F479176

General Info

Members Datasets Scaffolds Average Seq Length
752 268 750 159

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0395773|Ga0495628_0395773_416_979
Length 187
Sequence MLQFLELVFATNRHGRTLAAAPAMVSASPPMSEPSLDRPRKFLVVVDKTPECRVAVRFAARRAQHTGGRVTLLCIAQPADFQQWRGVEEIMKDEAHQEAEALVYAAAKTVNELAGIIPELVIAQGRPAEALLELVKSDKDISILVLASGIAKEGPGPLVSLFAGGVQAIPVTIVPGNLSEAKIDQLA

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 0.8
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10027885 3300001989 Bacteria 1971
2 JGI25151J46595_10000284 3300003187 Bacteria 57330
3 JGI25165J46597_1000035 3300003214 Bacteria 290723
4 JGI25153J46596_10000792 3300003215 Bacteria 19361
5 JGI25153J46596_10034448 3300003215 Bacteria 1655
6 rootH1_10046059 3300003316 Bacteria 2008
7 JGI25160J50197_1007421 3300003354 Bacteria 4290
8 Ga0070658_10006016 3300005327 Bacteria 9843
9 Ga0070658_10180640 3300005327 Bacteria 1775
10 Ga0070676_10024121 3300005328 Bacteria 3423
11 Ga0070676_10205036 3300005328 Bacteria 1295
12 Ga0070690_100119451 3300005330 Bacteria 1768
13 Ga0070670_101205585 3300005331 Bacteria 692
14 Ga0068869_100046402 3300005334 Bacteria 3133
15 Ga0070666_10000633 3300005335 Bacteria 21182
16 Ga0070666_10074236 3300005335 Bacteria 2318
17 Ga0070666_10076220 3300005335 Bacteria 2287
18 Ga0070680_100105641 3300005336 Bacteria 2341
19 Ga0070682_100436656 3300005337 Bacteria 999
20 Ga0068868_100069238 3300005338 Bacteria 2812
21 Ga0068868_100081729 3300005338 Bacteria 2591
22 Ga0068868_100153342 3300005338 Bacteria 1899
23 Ga0068868_100440182 3300005338 Bacteria 1132
24 Ga0070660_100032812 3300005339 Bacteria 3911
25 Ga0070691_10168035 3300005341 Bacteria 1135
26 Ga0070661_100059484 3300005344 Bacteria 2802
27 Ga0070661_100335168 3300005344 Bacteria 1184
28 Ga0070661_100534413 3300005344 Unclassified 942
29 Ga0070675_100219111 3300005354 Bacteria 1657
30 Ga0070671_100818029 3300005355 Bacteria 812
31 Ga0070671_101283766 3300005355 Bacteria 645
32 Ga0070659_100390384 3300005366 Bacteria 1174
33 Ga0070659_100732282 3300005366 Unclassified 857
34 Ga0070667_100110770 3300005367 Bacteria 2380
35 Ga0070667_100325874 3300005367 Bacteria 1387
36 Ga0070667_100552273 3300005367 Bacteria 1059
37 Ga0070667_100829758 3300005367 Bacteria 859
38 Ga0070703_10043000 3300005406 Bacteria 1415
39 Ga0070709_10001252 3300005434 Bacteria 13895
40 Ga0070709_10557283 3300005434 Unclassified 878
41 Ga0070713_100000199 3300005436 Bacteria 40083
42 Ga0070710_10189643 3300005437 Bacteria 1292
43 Ga0070710_10256962 3300005437 Bacteria 1125
44 Ga0070701_10368553 3300005438 Unclassified 902
45 Ga0070711_100005086 3300005439 Bacteria 7829
46 Ga0070711_100174461 3300005439 Bacteria 1641
47 Ga0070711_100188534 3300005439 Bacteria 1583
48 Ga0070711_100812536 3300005439 Bacteria 794
49 Ga0070705_100031377 3300005440 Bacteria 2942
50 Ga0070705_101241632 3300005440 Unclassified 615
51 Ga0070678_100026666 3300005456 Bacteria 3911
52 Ga0070678_100028400 3300005456 Bacteria 3814
53 Ga0070678_100070242 3300005456 Bacteria 2617
54 Ga0070681_10000002 3300005458 Bacteria 821814
55 Ga0070681_10057249 3300005458 Bacteria 3878
56 Ga0070681_10059268 3300005458 Bacteria 3808
57 Ga0070681_10217568 3300005458 Bacteria 1826
58 Ga0070681_10420405 3300005458 Bacteria 1249
59 Ga0070681_10728190 3300005458 Unclassified 908
60 Ga0068867_100013842 3300005459 Bacteria 5710
61 Ga0068867_100256306 3300005459 Bacteria 1424
62 Ga0070679_100036051 3300005530 Bacteria 4908
63 Ga0070679_100333344 3300005530 Bacteria 1466
64 Ga0070679_101933889 3300005530 Bacteria 539
65 Ga0070684_100210563 3300005535 Bacteria 1772
66 Ga0070684_100271498 3300005535 Bacteria 1552
67 Ga0068853_100004853 3300005539 Bacteria 10451
68 Ga0068853_100018884 3300005539 Bacteria 5710
69 Ga0068853_100086583 3300005539 Bacteria 2748
70 Ga0068853_100511707 3300005539 Bacteria 1134
71 Ga0068853_100990536 3300005539 Unclassified 809
72 Ga0068853_101090277 3300005539 Bacteria 770
73 Ga0070695_100239615 3300005545 Bacteria 1315
74 Ga0070696_100028958 3300005546 Bacteria 3781
75 Ga0070696_100325619 3300005546 Bacteria 1184
76 Ga0070693_100081443 3300005547 Bacteria 1930
77 Ga0070693_100279638 3300005547 Unclassified 1117
78 Ga0070665_100000728 3300005548 Bacteria 43882
79 Ga0070665_100037182 3300005548 Bacteria 4897
80 Ga0070665_100132277 3300005548 Bacteria 2497
81 Ga0070665_100142381 3300005548 Bacteria 2401
82 Ga0070665_100275066 3300005548 Bacteria 1686
83 Ga0068855_100239980 3300005563 Bacteria 2026
84 Ga0068855_100246552 3300005563 Bacteria 1994
85 Ga0068855_100284299 3300005563 Bacteria 1836
86 Ga0068855_100374770 3300005563 Bacteria 1564
87 Ga0068855_100462369 3300005563 Bacteria 1383
88 Ga0068855_101076563 3300005563 Bacteria 841
89 Ga0070664_100206050 3300005564 Bacteria 1756
90 Ga0068857_100001360 3300005577 Bacteria 19260
91 Ga0068857_100178550 3300005577 Bacteria 1932
92 Ga0068857_100282195 3300005577 Bacteria 1528
93 Ga0068857_100842992 3300005577 Bacteria 877
94 Ga0068857_101956901 3300005577 Archaea 575
95 Ga0068854_100648616 3300005578 Bacteria 906
96 Ga0068856_100009449 3300005614 Bacteria 9469
97 Ga0068856_100371925 3300005614 Bacteria 1448
98 Ga0068856_100566969 3300005614 Bacteria 1157
99 Ga0068856_100927282 3300005614 Unclassified 890
100 Ga0068852_100015237 3300005616 Bacteria 5953
101 Ga0068852_100062213 3300005616 Bacteria 3246
102 Ga0068852_100137985 3300005616 Bacteria 2253
103 Ga0068859_100452005 3300005617 Bacteria 1381
104 Ga0068859_102270714 3300005617 Bacteria 598
105 Ga0068864_100076648 3300005618 Bacteria 2923
106 Ga0068864_101421893 3300005618 Unclassified 696
107 Ga0068866_10193593 3300005718 Bacteria 1210
108 Ga0068870_10062015 3300005840 Bacteria 2012
109 Ga0068863_100534874 3300005841 Bacteria 1156
110 Ga0068858_100020784 3300005842 Bacteria 6134
111 Ga0068858_100030997 3300005842 Bacteria 4966
112 Ga0068858_100183267 3300005842 Bacteria 1977
113 Ga0068858_100409572 3300005842 Bacteria 1303
114 Ga0068858_100733696 3300005842 Bacteria 962
115 Ga0068860_100594391 3300005843 Bacteria 1112
116 Ga0068862_100610709 3300005844 Bacteria 1048
117 Ga0081540_1040679 3300005983 Bacteria 2420
118 Ga0070717_10764934 3300006028 Bacteria 878
119 Ga0070716_100595151 3300006173 Bacteria 831
120 Ga0070712_100000443 3300006175 Bacteria 23682
121 Ga0070712_100133084 3300006175 Bacteria 1887
122 Ga0070712_100269239 3300006175 Bacteria 1368
123 Ga0070712_100660458 3300006175 Bacteria 889
124 Ga0070712_100820723 3300006175 Bacteria 799
125 Ga0097621_100001436 3300006237 Bacteria 16342
126 Ga0097621_100173701 3300006237 Bacteria 1859
127 Ga0097621_100197113 3300006237 Bacteria 1746
128 Ga0097621_100221124 3300006237 Bacteria 1650
129 Ga0097621_100278623 3300006237 Bacteria 1471
130 Ga0097621_100335531 3300006237 Bacteria 1341
131 Ga0097621_100478245 3300006237 Bacteria 1126
132 Ga0097621_100505636 3300006237 Bacteria 1095
133 Ga0097621_101331889 3300006237 Bacteria 679
134 Ga0068871_100000329 3300006358 Bacteria 33127
135 Ga0068871_100007093 3300006358 Bacteria 7987
136 Ga0068871_100072694 3300006358 Bacteria 2833
137 Ga0068871_100113304 3300006358 Bacteria 2284
138 Ga0068871_100170069 3300006358 Bacteria 1867
139 Ga0068871_100207079 3300006358 Bacteria 1695
140 Ga0068871_100338703 3300006358 Bacteria 1328
141 Ga0068871_100495401 3300006358 Bacteria 1101
142 Ga0068871_101860809 3300006358 Unclassified 572
143 Ga0075428_100225931 3300006844 Bacteria 2021
144 Ga0075430_100536976 3300006846 Bacteria 965
145 Ga0068865_100085499 3300006881 Bacteria 2275
146 Ga0075436_100001475 3300006914 Bacteria 16015
147 Ga0075436_100320300 3300006914 Bacteria 1114
148 Ga0097620_100452012 3300006931 Bacteria 1381
149 Ga0097620_102271705 3300006931 Bacteria 598
150 Ga0105240_10002870 3300009093 Bacteria 27247
151 Ga0105240_10021543 3300009093 Bacteria 8571
152 Ga0105240_10031565 3300009093 Bacteria 6868
153 Ga0105240_10044045 3300009093 Bacteria 5674
154 Ga0105240_10230648 3300009093 Bacteria 2152
155 Ga0105240_10260545 3300009093 Bacteria 2000
156 Ga0105240_10367260 3300009093 Bacteria 1628
157 Ga0105240_10470357 3300009093 Bacteria 1403
158 Ga0105240_10513319 3300009093 Unclassified 1331
159 Ga0105240_10594310 3300009093 Bacteria 1219
160 Ga0105240_10732460 3300009093 Bacteria 1076
161 Ga0105240_10887870 3300009093 Bacteria 960
162 Ga0105240_11127749 3300009093 Unclassified 833
163 Ga0105240_12110191 3300009093 Bacteria 585
164 Ga0105245_10022596 3300009098 Bacteria 5522
165 Ga0105245_10080647 3300009098 Bacteria 2973
166 Ga0105245_10365033 3300009098 Bacteria 1434
167 Ga0105245_10485349 3300009098 Bacteria 1250
168 Ga0105245_11204084 3300009098 Bacteria 805
169 Ga0105247_10004766 3300009101 Bacteria 8636
170 Ga0105247_10147938 3300009101 Bacteria 1545
171 Ga0105247_10420663 3300009101 Bacteria 956
172 Ga0105247_10512964 3300009101 Bacteria 875
173 Ga0105243_10529716 3300009148 Bacteria 1122
174 Ga0105241_10021669 3300009174 Bacteria 4754
175 Ga0105241_10029757 3300009174 Bacteria 4077
176 Ga0105241_10114803 3300009174 Bacteria 2161
177 Ga0105241_10191554 3300009174 Bacteria 1703
178 Ga0105241_10324623 3300009174 Bacteria 1328
179 Ga0105241_10446664 3300009174 Bacteria 1143
180 Ga0105241_10822493 3300009174 Unclassified 857
181 Ga0105241_11213678 3300009174 Bacteria 715
182 Ga0105242_10020635 3300009176 Bacteria 5169
183 Ga0105242_10020889 3300009176 Bacteria 5136
184 Ga0105242_10025118 3300009176 Bacteria 4710
185 Ga0105242_10360506 3300009176 Bacteria 1345
186 Ga0105248_10000001 3300009177 Bacteria 1881304
187 Ga0105248_10047648 3300009177 Bacteria 4807
188 Ga0105248_10327564 3300009177 Bacteria 1725
189 Ga0105248_11113184 3300009177 Bacteria 893
190 Ga0105248_11235995 3300009177 Bacteria 845
191 Ga0105237_10012476 3300009545 Bacteria 8955
192 Ga0105237_10239817 3300009545 Bacteria 1814
193 Ga0105237_10251273 3300009545 Bacteria 1770
194 Ga0105237_10706865 3300009545 Unclassified 1014
195 Ga0105237_11157783 3300009545 Unclassified 780
196 Ga0105237_11349646 3300009545 Unclassified 719
197 Ga0105237_11826496 3300009545 Unclassified 615
198 Ga0105238_10001095 3300009551 Bacteria 27380
199 Ga0105238_10145968 3300009551 Bacteria 2342
200 Ga0105238_10206601 3300009551 Bacteria 1940
201 Ga0105238_10439940 3300009551 Bacteria 1300
202 Ga0105238_10598235 3300009551 Bacteria 1110
203 Ga0105238_10848330 3300009551 Bacteria 931
204 Ga0105249_10524233 3300009553 Bacteria 1233
205 Ga0105249_10761222 3300009553 Bacteria 1031
