3300053136 | Ga0500559_0185689 | Ga0500559_0185689_51_536 | 155 |
| 255 | 3300053154 | Ga0500619_001627 | Ga0500619_001627_3003_3473 | 155 |
| 256 | 3300054114 | Ga0501084_0000366 | Ga0501084_0000366_245_712 | 155 |
| 257 | 3300060353 | Ga0501082_0171551 | Ga0501082_0171551_1287_1754 | 155 |
| 258 | 3300005330 | Ga0070690_100119451 | Ga0070690_1001194513 | 156 |
| 259 | 3300005331 | Ga0070670_101205585 | Ga0070670_1012055851 | 156 |
| 260 | 3300005335 | Ga0070666_10076220 | Ga0070666_100762202 | 156 |
| 261 | 3300005338 | Ga0068868_100069238 | Ga0068868_1000692383 | 156 |
| 262 | 3300005338 | Ga0068868_100081729 | Ga0068868_1000817292 | 156 |
| 263 | 3300005338 | Ga0068868_100440182 | Ga0068868_1004401822 | 156 |
| 264 | 3300005344 | Ga0070661_100534413 | Ga0070661_1005344131 | 156 |
| 265 | 3300005367 | Ga0070667_100552273 | Ga0070667_1005522731 | 156 |
| 266 | 3300005367 | Ga0070667_100829758 | Ga0070667_1008297582 | 156 |
| 267 | 3300005440 | Ga0070705_101241632 | Ga0070705_1012416321 | 156 |
| 268 | 3300005456 | Ga0070678_100026666 | Ga0070678_1000266664 | 156 |
| 269 | 3300005456 | Ga0070678_100028400 | Ga0070678_1000284005 | 156 |
| 270 | 3300005456 | Ga0070678_100070242 | Ga0070678_1000702422 | 156 |
| 271 | 3300005458 | Ga0070681_10057249 | Ga0070681_100572495 | 156 |
| 272 | 3300005459 | Ga0068867_100256306 | Ga0068867_1002563062 | 156 |
| 273 | 3300005535 | Ga0070684_100210563 | Ga0070684_1002105632 | 156 |
| 274 | 3300005535 | Ga0070684_100271498 | Ga0070684_1002714981 | 156 |
| 275 | 3300005539 | Ga0068853_100990536 | Ga0068853_1009905361 | 156 |
| 276 | 3300005539 | Ga0068853_101090277 | Ga0068853_1010902771 | 156 |
| 277 | 3300005547 | Ga0070693_100081443 | Ga0070693_1000814432 | 156 |
| 278 | 3300005548 | Ga0070665_100142381 | Ga0070665_1001423813 | 156 |
| 279 | 3300005563 | Ga0068855_100462369 | Ga0068855_1004623693 | 156 |
| 280 | 3300005563 | Ga0068855_101076563 | Ga0068855_1010765631 | 156 |
| 281 | 3300005577 | Ga0068857_101956901 | Ga0068857_1019569011 | 156 |
| 282 | 3300005614 | Ga0068856_100566969 | Ga0068856_1005669692 | 156 |
| 283 | 3300005614 | Ga0068856_100927282 | Ga0068856_1009272822 | 156 |
| 284 | 3300005617 | Ga0068859_100452005 | Ga0068859_1004520052 | 156 |
| 285 | 3300005618 | Ga0068864_101421893 | Ga0068864_1014218932 | 156 |
| 286 | 3300005842 | Ga0068858_100020784 | Ga0068858_1000207842 | 156 |
| 287 | 3300005842 | Ga0068858_100733696 | Ga0068858_1007336962 | 156 |
| 288 | 3300006175 | Ga0070712_100660458 | Ga0070712_1006604582 | 156 |
| 289 | 3300006237 | Ga0097621_100001436 | Ga0097621_10000143611 | 156 |
| 290 | 3300006237 | Ga0097621_100197113 | Ga0097621_1001971132 | 156 |
| 291 | 3300006237 | Ga0097621_100278623 | Ga0097621_1002786233 | 156 |
| 292 | 3300006237 | Ga0097621_100335531 | Ga0097621_1003355313 | 156 |
| 293 | 3300006358 | Ga0068871_100000329 | Ga0068871_10000032925 | 156 |
| 294 | 3300006358 | Ga0068871_100072694 | Ga0068871_1000726942 | 156 |
| 295 | 3300006358 | Ga0068871_100113304 | Ga0068871_1001133043 | 156 |
| 296 | 3300006358 | Ga0068871_100170069 | Ga0068871_1001700692 | 156 |
| 297 | 3300006358 | Ga0068871_100207079 | Ga0068871_1002070793 | 156 |
| 298 | 3300006358 | Ga0068871_100495401 | Ga0068871_1004954011 | 156 |
| 299 | 3300006881 | Ga0068865_100085499 | Ga0068865_1000854992 | 156 |
| 300 | 3300006931 | Ga0097620_100452012 | Ga0097620_1004520122 | 156 |
| 301 | 3300009093 | Ga0105240_10260545 | Ga0105240_102605453 | 156 |
| 302 | 3300009093 | Ga0105240_10470357 | Ga0105240_104703573 | 156 |
| 303 | 3300009093 | Ga0105240_10513319 | Ga0105240_105133193 | 156 |
| 304 | 3300009093 | Ga0105240_10594310 | Ga0105240_105943101 | 156 |
| 305 | 3300009093 | Ga0105240_10732460 | Ga0105240_107324603 | 156 |
| 306 | 3300009098 | Ga0105245_10022596 | Ga0105245_100225963 | 156 |
| 307 | 3300009098 | Ga0105245_10080647 | Ga0105245_100806474 | 156 |
| 308 | 3300009098 | Ga0105245_10485349 | Ga0105245_104853491 | 156 |
| 309 | 3300009098 | Ga0105245_11204084 | Ga0105245_112040842 | 156 |
| 310 | 3300009148 | Ga0105243_10529716 | Ga0105243_105297161 | 156 |
| 311 | 3300009174 | Ga0105241_10191554 | Ga0105241_101915543 | 156 |
| 312 | 3300009174 | Ga0105241_10822493 | Ga0105241_108224931 | 156 |
| 313 | 3300009176 | Ga0105242_10020889 | Ga0105242_100208892 | 156 |
| 314 | 3300009176 | Ga0105242_10025118 | Ga0105242_100251182 | 156 |
| 315 | 3300009176 | Ga0105242_10360506 | Ga0105242_103605062 | 156 |
| 316 | 3300009177 | Ga0105248_10327564 | Ga0105248_103275643 | 156 |
| 317 | 3300009177 | Ga0105248_11113184 | Ga0105248_111131842 | 156 |
| 318 | 3300009545 | Ga0105237_10706865 | Ga0105237_107068651 | 156 |
| 319 | 3300009551 | Ga0105238_10848330 | Ga0105238_108483302 | 156 |