206 Ga0105249_10816926 3300009553 Bacteria 997
207 Ga0105249_13052870 3300009553 Bacteria 538
208 Ga0099796_10050240 3300010159 Bacteria 1445
209 Ga0105239_10004846 3300010375 Bacteria 15921
210 Ga0105239_10229125 3300010375 Bacteria 2085
211 Ga0105239_10329588 3300010375 Bacteria 1722
212 Ga0105239_10399659 3300010375 Bacteria 1555
213 Ga0105239_10404578 3300010375 Bacteria 1545
214 Ga0105239_11105273 3300010375 Bacteria 913
215 Ga0105239_12164550 3300010375 Bacteria 647
216 Ga0105246_10039033 3300011119 Bacteria 3196
217 Ga0105246_10103733 3300011119 Bacteria 2075
218 Ga0105246_10259839 3300011119 Bacteria 1383
219 Ga0105246_10617745 3300011119 Unclassified 939
220 Ga0157370_10034135 3300013104 Bacteria 4957
221 Ga0157369_10001844 3300013105 Bacteria 25612
222 Ga0157369_10176423 3300013105 Bacteria 2249
223 Ga0157369_10613293 3300013105 Bacteria 1123
224 Ga0157369_11163159 3300013105 Unclassified 788
225 Ga0157374_10103819 3300013296 Bacteria 2728
226 Ga0157374_10245877 3300013296 Bacteria 1760
227 Ga0157374_10249080 3300013296 Bacteria 1748
228 Ga0157374_11412075 3300013296 Unclassified 719
229 Ga0157378_10046152 3300013297 Bacteria 3873
230 Ga0157378_10082441 3300013297 Bacteria 2908
231 Ga0157378_10109188 3300013297 Bacteria 2534
232 Ga0157378_10191010 3300013297 Bacteria 1931
233 Ga0157378_10472339 3300013297 Bacteria 1248
234 Ga0157378_10577928 3300013297 Bacteria 1132
235 Ga0163162_10125826 3300013306 Bacteria 2669
236 Ga0163162_12676455 3300013306 Bacteria 574
237 Ga0157372_10191098 3300013307 Bacteria 2372
238 Ga0157372_10254495 3300013307 Bacteria 2039
239 Ga0157372_10377024 3300013307 Bacteria 1653
240 Ga0157372_10531560 3300013307 Bacteria 1371
241 Ga0157372_11201504 3300013307 Unclassified 876
242 Ga0157372_11206619 3300013307 Unclassified 874
243 Ga0157375_10168950 3300013308 Bacteria 2334
244 Ga0157375_10882518 3300013308 Bacteria 1039
245 Ga0163163_10495015 3300014325 Bacteria 1284
246 Ga0163163_11460583 3300014325 Bacteria 745
247 Ga0182008_10425385 3300014497 Bacteria 718
248 Ga0157379_10002841 3300014968 Bacteria 14599
249 Ga0157379_10002945 3300014968 Bacteria 14364
250 Ga0157379_10014719 3300014968 Bacteria 6862
251 Ga0157379_10015566 3300014968 Bacteria 6677
252 Ga0157379_10106425 3300014968 Bacteria 2518
253 Ga0157379_10212106 3300014968 Bacteria 1753
254 Ga0157379_10234922 3300014968 Bacteria 1662
255 Ga0157376_10108812 3300014969 Bacteria 2436
256 Ga0157376_10342519 3300014969 Bacteria 1428
257 Ga0157376_10418456 3300014969 Bacteria 1300
258 Ga0157376_10546745 3300014969 Bacteria 1145
259 Ga0157376_10699611 3300014969 Bacteria 1018
260 Ga0157376_11513187 3300014969 Unclassified 704
261 Ga0157376_11518183 3300014969 Unclassified 703
262 Ga0157376_12055537 3300014969 Unclassified 609
263 Ga0163161_10096366 3300017792 Bacteria 2196
264 Ga0213876_10000427 3300021384 Bacteria 34873
265 Ga0213876_10006949 3300021384 Bacteria 6168
266 Ga0213876_10014748 3300021384 Bacteria 4141
267 Ga0209233_1000006 3300025261 Bacteria 1473685
268 Ga0209130_1000550 3300025284 Bacteria 37462
269 Ga0209025_1000831 3300025294 Bacteria 49044
270 Ga0209758_1000008 3300025297 Bacteria 1215263
271 Ga0209758_1001349 3300025297 Bacteria 29561
272 Ga0207426_1000182 3300025302 Bacteria 155724
273 Ga0207692_10240802 3300025898 Bacteria 1080
274 Ga0207642_10143329 3300025899 Bacteria 1262
275 Ga0207642_10233967 3300025899 Bacteria 1034
276 Ga0207710_10114235 3300025900 Bacteria 1284
277 Ga0207680_10004246 3300025903 Bacteria 6784
278 Ga0207680_10162112 3300025903 Bacteria 1500
279 Ga0207699_10000124 3300025906 Bacteria 54948
280 Ga0207699_10606162 3300025906 Bacteria 797
281 Ga0207645_10016250 3300025907 Bacteria 4929
282 Ga0207645_10188557 3300025907 Bacteria 1354
283 Ga0207643_10020522 3300025908 Bacteria 3627
284 Ga0207705_10010749 3300025909 Bacteria 6645
285 Ga0207705_10233215 3300025909 Bacteria 1400
286 Ga0207705_10547164 3300025909 Unclassified 900
287 Ga0207654_10024438 3300025911 Bacteria 3249
288 Ga0207654_10071613 3300025911 Bacteria 2061
289 Ga0207654_10212429 3300025911 Bacteria 1279
290 Ga0207654_10322641 3300025911 Bacteria 1056
291 Ga0207654_10604457 3300025911 Bacteria 783
292 Ga0207654_10886494 3300025911 Unclassified 646
293 Ga0207654_11300561 3300025911 Bacteria 530
294 Ga0207707_10000002 3300025912 Bacteria 1142054
295 Ga0207707_10052017 3300025912 Bacteria 3567
296 Ga0207707_10133978 3300025912 Bacteria 2167
297 Ga0207695_10000012 3300025913 Bacteria 840961
298 Ga0207695_10019474 3300025913 Bacteria 7816
299 Ga0207695_10022923 3300025913 Bacteria 7073
300 Ga0207695_10047341 3300025913 Bacteria 4552
301 Ga0207695_10070818 3300025913 Bacteria 3562
302 Ga0207695_10193310 3300025913 Bacteria 1952
303 Ga0207695_10230788 3300025913 Bacteria 1755
304 Ga0207695_10377153 3300025913 Bacteria 1304
305 Ga0207695_10991755 3300025913 Bacteria 720
306 Ga0207671_10041130 3300025914 Bacteria 3421
307 Ga0207671_11068211 3300025914 Bacteria 635
308 Ga0207693_10000213 3300025915 Bacteria 53286
309 Ga0207693_10001025 3300025915 Bacteria 25014
310 Ga0207693_10085790 3300025915 Bacteria 2466
311 Ga0207693_10222715 3300025915 Unclassified 1482
312 Ga0207693_10521454 3300025915 Bacteria 927
313 Ga0207663_10074266 3300025916 Bacteria 2203
314 Ga0207663_10414639 3300025916 Bacteria 1033
315 Ga0207663_10783226 3300025916 Unclassified 759
316 Ga0207660_10000762 3300025917 Bacteria 21410
317 Ga0207660_10196886 3300025917 Bacteria 1572
318 Ga0207657_10042626 3300025919 Bacteria 4002
319 Ga0207649_10000367 3300025920 Bacteria 33632
320 Ga0207649_10243234 3300025920 Bacteria 1293
321 Ga0207652_10950701 3300025921 Bacteria 757
322 Ga0207681_10861965 3300025923 Bacteria 758
323 Ga0207694_10000006 3300025924 Bacteria 631109
324 Ga0207694_10029540 3300025924 Bacteria 4183
325 Ga0207694_10080815 3300025924 Bacteria 2552
326 Ga0207694_10222742 3300025924 Bacteria 1539
327 Ga0207650_10283041 3300025925 Bacteria 1351
328 Ga0207659_10639735 3300025926 Bacteria 908
329 Ga0207687_10083759 3300025927 Bacteria 2310
330 Ga0207687_10230472 3300025927 Bacteria 1463
331 Ga0207687_11376295 3300025927 Bacteria 606
332 Ga0207700_10000026 3300025928 Bacteria 139690
333 Ga0207700_10015912 3300025928 Bacteria 4980
334 Ga0207700_10247481 3300025928 Bacteria 1522
335 Ga0207700_10355802 3300025928 Bacteria 1276
336 Ga0207664_10010373 3300025929 Bacteria 6579
337 Ga0207644_10098489 3300025931 Bacteria 2192
338 Ga0207690_10668038 3300025932 Bacteria 852
339 Ga0207690_11186803 3300025932 Bacteria 637
340 Ga0207706_10075011 3300025933 Bacteria 2974
341 Ga0207686_10007932 3300025934 Bacteria 5725
342 Ga0207686_10079547 3300025934 Bacteria 2135
343 Ga0207686_10232254 3300025934 Bacteria 1338
344 Ga0207686_10842101 3300025934 Bacteria 737
345 Ga0207709_10015320 3300025935 Bacteria 4251
346 Ga0207704_10912711 3300025938 Bacteria 739
347 Ga0207711_10000001 3300025941 Bacteria 1325674
348 Ga0207711_10154528 3300025941 Bacteria 2073
349 Ga0207711_10179231 3300025941 Unclassified 1926
350 Ga0207711_10293964 3300025941 Bacteria 1497
351 Ga0207689_10066225 3300025942 Bacteria 2971
352 Ga0207689_10308801 3300025942 Bacteria 1312
353 Ga0207689_11079006 3300025942 Unclassified 677
354 Ga0207661_10778526 3300025944 Bacteria 881
355 Ga0207679_10616649 3300025945 Bacteria 979
356 Ga0207667_10000484 3300025949 Bacteria 52691
357 Ga0207667_10015995 3300025949 Bacteria 8495
358 Ga0207667_10042630 3300025949 Bacteria 4822
359 Ga0207667_10087471 3300025949 Bacteria 3223
360 Ga0207667_10368648 3300025949 Bacteria 1464
361 Ga0207667_11301923 3300025949 Unclassified 703
362 Ga0207712_10034051 3300025961 Bacteria 3448
363 Ga0207640_10423852 3300025981 Bacteria 1090
364 Ga0207658_10056556 3300025986 Bacteria 2912
365 Ga0207658_10101080 3300025986 Bacteria 2259
366 Ga0207677_10139294 3300026023 Bacteria 1855
367 Ga0207677_10386882 3300026023 Bacteria 1182
368 Ga0207703_10042079 3300026035 Bacteria 3663
369 Ga0207703_10077321 3300026035 Bacteria 2762
370 Ga0207703_10339880 3300026035 Bacteria 1379
371 Ga0207703_10362002 3300026035 Bacteria 1338
372 Ga0207703_10909093 3300026035 Bacteria 843
373 Ga0207639_10013412 3300026041 Bacteria 5737
374 Ga0207639_10025732 3300026041 Bacteria 4269
375 Ga0207639_10045148 3300026041 Bacteria 3318
376 Ga0207639_10073293 3300026041 Bacteria 2684
377 Ga0207639_11091975 3300026041 Bacteria 748
378 Ga0207639_11427802 3300026041 Unclassified 649
379 Ga0207702_10000021 3300026078 Bacteria 196115
380 Ga0207702_10009259 3300026078 Bacteria 8275
381 Ga0207702_10480507 3300026078 Bacteria 1209
382 Ga0207702_10613422 3300026078 Bacteria 1068
383 Ga0207702_10906135 3300026078 Bacteria 874
384 Ga0207641_10220240 3300026088 Bacteria 1759
385 Ga0207648_10005473 3300026089 Bacteria 12796
386 Ga0207648_10255101 3300026089 Bacteria 1564
387 Ga0207648_10648704 3300026089 Bacteria 975
388 Ga0207676_10879723 3300026095 Unclassified 878
389 Ga0207674_10000898 3300026116 Bacteria 38900
390 Ga0207674_10075071 3300026116 Bacteria 3391
391 Ga0207674_10127919 3300026116 Bacteria 2505
392 Ga0207674_10327257 3300026116 Bacteria 1482
393 Ga0207674_10721842 3300026116 Bacteria 962
394 Ga0207675_100082307 3300026118 Bacteria 3019
395 Ga0207683_10008637 3300026121 Bacteria 8710
396 Ga0207683_10021754 3300026121 Bacteria 5498
397 Ga0207683_10128768 3300026121 Bacteria 2276
398 Ga0207683_10591401 3300026121 Bacteria 1027
399 Ga0207698_10001029 3300026142 Bacteria 16220
400 Ga0207698_10060313 3300026142 Bacteria 2950
401 Ga0207698_10071704 3300026142 Bacteria 2750
402 Ga0268266_10000385 3300028379 Bacteria 67236
403 Ga0268266_10057702 3300028379 Bacteria 3341
404 Ga0268266_10064534 3300028379 Bacteria 3164
405 Ga0268266_10159546 3300028379 Bacteria 2039
406 Ga0268266_10320036 3300028379 Bacteria 1451
407 Ga0268266_10597594 3300028379 Bacteria 1060
408 Ga0268266_10654579 3300028379 Bacteria 1011
409 Ga0268264_10097183 3300028381 Bacteria 2552
410 Ga0268264_10100540 3300028381 Bacteria 2512
411 Ga0268264_10395584 3300028381 Bacteria 1327
412 Ga0265326_10056203 3300028558 Unclassified 1113
413 Ga0265334_10018182 3300028573 Bacteria 2899
414 Ga0265318_10002560 3300028577 Bacteria 9639
415 Ga0265318_10010669 3300028577 Bacteria 3991
416 Ga0265323_10150793 3300028653 Bacteria 745
417 Ga0265338_10000011 3300028800 Bacteria 433370
418 Ga0265338_10007110 3300028800 Bacteria 14018
419 Ga0265338_10010424 3300028800 Bacteria 10904
420 Ga0265338_10013075 3300028800 Bacteria 9407
421 Ga0265338_10066692 3300028800 Bacteria 3113
422 Ga0265338_10714133 3300028800 Bacteria 691
423 Ga0265330_10082572 3300031235 Unclassified 1383
424 Ga0265330_10107120 3300031235 Bacteria 1195
425 Ga0265332_10028790 3300031238 Bacteria 2430
426 Ga0265332_10030345 3300031238 Bacteria 2362
427 Ga0265332_10069078 3300031238 Bacteria 1506
428 Ga0265332_10165921 3300031238 Bacteria 922
429 Ga0265328_10194015 3300031239 Bacteria 770
430 Ga0265328_10271255 3300031239 Bacteria 652
431 Ga0265320_10000370 3300031240 Bacteria 36447
432 Ga0265320_10107986 3300031240 Bacteria 1277
433 Ga0265325_10000017 3300031241 Bacteria 130284
434 Ga0265325_10000484 3300031241 Bacteria 28834
435 Ga0265325_10000914 3300031241 Bacteria 21292
436 Ga0265325_10004365 3300031241 Bacteria 8952
437 Ga0265325_10024366 3300031241 Bacteria 3294
438 Ga0265325_10082607 3300031241 Bacteria 1595
439 Ga0265325_10090968 3300031241 Bacteria 1505
440 Ga0265325_10154371 3300031241 Bacteria 1084
441 Ga0265325_10231265 3300031241 Unclassified 843
442 Ga0265325_10238021 3300031241 Unclassified 828
443 Ga0265329_10006493 3300031242 Bacteria 4632
444 Ga0265329_10042822 3300031242 Bacteria 1449
445 Ga0265329_10114130 3300031242 Viruses 864
446 Ga0265340_10000206 3300031247 Bacteria 29746
447 Ga0265340_10003976 3300031247 Bacteria 8307
448 Ga0265340_10024503 3300031247 Bacteria 3064
449 Ga0265340_10033110 3300031247 Bacteria 2575
450 Ga0265340_10074140 3300031247 Bacteria 1610
451 Ga0265340_10274388 3300031247 Bacteria 749
452 Ga0265339_10000895 3300031249 Bacteria 22878
453 Ga0265339_10005604 3300031249 Bacteria 8335
454 Ga0265339_10011784 3300031249 Bacteria 5365
455 Ga0265339_10023415 3300031249 Bacteria 3570
456 Ga0265339_10094579 3300031249 Bacteria 1562
457 Ga0265339_10141253 3300031249 Bacteria 1225
458 Ga0265339_10448011 3300031249 Unclassified 599
459 Ga0265331_10000067 3300031250 Bacteria 158073
460 Ga0265331_10003379 3300031250 Bacteria 10346
461 Ga0265331_10009636 3300031250 Bacteria 5408
462 Ga0265331_10013806 3300031250 Bacteria 4330
463 Ga0265331_10074411 3300031250 Bacteria 1585
464 Ga0265331_10078937 3300031250 Bacteria 1532
465 Ga0265316_10019350 3300031344 Bacteria 5825
466 Ga0265316_10035146 3300031344 Bacteria 4064
467 Ga0265316_10044324 3300031344 Bacteria 3538
468 Ga0265316_10059973 3300031344 Bacteria 2958
469 Ga0265316_10141463 3300031344 Unclassified 1807
470 Ga0265316_10245902 3300031344 Bacteria 1314
471 Ga0265316_10329545 3300031344 Bacteria 1108
472 Ga0265316_10450315 3300031344 Bacteria 923
473 Ga0265316_10835471 3300031344 Unclassified 645
474 Ga0265313_10004380 3300031595 Bacteria 10897
475 Ga0265313_10005228 3300031595 Bacteria 9615
476 Ga0265313_10005338 3300031595 Bacteria 9489
477 Ga0265313_10007533 3300031595 Bacteria 7405
478 Ga0265313_10010085 3300031595 Bacteria 6040
479 Ga0265313_10112798 3300031595 Bacteria 1194
480 Ga0265313_10124895 3300031595 Bacteria 1119
481 Ga0265313_10256007 3300031595 Bacteria 713
482 Ga0265314_10000918 3300031711 Bacteria 34672
483 Ga0265314_10005990 3300031711 Bacteria 10843
484 Ga0265314_10007494 3300031711 Bacteria 9461
485 Ga0265314_10007742 3300031711 Bacteria 9287
486 Ga0265314_10012633 3300031711 Bacteria 6875
487 Ga0265314_10031435 3300031711 Bacteria 3918
488 Ga0265314_10044308 3300031711 Bacteria 3154
489 Ga0265314_10117540 3300031711 Bacteria 1679
490 Ga0265314_10141869 3300031711 Bacteria 1484
491 Ga0265314_10149776 3300031711 Bacteria 1432
492 Ga0265314_10249566 3300031711 Unclassified 1019
493 Ga0265314_10280133 3300031711 Bacteria 944
494 Ga0265342_10009937 3300031712 Bacteria 6652
495 Ga0265342_10029287 3300031712 Bacteria 3419
496 Ga0265342_10057244 3300031712 Bacteria 2308
497 Ga0265342_10243824 3300031712 Bacteria 961
498 Ga0265342_10252969 3300031712 Bacteria 940
499 Ga0307516_10030531 3300031730 Bacteria 5437
500 Ga0307516_10444620 3300031730 Unclassified 953
501 Ga0373926_0071222 3300035083 Bacteria 1278
502 Ga0373932_0114490 3300035112 Bacteria 893
503 Ga0373936_0137658 3300035113 Bacteria 1053
504 Ga0373939_0027361 3300035114 Bacteria 1615
505 Ga0373953_0169779 3300035117 Bacteria 939
506 Ga0373954_0153251 3300035118 Unclassified 1126
507 Ga0373954_0272756 3300035118 Unclassified 834
508 Ga0373956_0305607 3300035119 Unclassified 758
509 Ga0373955_0771102 3300035172 Unclassified 591
510 Ga0373955_0925983 3300035172 Bacteria 536
511 Ga0373931_0006560 3300035691 Bacteria 5443
512 Ga0373927_0168409 3300035695 Unclassified 1436
513 Ga0373927_0331416 3300035695 Bacteria 1003
514 Ga0373927_0486167 3300035695 Bacteria 816
515 Ga0373933_0018352 3300035724 Bacteria 3932
516 Ga0373933_0272850 3300035724 Unclassified 1092
517 Ga0373933_0472295 3300035724 Unclassified 821
518 Ga0373947_0481430 3300035725 Bacteria 842
519 Ga0373937_0001347 3300036401 Bacteria 20536
520 Ga0373937_0014387 3300036401 Bacteria 6987
521 Ga0373937_0017765 3300036401 Bacteria 6345
522 Ga0373937_0083005 3300036401 Bacteria 2965
523 Ga0373937_0148746 3300036401 Bacteria 2193
524 Ga0373937_0156754 3300036401 Bacteria 2134
525 Ga0373937_0192257 3300036401 Bacteria 1918
526 Ga0373937_0320255 3300036401 Bacteria 1467
527 Ga0373937_0790122 3300036401 Unclassified 897
528 Ga0373937_1062792 3300036401 Bacteria 758
529 Ga0373925_0368220 3300037068 Bacteria 1169
530 Ga0395900_0039256 3300037418 Bacteria 4878
531 Ga0395898_0074177 3300037466 Bacteria 3287
532 Ga0395898_0220664 3300037466 Bacteria 1808
533 Ga0395901_0010855 3300038443 Bacteria 9233
534 Ga0395901_0094182 3300038443 Bacteria 3137
535 Ga0436365_0285583 3300039437 Unclassified 985
536 Ga0436365_0390587 3300039437 Bacteria 6670
537 Ga0436365_0448800 3300039437 Bacteria 775
538 Ga0436365_0577140 3300039437 Bacteria 27302
539 Ga0436365_0583194 3300039437 Bacteria 93933
540 Ga0436365_1131003 3300039437 Bacteria 990
541 Ga0436365_1264489 3300039437 Bacteria 1507
542 Ga0436365_1406825 3300039437 Unclassified 846
543 Ga0436360_0524592 3300039438 Bacteria 1194
544 Ga0436360_0558935 3300039438 Bacteria 1545
545 Ga0436360_1278480 3300039438 Bacteria 952
546 Ga0436361_0796701 3300039447 Bacteria 668
547 Ga0436363_0355221 3300039450 Bacteria 1116
548 Ga0436362_1185563 3300039453 Unclassified 1314
549 Ga0439445_0022504 3300042004 Bacteria 1590
550 Ga0450909_034472 3300042185 Bacteria 772
551 Ga0466966_0351440 3300044684 Unclassified 886
552 Ga0466958_0360239 3300045836 Bacteria 937
553 Ga0466967_0366245 3300045976 Bacteria 1397
554 Ga0466967_1005322 3300045976 Bacteria 830
555 Ga0495651_0336322 3300046462 Unclassified 1002
556 Ga0495651_0741033 3300046462 Bacteria 610
557 Ga0495584_0243234 3300046491 Bacteria 915
558 Ga0495610_0010194 3300046512 Bacteria 5863
559 Ga0495628_0395773 3300046516 Unclassified 1010
560 Ga0495648_0074879 3300046524 Bacteria 1949
561 Ga0495652_0832461 3300046529 Unclassified 613
562 Ga0495609_0015399 3300046538 Bacteria 3579
563 Ga0495621_0305515 3300046539 Bacteria 660
564 Ga0495622_0009823 3300046557 Bacteria 4424
565 Ga0495633_0380312 3300046558 Bacteria 639
566 Ga0495667_0475086 3300046559 Bacteria 784
567 Ga0495611_0339948 3300046648 Unclassified 689
568 Ga0495599_0372969 3300046678 Unclassified 853
569 Ga0495623_0507498 3300046679 Bacteria 636
570 Ga0495670_0326786 3300046691 Bacteria 824
571 Ga0495581_0269866 3300047315 Bacteria 995
572 Ga0495674_0211461 3300047319 Bacteria 1606
573 Ga0495672_0556991 3300047320 Bacteria 502
574 Ga0495675_0203625 3300047444 Unclassified 1204
575 Ga0495593_0147465 3300047673 Bacteria 1191
576 Ga0495593_0571083 3300047673 Unclassified 568
577 Ga0496100_0748828 3300048903 Bacteria 764
578 Ga0496102_0278391 3300048905 Bacteria 1577
579 Ga0496106_0336546 3300048909 Bacteria 1212
580 Ga0496106_0735284 3300048909 Bacteria 785
581 Ga0496107_0348134 3300048910 Bacteria 1103
582 Ga0496114_1637730 3300048917 Bacteria 532
583 Ga0496121_0016235 3300048924 Bacteria 7704
584 Ga0496121_0144735 3300048924 Bacteria 1758
585 Ga0496126_0003628 3300048929 Bacteria 19298
586 Ga0496126_0230764 3300048929 Bacteria 1551
587 Ga0496126_0358679 3300048929 Bacteria 1191
588 Ga0495682_0001443 3300049460 Bacteria 12841
589 Ga0501031_0011841 3300049568 Bacteria 5688
590 Ga0501031_0148555 3300049568 Bacteria 1531
591 Ga0501032_0026248 3300049569 Bacteria 4009
592 Ga0501032_0044102 3300049569 Bacteria 3019
593 Ga0501032_0127946 3300049569 Bacteria 1677
594 Ga0501032_0165667 3300049569 Bacteria 1450
595 Ga0501032_0189207 3300049569 Bacteria 1345
596 Ga0501032_0408766 3300049569 Bacteria 871
597 Ga0501033_0007273 3300049570 Bacteria 8634
598 Ga0501033_0317075 3300049570 Bacteria 1095
599 Ga0501033_0355576 3300049570 Bacteria 1025
600 Ga0501033_0444312 3300049570 Unclassified 901
601 Ga0501034_0010803 3300049571 Bacteria 9484
602 Ga0501034_0017594 3300049571 Bacteria 7329
603 Ga0501034_0315936 3300049571 Bacteria 1496
604 Ga0501034_0386353 3300049571 Bacteria 1324
605 Ga0501034_0518932 3300049571 Bacteria 1103
606 Ga0501036_0030777 3300049572 Bacteria 4534
607 Ga0501036_0038275 3300049572 Bacteria 4059
608 Ga0501036_0222010 3300049572 Bacteria 1587
609 Ga0501036_0307612 3300049572 Bacteria 1325
610 Ga0501036_0561928 3300049572 Bacteria 948
611 Ga0501036_1268155 3300049572 Bacteria 599
612 Ga0501037_0009064 3300049573 Bacteria 7292
613 Ga0501037_0009459 3300049573 Bacteria 7155
614 Ga0501037_0062745 3300049573 Bacteria 2709
615 Ga0501037_0077439 3300049573 Bacteria 2413
616 Ga0501037_0111271 3300049573 Bacteria 1973
617 Ga0501037_0147252 3300049573 Unclassified 1684
618 Ga0501037_0154826 3300049573 Bacteria 1636
619 Ga0501038_0003178 3300049574 Bacteria 15314
620 Ga0501038_0060272 3300049574 Bacteria 3248
621 Ga0501038_0065266 3300049574 Bacteria 3102
622 Ga0501038_0098557 3300049574 Bacteria 2437
623 Ga0501038_0133759 3300049574 Bacteria 2033
624 Ga0501038_0348045 3300049574 Bacteria 1154
625 Ga0501038_0452305 3300049574 Bacteria 987
626 Ga0501039_0003110 3300049575 Bacteria 12404
627 Ga0501039_0406144 3300049575 Bacteria 1070
628 Ga0501040_0145850 3300049576 Bacteria 1668
629 Ga0501041_0235804 3300049577 Bacteria 1149
630 Ga0501042_0002157 3300049578 Bacteria 11973
631 Ga0501042_0232538 3300049578 Bacteria 1330
632 Ga0501043_0014986 3300049579 Bacteria 6071
633 Ga0501043_0022817 3300049579 Bacteria 4907
634 Ga0501043_0037650 3300049579 Bacteria 3804
635 Ga0501043_0041740 3300049579 Bacteria 3604
636 Ga0501043_0146470 3300049579 Bacteria 1849
637 Ga0501043_0243832 3300049579 Bacteria 1385
638 Ga0501043_0247448 3300049579 Bacteria 1374
639 Ga0501043_0277315 3300049579 Bacteria 1286