| 320 | 3300009553 | Ga0105249_10761222 | Ga0105249_107612221 | 156 |
| 321 | 3300010375 | Ga0105239_12164550 | Ga0105239_121645501 | 156 |
| 322 | 3300011119 | Ga0105246_10103733 | Ga0105246_101037334 | 156 |
| 323 | 3300013104 | Ga0157370_10034135 | Ga0157370_100341352 | 156 |
| 324 | 3300013105 | Ga0157369_11163159 | Ga0157369_111631591 | 156 |
| 325 | 3300013296 | Ga0157374_10103819 | Ga0157374_101038192 | 156 |
| 326 | 3300013296 | Ga0157374_10249080 | Ga0157374_102490803 | 156 |
| 327 | 3300013296 | Ga0157374_11412075 | Ga0157374_114120751 | 156 |
| 328 | 3300013297 | Ga0157378_10046152 | Ga0157378_100461523 | 156 |
| 329 | 3300013297 | Ga0157378_10109188 | Ga0157378_101091882 | 156 |
| 330 | 3300013297 | Ga0157378_10577928 | Ga0157378_105779282 | 156 |
| 331 | 3300013306 | Ga0163162_10125826 | Ga0163162_101258262 | 156 |
| 332 | 3300013306 | Ga0163162_12676455 | Ga0163162_126764551 | 156 |
| 333 | 3300013307 | Ga0157372_10377024 | Ga0157372_103770243 | 156 |
| 334 | 3300013308 | Ga0157375_10168950 | Ga0157375_101689503 | 156 |
| 335 | 3300013308 | Ga0157375_10882518 | Ga0157375_108825182 | 156 |
| 336 | 3300014968 | Ga0157379_10002945 | Ga0157379_100029458 | 156 |
| 337 | 3300014968 | Ga0157379_10015566 | Ga0157379_100155666 | 156 |
| 338 | 3300014968 | Ga0157379_10212106 | Ga0157379_102121062 | 156 |
| 339 | 3300014969 | Ga0157376_10342519 | Ga0157376_103425193 | 156 |
| 340 | 3300014969 | Ga0157376_10418456 | Ga0157376_104184562 | 156 |
| 341 | 3300014969 | Ga0157376_10546745 | Ga0157376_105467452 | 156 |
| 342 | 3300014969 | Ga0157376_11513187 | Ga0157376_115131872 | 156 |
| 343 | 3300014969 | Ga0157376_12055537 | Ga0157376_120555371 | 156 |
| 344 | 3300025899 | Ga0207642_10143329 | Ga0207642_101433292 | 156 |
| 345 | 3300025903 | Ga0207680_10162112 | Ga0207680_101621123 | 156 |
| 346 | 3300025909 | Ga0207705_10233215 | Ga0207705_102332152 | 156 |
| 347 | 3300025911 | Ga0207654_10886494 | Ga0207654_108864941 | 156 |
| 348 | 3300025913 | Ga0207695_10377153 | Ga0207695_103771532 | 156 |
| 349 | 3300025913 | Ga0207695_10991755 | Ga0207695_109917551 | 156 |
| 350 | 3300025915 | Ga0207693_10521454 | Ga0207693_105214542 | 156 |
| 351 | 3300025923 | Ga0207681_10861965 | Ga0207681_108619651 | 156 |
| 352 | 3300025925 | Ga0207650_10283041 | Ga0207650_102830413 | 156 |
| 353 | 3300025927 | Ga0207687_10083759 | Ga0207687_100837593 | 156 |
| 354 | 3300025927 | Ga0207687_10230472 | Ga0207687_102304722 | 156 |
| 355 | 3300025928 | Ga0207700_10355802 | Ga0207700_103558022 | 156 |
| 356 | 3300025931 | Ga0207644_10098489 | Ga0207644_100984893 | 156 |
| 357 | 3300025933 | Ga0207706_10075011 | Ga0207706_100750112 | 156 |
| 358 | 3300025934 | Ga0207686_10007932 | Ga0207686_100079326 | 156 |
| 359 | 3300025934 | Ga0207686_10079547 | Ga0207686_100795472 | 156 |
| 360 | 3300025934 | Ga0207686_10232254 | Ga0207686_102322541 | 156 |
| 361 | 3300025934 | Ga0207686_10842101 | Ga0207686_108421011 | 156 |
| 362 | 3300025938 | Ga0207704_10912711 | Ga0207704_109127112 | 156 |
| 363 | 3300025941 | Ga0207711_10154528 | Ga0207711_101545283 | 156 |
| 364 | 3300025942 | Ga0207689_10066225 | Ga0207689_100662252 | 156 |
| 365 | 3300025942 | Ga0207689_10308801 | Ga0207689_103088012 | 156 |
| 366 | 3300025944 | Ga0207661_10778526 | Ga0207661_107785261 | 156 |
| 367 | 3300025949 | Ga0207667_10042630 | Ga0207667_100426306 | 156 |
| 368 | 3300025949 | Ga0207667_11301923 | Ga0207667_113019231 | 156 |
| 369 | 3300026023 | Ga0207677_10139294 | Ga0207677_101392942 | 156 |
| 370 | 3300026023 | Ga0207677_10386882 | Ga0207677_103868822 | 156 |
| 371 | 3300026035 | Ga0207703_10042079 | Ga0207703_100420792 | 156 |
| 372 | 3300026035 | Ga0207703_10339880 | Ga0207703_103398802 | 156 |
| 373 | 3300026035 | Ga0207703_10909093 | Ga0207703_109090931 | 156 |
| 374 | 3300026089 | Ga0207648_10255101 | Ga0207648_102551012 | 156 |
| 375 | 3300026095 | Ga0207676_10879723 | Ga0207676_108797231 | 156 |
| 376 | 3300026116 | Ga0207674_10721842 | Ga0207674_107218421 | 156 |
| 377 | 3300026118 | Ga0207675_100082307 | Ga0207675_1000823073 | 156 |
| 378 | 3300026121 | Ga0207683_10008637 | Ga0207683_100086375 | 156 |
| 379 | 3300026121 | Ga0207683_10021754 | Ga0207683_100217543 | 156 |
| 380 | 3300026121 | Ga0207683_10128768 | Ga0207683_101287683 | 156 |
| 381 | 3300028379 | Ga0268266_10064534 | Ga0268266_100645341 | 156 |
| 382 | 3300028381 | Ga0268264_10097183 | Ga0268264_100971833 | 156 |
| 383 | 3300028800 | Ga0265338_10007110 | Ga0265338_100071103 | 156 |
| 384 | 3300031238 | Ga0265332_10069078 | Ga0265332_100690782 | 156 |
| 385 | 3300031238 | Ga0265332_10165921 | Ga0265332_101659211 | 156 |
| 386 | 3300031247 | Ga0265340_10003976 | Ga0265340_100039764 | 156 |
| 387 | 3300031247 | Ga0265340_10274388 | Ga0265340_102743882 | 156 |
| 388 | 3300031250 | Ga0265331_10009636 | Ga0265331_100096363 | 156 |
| 389 | 3300031344 | Ga0265316_10059973 | Ga0265316_100599734 | 156 |
| 390 | 3300031344 | Ga0265316_10329545 | Ga0265316_103295453 | 156 |
| 391 | 3300031711 | Ga0265314_10012633 | Ga0265314_100126334 | 156 |
| 392 | 3300035112 | Ga0373932_0114490 | Ga0373932_0114490_387_863 | 156 |
| 393 | 3300035114 | Ga0373939_0027361 | Ga0373939_0027361_1125_1601 | 156 |
| 394 | 3300035172 | Ga0373955_0771102 | Ga0373955_0771102_52_528 | 156 |
| 395 | 3300035172 | Ga0373955_0925983 | Ga0373955_0925983_37_510 | 156 |
| 396 | 3300036401 | Ga0373937_0790122 | Ga0373937_0790122_210_683 | 156 |
| 397 | 3300036401 | Ga0373937_1062792 | Ga0373937_1062792_142_615 | 156 |
| 398 | 3300037466 | Ga0395898_0074177 | Ga0395898_0074177_526_999 | 156 |
| 399 | 3300039437 | Ga0436365_1131003 | Ga0436365_1131003_197_667 | 156 |
| 400 | 3300039438 | Ga0436360_0558935 | Ga0436360_0558935_888_1364 | 156 |
| 401 | 3300045976 | Ga0466967_0366245 | Ga0466967_0366245_644_1117 | 156 |
| 402 | 3300046529 | Ga0495652_0832461 | Ga0495652_0832461_109_582 | 156 |
| 403 | 3300046678 | Ga0495599_0372969 | Ga0495599_0372969_136_609 | 156 |
| 404 | 3300046691 | Ga0495670_0326786 | Ga0495670_0326786_273_749 | 156 |
| 405 | 3300047315 | Ga0495581_0269866 | Ga0495581_0269866_368_841 | 156 |
| 406 | 3300047673 | Ga0495593_0147465 | Ga0495593_0147465_625_1101 | 156 |
| 407 | 3300047673 | Ga0495593_0571083 | Ga0495593_0571083_57_533 | 156 |
| 408 | 3300048909 | Ga0496106_0336546 | Ga0496106_0336546_588_1064 | 156 |
| 409 | 3300048917 | Ga0496114_1637730 | Ga0496114_1637730_46_522 | 156 |
| 410 | 3300049568 | Ga0501031_0148555 | Ga0501031_0148555_267_743 | 156 |
| 411 | 3300049569 | Ga0501032_0026248 | Ga0501032_0026248_3155_3631 | 156 |
| 412 | 3300049570 | Ga0501033_0317075 | Ga0501033_0317075_612_1085 | 156 |
| 413 | 3300049571 | Ga0501034_0518932 | Ga0501034_0518932_358_834 | 156 |
| 414 | 3300049573 | Ga0501037_0009459 | Ga0501037_0009459_5834_6310 | 156 |
| 415 | 3300049574 | Ga0501038_0065266 | Ga0501038_0065266_1644_2120 | 156 |
| 416 | 3300049579 | Ga0501043_0041740 | Ga0501043_0041740_2191_2667 | 156 |
| 417 | 3300049579 | Ga0501043_0786915 | Ga0501043_0786915_51_524 | 156 |
| 418 | 3300049581 | Ga0501047_0079440 | Ga0501047_0079440_1643_2119 | 156 |
| 419 | 3300049581 | Ga0501047_0293014 | Ga0501047_0293014_832_1308 | 156 |
| 420 | 3300049586 | Ga0501070_0000014 | Ga0501070_0000014_62971_63447 | 156 |
| 421 | 3300049741 | Ga0501079_0098379 | Ga0501079_0098379_1411_1887 | 156 |
| 422 | 3300049742 | Ga0501080_0001353 | Ga0501080_0001353_5343_5819 | 156 |
| 423 | 3300049822 | Ga0501035_0001780 | Ga0501035_0001780_17002_17478 | 156 |
| 424 | 3300049823 | Ga0501044_0022525 | Ga0501044_0022525_1234_1707 | 156 |
| 425 | 3300049823 | Ga0501044_0084197 | Ga0501044_0084197_865_1341 | 156 |
| 426 | 3300053103 | Ga0500555_004524 | Ga0500555_004524_2614_3087 | 156 |
| 427 | 3300053119 | Ga0500595_002039 | Ga0500595_002039_8174_8650 | 156 |
| 428 | 3300053119 | Ga0500595_003993 | Ga0500595_003993_5622_6116 | 156 |
| 429 | 3300005327 | Ga0070658_10006016 | Ga0070658_100060162 | 157 |
| 430 | 3300005335 | Ga0070666_10000633 | Ga0070666_100006339 | 157 |
| 431 | 3300005336 | Ga0070680_100105641 | Ga0070680_1001056412 | 157 |
| 432 | 3300005339 | Ga0070660_100032812 | Ga0070660_1000328122 | 157 |
| 433 | 3300005341 | Ga0070691_10168035 | Ga0070691_101680352 | 157 |
| 434 | 3300005355 | Ga0070671_101283766 | Ga0070671_1012837661 | 157 |
| 435 | 3300005366 | Ga0070659_100390384 | Ga0070659_1003903842 | 157 |
| 436 | 3300005434 | Ga0070709_10001252 | Ga0070709_100012525 | 157 |
| 437 | 3300005434 | Ga0070709_10557283 | Ga0070709_105572832 | 157 |
| 438 | 3300005436 | Ga0070713_100000199 | Ga0070713_10000019913 | 157 |
| 439 | 3300005437 | Ga0070710_10256962 | Ga0070710_102569622 | 157 |
| 440 | 3300005439 | Ga0070711_100005086 | Ga0070711_1000050864 | 157 |
| 441 | 3300005439 | Ga0070711_100174461 | Ga0070711_1001744612 | 157 |
| 442 | 3300005440 | Ga0070705_100031377 | Ga0070705_1000313772 | 157 |
| 443 | 3300005458 | Ga0070681_10059268 | Ga0070681_100592685 | 157 |
| 444 | 3300005458 | Ga0070681_10217568 | Ga0070681_102175682 | 157 |
| 445 | 3300005458 | Ga0070681_10420405 | Ga0070681_104204052 | 157 |
| 446 | 3300005530 | Ga0070679_100333344 | Ga0070679_1003333441 | 157 |
| 447 | 3300005539 | Ga0068853_100004853 | Ga0068853_1000048532 | 157 |
| 448 | 3300005545 | Ga0070695_100239615 | Ga0070695_1002396152 | 157 |
| 449 | 3300005546 | Ga0070696_100325619 | Ga0070696_1003256192 | 157 |
| 450 | 3300005547 | Ga0070693_100279638 | Ga0070693_1002796381 | 157 |
| 451 | 3300005548 | Ga0070665_100000728 | Ga0070665_10000072832 | 157 |