640 Ga0501043_0786915 3300049579 Bacteria 689
641 Ga0501046_0002292 3300049580 Bacteria 18042
642 Ga0501046_0090783 3300049580 Bacteria 2350
643 Ga0501046_0276044 3300049580 Unclassified 1232
644 Ga0501047_0004588 3300049581 Bacteria 12992
645 Ga0501047_0006654 3300049581 Bacteria 10863
646 Ga0501047_0008138 3300049581 Bacteria 9897
647 Ga0501047_0008920 3300049581 Bacteria 9468
648 Ga0501047_0019060 3300049581 Bacteria 6583
649 Ga0501047_0065424 3300049581 Bacteria 3505
650 Ga0501047_0079440 3300049581 Bacteria 3154
651 Ga0501047_0134245 3300049581 Bacteria 2355
652 Ga0501047_0175170 3300049581 Bacteria 2012
653 Ga0501047_0205133 3300049581 Bacteria 1831
654 Ga0501047_0293014 3300049581 Bacteria 1471
655 Ga0501047_0304483 3300049581 Bacteria 1435
656 Ga0501047_0398451 3300049581 Unclassified 1209
657 Ga0501047_0628720 3300049581 Bacteria 894
658 Ga0501047_0637043 3300049581 Unclassified 886
659 Ga0501047_0925040 3300049581 Bacteria 685
660 Ga0501048_0016380 3300049582 Bacteria 5462
661 Ga0501067_0000141 3300049583 Bacteria 39689
662 Ga0501067_0000481 3300049583 Bacteria 21772
663 Ga0501067_0101400 3300049583 Bacteria 1599
664 Ga0501067_0432754 3300049583 Bacteria 734
665 Ga0501068_0010448 3300049584 Bacteria 5218
666 Ga0501069_0018054 3300049585 Bacteria 3805
667 Ga0501069_0036606 3300049585 Bacteria 2707
668 Ga0501070_0000014 3300049586 Bacteria 180454
669 Ga0501070_0105824 3300049586 Bacteria 2326
670 Ga0501070_0212138 3300049586 Bacteria 1589
671 Ga0501070_0268843 3300049586 Bacteria 1393
672 Ga0501070_0320123 3300049586 Bacteria 1261
673 Ga0501070_0388186 3300049586 Unclassified 1130
674 Ga0501070_0442930 3300049586 Bacteria 1048
675 Ga0501072_0001282 3300049588 Bacteria 18794
676 Ga0501072_0042938 3300049588 Bacteria 3553
677 Ga0501072_0341187 3300049588 Bacteria 1190
678 Ga0501073_0023514 3300049589 Bacteria 4424
679 Ga0501073_0108059 3300049589 Bacteria 1930
680 Ga0501073_0146914 3300049589 Bacteria 1634
681 Ga0501073_0206832 3300049589 Bacteria 1356
682 Ga0501073_0532040 3300049589 Bacteria 812
683 Ga0501074_0001175 3300049590 Bacteria 17172
684 Ga0501074_0129900 3300049590 Bacteria 1802
685 Ga0501074_0747677 3300049590 Bacteria 690
686 Ga0501076_0357227 3300049592 Bacteria 1200
687 Ga0501077_0334108 3300049593 Bacteria 966
688 Ga0501079_0002116 3300049741 Bacteria 14274
689 Ga0501079_0098379 3300049741 Bacteria 2268
690 Ga0501079_0141995 3300049741 Bacteria 1870
691 Ga0501080_0001353 3300049742 Bacteria 20479
692 Ga0501080_0027115 3300049742 Bacteria 5327
693 Ga0501080_0036992 3300049742 Bacteria 4557
694 Ga0501080_0122730 3300049742 Bacteria 2406
695 Ga0501080_0207675 3300049742 Bacteria 1796
696 Ga0501080_0227132 3300049742 Bacteria 1707
697 Ga0501080_0309605 3300049742 Bacteria 1431
698 Ga0501080_0415554 3300049742 Bacteria 1209
699 Ga0501080_0577460 3300049742 Bacteria 999
700 Ga0501080_0602828 3300049742 Bacteria 975
701 Ga0501081_0352968 3300049743 Bacteria 1084
702 Ga0501083_0002575 3300049744 Bacteria 12468
703 Ga0501083_0032738 3300049744 Bacteria 3564
704 Ga0501035_0001780 3300049822 Bacteria 21770
705 Ga0501035_0002097 3300049822 Bacteria 19833
706 Ga0501035_0006268 3300049822 Bacteria 11184
707 Ga0501035_0016519 3300049822 Bacteria 6806
708 Ga0501035_0022243 3300049822 Bacteria 5823
709 Ga0501035_0060216 3300049822 Bacteria 3380
710 Ga0501035_0080787 3300049822 Bacteria 2870
711 Ga0501035_0249832 3300049822 Bacteria 1506
712 Ga0501035_0323732 3300049822 Bacteria 1295
713 Ga0501035_0617762 3300049822 Bacteria 882
714 Ga0501035_0884101 3300049822 Bacteria 708
715 Ga0501044_0000761 3300049823 Bacteria 39005
716 Ga0501044_0022525 3300049823 Bacteria 6712
717 Ga0501044_0025449 3300049823 Bacteria 6272
718 Ga0501044_0071584 3300049823 Bacteria 3525
719 Ga0501044_0084197 3300049823 Bacteria 3214
720 Ga0501044_0118026 3300049823 Bacteria 2656
721 Ga0501044_0119763 3300049823 Bacteria 2634
722 Ga0501044_0150205 3300049823 Bacteria 2312
723 Ga0501044_0187096 3300049823 Bacteria 2035
724 Ga0501044_0216106 3300049823 Bacteria 1869
725 Ga0501044_0267153 3300049823 Bacteria 1647
726 Ga0501044_0637730 3300049823 Bacteria 955
727 Ga0501044_0681044 3300049823 Unclassified 915
728 Ga0501044_1158298 3300049823 Unclassified 642
729 Ga0501045_0119215 3300049824 Bacteria 1959
730 Ga0501045_0199507 3300049824 Bacteria 1491
731 nmdc:mga08y16_625876_c1 3300050511 Unclassified 1083
732 nmdc:mga0rr50_605926_c1 3300050513 Bacteria 934
733 nmdc:mga08x19_37_c1 3300050514 Bacteria 163624
734 nmdc:mga08x19_44640_c1 3300050514 Bacteria 2830
735 nmdc:mga08x19_67234_c1 3300050514 Bacteria 2331
736 Ga0495595_0083670 3300053084 Bacteria 1524
737 Ga0500651_0377674 3300053093 Bacteria 800
738 Ga0500555_004524 3300053103 Bacteria 3951
739 Ga0500595_002039 3300053119 Bacteria 10320
740 Ga0500595_003993 3300053119 Bacteria 6736
741 Ga0500655_049101 3300053133 Bacteria 838
742 Ga0500559_0185689 3300053136 Bacteria 980
743 Ga0500619_001627 3300053154 Bacteria 4042
744 Ga0500645_149447 3300053730 Bacteria 643
745 Ga0501084_0000366 3300054114 Bacteria 34534
746 Ga0501084_0003091 3300054114 Bacteria 13499
747 Ga0501084_0006114 3300054114 Bacteria 9901
748 Ga0501082_0085960 3300060353 Bacteria 2713
749 Ga0501082_0171551 3300060353 Bacteria 1886
750 Ga0530510_0346303 3300061734 Bacteria 1116

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10728190 Ga0070681_107281902 147
2 3300005577 Ga0068857_100842992 Ga0068857_1008429922 147
3 3300009093 Ga0105240_10044045 Ga0105240_100440453 147
4 3300009545 Ga0105237_10012476 Ga0105237_100124762 147
5 3300009551 Ga0105238_10145968 Ga0105238_101459682 147
6 3300010375 Ga0105239_10399659 Ga0105239_103996593 147
7 3300013105 Ga0157369_10613293 Ga0157369_106132932 147
8 3300039438 Ga0436360_0524592 Ga0436360_0524592_657_1127 149
9 3300044684 Ga0466966_0351440 Ga0466966_0351440_180_650 149
10 3300045836 Ga0466958_0360239 Ga0466958_0360239_74_544 149
11 3300048929 Ga0496126_0230764 Ga0496126_0230764_14_496 150
12 3300009551 Ga0105238_10439940 Ga0105238_104399402 152
13 3300028800 Ga0265338_10066692 Ga0265338_100666923 152
14 3300005327 Ga0070658_10180640 Ga0070658_101806403 153
15 3300005328 Ga0070676_10205036 Ga0070676_102050362 153
16 3300005344 Ga0070661_100335168 Ga0070661_1003351682 153
17 3300005530 Ga0070679_101933889 Ga0070679_1019338891 153
18 3300005614 Ga0068856_100371925 Ga0068856_1003719253 153
19 3300009174 Ga0105241_10114803 Ga0105241_101148033 153
20 3300009553 Ga0105249_10524233 Ga0105249_105242332 153
21 3300013307 Ga0157372_11201504 Ga0157372_112015042 153
22 3300014325 Ga0163163_11460583 Ga0163163_114605832 153
23 3300025907 Ga0207645_10188557 Ga0207645_101885572 153
24 3300025909 Ga0207705_10547164 Ga0207705_105471641 153
25 3300025911 Ga0207654_11300561 Ga0207654_113005611 153
26 3300025913 Ga0207695_10022923 Ga0207695_100229234 153
27 3300025914 Ga0207671_11068211 Ga0207671_110682111 153
28 3300025924 Ga0207694_10029540 Ga0207694_100295402 153
29 3300025949 Ga0207667_10368648 Ga0207667_103686483 153
30 3300026078 Ga0207702_10480507 Ga0207702_104805072 153
31 3300026078 Ga0207702_10613422 Ga0207702_106134222 153
32 3300026089 Ga0207648_10648704 Ga0207648_106487043 153
33 3300026116 Ga0207674_10127919 Ga0207674_101279192 153
34 3300028653 Ga0265323_10150793 Ga0265323_101507931 153
35 3300031235 Ga0265330_10082572 Ga0265330_100825722 153
36 3300031235 Ga0265330_10107120 Ga0265330_101071202 153
37 3300031239 Ga0265328_10271255 Ga0265328_102712552 153
38 3300031241 Ga0265325_10000914 Ga0265325_1000091415 153
39 3300031241 Ga0265325_10238021 Ga0265325_102380211 153
40 3300031242 Ga0265329_10114130 Ga0265329_101141302 153
41 3300031247 Ga0265340_10000206 Ga0265340_1000020624 153
42 3300031247 Ga0265340_10033110 Ga0265340_100331102 153
43 3300031247 Ga0265340_10074140 Ga0265340_100741402 153
44 3300031249 Ga0265339_10011784 Ga0265339_100117843 153
45 3300031249 Ga0265339_10023415 Ga0265339_100234152 153
46 3300031249 Ga0265339_10448011 Ga0265339_104480111 153
47 3300031250 Ga0265331_10074411 Ga0265331_100744111 153
48 3300031344 Ga0265316_10019350 Ga0265316_100193506 153
49 3300031344 Ga0265316_10035146 Ga0265316_100351462 153
50 3300031344 Ga0265316_10835471 Ga0265316_108354711 153
51 3300031595 Ga0265313_10005338 Ga0265313_100053389 153
52 3300031595 Ga0265313_10112798 Ga0265313_101127982 153
53 3300031711 Ga0265314_10000918 Ga0265314_100009187 153
54 3300031711 Ga0265314_10141869 Ga0265314_101418692 153
55 3300031711 Ga0265314_10280133 Ga0265314_102801332 153
56 3300031712 Ga0265342_10009937 Ga0265342_100099373 153
57 3300031712 Ga0265342_10243824 Ga0265342_102438242 153
58 3300036401 Ga0373937_0192257 Ga0373937_0192257_760_1227 153
59 3300037466 Ga0395898_0220664 Ga0395898_0220664_941_1408 153
60 3300038443 Ga0395901_0094182 Ga0395901_0094182_1374_1841 153
61 3300003214 JGI25165J46597_1000035 JGI25165J46597_100003556 154
62 3300009101 Ga0105247_10420663 Ga0105247_104206631 154
63 3300013297 Ga0157378_10191010 Ga0157378_101910102 154
64 3300017792 Ga0163161_10096366 Ga0163161_100963663 154
65 3300021384 Ga0213876_10006949 Ga0213876_100069492 154
66 3300025261 Ga0209233_1000006 Ga0209233_1000006550 154
67 3300025932 Ga0207690_11186803 Ga0207690_111868031 154
68 3300028577 Ga0265318_10010669 Ga0265318_100106691 154
69 3300031249 Ga0265339_10094579 Ga0265339_100945792 154
70 3300031730 Ga0307516_10444620 Ga0307516_104446202 154
71 3300049569 Ga0501032_0127946 Ga0501032_0127946_1197_1661 154
72 3300049570 Ga0501033_0007273 Ga0501033_0007273_6873_7337 154
73 3300049572 Ga0501036_0561928 Ga0501036_0561928_135_599 154
74 3300049573 Ga0501037_0077439 Ga0501037_0077439_1252_1716 154
75 3300049574 Ga0501038_0348045 Ga0501038_0348045_395_859 154
76 3300049579 Ga0501043_0277315 Ga0501043_0277315_229_693 154
77 3300049581 Ga0501047_0019060 Ga0501047_0019060_5694_6158 154
78 3300049822 Ga0501035_0006268 Ga0501035_0006268_4980_5444 154
79 3300049823 Ga0501044_0000761 Ga0501044_0000761_16746_17210 154
80 3300049823 Ga0501044_0071584 Ga0501044_0071584_1917_2381 154
81 3300003215 JGI25153J46596_10000792 JGI25153J46596_1000079213 155
82 3300005328 Ga0070676_10024121 Ga0070676_100241212 155
83 3300005334 Ga0068869_100046402 Ga0068869_1000464023 155
84 3300005335 Ga0070666_10074236 Ga0070666_100742363 155
85 3300005337 Ga0070682_100436656 Ga0070682_1004366562 155
86 3300005338 Ga0068868_100153342 Ga0068868_1001533421 155
87 3300005344 Ga0070661_100059484 Ga0070661_1000594842 155