| 452 | 3300005548 | Ga0070665_100132277 | Ga0070665_1001322773 | 157 |
| 453 | 3300005563 | Ga0068855_100239980 | Ga0068855_1002399803 | 157 |
| 454 | 3300005563 | Ga0068855_100284299 | Ga0068855_1002842992 | 157 |
| 455 | 3300005563 | Ga0068855_100374770 | Ga0068855_1003747703 | 157 |
| 456 | 3300005564 | Ga0070664_100206050 | Ga0070664_1002060502 | 157 |
| 457 | 3300005577 | Ga0068857_100001360 | Ga0068857_1000013605 | 157 |
| 458 | 3300005577 | Ga0068857_100178550 | Ga0068857_1001785503 | 157 |
| 459 | 3300005614 | Ga0068856_100009449 | Ga0068856_1000094495 | 157 |
| 460 | 3300005616 | Ga0068852_100062213 | Ga0068852_1000622132 | 157 |
| 461 | 3300005842 | Ga0068858_100030997 | Ga0068858_1000309976 | 157 |
| 462 | 3300005842 | Ga0068858_100409572 | Ga0068858_1004095722 | 157 |
| 463 | 3300005844 | Ga0068862_100610709 | Ga0068862_1006107091 | 157 |
| 464 | 3300006173 | Ga0070716_100595151 | Ga0070716_1005951512 | 157 |
| 465 | 3300006175 | Ga0070712_100000443 | Ga0070712_10000044321 | 157 |
| 466 | 3300006237 | Ga0097621_100505636 | Ga0097621_1005056362 | 157 |
| 467 | 3300006237 | Ga0097621_101331889 | Ga0097621_1013318891 | 157 |
| 468 | 3300006914 | Ga0075436_100001475 | Ga0075436_1000014759 | 157 |
| 469 | 3300006914 | Ga0075436_100320300 | Ga0075436_1003203002 | 157 |
| 470 | 3300009098 | Ga0105245_10365033 | Ga0105245_103650332 | 157 |
| 471 | 3300009174 | Ga0105241_10324623 | Ga0105241_103246232 | 157 |
| 472 | 3300009174 | Ga0105241_10446664 | Ga0105241_104466642 | 157 |
| 473 | 3300009174 | Ga0105241_11213678 | Ga0105241_112136782 | 157 |
| 474 | 3300009177 | Ga0105248_10047648 | Ga0105248_100476487 | 157 |
| 475 | 3300009551 | Ga0105238_10001095 | Ga0105238_1000109524 | 157 |
| 476 | 3300010375 | Ga0105239_11105273 | Ga0105239_111052732 | 157 |
| 477 | 3300013296 | Ga0157374_10245877 | Ga0157374_102458772 | 157 |
| 478 | 3300013307 | Ga0157372_10531560 | Ga0157372_105315602 | 157 |
| 479 | 3300014497 | Ga0182008_10425385 | Ga0182008_104253851 | 157 |
| 480 | 3300014968 | Ga0157379_10002841 | Ga0157379_100028413 | 157 |
| 481 | 3300014968 | Ga0157379_10014719 | Ga0157379_100147192 | 157 |
| 482 | 3300014968 | Ga0157379_10106425 | Ga0157379_101064254 | 157 |
| 483 | 3300014968 | Ga0157379_10234922 | Ga0157379_102349222 | 157 |
| 484 | 3300021384 | Ga0213876_10014748 | Ga0213876_100147482 | 157 |
| 485 | 3300025898 | Ga0207692_10240802 | Ga0207692_102408022 | 157 |
| 486 | 3300025903 | Ga0207680_10004246 | Ga0207680_100042461 | 157 |
| 487 | 3300025906 | Ga0207699_10000124 | Ga0207699_100001245 | 157 |
| 488 | 3300025909 | Ga0207705_10010749 | Ga0207705_100107492 | 157 |
| 489 | 3300025911 | Ga0207654_10071613 | Ga0207654_100716132 | 157 |
| 490 | 3300025911 | Ga0207654_10212429 | Ga0207654_102124293 | 157 |
| 491 | 3300025911 | Ga0207654_10322641 | Ga0207654_103226412 | 157 |
| 492 | 3300025912 | Ga0207707_10052017 | Ga0207707_100520175 | 157 |
| 493 | 3300025912 | Ga0207707_10133978 | Ga0207707_101339781 | 157 |
| 494 | 3300025913 | Ga0207695_10019474 | Ga0207695_100194745 | 157 |
| 495 | 3300025913 | Ga0207695_10193310 | Ga0207695_101933103 | 157 |
| 496 | 3300025914 | Ga0207671_10041130 | Ga0207671_100411304 | 157 |
| 497 | 3300025915 | Ga0207693_10000213 | Ga0207693_1000021315 | 157 |
| 498 | 3300025915 | Ga0207693_10001025 | Ga0207693_100010259 | 157 |
| 499 | 3300025916 | Ga0207663_10074266 | Ga0207663_100742662 | 157 |
| 500 | 3300025917 | Ga0207660_10196886 | Ga0207660_101968862 | 157 |
| 501 | 3300025919 | Ga0207657_10042626 | Ga0207657_100426265 | 157 |
| 502 | 3300025920 | Ga0207649_10243234 | Ga0207649_102432342 | 157 |
| 503 | 3300025921 | Ga0207652_10950701 | Ga0207652_109507011 | 157 |
| 504 | 3300025924 | Ga0207694_10222742 | Ga0207694_102227421 | 157 |
| 505 | 3300025928 | Ga0207700_10000026 | Ga0207700_10000026149 | 157 |
| 506 | 3300025928 | Ga0207700_10015912 | Ga0207700_100159124 | 157 |
| 507 | 3300025929 | Ga0207664_10010373 | Ga0207664_100103731 | 157 |
| 508 | 3300025941 | Ga0207711_10179231 | Ga0207711_101792313 | 157 |
| 509 | 3300025949 | Ga0207667_10015995 | Ga0207667_100159952 | 157 |
| 510 | 3300025949 | Ga0207667_10087471 | Ga0207667_100874712 | 157 |
| 511 | 3300025986 | Ga0207658_10056556 | Ga0207658_100565562 | 157 |
| 512 | 3300026035 | Ga0207703_10077321 | Ga0207703_100773212 | 157 |
| 513 | 3300026041 | Ga0207639_10025732 | Ga0207639_100257326 | 157 |
| 514 | 3300026041 | Ga0207639_11091975 | Ga0207639_110919752 | 157 |
| 515 | 3300026041 | Ga0207639_11427802 | Ga0207639_114278021 | 157 |
| 516 | 3300026078 | Ga0207702_10000021 | Ga0207702_1000002198 | 157 |
| 517 | 3300026078 | Ga0207702_10009259 | Ga0207702_100092595 | 157 |
| 518 | 3300026078 | Ga0207702_10906135 | Ga0207702_109061351 | 157 |
| 519 | 3300026116 | Ga0207674_10000898 | Ga0207674_1000089823 | 157 |
| 520 | 3300026116 | Ga0207674_10075071 | Ga0207674_100750713 | 157 |
| 521 | 3300028379 | Ga0268266_10000385 | Ga0268266_1000038532 | 157 |
| 522 | 3300028379 | Ga0268266_10654579 | Ga0268266_106545792 | 157 |
| 523 | 3300028800 | Ga0265338_10013075 | Ga0265338_100130759 | 157 |
| 524 | 3300028800 | Ga0265338_10714133 | Ga0265338_107141332 | 157 |
| 525 | 3300031240 | Ga0265320_10000370 | Ga0265320_1000037030 | 157 |
| 526 | 3300031241 | Ga0265325_10000484 | Ga0265325_1000048415 | 157 |
| 527 | 3300031241 | Ga0265325_10004365 | Ga0265325_100043657 | 157 |
| 528 | 3300031241 | Ga0265325_10082607 | Ga0265325_100826072 | 157 |
| 529 | 3300031241 | Ga0265325_10090968 | Ga0265325_100909682 | 157 |
| 530 | 3300031241 | Ga0265325_10154371 | Ga0265325_101543711 | 157 |
| 531 | 3300031241 | Ga0265325_10231265 | Ga0265325_102312651 | 157 |
| 532 | 3300031242 | Ga0265329_10042822 | Ga0265329_100428222 | 157 |
| 533 | 3300031247 | Ga0265340_10024503 | Ga0265340_100245032 | 157 |
| 534 | 3300031249 | Ga0265339_10005604 | Ga0265339_100056046 | 157 |
| 535 | 3300031249 | Ga0265339_10141253 | Ga0265339_101412532 | 157 |
| 536 | 3300031250 | Ga0265331_10078937 | Ga0265331_100789372 | 157 |
| 537 | 3300031344 | Ga0265316_10044324 | Ga0265316_100443243 | 157 |
| 538 | 3300031344 | Ga0265316_10245902 | Ga0265316_102459022 | 157 |
| 539 | 3300031344 | Ga0265316_10450315 | Ga0265316_104503151 | 157 |
| 540 | 3300031595 | Ga0265313_10004380 | Ga0265313_100043804 | 157 |
| 541 | 3300031595 | Ga0265313_10124895 | Ga0265313_101248952 | 157 |
| 542 | 3300031595 | Ga0265313_10256007 | Ga0265313_102560071 | 157 |
| 543 | 3300031711 | Ga0265314_10007742 | Ga0265314_100077429 | 157 |
| 544 | 3300031711 | Ga0265314_10149776 | Ga0265314_101497762 | 157 |
| 545 | 3300031711 | Ga0265314_10249566 | Ga0265314_102495662 | 157 |
| 546 | 3300031712 | Ga0265342_10057244 | Ga0265342_100572442 | 157 |
| 547 | 3300031712 | Ga0265342_10252969 | Ga0265342_102529692 | 157 |
| 548 | 3300035118 | Ga0373954_0153251 | Ga0373954_0153251_203_676 | 157 |
| 549 | 3300035695 | Ga0373927_0168409 | Ga0373927_0168409_71_565 | 157 |
| 550 | 3300035724 | Ga0373933_0018352 | Ga0373933_0018352_3224_3697 | 157 |
| 551 | 3300035724 | Ga0373933_0272850 | Ga0373933_0272850_117_611 | 157 |
| 552 | 3300035724 | Ga0373933_0472295 | Ga0373933_0472295_239_733 | 157 |
| 553 | 3300036401 | Ga0373937_0001347 | Ga0373937_0001347_19134_19628 | 157 |
| 554 | 3300036401 | Ga0373937_0017765 | Ga0373937_0017765_5531_6004 | 157 |
| 555 | 3300036401 | Ga0373937_0083005 | Ga0373937_0083005_890_1363 | 157 |
| 556 | 3300036401 | Ga0373937_0320255 | Ga0373937_0320255_377_871 | 157 |
| 557 | 3300037068 | Ga0373925_0368220 | Ga0373925_0368220_172_666 | 157 |
| 558 | 3300037418 | Ga0395900_0039256 | Ga0395900_0039256_428_904 | 157 |
| 559 | 3300038443 | Ga0395901_0010855 | Ga0395901_0010855_4711_5187 | 157 |
| 560 | 3300039437 | Ga0436365_0390587 | Ga0436365_0390587_2417_2890 | 157 |
| 561 | 3300039453 | Ga0436362_1185563 | Ga0436362_1185563_187_660 | 157 |
| 562 | 3300045976 | Ga0466967_1005322 | Ga0466967_1005322_292_768 | 157 |
| 563 | 3300046462 | Ga0495651_0336322 | Ga0495651_0336322_479_952 | 157 |
| 564 | 3300046516 | Ga0495628_0395773 | Ga0495628_0395773_416_979 | 157 |
| 565 | 3300046648 | Ga0495611_0339948 | Ga0495611_0339948_16_495 | 157 |
| 566 | 3300047319 | Ga0495674_0211461 | Ga0495674_0211461_290_763 | 157 |
| 567 | 3300048905 | Ga0496102_0278391 | Ga0496102_0278391_706_1179 | 157 |
| 568 | 3300048909 | Ga0496106_0735284 | Ga0496106_0735284_188_682 | 157 |
| 569 | 3300048910 | Ga0496107_0348134 | Ga0496107_0348134_562_1056 | 157 |
| 570 | 3300048929 | Ga0496126_0003628 | Ga0496126_0003628_14776_15252 | 157 |
| 571 | 3300049568 | Ga0501031_0011841 | Ga0501031_0011841_2176_2661 | 157 |
| 572 | 3300049569 | Ga0501032_0044102 | Ga0501032_0044102_1992_2465 | 157 |
| 573 | 3300049569 | Ga0501032_0165667 | Ga0501032_0165667_107_583 | 157 |
| 574 | 3300049569 | Ga0501032_0189207 | Ga0501032_0189207_771_1256 | 157 |
| 575 | 3300049570 | Ga0501033_0355576 | Ga0501033_0355576_133_618 | 157 |
| 576 | 3300049571 | Ga0501034_0010803 | Ga0501034_0010803_191_676 | 157 |
| 577 | 3300049571 | Ga0501034_0017594 | Ga0501034_0017594_3621_4094 | 157 |
| 578 | 3300049571 | Ga0501034_0386353 | Ga0501034_0386353_532_1014 | 157 |
| 579 | 3300049572 | Ga0501036_0030777 | Ga0501036_0030777_1921_2406 | 157 |
| 580 | 3300049572 | Ga0501036_0038275 | Ga0501036_0038275_1644_2117 | 157 |
| 581 | 3300049572 | Ga0501036_0307612 | Ga0501036_0307612_824_1300 | 157 |
| 582 | 3300049573 | Ga0501037_0009064 | Ga0501037_0009064_1577_2062 | 157 |
| 583 | 3300049573 | Ga0501037_0062745 | Ga0501037_0062745_1270_1755 | 157 |