88 3300005354 Ga0070675_100219111 Ga0070675_1002191113 155
89 3300005355 Ga0070671_100818029 Ga0070671_1008180291 155
90 3300005366 Ga0070659_100732282 Ga0070659_1007322822 155
91 3300005367 Ga0070667_100110770 Ga0070667_1001107703 155
92 3300005367 Ga0070667_100325874 Ga0070667_1003258741 155
93 3300005438 Ga0070701_10368553 Ga0070701_103685532 155
94 3300005439 Ga0070711_100812536 Ga0070711_1008125361 155
95 3300005459 Ga0068867_100013842 Ga0068867_1000138423 155
96 3300005539 Ga0068853_100018884 Ga0068853_1000188844 155
97 3300005539 Ga0068853_100086583 Ga0068853_1000865832 155
98 3300005548 Ga0070665_100037182 Ga0070665_1000371826 155
99 3300005548 Ga0070665_100275066 Ga0070665_1002750662 155
100 3300005563 Ga0068855_100246552 Ga0068855_1002465522 155
101 3300005577 Ga0068857_100282195 Ga0068857_1002821952 155
102 3300005578 Ga0068854_100648616 Ga0068854_1006486162 155
103 3300005616 Ga0068852_100015237 Ga0068852_1000152376 155
104 3300005616 Ga0068852_100137985 Ga0068852_1001379852 155
105 3300005618 Ga0068864_100076648 Ga0068864_1000766481 155
106 3300005718 Ga0068866_10193593 Ga0068866_101935932 155
107 3300005840 Ga0068870_10062015 Ga0068870_100620152 155
108 3300005842 Ga0068858_100183267 Ga0068858_1001832672 155
109 3300005843 Ga0068860_100594391 Ga0068860_1005943912 155
110 3300006175 Ga0070712_100269239 Ga0070712_1002692393 155
111 3300006175 Ga0070712_100820723 Ga0070712_1008207231 155
112 3300006237 Ga0097621_100478245 Ga0097621_1004782453 155
113 3300006358 Ga0068871_100007093 Ga0068871_1000070933 155
114 3300006358 Ga0068871_100338703 Ga0068871_1003387032 155
115 3300009093 Ga0105240_10002870 Ga0105240_100028704 155
116 3300009093 Ga0105240_10031565 Ga0105240_100315653 155
117 3300009093 Ga0105240_10367260 Ga0105240_103672602 155
118 3300009093 Ga0105240_10887870 Ga0105240_108878702 155
119 3300009093 Ga0105240_11127749 Ga0105240_111277492 155
120 3300009101 Ga0105247_10004766 Ga0105247_100047665 155
121 3300009101 Ga0105247_10147938 Ga0105247_101479381 155
122 3300009101 Ga0105247_10512964 Ga0105247_105129642 155
123 3300009174 Ga0105241_10021669 Ga0105241_100216696 155
124 3300009174 Ga0105241_10029757 Ga0105241_100297573 155
125 3300009176 Ga0105242_10020635 Ga0105242_100206353 155
126 3300009177 Ga0105248_10000001 Ga0105248_100000011443 155
127 3300009177 Ga0105248_11235995 Ga0105248_112359952 155
128 3300009545 Ga0105237_10239817 Ga0105237_102398172 155
129 3300009545 Ga0105237_10251273 Ga0105237_102512732 155
130 3300009545 Ga0105237_11157783 Ga0105237_111577832 155
131 3300009545 Ga0105237_11349646 Ga0105237_113496461 155
132 3300009545 Ga0105237_11826496 Ga0105237_118264961 155
133 3300009551 Ga0105238_10206601 Ga0105238_102066011 155
134 3300009551 Ga0105238_10598235 Ga0105238_105982352 155
135 3300009553 Ga0105249_10816926 Ga0105249_108169263 155
136 3300009553 Ga0105249_13052870 Ga0105249_130528701 155
137 3300010375 Ga0105239_10004846 Ga0105239_100048465 155
138 3300010375 Ga0105239_10229125 Ga0105239_102291253 155
139 3300010375 Ga0105239_10329588 Ga0105239_103295882 155
140 3300010375 Ga0105239_10404578 Ga0105239_104045783 155
141 3300011119 Ga0105246_10039033 Ga0105246_100390332 155
142 3300011119 Ga0105246_10617745 Ga0105246_106177452 155
143 3300013105 Ga0157369_10001844 Ga0157369_1000184419 155
144 3300013105 Ga0157369_10176423 Ga0157369_101764233 155
145 3300013297 Ga0157378_10082441 Ga0157378_100824413 155
146 3300013297 Ga0157378_10472339 Ga0157378_104723392 155
147 3300013307 Ga0157372_11206619 Ga0157372_112066191 155
148 3300014325 Ga0163163_10495015 Ga0163163_104950152 155
149 3300014969 Ga0157376_10699611 Ga0157376_106996111 155
150 3300014969 Ga0157376_11518183 Ga0157376_115181832 155
151 3300025297 Ga0209758_1000008 Ga0209758_1000008408 155
152 3300025899 Ga0207642_10233967 Ga0207642_102339672 155
153 3300025900 Ga0207710_10114235 Ga0207710_101142351 155
154 3300025907 Ga0207645_10016250 Ga0207645_100162502 155
155 3300025908 Ga0207643_10020522 Ga0207643_100205223 155
156 3300025911 Ga0207654_10024438 Ga0207654_100244382 155
157 3300025911 Ga0207654_10604457 Ga0207654_106044572 155
158 3300025912 Ga0207707_10000002 Ga0207707_10000002104 155
159 3300025913 Ga0207695_10000012 Ga0207695_10000012458 155
160 3300025913 Ga0207695_10070818 Ga0207695_100708185 155
161 3300025915 Ga0207693_10085790 Ga0207693_100857902 155
162 3300025916 Ga0207663_10414639 Ga0207663_104146392 155
163 3300025917 Ga0207660_10000762 Ga0207660_1000076212 155
164 3300025924 Ga0207694_10000006 Ga0207694_10000006210 155
165 3300025924 Ga0207694_10080815 Ga0207694_100808153 155
166 3300025926 Ga0207659_10639735 Ga0207659_106397352 155
167 3300025927 Ga0207687_11376295 Ga0207687_113762951 155
168 3300025932 Ga0207690_10668038 Ga0207690_106680382 155
169 3300025935 Ga0207709_10015320 Ga0207709_100153204 155
170 3300025941 Ga0207711_10000001 Ga0207711_10000001431 155
171 3300025941 Ga0207711_10293964 Ga0207711_102939642 155
172 3300025942 Ga0207689_11079006 Ga0207689_110790062 155
173 3300025945 Ga0207679_10616649 Ga0207679_106166492 155
174 3300025949 Ga0207667_10000484 Ga0207667_1000048410 155
175 3300025961 Ga0207712_10034051 Ga0207712_100340513 155
176 3300025981 Ga0207640_10423852 Ga0207640_104238522 155
177 3300025986 Ga0207658_10101080 Ga0207658_101010801 155
178 3300026035 Ga0207703_10362002 Ga0207703_103620022 155
179 3300026041 Ga0207639_10013412 Ga0207639_100134123 155
180 3300026041 Ga0207639_10073293 Ga0207639_100732932 155
181 3300026088 Ga0207641_10220240 Ga0207641_102202402 155
182 3300026089 Ga0207648_10005473 Ga0207648_100054737 155
183 3300026116 Ga0207674_10327257 Ga0207674_103272572 155
184 3300026121 Ga0207683_10591401 Ga0207683_105914012 155
185 3300026142 Ga0207698_10001029 Ga0207698_1000102918 155
186 3300026142 Ga0207698_10060313 Ga0207698_100603132 155
187 3300026142 Ga0207698_10071704 Ga0207698_100717042 155
188 3300028379 Ga0268266_10057702 Ga0268266_100577022 155
189 3300028379 Ga0268266_10159546 Ga0268266_101595463 155
190 3300028379 Ga0268266_10597594 Ga0268266_105975942 155
191 3300028381 Ga0268264_10100540 Ga0268264_101005403 155
192 3300028381 Ga0268264_10395584 Ga0268264_103955842 155
193 3300028558 Ga0265326_10056203 Ga0265326_100562032 155
194 3300028573 Ga0265334_10018182 Ga0265334_100181822 155
195 3300028577 Ga0265318_10002560 Ga0265318_100025604 155
196 3300028800 Ga0265338_10000011 Ga0265338_1000001177 155
197 3300028800 Ga0265338_10010424 Ga0265338_100104243 155
198 3300031238 Ga0265332_10028790 Ga0265332_100287903 155
199 3300031238 Ga0265332_10030345 Ga0265332_100303452 155
200 3300031239 Ga0265328_10194015 Ga0265328_101940151 155
201 3300031240 Ga0265320_10107986 Ga0265320_101079862 155
202 3300031241 Ga0265325_10000017 Ga0265325_1000001783 155
203 3300031241 Ga0265325_10024366 Ga0265325_100243664 155
204 3300031242 Ga0265329_10006493 Ga0265329_100064933 155
205 3300031249 Ga0265339_10000895 Ga0265339_1000089521 155
206 3300031250 Ga0265331_10003379 Ga0265331_100033797 155
207 3300031250 Ga0265331_10013806 Ga0265331_100138063 155
208 3300031344 Ga0265316_10141463 Ga0265316_101414632 155
209 3300031595 Ga0265313_10005228 Ga0265313_100052283 155
210 3300031595 Ga0265313_10007533 Ga0265313_100075333 155
211 3300031595 Ga0265313_10010085 Ga0265313_100100853 155
212 3300031711 Ga0265314_10005990 Ga0265314_100059906 155
213 3300031711 Ga0265314_10007494 Ga0265314_100074944 155
214 3300031711 Ga0265314_10031435 Ga0265314_100314353 155
215 3300031712 Ga0265342_10029287 Ga0265342_100292872 155
216 3300031730 Ga0307516_10030531 Ga0307516_100305312 155
217 3300039437 Ga0436365_0448800 Ga0436365_0448800_197_670 155
218 3300039437 Ga0436365_0577140 Ga0436365_0577140_7112_7585 155
219 3300039437 Ga0436365_1264489 Ga0436365_1264489_848_1315 155
220 3300039447 Ga0436361_0796701 Ga0436361_0796701_134_607 155
221 3300039450 Ga0436363_0355221 Ga0436363_0355221_116_589 155
222 3300046462 Ga0495651_0741033 Ga0495651_0741033_54_524 155
223 3300046524 Ga0495648_0074879 Ga0495648_0074879_524_997 155
224 3300046538 Ga0495609_0015399 Ga0495609_0015399_2418_2891 155
225 3300046539 Ga0495621_0305515 Ga0495621_0305515_131_604 155
226 3300046557 Ga0495622_0009823 Ga0495622_0009823_2750_3223 155
227 3300046558 Ga0495633_0380312 Ga0495633_0380312_133_606 155
228 3300047320 Ga0495672_0556991 Ga0495672_0556991_17_490 155
229 3300048903 Ga0496100_0748828 Ga0496100_0748828_169_639 155
230 3300048924 Ga0496121_0016235 Ga0496121_0016235_2178_2648 155
231 3300048929 Ga0496126_0358679 Ga0496126_0358679_592_1065 155
232 3300049460 Ga0495682_0001443 Ga0495682_0001443_7653_8123 155
233 3300049571 Ga0501034_0315936 Ga0501034_0315936_251_721 155
234 3300049579 Ga0501043_0247448 Ga0501043_0247448_35_502 155
235 3300049580 Ga0501046_0090783 Ga0501046_0090783_1202_1675 155
236 3300049580 Ga0501046_0276044 Ga0501046_0276044_498_968 155
237 3300049581 Ga0501047_0006654 Ga0501047_0006654_8288_8761 155
238 3300049581 Ga0501047_0008920 Ga0501047_0008920_4430_4897 155
239 3300049581 Ga0501047_0065424 Ga0501047_0065424_3011_3478 155
240 3300049581 Ga0501047_0205133 Ga0501047_0205133_995_1465 155
241 3300049583 Ga0501067_0000481 Ga0501067_0000481_11971_12438 155
242 3300049583 Ga0501067_0432754 Ga0501067_0432754_224_691 155
243 3300049586 Ga0501070_0212138 Ga0501070_0212138_167_637 155
244 3300049588 Ga0501072_0001282 Ga0501072_0001282_4634_5101 155
245 3300049589 Ga0501073_0206832 Ga0501073_0206832_478_945 155
246 3300049742 Ga0501080_0036992 Ga0501080_0036992_478_948 155
247 3300049742 Ga0501080_0207675 Ga0501080_0207675_200_673 155
248 3300049742 Ga0501080_0227132 Ga0501080_0227132_1058_1531 155
249 3300049742 Ga0501080_0309605 Ga0501080_0309605_56_523 155
250 3300049742 Ga0501080_0415554 Ga0501080_0415554_53_523 155
251 3300049822 Ga0501035_0323732 Ga0501035_0323732_365_832 155
252 3300049823 Ga0501044_0187096 Ga0501044_0187096_1373_1843 155
253 3300049823 Ga0501044_0637730 Ga0501044_0637730_461_934 155
254 3300053136 Ga0500559_0185689 Ga0500559_0185689_51_536 155
255 3300053154 Ga0500619_001627 Ga0500619_001627_3003_3473 155
256 3300054114 Ga0501084_0000366 Ga0501084_0000366_245_712 155
257 3300060353 Ga0501082_0171551 Ga0501082_0171551_1287_1754 155
258 3300005330 Ga0070690_100119451 Ga0070690_1001194513 156
259 3300005331 Ga0070670_101205585 Ga0070670_1012055851 156
260 3300005335 Ga0070666_10076220 Ga0070666_100762202 156
261 3300005338 Ga0068868_100069238 Ga0068868_1000692383 156
262 3300005338 Ga0068868_100081729 Ga0068868_1000817292 156
263 3300005338 Ga0068868_100440182 Ga0068868_1004401822 156
264 3300005344 Ga0070661_100534413 Ga0070661_1005344131 156
265 3300005367 Ga0070667_100552273 Ga0070667_1005522731 156
266 3300005367 Ga0070667_100829758 Ga0070667_1008297582 156
267 3300005440 Ga0070705_101241632 Ga0070705_1012416321 156
268 3300005456 Ga0070678_100026666 Ga0070678_1000266664 156
269 3300005456 Ga0070678_100028400 Ga0070678_1000284005 156
270 3300005456 Ga0070678_100070242 Ga0070678_1000702422 156
271 3300005458 Ga0070681_10057249 Ga0070681_100572495 156
272 3300005459 Ga0068867_100256306 Ga0068867_1002563062 156
273 3300005535 Ga0070684_100210563 Ga0070684_1002105632 156
274 3300005535 Ga0070684_100271498 Ga0070684_1002714981 156
275 3300005539 Ga0068853_100990536 Ga0068853_1009905361 156
276 3300005539 Ga0068853_101090277 Ga0068853_1010902771 156
277 3300005547 Ga0070693_100081443 Ga0070693_1000814432 156
278 3300005548 Ga0070665_100142381 Ga0070665_1001423813 156
279 3300005563 Ga0068855_100462369 Ga0068855_1004623693 156
280 3300005563 Ga0068855_101076563 Ga0068855_1010765631 156
281 3300005577 Ga0068857_101956901 Ga0068857_1019569011 156
282 3300005614 Ga0068856_100566969 Ga0068856_1005669692 156
283 3300005614 Ga0068856_100927282 Ga0068856_1009272822 156
284 3300005617 Ga0068859_100452005 Ga0068859_1004520052 156
285 3300005618 Ga0068864_101421893 Ga0068864_1014218932 156
286 3300005842 Ga0068858_100020784 Ga0068858_1000207842 156
287 3300005842 Ga0068858_100733696 Ga0068858_1007336962 156
288 3300006175 Ga0070712_100660458 Ga0070712_1006604582 156
289 3300006237 Ga0097621_100001436 Ga0097621_10000143611 156
290 3300006237 Ga0097621_100197113 Ga0097621_1001971132 156
291 3300006237 Ga0097621_100278623 Ga0097621_1002786233 156
292 3300006237 Ga0097621_100335531 Ga0097621_1003355313 156
293 3300006358 Ga0068871_100000329 Ga0068871_10000032925 156
294 3300006358 Ga0068871_100072694 Ga0068871_1000726942 156
295 3300006358 Ga0068871_100113304 Ga0068871_1001133043 156
296 3300006358 Ga0068871_100170069 Ga0068871_1001700692 156
297 3300006358 Ga0068871_100207079 Ga0068871_1002070793 156
298 3300006358 Ga0068871_100495401 Ga0068871_1004954011 156
299 3300006881 Ga0068865_100085499 Ga0068865_1000854992 156
300 3300006931 Ga0097620_100452012 Ga0097620_1004520122 156
301 3300009093 Ga0105240_10260545 Ga0105240_102605453 156
302 3300009093 Ga0105240_10470357 Ga0105240_104703573 156
303 3300009093 Ga0105240_10513319 Ga0105240_105133193 156
304 3300009093 Ga0105240_10594310 Ga0105240_105943101 156
305 3300009093 Ga0105240_10732460 Ga0105240_107324603 156
306 3300009098 Ga0105245_10022596 Ga0105245_100225963 156
307 3300009098 Ga0105245_10080647 Ga0105245_100806474 156
308 3300009098 Ga0105245_10485349 Ga0105245_104853491 156
309 3300009098 Ga0105245_11204084 Ga0105245_112040842 156
310 3300009148 Ga0105243_10529716 Ga0105243_105297161 156
311 3300009174 Ga0105241_10191554 Ga0105241_101915543 156
312 3300009174 Ga0105241_10822493 Ga0105241_108224931 156
313 3300009176 Ga0105242_10020889 Ga0105242_100208892 156
314 3300009176 Ga0105242_10025118 Ga0105242_100251182 156
315 3300009176 Ga0105242_10360506 Ga0105242_103605062 156
316 3300009177 Ga0105248_10327564 Ga0105248_103275643 156
317 3300009177 Ga0105248_11113184 Ga0105248_111131842 156
318 3300009545 Ga0105237_10706865 Ga0105237_107068651 156
319 3300009551 Ga0105238_10848330 Ga0105238_108483302 156
320 3300009553 Ga0105249_10761222 Ga0105249_107612221 156
321 3300010375 Ga0105239_12164550 Ga0105239_121645501 156
322 3300011119 Ga0105246_10103733 Ga0105246_101037334 156
323 3300013104 Ga0157370_10034135 Ga0157370_100341352 156
324 3300013105 Ga0157369_11163159 Ga0157369_111631591 156
325 3300013296 Ga0157374_10103819 Ga0157374_101038192 156
326 3300013296 Ga0157374_10249080 Ga0157374_102490803 156
327 3300013296 Ga0157374_11412075 Ga0157374_114120751 156
328 3300013297 Ga0157378_10046152 Ga0157378_100461523 156
329 3300013297 Ga0157378_10109188 Ga0157378_101091882 156
330 3300013297 Ga0157378_10577928 Ga0157378_105779282 156
331 3300013306 Ga0163162_10125826 Ga0163162_101258262 156
332 3300013306 Ga0163162_12676455 Ga0163162_126764551 156
333 3300013307 Ga0157372_10377024 Ga0157372_103770243 156
334 3300013308 Ga0157375_10168950 Ga0157375_101689503 156
335 3300013308 Ga0157375_10882518 Ga0157375_108825182 156
336 3300014968 Ga0157379_10002945 Ga0157379_100029458 156
337 3300014968 Ga0157379_10015566 Ga0157379_100155666 156
338 3300014968 Ga0157379_10212106 Ga0157379_102121062 156
339 3300014969 Ga0157376_10342519 Ga0157376_103425193 156
340 3300014969 Ga0157376_10418456 Ga0157376_104184562 156
341 3300014969 Ga0157376_10546745 Ga0157376_105467452 156
342 3300014969 Ga0157376_11513187 Ga0157376_115131872 156
343 3300014969 Ga0157376_12055537 Ga0157376_120555371 156
344 3300025899 Ga0207642_10143329 Ga0207642_101433292 156
345 3300025903 Ga0207680_10162112 Ga0207680_101621123 156
346 3300025909 Ga0207705_10233215 Ga0207705_102332152 156
347 3300025911 Ga0207654_10886494 Ga0207654_108864941 156
348 3300025913 Ga0207695_10377153 Ga0207695_103771532 156
349 3300025913 Ga0207695_10991755 Ga0207695_109917551 156
350 3300025915 Ga0207693_10521454 Ga0207693_105214542 156
351 3300025923 Ga0207681_10861965 Ga0207681_108619651 156
352 3300025925 Ga0207650_10283041 Ga0207650_102830413 156
353 3300025927 Ga0207687_10083759 Ga0207687_100837593 156
354 3300025927 Ga0207687_10230472 Ga0207687_102304722 156
355 3300025928 Ga0207700_10355802 Ga0207700_103558022 156
356 3300025931 Ga0207644_10098489 Ga0207644_100984893 156
357 3300025933 Ga0207706_10075011 Ga0207706_100750112 156
358 3300025934 Ga0207686_10007932 Ga0207686_100079326 156
359 3300025934 Ga0207686_10079547 Ga0207686_100795472 156
360 3300025934 Ga0207686_10232254 Ga0207686_102322541 156
361 3300025934 Ga0207686_10842101 Ga0207686_108421011 156
362 3300025938 Ga0207704_10912711 Ga0207704_109127112 156
363 3300025941 Ga0207711_10154528 Ga0207711_101545283 156
364 3300025942 Ga0207689_10066225 Ga0207689_100662252 156
365 3300025942 Ga0207689_10308801 Ga0207689_103088012 156
366 3300025944 Ga0207661_10778526 Ga0207661_107785261 156
367 3300025949 Ga0207667_10042630 Ga0207667_100426306 156
368 3300025949 Ga0207667_11301923 Ga0207667_113019231 156
369 3300026023 Ga0207677_10139294 Ga0207677_101392942 156
370 3300026023 Ga0207677_10386882 Ga0207677_103868822 156
371 3300026035 Ga0207703_10042079 Ga0207703_100420792 156
372 3300026035 Ga0207703_10339880 Ga0207703_103398802 156
373 3300026035 Ga0207703_10909093 Ga0207703_109090931 156
374 3300026089 Ga0207648_10255101 Ga0207648_102551012 156
375 3300026095 Ga0207676_10879723 Ga0207676_108797231 156
376 3300026116 Ga0207674_10721842 Ga0207674_107218421 156
377 3300026118 Ga0207675_100082307 Ga0207675_1000823073 156
378 3300026121 Ga0207683_10008637 Ga0207683_100086375 156
379 3300026121 Ga0207683_10021754 Ga0207683_100217543 156
380 3300026121 Ga0207683_10128768 Ga0207683_101287683 156
381 3300028379 Ga0268266_10064534 Ga0268266_100645341 156
382 3300028381 Ga0268264_10097183 Ga0268264_100971833 156
383 3300028800 Ga0265338_10007110 Ga0265338_100071103 156
384 3300031238 Ga0265332_10069078 Ga0265332_100690782 156
385 3300031238 Ga0265332_10165921 Ga0265332_101659211 156
386 3300031247 Ga0265340_10003976 Ga0265340_100039764 156
387 3300031247 Ga0265340_10274388 Ga0265340_102743882 156
388 3300031250 Ga0265331_10009636 Ga0265331_100096363 156
389 3300031344 Ga0265316_10059973 Ga0265316_100599734 156
390 3300031344 Ga0265316_10329545 Ga0265316_103295453 156
391 3300031711 Ga0265314_10012633 Ga0265314_100126334 156
392 3300035112 Ga0373932_0114490 Ga0373932_0114490_387_863 156
393 3300035114 Ga0373939_0027361 Ga0373939_0027361_1125_1601 156
394 3300035172 Ga0373955_0771102 Ga0373955_0771102_52_528 156
395 3300035172 Ga0373955_0925983 Ga0373955_0925983_37_510 156
396 3300036401 Ga0373937_0790122 Ga0373937_0790122_210_683 156
397 3300036401 Ga0373937_1062792 Ga0373937_1062792_142_615 156
398 3300037466 Ga0395898_0074177 Ga0395898_0074177_526_999 156
399 3300039437 Ga0436365_1131003 Ga0436365_1131003_197_667 156
400 3300039438 Ga0436360_0558935 Ga0436360_0558935_888_1364 156
401 3300045976 Ga0466967_0366245 Ga0466967_0366245_644_1117 156
402 3300046529 Ga0495652_0832461 Ga0495652_0832461_109_582 156
403 3300046678 Ga0495599_0372969 Ga0495599_0372969_136_609 156
404 3300046691 Ga0495670_0326786 Ga0495670_0326786_273_749 156
405 3300047315 Ga0495581_0269866 Ga0495581_0269866_368_841 156
406 3300047673 Ga0495593_0147465 Ga0495593_0147465_625_1101 156
407 3300047673 Ga0495593_0571083 Ga0495593_0571083_57_533 156
408 3300048909 Ga0496106_0336546 Ga0496106_0336546_588_1064 156
409 3300048917 Ga0496114_1637730 Ga0496114_1637730_46_522 156
410 3300049568 Ga0501031_0148555 Ga0501031_0148555_267_743 156
411 3300049569 Ga0501032_0026248 Ga0501032_0026248_3155_3631 156
412 3300049570 Ga0501033_0317075 Ga0501033_0317075_612_1085 156
413 3300049571 Ga0501034_0518932 Ga0501034_0518932_358_834 156
414 3300049573 Ga0501037_0009459 Ga0501037_0009459_5834_6310 156
415 3300049574 Ga0501038_0065266 Ga0501038_0065266_1644_2120 156
416 3300049579 Ga0501043_0041740 Ga0501043_0041740_2191_2667 156
417 3300049579 Ga0501043_0786915 Ga0501043_0786915_51_524 156
418 3300049581 Ga0501047_0079440 Ga0501047_0079440_1643_2119 156
419 3300049581 Ga0501047_0293014 Ga0501047_0293014_832_1308 156
420 3300049586 Ga0501070_0000014 Ga0501070_0000014_62971_63447 156
421 3300049741 Ga0501079_0098379 Ga0501079_0098379_1411_1887 156
422 3300049742 Ga0501080_0001353 Ga0501080_0001353_5343_5819 156
423 3300049822 Ga0501035_0001780 Ga0501035_0001780_17002_17478 156
424 3300049823 Ga0501044_0022525 Ga0501044_0022525_1234_1707 156
425 3300049823 Ga0501044_0084197 Ga0501044_0084197_865_1341 156
426 3300053103 Ga0500555_004524 Ga0500555_004524_2614_3087 156
427 3300053119 Ga0500595_002039 Ga0500595_002039_8174_8650 156
428 3300053119 Ga0500595_003993 Ga0500595_003993_5622_6116 156
429 3300005327 Ga0070658_10006016 Ga0070658_100060162 157
430 3300005335 Ga0070666_10000633 Ga0070666_100006339 157
431 3300005336 Ga0070680_100105641 Ga0070680_1001056412 157
432 3300005339 Ga0070660_100032812 Ga0070660_1000328122 157
433 3300005341 Ga0070691_10168035 Ga0070691_101680352 157
434 3300005355 Ga0070671_101283766 Ga0070671_1012837661 157
435 3300005366 Ga0070659_100390384 Ga0070659_1003903842 157
436 3300005434 Ga0070709_10001252 Ga0070709_100012525 157
437 3300005434 Ga0070709_10557283 Ga0070709_105572832 157
438 3300005436 Ga0070713_100000199 Ga0070713_10000019913 157
439 3300005437 Ga0070710_10256962 Ga0070710_102569622 157
440 3300005439 Ga0070711_100005086 Ga0070711_1000050864 157
441 3300005439 Ga0070711_100174461 Ga0070711_1001744612 157
442 3300005440 Ga0070705_100031377 Ga0070705_1000313772 157
443 3300005458 Ga0070681_10059268 Ga0070681_100592685 157
444 3300005458 Ga0070681_10217568 Ga0070681_102175682 157
445 3300005458 Ga0070681_10420405 Ga0070681_104204052 157
446 3300005530 Ga0070679_100333344 Ga0070679_1003333441 157
447 3300005539 Ga0068853_100004853 Ga0068853_1000048532 157
448 3300005545 Ga0070695_100239615 Ga0070695_1002396152 157
449 3300005546 Ga0070696_100325619 Ga0070696_1003256192 157
450 3300005547 Ga0070693_100279638 Ga0070693_1002796381 157
451 3300005548 Ga0070665_100000728 Ga0070665_10000072832 157
452 3300005548 Ga0070665_100132277 Ga0070665_1001322773 157
453 3300005563 Ga0068855_100239980 Ga0068855_1002399803 157
454 3300005563 Ga0068855_100284299 Ga0068855_1002842992 157
455 3300005563 Ga0068855_100374770 Ga0068855_1003747703 157
456 3300005564 Ga0070664_100206050 Ga0070664_1002060502 157
457 3300005577 Ga0068857_100001360 Ga0068857_1000013605 157
458 3300005577 Ga0068857_100178550 Ga0068857_1001785503 157
459 3300005614 Ga0068856_100009449 Ga0068856_1000094495 157
460 3300005616 Ga0068852_100062213 Ga0068852_1000622132 157
461 3300005842 Ga0068858_100030997 Ga0068858_1000309976 157
462 3300005842 Ga0068858_100409572 Ga0068858_1004095722 157
463 3300005844 Ga0068862_100610709 Ga0068862_1006107091 157
464 3300006173 Ga0070716_100595151 Ga0070716_1005951512 157
465 3300006175 Ga0070712_100000443 Ga0070712_10000044321 157
466 3300006237 Ga0097621_100505636 Ga0097621_1005056362 157
467 3300006237 Ga0097621_101331889 Ga0097621_1013318891 157
468 3300006914 Ga0075436_100001475 Ga0075436_1000014759 157
469 3300006914 Ga0075436_100320300 Ga0075436_1003203002 157
470 3300009098 Ga0105245_10365033 Ga0105245_103650332 157
471 3300009174 Ga0105241_10324623 Ga0105241_103246232 157
472 3300009174 Ga0105241_10446664 Ga0105241_104466642 157
473 3300009174 Ga0105241_11213678 Ga0105241_112136782 157
474 3300009177 Ga0105248_10047648 Ga0105248_100476487 157
475 3300009551 Ga0105238_10001095 Ga0105238_1000109524 157
476 3300010375 Ga0105239_11105273 Ga0105239_111052732 157
477 3300013296 Ga0157374_10245877 Ga0157374_102458772 157
478 3300013307 Ga0157372_10531560 Ga0157372_105315602 157
479 3300014497 Ga0182008_10425385 Ga0182008_104253851 157
480 3300014968 Ga0157379_10002841 Ga0157379_100028413 157
481 3300014968 Ga0157379_10014719 Ga0157379_100147192 157
482 3300014968 Ga0157379_10106425 Ga0157379_101064254 157
483 3300014968 Ga0157379_10234922 Ga0157379_102349222 157
484 3300021384 Ga0213876_10014748 Ga0213876_100147482 157
485 3300025898 Ga0207692_10240802 Ga0207692_102408022 157
486 3300025903 Ga0207680_10004246 Ga0207680_100042461 157
487 3300025906 Ga0207699_10000124 Ga0207699_100001245 157
488 3300025909 Ga0207705_10010749 Ga0207705_100107492 157
489 3300025911 Ga0207654_10071613 Ga0207654_100716132 157
490 3300025911 Ga0207654_10212429 Ga0207654_102124293 157
491 3300025911 Ga0207654_10322641 Ga0207654_103226412 157
492 3300025912 Ga0207707_10052017 Ga0207707_100520175 157
493 3300025912 Ga0207707_10133978 Ga0207707_101339781 157
494 3300025913 Ga0207695_10019474 Ga0207695_100194745 157
495 3300025913 Ga0207695_10193310 Ga0207695_101933103 157
496 3300025914 Ga0207671_10041130 Ga0207671_100411304 157
497 3300025915 Ga0207693_10000213 Ga0207693_1000021315 157
498 3300025915 Ga0207693_10001025 Ga0207693_100010259 157
499 3300025916 Ga0207663_10074266 Ga0207663_100742662 157
500 3300025917 Ga0207660_10196886 Ga0207660_101968862 157
501 3300025919 Ga0207657_10042626 Ga0207657_100426265 157
502 3300025920 Ga0207649_10243234 Ga0207649_102432342 157
503 3300025921 Ga0207652_10950701 Ga0207652_109507011 157
504 3300025924 Ga0207694_10222742 Ga0207694_102227421 157
505 3300025928 Ga0207700_10000026 Ga0207700_10000026149 157
506 3300025928 Ga0207700_10015912 Ga0207700_100159124 157
507 3300025929 Ga0207664_10010373 Ga0207664_100103731 157
508 3300025941 Ga0207711_10179231 Ga0207711_101792313 157
509 3300025949 Ga0207667_10015995 Ga0207667_100159952 157
510 3300025949 Ga0207667_10087471 Ga0207667_100874712 157
511 3300025986 Ga0207658_10056556 Ga0207658_100565562 157
512 3300026035 Ga0207703_10077321 Ga0207703_100773212 157
513 3300026041 Ga0207639_10025732 Ga0207639_100257326 157
514 3300026041 Ga0207639_11091975 Ga0207639_110919752 157
515 3300026041 Ga0207639_11427802 Ga0207639_114278021 157
516 3300026078 Ga0207702_10000021 Ga0207702_1000002198 157
517 3300026078 Ga0207702_10009259 Ga0207702_100092595 157
518 3300026078 Ga0207702_10906135 Ga0207702_109061351 157
519 3300026116 Ga0207674_10000898 Ga0207674_1000089823 157
520 3300026116 Ga0207674_10075071 Ga0207674_100750713 157
521 3300028379 Ga0268266_10000385 Ga0268266_1000038532 157
522 3300028379 Ga0268266_10654579 Ga0268266_106545792 157
523 3300028800 Ga0265338_10013075 Ga0265338_100130759 157
524 3300028800 Ga0265338_10714133 Ga0265338_107141332 157
525 3300031240 Ga0265320_10000370 Ga0265320_1000037030 157
526 3300031241 Ga0265325_10000484 Ga0265325_1000048415 157
527 3300031241 Ga0265325_10004365 Ga0265325_100043657 157
528 3300031241 Ga0265325_10082607 Ga0265325_100826072 157
529 3300031241 Ga0265325_10090968 Ga0265325_100909682 157
530 3300031241 Ga0265325_10154371 Ga0265325_101543711 157
531 3300031241 Ga0265325_10231265 Ga0265325_102312651 157
532 3300031242 Ga0265329_10042822 Ga0265329_100428222 157
533 3300031247 Ga0265340_10024503 Ga0265340_100245032 157
534 3300031249 Ga0265339_10005604 Ga0265339_100056046 157
535 3300031249 Ga0265339_10141253 Ga0265339_101412532 157
536 3300031250 Ga0265331_10078937 Ga0265331_100789372 157
537 3300031344 Ga0265316_10044324 Ga0265316_100443243 157
538 3300031344 Ga0265316_10245902 Ga0265316_102459022 157
539 3300031344 Ga0265316_10450315 Ga0265316_104503151 157
540 3300031595 Ga0265313_10004380 Ga0265313_100043804 157
541 3300031595 Ga0265313_10124895 Ga0265313_101248952 157
542 3300031595 Ga0265313_10256007 Ga0265313_102560071 157
543 3300031711 Ga0265314_10007742 Ga0265314_100077429 157
544 3300031711 Ga0265314_10149776 Ga0265314_101497762 157
545 3300031711 Ga0265314_10249566 Ga0265314_102495662 157
546 3300031712 Ga0265342_10057244 Ga0265342_100572442 157
547 3300031712 Ga0265342_10252969 Ga0265342_102529692 157
548 3300035118 Ga0373954_0153251 Ga0373954_0153251_203_676 157
549 3300035695 Ga0373927_0168409 Ga0373927_0168409_71_565 157
550 3300035724 Ga0373933_0018352 Ga0373933_0018352_3224_3697 157
551 3300035724 Ga0373933_0272850 Ga0373933_0272850_117_611 157
552 3300035724 Ga0373933_0472295 Ga0373933_0472295_239_733 157
553 3300036401 Ga0373937_0001347 Ga0373937_0001347_19134_19628 157
554 3300036401 Ga0373937_0017765 Ga0373937_0017765_5531_6004 157
555 3300036401 Ga0373937_0083005 Ga0373937_0083005_890_1363 157
556 3300036401 Ga0373937_0320255 Ga0373937_0320255_377_871 157
557 3300037068 Ga0373925_0368220 Ga0373925_0368220_172_666 157
558 3300037418 Ga0395900_0039256 Ga0395900_0039256_428_904 157
559 3300038443 Ga0395901_0010855 Ga0395901_0010855_4711_5187 157
560 3300039437 Ga0436365_0390587 Ga0436365_0390587_2417_2890 157
561 3300039453 Ga0436362_1185563 Ga0436362_1185563_187_660 157
562 3300045976 Ga0466967_1005322 Ga0466967_1005322_292_768 157
563 3300046462 Ga0495651_0336322 Ga0495651_0336322_479_952 157
564 3300046516 Ga0495628_0395773 Ga0495628_0395773_416_979 157
565 3300046648 Ga0495611_0339948 Ga0495611_0339948_16_495 157
566 3300047319 Ga0495674_0211461 Ga0495674_0211461_290_763 157
567 3300048905 Ga0496102_0278391 Ga0496102_0278391_706_1179 157
568 3300048909 Ga0496106_0735284 Ga0496106_0735284_188_682 157
569 3300048910 Ga0496107_0348134 Ga0496107_0348134_562_1056 157
570 3300048929 Ga0496126_0003628 Ga0496126_0003628_14776_15252 157
571 3300049568 Ga0501031_0011841 Ga0501031_0011841_2176_2661 157
572 3300049569 Ga0501032_0044102 Ga0501032_0044102_1992_2465 157
573 3300049569 Ga0501032_0165667 Ga0501032_0165667_107_583 157
574 3300049569 Ga0501032_0189207 Ga0501032_0189207_771_1256 157
575 3300049570 Ga0501033_0355576 Ga0501033_0355576_133_618 157
576 3300049571 Ga0501034_0010803 Ga0501034_0010803_191_676 157
577 3300049571 Ga0501034_0017594 Ga0501034_0017594_3621_4094 157
578 3300049571 Ga0501034_0386353 Ga0501034_0386353_532_1014 157
579 3300049572 Ga0501036_0030777 Ga0501036_0030777_1921_2406 157
580 3300049572 Ga0501036_0038275 Ga0501036_0038275_1644_2117 157
581 3300049572 Ga0501036_0307612 Ga0501036_0307612_824_1300 157
582 3300049573 Ga0501037_0009064 Ga0501037_0009064_1577_2062 157
583 3300049573 Ga0501037_0062745 Ga0501037_0062745_1270_1755 157
584 3300049573 Ga0501037_0111271 Ga0501037_0111271_1283_1756 157
585 3300049573 Ga0501037_0154826 Ga0501037_0154826_852_1328 157
586 3300049574 Ga0501038_0003178 Ga0501038_0003178_269_754 157
587 3300049574 Ga0501038_0060272 Ga0501038_0060272_24_509 157
588 3300049574 Ga0501038_0133759 Ga0501038_0133759_1496_1972 157
589 3300049574 Ga0501038_0452305 Ga0501038_0452305_429_911 157
590 3300049575 Ga0501039_0003110 Ga0501039_0003110_5233_5718 157
591 3300049575 Ga0501039_0406144 Ga0501039_0406144_38_514 157
592 3300049576 Ga0501040_0145850 Ga0501040_0145850_777_1262 157
593 3300049578 Ga0501042_0002157 Ga0501042_0002157_6397_6882 157
594 3300049578 Ga0501042_0232538 Ga0501042_0232538_486_959 157
595 3300049579 Ga0501043_0022817 Ga0501043_0022817_813_1289 157
596 3300049579 Ga0501043_0037650 Ga0501043_0037650_2345_2830 157
597 3300049579 Ga0501043_0243832 Ga0501043_0243832_133_618 157
598 3300049580 Ga0501046_0002292 Ga0501046_0002292_16787_17272 157
599 3300049581 Ga0501047_0008138 Ga0501047_0008138_2562_3047 157
600 3300049581 Ga0501047_0134245 Ga0501047_0134245_582_1064 157
601 3300049581 Ga0501047_0304483 Ga0501047_0304483_34_507 157
602 3300049581 Ga0501047_0637043 Ga0501047_0637043_222_698 157
603 3300049581 Ga0501047_0925040 Ga0501047_0925040_55_534 157
604 3300049582 Ga0501048_0016380 Ga0501048_0016380_697_1182 157
605 3300049583 Ga0501067_0000141 Ga0501067_0000141_19284_19769 157
606 3300049583 Ga0501067_0101400 Ga0501067_0101400_1075_1548 157
607 3300049584 Ga0501068_0010448 Ga0501068_0010448_1898_2383 157
608 3300049585 Ga0501069_0018054 Ga0501069_0018054_3299_3784 157
609 3300049585 Ga0501069_0036606 Ga0501069_0036606_951_1424 157
610 3300049586 Ga0501070_0320123 Ga0501070_0320123_184_657 157
611 3300049586 Ga0501070_0442930 Ga0501070_0442930_494_976 157
612 3300049588 Ga0501072_0042938 Ga0501072_0042938_2529_3014 157
613 3300049589 Ga0501073_0023514 Ga0501073_0023514_451_936 157
614 3300049589 Ga0501073_0108059 Ga0501073_0108059_605_1078 157
615 3300049590 Ga0501074_0001175 Ga0501074_0001175_16555_17040 157
616 3300049590 Ga0501074_0129900 Ga0501074_0129900_605_1078 157
617 3300049741 Ga0501079_0002116 Ga0501079_0002116_13728_14213 157
618 3300049741 Ga0501079_0141995 Ga0501079_0141995_843_1316 157
619 3300049742 Ga0501080_0122730 Ga0501080_0122730_34_507 157
620 3300049742 Ga0501080_0577460 Ga0501080_0577460_64_549 157
621 3300049744 Ga0501083_0002575 Ga0501083_0002575_10055_10540 157
622 3300049744 Ga0501083_0032738 Ga0501083_0032738_384_857 157
623 3300049822 Ga0501035_0002097 Ga0501035_0002097_16039_16512 157
624 3300049822 Ga0501035_0022243 Ga0501035_0022243_4428_4913 157
625 3300049822 Ga0501035_0249832 Ga0501035_0249832_972_1448 157
626 3300049822 Ga0501035_0884101 Ga0501035_0884101_133_618 157
627 3300049823 Ga0501044_0118026 Ga0501044_0118026_1401_1886 157
628 3300049823 Ga0501044_0150205 Ga0501044_0150205_1656_2129 157
629 3300049823 Ga0501044_0216106 Ga0501044_0216106_916_1392 157
630 3300049824 Ga0501045_0199507 Ga0501045_0199507_219_704 157
631 3300050513 nmdc:mga0rr50_605926_c1 nmdc:mga0rr50_605926_c1_269_742 157
632 3300050514 nmdc:mga08x19_37_c1 nmdc:mga08x19_37_c1_145651_146124 157
633 3300050514 nmdc:mga08x19_44640_c1 nmdc:mga08x19_44640_c1_1460_1933 157
634 3300050514 nmdc:mga08x19_67234_c1 nmdc:mga08x19_67234_c1_1739_2212 157
635 3300053093 Ga0500651_0377674 Ga0500651_0377674_285_758 157
636 3300053133 Ga0500655_049101 Ga0500655_049101_353_826 157
637 3300054114 Ga0501084_0003091 Ga0501084_0003091_62_547 157
638 3300054114 Ga0501084_0006114 Ga0501084_0006114_2230_2703 157
639 3300060353 Ga0501082_0085960 Ga0501082_0085960_1624_2097 157
640 3300005406 Ga0070703_10043000 Ga0070703_100430001 158
641 3300005437 Ga0070710_10189643 Ga0070710_101896432 158
642 3300005439 Ga0070711_100188534 Ga0070711_1001885342 158
643 3300005458 Ga0070681_10000002 Ga0070681_10000002853 158
644 3300005530 Ga0070679_100036051 Ga0070679_1000360514 158
645 3300005546 Ga0070696_100028958 Ga0070696_1000289582 158
646 3300005617 Ga0068859_102270714 Ga0068859_1022707141 158
647 3300005841 Ga0068863_100534874 Ga0068863_1005348742 158
648 3300006028 Ga0070717_10764934 Ga0070717_107649342 158
649 3300006175 Ga0070712_100133084 Ga0070712_1001330841 158
650 3300006358 Ga0068871_101860809 Ga0068871_1018608091 158
651 3300006844 Ga0075428_100225931 Ga0075428_1002259312 158
652 3300006846 Ga0075430_100536976 Ga0075430_1005369761 158
653 3300006931 Ga0097620_102271705 Ga0097620_1022717051 158
654 3300009093 Ga0105240_12110191 Ga0105240_121101911 158
655 3300010159 Ga0099796_10050240 Ga0099796_100502402 158
656 3300011119 Ga0105246_10259839 Ga0105246_102598392 158
657 3300021384 Ga0213876_10000427 Ga0213876_1000042719 158
658 3300025906 Ga0207699_10606162 Ga0207699_106061621 158
659 3300025915 Ga0207693_10222715 Ga0207693_102227151 158
660 3300025916 Ga0207663_10783226 Ga0207663_107832261 158
661 3300025928 Ga0207700_10247481 Ga0207700_102474811 158
662 3300035083 Ga0373926_0071222 Ga0373926_0071222_480_974 158
663 3300035113 Ga0373936_0137658 Ga0373936_0137658_219_710 158
664 3300035117 Ga0373953_0169779 Ga0373953_0169779_218_709 158
665 3300035118 Ga0373954_0272756 Ga0373954_0272756_180_671 158
666 3300035119 Ga0373956_0305607 Ga0373956_0305607_34_525 158
667 3300035691 Ga0373931_0006560 Ga0373931_0006560_1150_1644 158
668 3300035695 Ga0373927_0331416 Ga0373927_0331416_28_522 158
669 3300035695 Ga0373927_0486167 Ga0373927_0486167_222_710 158
670 3300035725 Ga0373947_0481430 Ga0373947_0481430_128_622 158
671 3300036401 Ga0373937_0014387 Ga0373937_0014387_3086_3577 158
672 3300036401 Ga0373937_0148746 Ga0373937_0148746_720_1211 158
673 3300036401 Ga0373937_0156754 Ga0373937_0156754_902_1393 158
674 3300039437 Ga0436365_0583194 Ga0436365_0583194_12822_13301 158
675 3300039438 Ga0436360_1278480 Ga0436360_1278480_160_654 158
676 3300046491 Ga0495584_0243234 Ga0495584_0243234_273_761 158
677 3300046559 Ga0495667_0475086 Ga0495667_0475086_193_684 158
678 3300046679 Ga0495623_0507498 Ga0495623_0507498_131_622 158
679 3300047444 Ga0495675_0203625 Ga0495675_0203625_414_905 158
680 3300049570 Ga0501033_0444312 Ga0501033_0444312_44_529 158
681 3300049572 Ga0501036_0222010 Ga0501036_0222010_1028_1516 158
682 3300049574 Ga0501038_0098557 Ga0501038_0098557_55_540 158
683 3300049577 Ga0501041_0235804 Ga0501041_0235804_518_1006 158
684 3300049586 Ga0501070_0268843 Ga0501070_0268843_738_1226 158
685 3300049588 Ga0501072_0341187 Ga0501072_0341187_133_621 158
686 3300049589 Ga0501073_0146914 Ga0501073_0146914_886_1392 158
687 3300049590 Ga0501074_0747677 Ga0501074_0747677_103_591 158
688 3300049592 Ga0501076_0357227 Ga0501076_0357227_669_1157 158
689 3300049593 Ga0501077_0334108 Ga0501077_0334108_446_934 158
690 3300049742 Ga0501080_0602828 Ga0501080_0602828_417_905 158
691 3300049743 Ga0501081_0352968 Ga0501081_0352968_44_532 158
692 3300049822 Ga0501035_0016519 Ga0501035_0016519_3383_3868 158
693 3300049822 Ga0501035_0617762 Ga0501035_0617762_71_559 158
694 3300049823 Ga0501044_0119763 Ga0501044_0119763_1207_1692 158
695 3300049824 Ga0501045_0119215 Ga0501045_0119215_769_1257 158
696 3300050511 nmdc:mga08y16_625876_c1 nmdc:mga08y16_625876_c1_238_726 158
697 3300053084 Ga0495595_0083670 Ga0495595_0083670_597_1088 158
698 3300061734 Ga0530510_0346303 Ga0530510_0346303_158_646 158
699 3300009093 Ga0105240_10021543 Ga0105240_100215434 159
700 3300025913 Ga0207695_10047341 Ga0207695_100473411 159
701 3300028379 Ga0268266_10320036 Ga0268266_103200361 159
702 3300039437 Ga0436365_1406825 Ga0436365_1406825_75_572 159
703 3300049581 Ga0501047_0004588 Ga0501047_0004588_3059_3550 159
704 3300049822 Ga0501035_0060216 Ga0501035_0060216_454_945 159
705 3300049823 Ga0501044_0025449 Ga0501044_0025449_5517_6008 159
706 3300006237 Ga0097621_100173701 Ga0097621_1001737014 160
707 3300013307 Ga0157372_10191098 Ga0157372_101910984 160
708 3300049579 Ga0501043_0146470 Ga0501043_0146470_978_1478 160
709 3300049581 Ga0501047_0628720 Ga0501047_0628720_273_773 160
710 3300006237 Ga0097621_100221124 Ga0097621_1002211242 161
711 3300014969 Ga0157376_10108812 Ga0157376_101088124 161
712 3300049823 Ga0501044_1158298 Ga0501044_1158298_116_604 161
713 3300009093 Ga0105240_10230648 Ga0105240_102306483 162
714 3300013307 Ga0157372_10254495 Ga0157372_102544952 162
715 3300025913 Ga0207695_10230788 Ga0207695_102307882 162
716 3300025920 Ga0207649_10000367 Ga0207649_1000036719 162
717 3300031250 Ga0265331_10000067 Ga0265331_10000067170 162
718 3300031711 Ga0265314_10044308 Ga0265314_100443082 162
719 3300031711 Ga0265314_10117540 Ga0265314_101175402 162
720 3300039437 Ga0436365_0285583 Ga0436365_0285583_414_941 162
721 3300049569 Ga0501032_0408766 Ga0501032_0408766_82_600 162
722 3300049572 Ga0501036_1268155 Ga0501036_1268155_29_547 162
723 3300049573 Ga0501037_0147252 Ga0501037_0147252_274_786 162
724 3300049579 Ga0501043_0014986 Ga0501043_0014986_4730_5242 162
725 3300049581 Ga0501047_0398451 Ga0501047_0398451_677_1195 162
726 3300049586 Ga0501070_0388186 Ga0501070_0388186_14_532 162
727 3300049589 Ga0501073_0532040 Ga0501073_0532040_178_690 162
728 3300049742 Ga0501080_0027115 Ga0501080_0027115_142_660 162
729 3300049822 Ga0501035_0080787 Ga0501035_0080787_1368_1886 162
730 3300049823 Ga0501044_0267153 Ga0501044_0267153_153_671 162
731 iso_pu_bacteria 2821443989 2821448533 162
732 iso_pu_bacteria 2844533157 2844534234 162
733 3300049581 Ga0501047_0175170 Ga0501047_0175170_1208_1717 163
734 3300049586 Ga0501070_0105824 Ga0501070_0105824_217_741 164
735 3300001989 JGI24739J22299_10027885 JGI24739J22299_100278852 166
736 3300003187 JGI25151J46595_10000284 JGI25151J46595_1000028441 166
737 3300003215 JGI25153J46596_10034448 JGI25153J46596_100344481 166
738 3300003316 rootH1_10046059 rootH1_100460592 166
739 3300003354 JGI25160J50197_1007421 JGI25160J50197_10074214 166
740 3300005539 Ga0068853_100511707 Ga0068853_1005117072 166
741 3300005983 Ga0081540_1040679 Ga0081540_10406792 166
742 3300025284 Ga0209130_1000550 Ga0209130_10005506 166
743 3300025294 Ga0209025_1000831 Ga0209025_100083142 166
744 3300025297 Ga0209758_1001349 Ga0209758_10013492 166
745 3300025302 Ga0207426_1000182 Ga0207426_100018286 166
746 3300026041 Ga0207639_10045148 Ga0207639_100451484 166
747 3300042004 Ga0439445_0022504 Ga0439445_0022504_1007_1510 166
748 3300042185 Ga0450909_034472 Ga0450909_034472_227_730 166
749 3300046512 Ga0495610_0010194 Ga0495610_0010194_1305_1808 166
750 3300048924 Ga0496121_0144735 Ga0496121_0144735_980_1483 166
751 3300049823 Ga0501044_0681044 Ga0501044_0681044_142_645 166
752 3300053730 Ga0500645_149447 Ga0500645_149447_24_527 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

39

156

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8373 12 154
1mjh-assembly1.cif.gz_B structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8124 12 158
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8056 12 154
1mjh-assembly1.cif.gz_B structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8023 12 158
3s3t-assembly1.cif.gz_A universal stress protein uspa from lactobacillus plantarum 0.7956 14 153
ID Description Score Start End Superfamily
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8373 12 154 3.40.50.620
af_A0A1D6Q6M0_26_165_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8229 13 125 3.40.50.620
af_Q7XE49_1_175_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8127 16 154 3.40.50.620
af_Q2FXL6_6_143_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8062 16 153 3.40.50.620
af_A0A0P0VMX2_31_171_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8056 6 128 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1H6GZU4-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.973 11 166
AF-A0A1H6GZU4-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.9608 11 166
AF-A0A3B9DJE0-F1-model_v4 deleted 0.958 10 166
AF-A0A6N7JN68-F1-model_v4 Universal stress protein 0.9563 8 166
AF-A0A0P7WJN0-F1-model_v4 Universal stress protein family protein 0.9552 14 166

Feature Viewer

pLDDT pTM Quality
88.19 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map