| 584 | 3300049573 | Ga0501037_0111271 | Ga0501037_0111271_1283_1756 | 157 |
| 585 | 3300049573 | Ga0501037_0154826 | Ga0501037_0154826_852_1328 | 157 |
| 586 | 3300049574 | Ga0501038_0003178 | Ga0501038_0003178_269_754 | 157 |
| 587 | 3300049574 | Ga0501038_0060272 | Ga0501038_0060272_24_509 | 157 |
| 588 | 3300049574 | Ga0501038_0133759 | Ga0501038_0133759_1496_1972 | 157 |
| 589 | 3300049574 | Ga0501038_0452305 | Ga0501038_0452305_429_911 | 157 |
| 590 | 3300049575 | Ga0501039_0003110 | Ga0501039_0003110_5233_5718 | 157 |
| 591 | 3300049575 | Ga0501039_0406144 | Ga0501039_0406144_38_514 | 157 |
| 592 | 3300049576 | Ga0501040_0145850 | Ga0501040_0145850_777_1262 | 157 |
| 593 | 3300049578 | Ga0501042_0002157 | Ga0501042_0002157_6397_6882 | 157 |
| 594 | 3300049578 | Ga0501042_0232538 | Ga0501042_0232538_486_959 | 157 |
| 595 | 3300049579 | Ga0501043_0022817 | Ga0501043_0022817_813_1289 | 157 |
| 596 | 3300049579 | Ga0501043_0037650 | Ga0501043_0037650_2345_2830 | 157 |
| 597 | 3300049579 | Ga0501043_0243832 | Ga0501043_0243832_133_618 | 157 |
| 598 | 3300049580 | Ga0501046_0002292 | Ga0501046_0002292_16787_17272 | 157 |
| 599 | 3300049581 | Ga0501047_0008138 | Ga0501047_0008138_2562_3047 | 157 |
| 600 | 3300049581 | Ga0501047_0134245 | Ga0501047_0134245_582_1064 | 157 |
| 601 | 3300049581 | Ga0501047_0304483 | Ga0501047_0304483_34_507 | 157 |
| 602 | 3300049581 | Ga0501047_0637043 | Ga0501047_0637043_222_698 | 157 |
| 603 | 3300049581 | Ga0501047_0925040 | Ga0501047_0925040_55_534 | 157 |
| 604 | 3300049582 | Ga0501048_0016380 | Ga0501048_0016380_697_1182 | 157 |
| 605 | 3300049583 | Ga0501067_0000141 | Ga0501067_0000141_19284_19769 | 157 |
| 606 | 3300049583 | Ga0501067_0101400 | Ga0501067_0101400_1075_1548 | 157 |
| 607 | 3300049584 | Ga0501068_0010448 | Ga0501068_0010448_1898_2383 | 157 |
| 608 | 3300049585 | Ga0501069_0018054 | Ga0501069_0018054_3299_3784 | 157 |
| 609 | 3300049585 | Ga0501069_0036606 | Ga0501069_0036606_951_1424 | 157 |
| 610 | 3300049586 | Ga0501070_0320123 | Ga0501070_0320123_184_657 | 157 |
| 611 | 3300049586 | Ga0501070_0442930 | Ga0501070_0442930_494_976 | 157 |
| 612 | 3300049588 | Ga0501072_0042938 | Ga0501072_0042938_2529_3014 | 157 |
| 613 | 3300049589 | Ga0501073_0023514 | Ga0501073_0023514_451_936 | 157 |
| 614 | 3300049589 | Ga0501073_0108059 | Ga0501073_0108059_605_1078 | 157 |
| 615 | 3300049590 | Ga0501074_0001175 | Ga0501074_0001175_16555_17040 | 157 |
| 616 | 3300049590 | Ga0501074_0129900 | Ga0501074_0129900_605_1078 | 157 |
| 617 | 3300049741 | Ga0501079_0002116 | Ga0501079_0002116_13728_14213 | 157 |
| 618 | 3300049741 | Ga0501079_0141995 | Ga0501079_0141995_843_1316 | 157 |
| 619 | 3300049742 | Ga0501080_0122730 | Ga0501080_0122730_34_507 | 157 |
| 620 | 3300049742 | Ga0501080_0577460 | Ga0501080_0577460_64_549 | 157 |
| 621 | 3300049744 | Ga0501083_0002575 | Ga0501083_0002575_10055_10540 | 157 |
| 622 | 3300049744 | Ga0501083_0032738 | Ga0501083_0032738_384_857 | 157 |
| 623 | 3300049822 | Ga0501035_0002097 | Ga0501035_0002097_16039_16512 | 157 |
| 624 | 3300049822 | Ga0501035_0022243 | Ga0501035_0022243_4428_4913 | 157 |
| 625 | 3300049822 | Ga0501035_0249832 | Ga0501035_0249832_972_1448 | 157 |
| 626 | 3300049822 | Ga0501035_0884101 | Ga0501035_0884101_133_618 | 157 |
| 627 | 3300049823 | Ga0501044_0118026 | Ga0501044_0118026_1401_1886 | 157 |
| 628 | 3300049823 | Ga0501044_0150205 | Ga0501044_0150205_1656_2129 | 157 |
| 629 | 3300049823 | Ga0501044_0216106 | Ga0501044_0216106_916_1392 | 157 |
| 630 | 3300049824 | Ga0501045_0199507 | Ga0501045_0199507_219_704 | 157 |
| 631 | 3300050513 | nmdc:mga0rr50_605926_c1 | nmdc:mga0rr50_605926_c1_269_742 | 157 |
| 632 | 3300050514 | nmdc:mga08x19_37_c1 | nmdc:mga08x19_37_c1_145651_146124 | 157 |
| 633 | 3300050514 | nmdc:mga08x19_44640_c1 | nmdc:mga08x19_44640_c1_1460_1933 | 157 |
| 634 | 3300050514 | nmdc:mga08x19_67234_c1 | nmdc:mga08x19_67234_c1_1739_2212 | 157 |
| 635 | 3300053093 | Ga0500651_0377674 | Ga0500651_0377674_285_758 | 157 |
| 636 | 3300053133 | Ga0500655_049101 | Ga0500655_049101_353_826 | 157 |
| 637 | 3300054114 | Ga0501084_0003091 | Ga0501084_0003091_62_547 | 157 |
| 638 | 3300054114 | Ga0501084_0006114 | Ga0501084_0006114_2230_2703 | 157 |
| 639 | 3300060353 | Ga0501082_0085960 | Ga0501082_0085960_1624_2097 | 157 |
| 640 | 3300005406 | Ga0070703_10043000 | Ga0070703_100430001 | 158 |
| 641 | 3300005437 | Ga0070710_10189643 | Ga0070710_101896432 | 158 |
| 642 | 3300005439 | Ga0070711_100188534 | Ga0070711_1001885342 | 158 |
| 643 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002853 | 158 |
| 644 | 3300005530 | Ga0070679_100036051 | Ga0070679_1000360514 | 158 |
| 645 | 3300005546 | Ga0070696_100028958 | Ga0070696_1000289582 | 158 |
| 646 | 3300005617 | Ga0068859_102270714 | Ga0068859_1022707141 | 158 |
| 647 | 3300005841 | Ga0068863_100534874 | Ga0068863_1005348742 | 158 |
| 648 | 3300006028 | Ga0070717_10764934 | Ga0070717_107649342 | 158 |
| 649 | 3300006175 | Ga0070712_100133084 | Ga0070712_1001330841 | 158 |
| 650 | 3300006358 | Ga0068871_101860809 | Ga0068871_1018608091 | 158 |
| 651 | 3300006844 | Ga0075428_100225931 | Ga0075428_1002259312 | 158 |
| 652 | 3300006846 | Ga0075430_100536976 | Ga0075430_1005369761 | 158 |
| 653 | 3300006931 | Ga0097620_102271705 | Ga0097620_1022717051 | 158 |
| 654 | 3300009093 | Ga0105240_12110191 | Ga0105240_121101911 | 158 |
| 655 | 3300010159 | Ga0099796_10050240 | Ga0099796_100502402 | 158 |
| 656 | 3300011119 | Ga0105246_10259839 | Ga0105246_102598392 | 158 |
| 657 | 3300021384 | Ga0213876_10000427 | Ga0213876_1000042719 | 158 |
| 658 | 3300025906 | Ga0207699_10606162 | Ga0207699_106061621 | 158 |
| 659 | 3300025915 | Ga0207693_10222715 | Ga0207693_102227151 | 158 |
| 660 | 3300025916 | Ga0207663_10783226 | Ga0207663_107832261 | 158 |
| 661 | 3300025928 | Ga0207700_10247481 | Ga0207700_102474811 | 158 |
| 662 | 3300035083 | Ga0373926_0071222 | Ga0373926_0071222_480_974 | 158 |
| 663 | 3300035113 | Ga0373936_0137658 | Ga0373936_0137658_219_710 | 158 |
| 664 | 3300035117 | Ga0373953_0169779 | Ga0373953_0169779_218_709 | 158 |
| 665 | 3300035118 | Ga0373954_0272756 | Ga0373954_0272756_180_671 | 158 |
| 666 | 3300035119 | Ga0373956_0305607 | Ga0373956_0305607_34_525 | 158 |
| 667 | 3300035691 | Ga0373931_0006560 | Ga0373931_0006560_1150_1644 | 158 |
| 668 | 3300035695 | Ga0373927_0331416 | Ga0373927_0331416_28_522 | 158 |
| 669 | 3300035695 | Ga0373927_0486167 | Ga0373927_0486167_222_710 | 158 |
| 670 | 3300035725 | Ga0373947_0481430 | Ga0373947_0481430_128_622 | 158 |
| 671 | 3300036401 | Ga0373937_0014387 | Ga0373937_0014387_3086_3577 | 158 |
| 672 | 3300036401 | Ga0373937_0148746 | Ga0373937_0148746_720_1211 | 158 |
| 673 | 3300036401 | Ga0373937_0156754 | Ga0373937_0156754_902_1393 | 158 |
| 674 | 3300039437 | Ga0436365_0583194 | Ga0436365_0583194_12822_13301 | 158 |
| 675 | 3300039438 | Ga0436360_1278480 | Ga0436360_1278480_160_654 | 158 |
| 676 | 3300046491 | Ga0495584_0243234 | Ga0495584_0243234_273_761 | 158 |
| 677 | 3300046559 | Ga0495667_0475086 | Ga0495667_0475086_193_684 | 158 |
| 678 | 3300046679 | Ga0495623_0507498 | Ga0495623_0507498_131_622 | 158 |
| 679 | 3300047444 | Ga0495675_0203625 | Ga0495675_0203625_414_905 | 158 |
| 680 | 3300049570 | Ga0501033_0444312 | Ga0501033_0444312_44_529 | 158 |
| 681 | 3300049572 | Ga0501036_0222010 | Ga0501036_0222010_1028_1516 | 158 |
| 682 | 3300049574 | Ga0501038_0098557 | Ga0501038_0098557_55_540 | 158 |
| 683 | 3300049577 | Ga0501041_0235804 | Ga0501041_0235804_518_1006 | 158 |
| 684 | 3300049586 | Ga0501070_0268843 | Ga0501070_0268843_738_1226 | 158 |
| 685 | 3300049588 | Ga0501072_0341187 | Ga0501072_0341187_133_621 | 158 |
| 686 | 3300049589 | Ga0501073_0146914 | Ga0501073_0146914_886_1392 | 158 |
| 687 | 3300049590 | Ga0501074_0747677 | Ga0501074_0747677_103_591 | 158 |
| 688 | 3300049592 | Ga0501076_0357227 | Ga0501076_0357227_669_1157 | 158 |
| 689 | 3300049593 | Ga0501077_0334108 | Ga0501077_0334108_446_934 | 158 |
| 690 | 3300049742 | Ga0501080_0602828 | Ga0501080_0602828_417_905 | 158 |
| 691 | 3300049743 | Ga0501081_0352968 | Ga0501081_0352968_44_532 | 158 |
| 692 | 3300049822 | Ga0501035_0016519 | Ga0501035_0016519_3383_3868 | 158 |
| 693 | 3300049822 | Ga0501035_0617762 | Ga0501035_0617762_71_559 | 158 |
| 694 | 3300049823 | Ga0501044_0119763 | Ga0501044_0119763_1207_1692 | 158 |
| 695 | 3300049824 | Ga0501045_0119215 | Ga0501045_0119215_769_1257 | 158 |
| 696 | 3300050511 | nmdc:mga08y16_625876_c1 | nmdc:mga08y16_625876_c1_238_726 | 158 |
| 697 | 3300053084 | Ga0495595_0083670 | Ga0495595_0083670_597_1088 | 158 |
| 698 | 3300061734 | Ga0530510_0346303 | Ga0530510_0346303_158_646 | 158 |
| 699 | 3300009093 | Ga0105240_10021543 | Ga0105240_100215434 | 159 |
| 700 | 3300025913 | Ga0207695_10047341 | Ga0207695_100473411 | 159 |
| 701 | 3300028379 | Ga0268266_10320036 | Ga0268266_103200361 | 159 |
| 702 | 3300039437 | Ga0436365_1406825 | Ga0436365_1406825_75_572 | 159 |
| 703 | 3300049581 | Ga0501047_0004588 | Ga0501047_0004588_3059_3550 | 159 |
| 704 | 3300049822 | Ga0501035_0060216 | Ga0501035_0060216_454_945 | 159 |
| 705 | 3300049823 | Ga0501044_0025449 | Ga0501044_0025449_5517_6008 | 159 |
| 706 | 3300006237 | Ga0097621_100173701 | Ga0097621_1001737014 | 160 |
| 707 | 3300013307 | Ga0157372_10191098 | Ga0157372_101910984 | 160 |
| 708 | 3300049579 | Ga0501043_0146470 | Ga0501043_0146470_978_1478 | 160 |
| 709 | 3300049581 | Ga0501047_0628720 | Ga0501047_0628720_273_773 | 160 |
| 710 | 3300006237 | Ga0097621_100221124 | Ga0097621_1002211242 | 161 |
| 711 | 3300014969 | Ga0157376_10108812 | Ga0157376_101088124 | 161 |
| 712 | 3300049823 | Ga0501044_1158298 | Ga0501044_1158298_116_604 | 161 |
| 713 | 3300009093 | Ga0105240_10230648 | Ga0105240_102306483 | 162 |
| 714 | 3300013307 | Ga0157372_10254495 | Ga0157372_102544952 | 162 |
| 715 | 3300025913 | Ga0207695_10230788 | Ga0207695_102307882 | 162 |
| 716 | 3300025920 | Ga0207649_10000367 | Ga0207649_1000036719 | 162 |
| 717 | 3300031250 | Ga0265331_10000067 | Ga0265331_10000067170 | 162 |
| 718 | 3300031711 | Ga0265314_10044308 | Ga0265314_100443082 | 162 |
| 719 | 3300031711 | Ga0265314_10117540 | Ga0265314_101175402 | 162 |
| 720 | 3300039437 | Ga0436365_0285583 | Ga0436365_0285583_414_941 | 162 |
| 721 | 3300049569 | Ga0501032_0408766 | Ga0501032_0408766_82_600 | 162 |
| 722 | 3300049572 | Ga0501036_1268155 | Ga0501036_1268155_29_547 | 162 |
| 723 | 3300049573 | Ga0501037_0147252 | Ga0501037_0147252_274_786 | 162 |
| 724 | 3300049579 | Ga0501043_0014986 | Ga0501043_0014986_4730_5242 | 162 |
| 725 | 3300049581 | Ga0501047_0398451 | Ga0501047_0398451_677_1195 | 162 |
| 726 | 3300049586 | Ga0501070_0388186 | Ga0501070_0388186_14_532 | 162 |
| 727 | 3300049589 | Ga0501073_0532040 | Ga0501073_0532040_178_690 | 162 |
| 728 | 3300049742 | Ga0501080_0027115 | Ga0501080_0027115_142_660 | 162 |
| 729 | 3300049822 | Ga0501035_0080787 | Ga0501035_0080787_1368_1886 | 162 |
| 730 | 3300049823 | Ga0501044_0267153 | Ga0501044_0267153_153_671 | 162 |
| 731 | iso_pu_bacteria | 2821443989 | 2821448533 | 162 |
| 732 | iso_pu_bacteria | 2844533157 | 2844534234 | 162 |
| 733 | 3300049581 | Ga0501047_0175170 | Ga0501047_0175170_1208_1717 | 163 |
| 734 | 3300049586 | Ga0501070_0105824 | Ga0501070_0105824_217_741 | 164 |
| 735 | 3300001989 | JGI24739J22299_10027885 | JGI24739J22299_100278852 | 166 |
| 736 | 3300003187 | JGI25151J46595_10000284 | JGI25151J46595_1000028441 | 166 |
| 737 | 3300003215 | JGI25153J46596_10034448 | JGI25153J46596_100344481 | 166 |
| 738 | 3300003316 | rootH1_10046059 | rootH1_100460592 | 166 |
| 739 | 3300003354 | JGI25160J50197_1007421 | JGI25160J50197_10074214 | 166 |
| 740 | 3300005539 | Ga0068853_100511707 | Ga0068853_1005117072 | 166 |
| 741 | 3300005983 | Ga0081540_1040679 | Ga0081540_10406792 | 166 |
| 742 | 3300025284 | Ga0209130_1000550 | Ga0209130_10005506 | 166 |
| 743 | 3300025294 | Ga0209025_1000831 | Ga0209025_100083142 | 166 |
| 744 | 3300025297 | Ga0209758_1001349 | Ga0209758_10013492 | 166 |
| 745 | 3300025302 | Ga0207426_1000182 | Ga0207426_100018286 | 166 |
| 746 | 3300026041 | Ga0207639_10045148 | Ga0207639_100451484 | 166 |
| 747 | 3300042004 | Ga0439445_0022504 | Ga0439445_0022504_1007_1510 | 166 |
| 748 | 3300042185 | Ga0450909_034472 | Ga0450909_034472_227_730 | 166 |
| 749 | 3300046512 | Ga0495610_0010194 | Ga0495610_0010194_1305_1808 | 166 |
| 750 | 3300048924 | Ga0496121_0144735 | Ga0496121_0144735_980_1483 | 166 |
| 751 | 3300049823 | Ga0501044_0681044 | Ga0501044_0681044_142_645 | 166 |
| 752 | 3300053730 | Ga0500645_149447 | Ga0500645_149447_24_527 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjh-assembly1.cif.gz_A | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8373 | 12 | 154 |
| 1mjh-assembly1.cif.gz_B | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8124 | 12 | 158 |
| 1mjh-assembly1.cif.gz_A | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8056 | 12 | 154 |
| 1mjh-assembly1.cif.gz_B | structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics | 0.8023 | 12 | 158 |
| 3s3t-assembly1.cif.gz_A | universal stress protein uspa from lactobacillus plantarum | 0.7956 | 14 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mjhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8373 | 12 | 154 | 3.40.50.620 |
| af_A0A1D6Q6M0_26_165_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8229 | 13 | 125 | 3.40.50.620 |
| af_Q7XE49_1_175_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8127 | 16 | 154 | 3.40.50.620 |
| af_Q2FXL6_6_143_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8062 | 16 | 153 | 3.40.50.620 |
| af_A0A0P0VMX2_31_171_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8056 | 6 | 128 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6GZU4-F1-model_v4 | Nucleotide-binding universal stress protein, UspA family | 0.973 | 11 | 166 |
|
| AF-A0A1H6GZU4-F1-model_v4 | Nucleotide-binding universal stress protein, UspA family | 0.9608 | 11 | 166 |
|
| AF-A0A3B9DJE0-F1-model_v4 | deleted | 0.958 | 10 | 166 |
|
| AF-A0A6N7JN68-F1-model_v4 | Universal stress protein | 0.9563 | 8 | 166 |
|
| AF-A0A0P7WJN0-F1-model_v4 | Universal stress protein family protein | 0.9552 | 14 | 166 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar