F479061

General Info

Members Datasets Scaffolds Average Seq Length
750 398 1501 120

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0007603|Ga0495629_0007603_6286_6711
Length 141
Sequence MEAAMTRLTGSALRVTIFIGENDTWHHKPLYAEIVHRAHAAGLAGASVFRGIEGFGASSLIHTSRLLSLSEDLPVAVIVVDTEERVRAFLPQLDELVTEGLVILDDCEVIRHVGRDRTPEGSSDTSGATGGDLPGKGEKSS

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
234 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
235 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
236 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
237 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
238 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
363 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
364 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
365 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
366 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
367 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
368 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
372 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
373 2643221647 Streptomyces sp. Root369 Isolate Unclassified
374 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
375 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
376 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
377 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
378 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
379 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
380 2867428634 Streptomyces sp. RP5T Isolate Unclassified
381 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
382 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
383 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
384 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
385 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
386 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
387 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
388 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
389 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
390 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
391 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
392 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
393 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
394 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
395 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
396 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
397 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
398 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.07
Metatranscriptomes 1.2
Isolates 3.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 6.27
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0007603 3300046459 Bacteria 7984
2 JGI24741J21665_1011946 3300001915 Bacteria 1506
3 JGI24752J21851_1005287 3300001976 Bacteria 1687
4 JGI24743J22301_10055291 3300001991 Bacteria 813
5 JGI24033J26618_1005776 3300002155 Bacteria 1374
6 rootH1_10000928 3300003316 Bacteria 3830
7 rootH1_10000928 3300003323 Bacteria 6366
8 JGI25405J52794_10028959 3300003911 Bacteria 1145
9 Ga0070658_10162268 3300005327 Bacteria 1875
10 Ga0070676_10059684 3300005328 Bacteria 2263
11 Ga0070676_10376463 3300005328 Bacteria 982
12 Ga0070683_100008705 3300005329 Bacteria 8630
13 Ga0070683_100372872 3300005329 Bacteria 1360
14 Ga0070683_100961294 3300005329 Bacteria 820
15 Ga0070690_100217909 3300005330 Bacteria 1336
16 Ga0070690_100353270 3300005330 Bacteria 1067
17 Ga0070670_100066887 3300005331 Bacteria 3084
18 Ga0070670_100077432 3300005331 Bacteria 2857
19 Ga0070677_10505740 3300005333 Bacteria 655
20 Ga0068869_100035200 3300005334 Bacteria 3548
21 Ga0068869_100515780 3300005334 Bacteria 1000
22 Ga0068869_100567628 3300005334 Bacteria 955
23 Ga0068869_100767020 3300005334 Bacteria 827
24 Ga0070680_100017381 3300005336 Bacteria 5671
25 Ga0070680_100815014 3300005336 Bacteria 804
26 Ga0070680_101254613 3300005336 Bacteria 641
27 Ga0070682_100266018 3300005337 Bacteria 1243
28 Ga0070682_100876724 3300005337 Bacteria 735
29 Ga0068868_100155925 3300005338 Bacteria 1883
30 Ga0068868_100287860 3300005338 Bacteria 1392
31 Ga0070660_100130752 3300005339 Bacteria 2009
32 Ga0070660_101215435 3300005339 Bacteria 639
33 Ga0070689_100203122 3300005340 Bacteria 1619
34 Ga0070691_10001167 3300005341 Bacteria 10968
35 Ga0070687_100163297 3300005343 Bacteria 1319
36 Ga0070687_100464451 3300005343 Bacteria 845
37 Ga0070687_100731064 3300005343 Bacteria 694
38 Ga0070661_100015658 3300005344 Bacteria 5353
39 Ga0070692_10016219 3300005345 Bacteria 3541
40 Ga0070692_10043355 3300005345 Bacteria 2313
41 Ga0070668_100024991 3300005347 Bacteria 4528
42 Ga0070668_100178747 3300005347 Bacteria 1732
43 Ga0070669_100599268 3300005353 Bacteria 923
44 Ga0070669_100943868 3300005353 Bacteria 738
45 Ga0070675_100001370 3300005354 Bacteria 17869
46 Ga0070675_100072093 3300005354 Bacteria 2867
47 Ga0070671_100007914 3300005355 Bacteria 8500
48 Ga0070671_101787130 3300005355 Bacteria 546
49 Ga0070674_100743836 3300005356 Bacteria 842
50 Ga0070673_100171393 3300005364 Bacteria 1853
51 Ga0070688_100094754 3300005365 Bacteria 1958
52 Ga0070659_100016561 3300005366 Bacteria 5535
53 Ga0070659_100068750 3300005366 Bacteria 2810
54 Ga0070659_100895815 3300005366 Bacteria 775
55 Ga0070667_100227476 3300005367 Bacteria 1662
56 Ga0070667_100398675 3300005367 Bacteria 1252
57 Ga0070709_10035456 3300005434 Bacteria 3032
58 Ga0070709_10786237 3300005434 Bacteria 746
59 Ga0070714_100056693 3300005435 Bacteria 3352
60 Ga0070714_100260463 3300005435 Bacteria 1606
61 Ga0070714_100930971 3300005435 Bacteria 844
62 Ga0070714_101137669 3300005435 Bacteria 761
63 Ga0070713_100070578 3300005436 Bacteria 2949
64 Ga0070713_100849905 3300005436 Bacteria 876
65 Ga0070713_101381412 3300005436 Bacteria 683
66 Ga0070713_101456465 3300005436 Bacteria 664
67 Ga0070701_10388873 3300005438 Bacteria 881
68 Ga0070711_100635309 3300005439 Bacteria 894
69 Ga0070700_100030250 3300005441 Bacteria 3235
70 Ga0070700_100033885 3300005441 Bacteria 3079
71 Ga0070694_100881806 3300005444 Bacteria 738
72 Ga0070663_100036802 3300005455 Bacteria 3402
73 Ga0070663_100512087 3300005455 Bacteria 998
74 Ga0070678_100003761 3300005456 Bacteria 8506
75 Ga0070662_100049983 3300005457 Bacteria 3016
76 Ga0070662_101821379 3300005457 Bacteria 526
77 Ga0070681_10011819 3300005458 Bacteria 8654
78 Ga0070681_10633772 3300005458 Bacteria 984
79 Ga0068867_100131035 3300005459 Bacteria 1948
80 Ga0070706_100553502 3300005467 Bacteria 1070
81 Ga0070706_100937675 3300005467 Bacteria 799
82 Ga0070707_100358315 3300005468 Unclassified 1417
83 Ga0070699_102037875 3300005518 Bacteria 524
84 Ga0070679_100067175 3300005530 Bacteria 3575
85 Ga0070679_100125495 3300005530 Bacteria 2549
86 Ga0070679_101002754 3300005530 Bacteria 779
87 Ga0070679_101618064 3300005530 Bacteria 595
88 Ga0070684_100033626 3300005535 Bacteria 4379
89 Ga0070684_100307182 3300005535 Bacteria 1456
90 Ga0070684_100680147 3300005535 Bacteria 959
91 Ga0068853_100054880 3300005539 Bacteria 3434
92 Ga0070672_100460737 3300005543 Bacteria 1096
93 Ga0070672_100535876 3300005543 Bacteria 1015
94 Ga0070686_100811377 3300005544 Bacteria 755
95 Ga0070693_100007939 3300005547 Bacteria 5209
96 Ga0070693_100041674 3300005547 Bacteria 2584
97 Ga0070665_100014327 3300005548 Bacteria 7962
98 Ga0070665_100150538 3300005548 Bacteria 2330
99 Ga0068855_100005588 3300005563 Bacteria 15343
100 Ga0068855_100214259 3300005563 Bacteria 2163
101 Ga0070664_100000166 3300005564 Bacteria 45730
102 Ga0068857_100013922 3300005577 Bacteria 7000
103 Ga0068857_100059687 3300005577 Bacteria 3389
104 Ga0068857_101524624 3300005577 Bacteria 652
105 Ga0068854_100020551 3300005578 Bacteria 4470
106 Ga0068854_100027912 3300005578 Bacteria 3894
107 Ga0068856_100092816 3300005614 Bacteria 3004
108 Ga0068856_100144151 3300005614 Bacteria 2390
109 Ga0068856_100160935 3300005614 Bacteria 2255
110 Ga0068856_100471331 3300005614 Bacteria 1276
111 Ga0068856_102288305 3300005614 Bacteria 549
112 Ga0070702_100005789 3300005615 Bacteria 5794
113 Ga0070702_100687482 3300005615 Bacteria 778
114 Ga0070702_101509302 3300005615 Bacteria 553
115 Ga0068852_100010137 3300005616 Bacteria 7018
116 Ga0068852_100321739 3300005616 Bacteria 1502
117 Ga0068852_101048119 3300005616 Bacteria 835
118 Ga0068859_100019090 3300005617 Bacteria 6885
119 Ga0068864_100004490 3300005618 Bacteria 11476
120 Ga0068864_100227265 3300005618 Bacteria 1724
121 Ga0068864_101577732 3300005618 Bacteria 660
122 Ga0068861_101541519 3300005719 Bacteria 653
123 Ga0068851_10035189 3300005834 Bacteria 2503
124 Ga0068870_10007533 3300005840 Bacteria 4858
125 Ga0068870_10349348 3300005840 Bacteria 948
126 Ga0068863_100011554 3300005841 Bacteria 8542
127 Ga0068863_100026927 3300005841 Bacteria 5482
128 Ga0068863_100293299 3300005841 Bacteria 1577
129 Ga0068863_100816841 3300005841 Bacteria 930
130 Ga0068863_102393711 3300005841 Bacteria 538
131 Ga0068858_100031027 3300005842 Bacteria 4963
132 Ga0068858_100034392 3300005842 Bacteria 4700
133 Ga0068858_100790058 3300005842 Bacteria 926
134 Ga0068860_100145261 3300005843 Bacteria 2282
135 Ga0068860_100484952 3300005843 Bacteria 1232
136 Ga0068860_102110117 3300005843 Bacteria 585
137 Ga0068862_100279823 3300005844 Bacteria 1529
138 Ga0068862_100680836 3300005844 Bacteria 995
139 Ga0068862_100935713 3300005844 Bacteria 854
140 Ga0081455_10000279 3300005937 Bacteria 67790
141 Ga0081540_1073476 3300005983 Bacteria 1571
142 Ga0081539_10039765 3300005985 Bacteria 2770
143 Ga0070717_10008207 3300006028 Bacteria 7800
144 Ga0075365_10112654 3300006038 Bacteria 1871
145 Ga0075363_100012421 3300006048 Bacteria 4104
146 Ga0075363_100257663 3300006048 Bacteria 1005
147 Ga0075432_10044080 3300006058 Bacteria 1564
148 Ga0075432_10273135 3300006058 Bacteria 693
149 Ga0070715_10346344 3300006163 Bacteria 810
150 Ga0070712_100115601 3300006175 Bacteria 2011
151 Ga0097621_100238929 3300006237 Bacteria 1588
152 Ga0075370_10281845 3300006353 Bacteria 987
153 Ga0068871_100070497 3300006358 Bacteria 2873
154 Ga0068871_101824916 3300006358 Bacteria 577
155 Ga0075428_100015211 3300006844 Bacteria 8537
156 Ga0075430_100017285 3300006846 Bacteria 6142
157 Ga0075430_100600727 3300006846 Bacteria 908
158 Ga0075430_100830082 3300006846 Bacteria 762
159 Ga0075431_100019435 3300006847 Bacteria 6927
160 Ga0075431_100122391 3300006847 Bacteria 2684
161 Ga0075433_10042781 3300006852 Bacteria 3932
162 Ga0075434_100156419 3300006871 Bacteria 2298
163 Ga0075434_100712754 3300006871 Bacteria 1021
164 Ga0075434_101537720 3300006871 Bacteria 674
165 Ga0075429_100003939 3300006880 Bacteria 12696
166 Ga0075429_100081009 3300006880 Bacteria 2830
167 Ga0068865_100797643 3300006881 Bacteria 814
168 Ga0075436_100004081 3300006914 Bacteria 10016
169 Ga0097620_100019090 3300006931 Bacteria 6885
170 Ga0075435_100114998 3300007076 Bacteria 2240
171 Ga0075435_100232765 3300007076 Bacteria 1565
172 Ga0075435_100801286 3300007076 Bacteria 820
173 Ga0105251_10088297 3300009011 Bacteria 1426
174 Ga0105251_10223157 3300009011 Bacteria 848
175 Ga0105250_10084453 3300009092 Bacteria 1288
176 Ga0105240_10010074 3300009093 Bacteria 13307
177 Ga0105240_10535291 3300009093 Bacteria 1298
178 Ga0111539_10000110 3300009094 Bacteria 89582
179 Ga0111539_10012853 3300009094 Bacteria 10476
180 Ga0111539_10384488 3300009094 Bacteria 1634
181 Ga0105245_10009142 3300009098 Bacteria 8641
182 Ga0105245_10043372 3300009098 Bacteria 4012
183 Ga0105245_10194052 3300009098 Bacteria 1947
184 Ga0105247_10081838 3300009101 Bacteria 2036
185 Ga0105247_10086218 3300009101 Bacteria 1987
186 Ga0105247_10554668 3300009101 Bacteria 845
187 Ga0105247_10780876 3300009101 Bacteria 727
188 Ga0114129_10012650 3300009147 Bacteria 12016
189 Ga0114129_10156674 3300009147 Bacteria 3114
190 Ga0114129_10428700 3300009147 Bacteria 1738
191 Ga0105243_10154050 3300009148 Bacteria 1974
192 Ga0105243_12508760 3300009148 Bacteria 555
193 Ga0105241_10000880 3300009174 Bacteria 22699
194 Ga0105241_10002617 3300009174 Bacteria 13480
195 Ga0105242_10602255 3300009176 Bacteria 1062
196 Ga0105248_10019067 3300009177 Bacteria 7585
197 Ga0105248_10117703 3300009177 Bacteria 2997
198 Ga0105248_12425783 3300009177 Bacteria 597
199 Ga0105248_12637609 3300009177 Bacteria 573
200 Ga0105248_12830940 3300009177 Bacteria 553
201 Ga0105237_10010837 3300009545 Bacteria 9673
202 Ga0105237_10632450 3300009545 Bacteria 1077
203 Ga0105237_10903332 3300009545 Bacteria 890
204 Ga0105238_10004025 3300009551 Bacteria 14582
205 Ga0105238_10644116 3300009551 Bacteria 1069
206 Ga0105238_10703329 3300009551 Bacteria 1023
207 Ga0105238_11202856 3300009551 Unclassified 782
208 Ga0105238_11645416 3300009551 Bacteria 672
209 Ga0105249_10272826 3300009553 Bacteria 1686
210 Ga0105249_11814065 3300009553 Bacteria 683
211 Ga0105239_10019804 3300010375 Bacteria 7426
212 Ga0105239_10228485 3300010375 Bacteria 2088
213 Ga0105239_10237532 3300010375 Bacteria 2046
214 Ga0105239_10527160 3300010375 Bacteria 1344
215 Ga0105239_12274133 3300010375 Bacteria 631
216 Ga0105246_10025697 3300011119 Bacteria 3840
217 Ga0105246_10336287 3300011119 Bacteria 1232
218 Ga0157371_10034438 3300013102 Bacteria 3632
219 Ga0157370_10344177 3300013104 Bacteria 1374
220 Ga0157369_10111963 3300013105 Bacteria 2900
221 Ga0157369_10555689 3300013105 Bacteria 1186
222 Ga0157369_11321174 3300013105 Bacteria 735
223 Ga0157374_10884455 3300013296 Bacteria 911
224 Ga0157378_10046411 3300013297 Bacteria 3862
225 Ga0157378_11267360 3300013297 Bacteria 778
226 Ga0163162_10805540 3300013306 Bacteria 1056
227 Ga0157372_10088573 3300013307 Bacteria 3515
228 Ga0157372_10458592 3300013307 Bacteria 1485
229 Ga0157375_10066641 3300013308 Bacteria 3596
230 Ga0157375_12037352 3300013308 Bacteria 682
231 Ga0157375_12627018 3300013308 Bacteria 602
232 Ga0163163_10003097 3300014325 Bacteria 14094
233 Ga0163163_10343754 3300014325 Bacteria 1548
234 Ga0163163_10657256 3300014325 Bacteria 1112
235 Ga0163163_11024649 3300014325 Bacteria 889
236 Ga0182008_10098199 3300014497 Bacteria 1446
237 Ga0157377_10045880 3300014745 Bacteria 2442
238 Ga0157377_10109741 3300014745 Bacteria 1657
239 Ga0157377_11080874 3300014745 Bacteria 613
240 Ga0157379_10036205 3300014968 Bacteria 4401
241 Ga0157379_10191698 3300014968 Bacteria 1847
242 Ga0157379_10700149 3300014968 Bacteria 951
243 Ga0157376_10370253 3300014969 Bacteria 1377
244 Ga0157376_10573211 3300014969 Bacteria 1120
245 Ga0157376_11935782 3300014969 Bacteria 627
246 Ga0182005_1124569 3300015265 Bacteria 736
247 Ga0183367_1003 3300015688 Bacteria 814276
248 Ga0163161_10960619 3300017792 Bacteria 727
249 Ga0197907_10554933 3300020069 Bacteria 1146
250 Ga0197907_11146920 3300020069 Bacteria 856
251 Ga0197907_11433219 3300020069 Bacteria 1469
252 Ga0206356_10762720 3300020070 Bacteria 1110
253 Ga0206356_11111953 3300020070 Bacteria 1086
254 Ga0206354_10249310 3300020081 Bacteria 908
255 Ga0206353_10436635 3300020082 Bacteria 813
256 Ga0206353_11664185 3300020082 Bacteria 1186
257 Ga0213876_10538242 3300021384 Bacteria 622
258 Ga0213875_10001134 3300021388 Bacteria 18308
259 Ga0224712_10052768 3300022467 Bacteria 1589
260 Ga0207713_1090264 3300025735 Bacteria 1078
261 Ga0207710_10182670 3300025900 Bacteria 1030
262 Ga0207710_10467741 3300025900 Bacteria 652
263 Ga0207688_10053801 3300025901 Bacteria 2258
264 Ga0207680_10278979 3300025903 Bacteria 1161
265 Ga0207647_10008758 3300025904 Bacteria 7224
266 Ga0207647_10064821 3300025904 Bacteria 2219
267 Ga0207647_10083955 3300025904 Bacteria 1907
268 Ga0207699_10070876 3300025906 Bacteria 2129
269 Ga0207699_10333223 3300025906 Bacteria 1067
270 Ga0207645_10342603 3300025907 Bacteria 999
271 Ga0207643_10000435 3300025908 Bacteria 27424
272 Ga0207705_10049661 3300025909 Bacteria 3019
273 Ga0207654_10007213 3300025911 Bacteria 5599
274 Ga0207654_10026900 3300025911 Bacteria 3121
275 Ga0207707_10017186 3300025912 Bacteria 6305
276 Ga0207707_10859471 3300025912 Bacteria 752
277 Ga0207695_10000994 3300025913 Bacteria 50163
278 Ga0207695_10523175 3300025913 Bacteria 1068
279 Ga0207671_10000432 3300025914 Bacteria 57666
280 Ga0207671_10079657 3300025914 Bacteria 2455
281 Ga0207671_10667316 3300025914 Bacteria 827
282 Ga0207693_10061453 3300025915 Bacteria 2942
283 Ga0207663_10027843 3300025916 Bacteria 3300
284 Ga0207660_10019638 3300025917 Bacteria 4520
285 Ga0207660_10553355 3300025917 Bacteria 936
286 Ga0207662_10277515 3300025918 Bacteria 1108
287 Ga0207657_10038939 3300025919 Bacteria 4227
288 Ga0207657_10653073 3300025919 Bacteria 819
289 Ga0207649_10003821 3300025920 Bacteria 8213
290 Ga0207652_10003826 3300025921 Bacteria 12343
291 Ga0207652_10095694 3300025921 Bacteria 2616
292 Ga0207652_11715787 3300025921 Bacteria 533
293 Ga0207646_10216881 3300025922 Unclassified 1728
294 Ga0207681_11353857 3300025923 Bacteria 598
295 Ga0207694_10001118 3300025924 Bacteria 23223
296 Ga0207694_10887378 3300025924 Bacteria 754
297 Ga0207694_11394060 3300025924 Bacteria 592
298 Ga0207650_10103191 3300025925 Bacteria 2198
299 Ga0207659_10059557 3300025926 Bacteria 2745
300 Ga0207700_10054042 3300025928 Bacteria 3013
301 Ga0207700_10602138 3300025928 Bacteria 978
302 Ga0207664_10346527 3300025929 Bacteria 1314
303 Ga0207664_10350905 3300025929 Bacteria 1306
304 Ga0207664_10588201 3300025929 Bacteria 999
305 Ga0207664_11661634 3300025929 Bacteria 561
306 Ga0207644_10008211 3300025931 Bacteria 6838
307 Ga0207690_10038585 3300025932 Bacteria 3110
308 Ga0207690_11034775 3300025932 Bacteria 683
309 Ga0207706_10072323 3300025933 Bacteria 3033
310 Ga0207686_10947205 3300025934 Bacteria 697
311 Ga0207709_10395907 3300025935 Bacteria 1055
312 Ga0207670_10034533 3300025936 Bacteria 3269
313 Ga0207669_11061232 3300025937 Bacteria 683
314 Ga0207704_10618756 3300025938 Bacteria 889
315 Ga0207691_10429488 3300025940 Bacteria 1125
316 Ga0207711_10055943 3300025941 Bacteria 3388
317 Ga0207711_10241481 3300025941 Bacteria 1656
318 Ga0207711_11814265 3300025941 Bacteria 553
319 Ga0207689_10000806 3300025942 Bacteria 30219
320 Ga0207661_10018572 3300025944 Bacteria 5167
321 Ga0207661_10148426 3300025944 Bacteria 2025
322 Ga0207661_10411945 3300025944 Bacteria 1227
323 Ga0207661_10731715 3300025944 Bacteria 910
324 Ga0207661_11027660 3300025944 Bacteria 759
325 Ga0207679_10004442 3300025945 Bacteria 8736
326 Ga0207667_10018884 3300025949 Bacteria 7713
327 Ga0207667_10507957 3300025949 Bacteria 1222
328 Ga0207667_10528760 3300025949 Bacteria 1194
329 Ga0207667_11176534 3300025949 Bacteria 747
330 Ga0207651_10184711 3300025960 Bacteria 1657
331 Ga0207668_10513605 3300025972 Bacteria 1032
332 Ga0207668_11291220 3300025972 Bacteria 657
333 Ga0207640_10014763 3300025981 Bacteria 4504
334 Ga0207640_10024634 3300025981 Bacteria 3633
335 Ga0207658_10212226 3300025986 Bacteria 1623
336 Ga0207658_10894653 3300025986 Bacteria 808
337 Ga0207677_10007948 3300026023 Bacteria 5899
338 Ga0207703_10132584 3300026035 Bacteria 2153
339 Ga0207703_10144272 3300026035 Bacteria 2069
340 Ga0207703_10254873 3300026035 Bacteria 1583
341 Ga0207639_10159404 3300026041 Bacteria 1900
342 Ga0207639_10876948 3300026041 Bacteria 838
343 Ga0207639_11110574 3300026041 Bacteria 742
344 Ga0207678_10017848 3300026067 Bacteria 6232
345 Ga0207678_10129560 3300026067 Bacteria 2152
346 Ga0207708_10008078 3300026075 Bacteria 7798
347 Ga0207702_10013855 3300026078 Bacteria 6696
348 Ga0207702_10106841 3300026078 Bacteria 2481
349 Ga0207702_10268868 3300026078 Bacteria 1607
350 Ga0207702_12088217 3300026078 Bacteria 556
351 Ga0207702_12395948 3300026078 Bacteria 515
352 Ga0207641_10089562 3300026088 Bacteria 2689
353 Ga0207641_10094399 3300026088 Bacteria 2623
354 Ga0207641_10136850 3300026088 Bacteria 2206
355 Ga0207648_10200372 3300026089 Bacteria 1770
356 Ga0207676_10013363 3300026095 Bacteria 5897
357 Ga0207676_10026440 3300026095 Bacteria 4317
358 Ga0207676_11175180 3300026095 Bacteria 760
359 Ga0207674_10059678 3300026116 Bacteria 3859
360 Ga0207674_10305644 3300026116 Bacteria 1540
361 Ga0207675_100561761 3300026118 Bacteria 1141
362 Ga0207675_101991604 3300026118 Bacteria 598
363 Ga0207683_10000454 3300026121 Bacteria 38017
364 Ga0207683_10277066 3300026121 Bacteria 1533
365 Ga0207698_10016175 3300026142 Bacteria 5020
366 Ga0207698_10035772 3300026142 Bacteria 3637
367 Ga0207428_10002392 3300027907 Bacteria 18747
368 Ga0207428_10046432 3300027907 Bacteria 3493
369 Ga0268266_10013378 3300028379 Bacteria 7069
370 Ga0268266_10072279 3300028379 Bacteria 2991
371 Ga0268266_10671609 3300028379 Bacteria 998
372 Ga0268265_10646496 3300028380 Bacteria 1016
373 Ga0268265_10803388 3300028380 Bacteria 917
374 Ga0268264_10039747 3300028381 Bacteria 3886
375 Ga0268264_10119197 3300028381 Bacteria 2323
376 Ga0307517_10004520 3300028786 Bacteria 21344
377 Ga0307517_10279845 3300028786 Bacteria 952
378 Ga0307515_10000995 3300028794 Bacteria 64758
379 Ga0307511_10052961 3300030521 Bacteria 3224
380 Ga0307509_10027136 3300031507 Bacteria 6375
381 Ga0307509_10090528 3300031507 Bacteria 3135
382 Ga0307509_10765556 3300031507 Bacteria 631
383 Ga0307408_100018911 3300031548 Bacteria 4632
384 Ga0307408_100143991 3300031548 Bacteria 1874
385 Ga0307508_10084575 3300031616 Bacteria 2755
386 Ga0307514_10386280 3300031649 Bacteria 723
387 Ga0316576_10002172 3300031727 Bacteria 11067
388 Ga0316576_10391294 3300031727 Unclassified 1031
389 Ga0307516_10004980 3300031730 Bacteria 16136
390 Ga0307516_10189532 3300031730 Bacteria 1783
391 Ga0307516_10198930 3300031730 Bacteria 1725
392 Ga0307405_10055346 3300031731 Bacteria 2482
393 Ga0307405_10147922 3300031731 Bacteria 1648
394 Ga0307413_10239696 3300031824 Bacteria 1338
395 Ga0307413_10272014 3300031824 Bacteria 1269
396 Ga0307518_10207851 3300031838 Bacteria 1292
397 Ga0307410_10185619 3300031852 Bacteria 1578
398 Ga0307410_10217904 3300031852 Bacteria 1467
399 Ga0307410_10914174 3300031852 Bacteria 752
400 Ga0307406_10018039 3300031901 Bacteria 4117
401 Ga0307406_10649955 3300031901 Bacteria 875
402 Ga0307407_10003499 3300031903 Bacteria 6460
403 Ga0307407_10045964 3300031903 Bacteria 2470
404 Ga0307412_10029826 3300031911 Bacteria 3427
405 Ga0307412_11145963 3300031911 Bacteria 694
406 Ga0307409_100001301 3300031995 Bacteria 12106
407 Ga0307409_100396033 3300031995 Bacteria 1317
408 Ga0307409_100509729 3300031995 Bacteria 1173
409 Ga0307409_101534981 3300031995 Bacteria 694
410 Ga0307416_100023485 3300032002 Bacteria 4476
411 Ga0307416_101600174 3300032002 Bacteria 757
412 Ga0307414_10473554 3300032004 Bacteria 1103
413 Ga0307411_11667727 3300032005 Bacteria 589
414 Ga0307415_100007905 3300032126 Bacteria 5853
415 Ga0307415_100018976 3300032126 Bacteria 4166
416 Ga0307415_100782567 3300032126 Bacteria 869
417 Ga0307507_10136818 3300033179 Bacteria 1894
418 Ga0307510_10024191 3300033180 Bacteria 7021
419 Ga0307510_10036193 3300033180 Bacteria 5497
420 Ga0307510_10233750 3300033180 Bacteria 1339
421 Ga0373936_0219246 3300035113 Bacteria 843
422 Ga0373961_0330484 3300035241 Bacteria 571
423 Ga0316574_0705219 3300035398 Bacteria 619
424 Ga0373931_0181720 3300035691 Bacteria 1246
425 Ga0373935_0008773 3300035692 Bacteria 6057
426 Ga0316582_0296414 3300036647 Bacteria 1111
427 Ga0395899_0015592 3300037312 Bacteria 5794
428 Ga0395900_0254669 3300037418 Bacteria 1755
429 Ga0395900_0662504 3300037418 Bacteria 980
430 Ga0395898_0006959 3300037466 Bacteria 12021
431 Ga0395898_1056282 3300037466 Bacteria 747
432 Ga0436364_0686139 3300037853 Bacteria 16704
433 Ga0395901_1151002 3300038443 Bacteria 744
434 Ga0436365_0574066 3300039437 Bacteria 5716
435 Ga0451853_0488960 3300041512 Bacteria 3240
436 Ga0451853_0616727 3300041512 Bacteria 992
437 Ga0451853_3159732 3300041512 Bacteria 509
438 Ga0439448_0033366 3300042005 Bacteria 1642
439 Ga0439448_0165701 3300042005 Bacteria 770
440 Ga0439449_0091560 3300042007 Bacteria 1123
441 Ga0439449_0133025 3300042007 Bacteria 925
442 Ga0439450_031783 3300042008 Bacteria 1190
443 Ga0439455_0013375 3300042012 Bacteria 1857
444 Ga0439463_103545 3300042016 Bacteria 734
445 Ga0450890_057813 3300042127 Bacteria 602
446 Ga0450902_031970 3300042137 Bacteria 887
447 Ga0450903_000643 3300042138 Bacteria 7048
448 Ga0439458_0000283 3300042157 Bacteria 12594
449 Ga0439458_0051541 3300042157 Bacteria 1016
450 Ga0439458_0069489 3300042157 Bacteria 888
451 Ga0466972_0021175 3300044658 Bacteria 3244
452 Ga0466972_0036479 3300044658 Bacteria 2405
453 Ga0466965_0004611 3300044683 Bacteria 6136
454 Ga0466965_0008522 3300044683 Bacteria 4742
455 Ga0466965_0402951 3300044683 Bacteria 756
456 Ga0466966_0012287 3300044684 Bacteria 5674
457 Ga0466966_0033465 3300044684 Bacteria 3328
458 Ga0466966_0046339 3300044684 Bacteria 2776
459 Ga0466966_0052060 3300044684 Bacteria 2602
460 Ga0466966_0111423 3300044684 Bacteria 1687
461 Ga0466961_0002562 3300044693 Bacteria 11264
462 Ga0466961_0005046 3300044693 Bacteria 8302
463 Ga0466961_0380613 3300044693 Bacteria 857
464 Ga0466961_0395874 3300044693 Bacteria 838
465 Ga0466961_0481960 3300044693 Bacteria 750
466 Ga0466963_0000555 3300044694 Bacteria 17588
467 Ga0466963_0078297 3300044694 Bacteria 2234
468 Ga0466963_0709096 3300044694 Bacteria 710
469 Ga0466971_0005854 3300044719 Bacteria 5352
470 Ga0466971_0007549 3300044719 Bacteria 4740
471 Ga0466971_0046736 3300044719 Bacteria 1945
472 Ga0466971_0241679 3300044719 Bacteria 859
473 Ga0466968_0002955 3300044735 Bacteria 6280
474 Ga0466968_0527306 3300044735 Bacteria 591
475 Ga0466970_0000125 3300044765 Bacteria 34778
476 Ga0466970_0002361 3300044765 Bacteria 9125
477 Ga0466970_0142227 3300044765 Bacteria 1322
478 Ga0466957_0000483 3300044842 Bacteria 19817
479 Ga0466957_0024315 3300044842 Bacteria 3584
480 Ga0466957_0812040 3300044842 Bacteria 665
481 Ga0466957_1235630 3300044842 Bacteria 541
482 Ga0466959_0002703 3300045049 Bacteria 11394
483 Ga0466959_0010704 3300045049 Bacteria 6568
484 Ga0466959_0072414 3300045049 Bacteria 2494
485 Ga0466959_0245289 3300045049 Bacteria 1236
486 Ga0466959_0539751 3300045049 Bacteria 787
487 Ga0466959_0573672 3300045049 Bacteria 760
488 Ga0466958_0007333 3300045836 Bacteria 6058
489 Ga0466958_0021607 3300045836 Bacteria 3763
490 Ga0466958_0449876 3300045836 Unclassified 834
491 Ga0466967_0000622 3300045976 Bacteria 17706
492 Ga0466967_0002131 3300045976 Bacteria 12131
493 Ga0466967_0008073 3300045976 Bacteria 7677
494 Ga0466967_0353044 3300045976 Bacteria 1424
495 Ga0466967_2122787 3300045976 Bacteria 558
496 Ga0495617_162563 3300046452 Bacteria 707
497 Ga0495603_0001309 3300046455 Bacteria 14490
498 Ga0495603_0010457 3300046455 Bacteria 5621
499 Ga0495603_0031301 3300046455 Bacteria 3202
500 Ga0495603_0038491 3300046455 Bacteria 2867
501 Ga0495590_0044178 3300046457 Bacteria 1554
502 Ga0495629_0004899 3300046459 Bacteria 10049
503 Ga0495629_0052191 3300046459 Bacteria 2861
504 Ga0495629_0061693 3300046459 Bacteria 2620
505 Ga0495629_0517185 3300046459 Bacteria 804
506 Ga0495638_0238014 3300046460 Bacteria 1009
507 Ga0495641_0306726 3300046461 Bacteria 716
508 Ga0495653_0478003 3300046463 Bacteria 780
509 Ga0495580_0129080 3300046472 Bacteria 1754
510 Ga0495580_0904673 3300046472 Bacteria 567
511 Ga0495582_0078537 3300046473 Bacteria 1831
512 Ga0495582_0232935 3300046473 Bacteria 1055
513 Ga0495582_0254813 3300046473 Bacteria 1007
514 Ga0495605_0041947 3300046474 Bacteria 2277
515 Ga0495605_0221049 3300046474 Bacteria 818
516 Ga0495662_0022994 3300046476 Bacteria 3009
517 Ga0495662_0028046 3300046476 Bacteria 2718
518 Ga0495585_0048714 3300046492 Bacteria 2355
519 Ga0495585_0054093 3300046492 Bacteria 2220
520 Ga0495594_0000804 3300046499 Bacteria 16227
521 Ga0495594_0022335 3300046499 Bacteria 3384
522 Ga0495594_0033766 3300046499 Bacteria 2783
523 Ga0495594_0219032 3300046499 Bacteria 1085
524 Ga0495594_0325722 3300046499 Bacteria 875
525 Ga0495596_0316016 3300046500 Bacteria 607
526 Ga0495607_0044142 3300046501 Bacteria 2630
527 Ga0495607_0107516 3300046501 Bacteria 1483
528 Ga0495583_0111140 3300046506 Bacteria 1161
529 Ga0495583_0202440 3300046506 Bacteria 806
530 Ga0495606_0009993 3300046507 Bacteria 7937
531 Ga0495616_0298137 3300046513 Bacteria 681
532 Ga0495620_0075927 3300046515 Bacteria 1366
533 Ga0495620_0249491 3300046515 Bacteria 677
534 Ga0495630_0253272 3300046517 Bacteria 1345
535 Ga0495630_0863476 3300046517 Bacteria 690
536 Ga0495630_1116156 3300046517 Bacteria 598
537 Ga0495631_0083044 3300046518 Bacteria 1381
538 Ga0495631_0380910 3300046518 Bacteria 600
539 Ga0495643_0303389 3300046522 Bacteria 727
540 Ga0495644_0120279 3300046523 Bacteria 999
541 Ga0495648_0027270 3300046524 Bacteria 3827
542 Ga0495640_0329979 3300046533 Bacteria 944
543 Ga0495597_0133888 3300046542 Bacteria 1026
544 Ga0495622_0179196 3300046557 Bacteria 951
545 Ga0495622_0279231 3300046557 Bacteria 730
546 Ga0495633_0276619 3300046558 Bacteria 764
547 Ga0495667_0095485 3300046559 Bacteria 1925
548 Ga0495667_0528056 3300046559 Bacteria 738
549 Ga0495656_0360892 3300046615 Bacteria 754
550 Ga0495668_0292548 3300046616 Bacteria 892
551 Ga0495611_0001285 3300046648 Bacteria 12841
552 Ga0495611_0203129 3300046648 Bacteria 924
553 Ga0495625_0002090 3300046660 Bacteria 22320
554 Ga0495625_0148976 3300046660 Bacteria 1574
555 Ga0495625_0264505 3300046660 Bacteria 1112
556 Ga0495625_0280402 3300046660 Bacteria 1072
557 Ga0495635_0036377 3300046663 Bacteria 3413
558 Ga0495661_0013927 3300046665 Bacteria 5393
559 Ga0495661_0238490 3300046665 Bacteria 934
560 Ga0495588_0040348 3300046674 Bacteria 2380
561 Ga0495657_0033911 3300046675 Bacteria 3550
562 Ga0495657_0575161 3300046675 Bacteria 653
563 Ga0495613_0007917 3300046689 Bacteria 7905
564 Ga0495613_0086134 3300046689 Bacteria 2278
565 Ga0495613_0398815 3300046689 Bacteria 938
566 Ga0495624_0170817 3300046690 Bacteria 1326
567 Ga0495670_0066397 3300046691 Bacteria 1820
568 Ga0495671_0043143 3300046692 Bacteria 2264
569 Ga0495649_0293018 3300046694 Bacteria 830
570 Ga0495649_0397092 3300046694 Bacteria 692
571 Ga0495589_0009637 3300046794 Bacteria 5021
572 Ga0495589_0103089 3300046794 Bacteria 1379
573 Ga0495589_0113144 3300046794 Bacteria 1309
574 Ga0495589_0143079 3300046794 Bacteria 1144
575 Ga0495600_0424912 3300046809 Bacteria 824
576 Ga0495600_0659237 3300046809 Bacteria 632
577 Ga0495660_0185404 3300046810 Bacteria 1003
578 Ga0495581_0178637 3300047315 Bacteria 1241
579 Ga0495581_0251608 3300047315 Bacteria 1033
580 Ga0495581_0638872 3300047315 Bacteria 615
581 Ga0495581_0868757 3300047315 Unclassified 516
582 Ga0495636_0104675 3300047318 Bacteria 1240
583 Ga0495674_1060278 3300047319 Bacteria 619
584 Ga0495672_0187508 3300047320 Bacteria 1043
585 Ga0495672_0390117 3300047320 Bacteria 639
586 Ga0495676_0297283 3300047321 Bacteria 1089
587 Ga0495676_0471731 3300047321 Bacteria 826
588 Ga0495680_0712868 3300047322 Bacteria 662
589 Ga0495683_0024420 3300047323 Bacteria 3101
590 Ga0495687_044073 3300047443 Bacteria 1941
591 Ga0495675_0060735 3300047444 Bacteria 2395
592 Ga0495677_0180284 3300047445 Bacteria 818
593 Ga0495685_004834 3300047447 Bacteria 4373
594 Ga0495685_006386 3300047447 Bacteria 3856
595 Ga0495685_029095 3300047447 Bacteria 1900
596 Ga0495685_052393 3300047447 Bacteria 1382
597 Ga0495685_153156 3300047447 Bacteria 748
598 Ga0495681_0000769 3300047470 Bacteria 24687
599 Ga0495681_0141476 3300047470 Bacteria 1016
600 Ga0495684_0913689 3300047471 Bacteria 564
601 Ga0495593_0468408 3300047673 Bacteria 631
602 Ga0495614_0003970 3300048089 Bacteria 6640
603 Ga0495626_0042425 3300048091 Bacteria 2137
604 Ga0496100_0067404 3300048903 Bacteria 2377
605 Ga0496100_0354341 3300048903 Bacteria 1109
606 Ga0496101_0139581 3300048904 Bacteria 1846
607 Ga0496102_0017163 3300048905 Bacteria 6338
608 Ga0496102_0029147 3300048905 Bacteria 4936
609 Ga0496102_0129067 3300048905 Bacteria 2365
610 Ga0496102_0284066 3300048905 Unclassified 1560
611 Ga0496102_0974292 3300048905 Bacteria 769
612 Ga0496103_0040629 3300048906 Bacteria 2858
613 Ga0496104_0001358 3300048907 Bacteria 21173
614 Ga0496104_0012419 3300048907 Bacteria 7657
615 Ga0496104_0028221 3300048907 Bacteria 5201
616 Ga0496104_0883510 3300048907 Bacteria 799
617 Ga0496105_0001459 3300048908 Bacteria 16658
618 Ga0496105_0070908 3300048908 Bacteria 2880
619 Ga0496106_0108866 3300048909 Bacteria 2155
620 Ga0496107_0304765 3300048910 Bacteria 1186
621 Ga0496108_0001129 3300048911 Bacteria 20890
622 Ga0496108_0016141 3300048911 Bacteria 6088
623 Ga0496108_0017340 3300048911 Bacteria 5889
624 Ga0496108_0302033 3300048911 Bacteria 1394
625 Ga0496109_0001069 3300048912 Bacteria 22712
626 Ga0496109_0024444 3300048912 Bacteria 5371
627 Ga0496109_0039884 3300048912 Bacteria 4251
628 Ga0496109_0274524 3300048912 Bacteria 1588
629 Ga0496109_0616667 3300048912 Bacteria 1021
630 Ga0496109_0729143 3300048912 Unclassified 929
631 Ga0496109_0796154 3300048912 Unclassified 883
632 Ga0496109_1375531 3300048912 Bacteria 641
633 Ga0496110_0000330 3300048913 Bacteria 31599
634 Ga0496110_0040819 3300048913 Bacteria 4045
635 Ga0496110_0085855 3300048913 Bacteria 2809
636 Ga0496110_0603950 3300048913 Bacteria 995
637 Ga0496110_0770151 3300048913 Bacteria 866
638 Ga0496111_0000343 3300048914 Bacteria 23065
639 Ga0496111_0010404 3300048914 Bacteria 6242
640 Ga0496111_0013179 3300048914 Bacteria 5621
641 Ga0496112_0238051 3300048915 Bacteria 1773
642 Ga0496112_0448726 3300048915 Bacteria 1227
643 Ga0496113_0014467 3300048916 Bacteria 5385
644 Ga0496113_0018510 3300048916 Bacteria 4853
645 Ga0496114_0035699 3300048917 Bacteria 4106
646 Ga0496114_0042246 3300048917 Bacteria 3779
647 Ga0496114_0557570 3300048917 Bacteria 1012
648 Ga0496115_0032294 3300048918 Bacteria 4130
649 Ga0496115_0331677 3300048918 Bacteria 1243
650 Ga0496115_0424322 3300048918 Bacteria 1077
651 Ga0496124_0665023 3300048927 Bacteria 666
652 Ga0496124_0686982 3300048927 Bacteria 651
653 Ga0496125_0268827 3300048928 Bacteria 1064
654 Ga0496126_0314481 3300048929 Bacteria 1289
655 Ga0496126_0390223 3300048929 Bacteria 1131
656 Ga0495682_0368376 3300049460 Bacteria 506
657 Ga0501034_0002786 3300049571 Bacteria 20477
658 Ga0501034_0017642 3300049571 Bacteria 7319
659 Ga0501034_1539311 3300049571 Bacteria 538
660 Ga0501036_0014024 3300049572 Bacteria 6660
661 Ga0501037_0077748 3300049573 Bacteria 2408
662 Ga0501038_0001860 3300049574 Bacteria 19504
663 Ga0501038_0006557 3300049574 Bacteria 10764
664 Ga0501038_0363995 3300049574 Bacteria 1124
665 Ga0501039_1434416 3300049575 Bacteria 531
666 Ga0501042_0006050 3300049578 Bacteria 7836
667 Ga0501043_0001862 3300049579 Bacteria 18068
668 Ga0501043_0084213 3300049579 Bacteria 2499
669 Ga0501047_0008254 3300049581 Bacteria 9830
670 Ga0501047_0101855 3300049581 Bacteria 2751
671 Ga0501048_0000285 3300049582 Bacteria 34306
672 Ga0501048_0090478 3300049582 Bacteria 2159
673 Ga0501068_0766668 3300049584 Bacteria 632
674 Ga0501070_0308573 3300049586 Bacteria 1288
675 Ga0501073_0169165 3300049589 Bacteria 1513
676 Ga0501073_0213776 3300049589 Bacteria 1332
677 Ga0501074_0005579 3300049590 Bacteria 9051
678 Ga0501074_0404843 3300049590 Bacteria 968
679 Ga0501076_0377739 3300049592 Bacteria 1165
680 Ga0501080_0077012 3300049742 Bacteria 3101
681 Ga0501080_0187660 3300049742 Bacteria 1901
682 Ga0501083_0504528 3300049744 Bacteria 787
683 Ga0501035_0128333 3300049822 Bacteria 2212
684 Ga0501044_0009166 3300049823 Bacteria 10809
685 Ga0501044_0023453 3300049823 Bacteria 6563
686 Ga0501044_0094122 3300049823 Bacteria 3021
687 nmdc:mga03n38_4590_c1 3300050490 Bacteria 4598
688 nmdc:mga0yw44_623034_c1 3300050492 Bacteria 733
689 nmdc:mga05p37_109765_c1 3300050507 Bacteria 3394
690 nmdc:mga05p37_1143246_c1 3300050507 Bacteria 811
691 nmdc:mga05p37_1207929_c1 3300050507 Bacteria 780
692 nmdc:mga09592_610361_c1 3300050508 Bacteria 934
693 nmdc:mga09592_763_c1 3300050508 Bacteria 24805
694 nmdc:mga0qj67_15422_c1 3300050509 Bacteria 5786
695 nmdc:mga06r32_1142_c1 3300050510 Bacteria 23840
696 nmdc:mga06r32_1188134_c1 3300050510 Bacteria 709
697 nmdc:mga06r32_228696_c1 3300050510 Bacteria 1848
698 nmdc:mga08y16_5733_c1 3300050511 Bacteria 13016
699 nmdc:mga08y16_959_c1 3300050511 Bacteria 28003
700 nmdc:mga0n895_493863_c1 3300050512 Bacteria 1234
701 nmdc:mga0n895_652552_c1 3300050512 Bacteria 1051
702 nmdc:mga0n895_936661_c1 3300050512 Bacteria 850
703 nmdc:mga0rr50_1556405_c1 3300050513 Bacteria 558
704 nmdc:mga0rr50_39330_c1 3300050513 Bacteria 3430
705 nmdc:mga08x19_17668_c1 3300050514 Bacteria 4368
706 nmdc:mga0a205_195131_c1 3300050515 Bacteria 1916
707 nmdc:mga0a205_66522_c1 3300050515 Bacteria 3482
708 Ga0495601_0053094 3300053077 Bacteria 2561
709 Ga0495612_0065462 3300053078 Bacteria 1510
710 Ga0495612_0185284 3300053078 Bacteria 915
711 Ga0500610_0077777 3300053079 Bacteria 1729
712 Ga0495655_0044769 3300053083 Unclassified 1146
713 Ga0500583_0025021 3300053092 Bacteria 2543
714 Ga0500650_0468784 3300053098 Bacteria 538
715 Ga0500579_237270 3300053143 Bacteria 610
716 Ga0500600_0166654 3300053149 Bacteria 1076
717 Ga0500600_0265516 3300053149 Bacteria 758
718 Ga0500630_051665 3300053159 Bacteria 1985
719 Ga0501084_0698600 3300054114 Bacteria 855
720 Ga0501084_1577494 3300054114 Bacteria 549
721 Ga0466962_0000081 3300061719 Bacteria 38408
722 Ga0466962_0008583 3300061719 Bacteria 4896
723 Ga0466962_0021999 3300061719 Bacteria 3063
724 2585305867 2582581313 Bacteria 10042643
725 2585315251 2582581314 Bacteria 11452267
726 2644270241 2643221647 Bacteria 10741251
727 2785366366 2784746768 Bacteria 10036182
728 2786667355 2786546132 Bacteria 10419719
729 2808847006 2808606359 Bacteria 9866990
730 2827630523 2827628540 Bacteria 6858585
731 2856747688 2856741275 Bacteria 8096094
732 2862282508 2862281513 Bacteria 9621493
733 2867437548 2867428634 Bacteria 9590268
734 2877684150 2877676314 Bacteria 9512378
735 2884699626 2884693830 Bacteria 11273186
736 2891557716 2891554331 Bacteria 8812224
737 2895443171 2895442618 Bacteria 11027144
738 2919470112 2919468124 Bacteria 9133025
739 2954008329 2954002825 Bacteria 9173742
740 2954389458 2954380949 Bacteria 10050426
741 2954673509 2954673503 Bacteria 9685905
742 2954690481 2954682443 Bacteria 9862841
743 2954700236 2954691527 Bacteria 10720516
744 2954701993 2954701450 Bacteria 10834262
745 2954719005 2954711539 Bacteria 10867210
746 2954728976 2954721474 Bacteria 10456478
747 2954732835 2954731030 Bacteria 10243860
748 2954747875 2954740390 Bacteria 10229294
749 2954751713 2954749733 Bacteria 10366972
750 2954767001 2954759201 Bacteria 9358192
751 3006498385 3006493962 Bacteria 8825450
752 Ga0495629_0007603
753 JGI24741J21665_1011946
754 JGI24752J21851_1005287
755 JGI24743J22301_10055291
756 JGI24033J26618_1005776
757 rootH1_10000928
758 JGI25405J52794_10028959
759 Ga0070658_10162268
760 Ga0070676_10059684
761 Ga0070676_10376463
762 Ga0070683_100008705
763 Ga0070683_100372872
764 Ga0070683_100961294
765 Ga0070690_100217909
766 Ga0070690_100353270
767 Ga0070670_100066887
768 Ga0070670_100077432
769 Ga0070677_10505740
770 Ga0068869_100035200
771 Ga0068869_100515780
772 Ga0068869_100567628
773 Ga0068869_100767020
774 Ga0070680_100017381
775 Ga0070680_100815014
776 Ga0070680_101254613
777 Ga0070682_100266018
778 Ga0070682_100876724
779 Ga0068868_100155925
780 Ga0068868_100287860
781 Ga0070660_100130752
782 Ga0070660_101215435
783 Ga0070689_100203122
784 Ga0070691_10001167
785 Ga0070687_100163297
786 Ga0070687_100464451
787 Ga0070687_100731064
788 Ga0070661_100015658
789 Ga0070692_10016219
790 Ga0070692_10043355
791 Ga0070668_100024991
792 Ga0070668_100178747
793 Ga0070669_100599268
794 Ga0070669_100943868
795 Ga0070675_100001370
796 Ga0070675_100072093
797 Ga0070671_100007914
798 Ga0070671_101787130
799 Ga0070674_100743836
800 Ga0070673_100171393
801 Ga0070688_100094754
802 Ga0070659_100016561
803 Ga0070659_100068750
804 Ga0070659_100895815
805 Ga0070667_100227476
806 Ga0070667_100398675
807 Ga0070709_10035456
808 Ga0070709_10786237
809 Ga0070714_100056693
810 Ga0070714_100260463
811 Ga0070714_100930971
812 Ga0070714_101137669
813 Ga0070713_100070578
814 Ga0070713_100849905
815 Ga0070713_101381412
816 Ga0070713_101456465
817 Ga0070701_10388873
818 Ga0070711_100635309
819 Ga0070700_100030250
820 Ga0070700_100033885
821 Ga0070694_100881806
822 Ga0070663_100036802
823 Ga0070663_100512087
824 Ga0070678_100003761
825 Ga0070662_100049983
826 Ga0070662_101821379
827 Ga0070681_10011819
828 Ga0070681_10633772
829 Ga0068867_100131035
830 Ga0070706_100553502
831 Ga0070706_100937675
832 Ga0070707_100358315
833 Ga0070699_102037875
834 Ga0070679_100067175
835 Ga0070679_100125495
836 Ga0070679_101002754
837 Ga0070679_101618064
838 Ga0070684_100033626
839 Ga0070684_100307182
840 Ga0070684_100680147
841 Ga0068853_100054880
842 Ga0070672_100460737
843 Ga0070672_100535876
844 Ga0070686_100811377
845 Ga0070693_100007939
846 Ga0070693_100041674
847 Ga0070665_100014327
848 Ga0070665_100150538
849 Ga0068855_100005588
850 Ga0068855_100214259
851 Ga0070664_100000166
852 Ga0068857_100013922
853 Ga0068857_100059687
854 Ga0068857_101524624
855 Ga0068854_100020551
856 Ga0068854_100027912
857 Ga0068856_100092816
858 Ga0068856_100144151
859 Ga0068856_100160935
860 Ga0068856_100471331
861 Ga0068856_102288305
862 Ga0070702_100005789
863 Ga0070702_100687482
864 Ga0070702_101509302
865 Ga0068852_100010137
866 Ga0068852_100321739
867 Ga0068852_101048119
868 Ga0068859_100019090
869 Ga0068864_100004490
870 Ga0068864_100227265
871 Ga0068864_101577732
872 Ga0068861_101541519
873 Ga0068851_10035189
874 Ga0068870_10007533
875 Ga0068870_10349348
876 Ga0068863_100011554
877 Ga0068863_100026927
878 Ga0068863_100293299
879 Ga0068863_100816841
880 Ga0068863_102393711
881 Ga0068858_100031027
882 Ga0068858_100034392
883 Ga0068858_100790058
884 Ga0068860_100145261
885 Ga0068860_100484952
886 Ga0068860_102110117
887 Ga0068862_100279823
888 Ga0068862_100680836
889 Ga0068862_100935713
890 Ga0081455_10000279
891 Ga0081540_1073476
892 Ga0081539_10039765
893 Ga0070717_10008207
894 Ga0075365_10112654
895 Ga0075363_100012421
896 Ga0075363_100257663
897 Ga0075432_10044080
898 Ga0075432_10273135
899 Ga0070715_10346344
900 Ga0070712_100115601
901 Ga0097621_100238929
902 Ga0075370_10281845
903 Ga0068871_100070497
904 Ga0068871_101824916
905 Ga0075428_100015211
906 Ga0075430_100017285
907 Ga0075430_100600727
908 Ga0075430_100830082
909 Ga0075431_100019435
910 Ga0075431_100122391
911 Ga0075433_10042781
912 Ga0075434_100156419
913 Ga0075434_100712754
914 Ga0075434_101537720
915 Ga0075429_100003939
916 Ga0075429_100081009
917 Ga0068865_100797643
918 Ga0075436_100004081
919 Ga0097620_100019090
920 Ga0075435_100114998
921 Ga0075435_100232765
922 Ga0075435_100801286
923 Ga0105251_10088297
924 Ga0105251_10223157
925 Ga0105250_10084453
926 Ga0105240_10010074
927 Ga0105240_10535291
928 Ga0111539_10000110
929 Ga0111539_10012853
930 Ga0111539_10384488
931 Ga0105245_10009142
932 Ga0105245_10043372
933 Ga0105245_10194052
934 Ga0105247_10081838
935 Ga0105247_10086218
936 Ga0105247_10554668
937 Ga0105247_10780876
938 Ga0114129_10012650
939 Ga0114129_10156674
940 Ga0114129_10428700
941 Ga0105243_10154050
942 Ga0105243_12508760
943 Ga0105241_10000880
944 Ga0105241_10002617
945 Ga0105242_10602255
946 Ga0105248_10019067
947 Ga0105248_10117703
948 Ga0105248_12425783
949 Ga0105248_12637609
950 Ga0105248_12830940
951 Ga0105237_10010837
952 Ga0105237_10632450
953 Ga0105237_10903332
954 Ga0105238_10004025
955 Ga0105238_10644116
956 Ga0105238_10703329
957 Ga0105238_11202856
958 Ga0105238_11645416
959 Ga0105249_10272826
960 Ga0105249_11814065
961 Ga0105239_10019804
962 Ga0105239_10228485
963 Ga0105239_10237532
964 Ga0105239_10527160
965 Ga0105239_12274133
966 Ga0105246_10025697
967 Ga0105246_10336287
968 Ga0157371_10034438
969 Ga0157370_10344177
970 Ga0157369_10111963
971 Ga0157369_10555689
972 Ga0157369_11321174
973 Ga0157374_10884455
974 Ga0157378_10046411
975 Ga0157378_11267360
976 Ga0163162_10805540
977 Ga0157372_10088573
978 Ga0157372_10458592
979 Ga0157375_10066641
980 Ga0157375_12037352
981 Ga0157375_12627018
982 Ga0163163_10003097
983 Ga0163163_10343754
984 Ga0163163_10657256
985 Ga0163163_11024649
986 Ga0182008_10098199
987 Ga0157377_10045880
988 Ga0157377_10109741
989 Ga0157377_11080874
990 Ga0157379_10036205
991 Ga0157379_10191698
992 Ga0157379_10700149
993 Ga0157376_10370253
994 Ga0157376_10573211
995 Ga0157376_11935782
996 Ga0182005_1124569
997 Ga0183367_1003
998 Ga0163161_10960619
999 Ga0197907_10554933
1000 Ga0197907_11146920
1001 Ga0197907_11433219
1002 Ga0206356_10762720
1003 Ga0206356_11111953
1004 Ga0206354_10249310
1005 Ga0206353_10436635
1006 Ga0206353_11664185
1007 Ga0213876_10538242
1008 Ga0213875_10001134
1009 Ga0224712_10052768
1010 Ga0207713_1090264
1011 Ga0207710_10182670
1012 Ga0207710_10467741
1013 Ga0207688_10053801
1014 Ga0207680_10278979
1015 Ga0207647_10008758
1016 Ga0207647_10064821
1017 Ga0207647_10083955
1018 Ga0207699_10070876
1019 Ga0207699_10333223
1020 Ga0207645_10342603
1021 Ga0207643_10000435
1022 Ga0207705_10049661
1023 Ga0207654_10007213
1024 Ga0207654_10026900
1025 Ga0207707_10017186
1026 Ga0207707_10859471
1027 Ga0207695_10000994
1028 Ga0207695_10523175
1029 Ga0207671_10000432
1030 Ga0207671_10079657
1031 Ga0207671_10667316
1032 Ga0207693_10061453
1033 Ga0207663_10027843
1034 Ga0207660_10019638
1035 Ga0207660_10553355
1036 Ga0207662_10277515
1037 Ga0207657_10038939
1038 Ga0207657_10653073
1039 Ga0207649_10003821
1040 Ga0207652_10003826
1041 Ga0207652_10095694
1042 Ga0207652_11715787
1043 Ga0207646_10216881
1044 Ga0207681_11353857
1045 Ga0207694_10001118
1046 Ga0207694_10887378
1047 Ga0207694_11394060
1048 Ga0207650_10103191
1049 Ga0207659_10059557
1050 Ga0207700_10054042
1051 Ga0207700_10602138
1052 Ga0207664_10346527
1053 Ga0207664_10350905
1054 Ga0207664_10588201
1055 Ga0207664_11661634
1056 Ga0207644_10008211
1057 Ga0207690_10038585
1058 Ga0207690_11034775
1059 Ga0207706_10072323
1060 Ga0207686_10947205
1061 Ga0207709_10395907
1062 Ga0207670_10034533
1063 Ga0207669_11061232
1064 Ga0207704_10618756
1065 Ga0207691_10429488
1066 Ga0207711_10055943
1067 Ga0207711_10241481
1068 Ga0207711_11814265
1069 Ga0207689_10000806
1070 Ga0207661_10018572
1071 Ga0207661_10148426
1072 Ga0207661_10411945
1073 Ga0207661_10731715
1074 Ga0207661_11027660
1075 Ga0207679_10004442
1076 Ga0207667_10018884
1077 Ga0207667_10507957
1078 Ga0207667_10528760
1079 Ga0207667_11176534
1080 Ga0207651_10184711
1081 Ga0207668_10513605
1082 Ga0207668_11291220
1083 Ga0207640_10014763
1084 Ga0207640_10024634
1085 Ga0207658_10212226
1086 Ga0207658_10894653
1087 Ga0207677_10007948
1088 Ga0207703_10132584
1089 Ga0207703_10144272
1090 Ga0207703_10254873
1091 Ga0207639_10159404
1092 Ga0207639_10876948
1093 Ga0207639_11110574
1094 Ga0207678_10017848
1095 Ga0207678_10129560
1096 Ga0207708_10008078
1097 Ga0207702_10013855
1098 Ga0207702_10106841
1099 Ga0207702_10268868
1100 Ga0207702_12088217
1101 Ga0207702_12395948
1102 Ga0207641_10089562
1103 Ga0207641_10094399
1104 Ga0207641_10136850
1105 Ga0207648_10200372
1106 Ga0207676_10013363
1107 Ga0207676_10026440
1108 Ga0207676_11175180
1109 Ga0207674_10059678
1110 Ga0207674_10305644
1111 Ga0207675_100561761
1112 Ga0207675_101991604
1113 Ga0207683_10000454
1114 Ga0207683_10277066
1115 Ga0207698_10016175
1116 Ga0207698_10035772
1117 Ga0207428_10002392
1118 Ga0207428_10046432
1119 Ga0268266_10013378
1120 Ga0268266_10072279
1121 Ga0268266_10671609
1122 Ga0268265_10646496
1123 Ga0268265_10803388
1124 Ga0268264_10039747
1125 Ga0268264_10119197
1126 Ga0307517_10004520
1127 Ga0307517_10279845
1128 Ga0307515_10000995
1129 Ga0307511_10052961
1130 Ga0307509_10027136
1131 Ga0307509_10090528
1132 Ga0307509_10765556
1133 Ga0307408_100018911
1134 Ga0307408_100143991
1135 Ga0307508_10084575
1136 Ga0307514_10386280
1137 Ga0316576_10002172
1138 Ga0316576_10391294
1139 Ga0307516_10004980
1140 Ga0307516_10189532
1141 Ga0307516_10198930
1142 Ga0307405_10055346
1143 Ga0307405_10147922
1144 Ga0307413_10239696
1145 Ga0307413_10272014
1146 Ga0307518_10207851
1147 Ga0307410_10185619
1148 Ga0307410_10217904
1149 Ga0307410_10914174
1150 Ga0307406_10018039
1151 Ga0307406_10649955
1152 Ga0307407_10003499
1153 Ga0307407_10045964
1154 Ga0307412_10029826
1155 Ga0307412_11145963
1156 Ga0307409_100001301
1157 Ga0307409_100396033
1158 Ga0307409_100509729
1159 Ga0307409_101534981
1160 Ga0307416_100023485
1161 Ga0307416_101600174
1162 Ga0307414_10473554
1163 Ga0307411_11667727
1164 Ga0307415_100007905
1165 Ga0307415_100018976
1166 Ga0307415_100782567
1167 Ga0307507_10136818
1168 Ga0307510_10024191
1169 Ga0307510_10036193
1170 Ga0307510_10233750
1171 Ga0373936_0219246
1172 Ga0373961_0330484
1173 Ga0316574_0705219
1174 Ga0373931_0181720
1175 Ga0373935_0008773
1176 Ga0316582_0296414
1177 Ga0395899_0015592
1178 Ga0395900_0254669
1179 Ga0395900_0662504
1180 Ga0395898_0006959
1181 Ga0395898_1056282
1182 Ga0436364_0686139
1183 Ga0395901_1151002
1184 Ga0436365_0574066
1185 Ga0451853_0488960
1186 Ga0451853_0616727
1187 Ga0451853_3159732
1188 Ga0439448_0033366
1189 Ga0439448_0165701
1190 Ga0439449_0091560
1191 Ga0439449_0133025
1192 Ga0439450_031783
1193 Ga0439455_0013375
1194 Ga0439463_103545
1195 Ga0450890_057813
1196 Ga0450902_031970
1197 Ga0450903_000643
1198 Ga0439458_0000283
1199 Ga0439458_0051541
1200 Ga0439458_0069489
1201 Ga0466972_0021175
1202 Ga0466972_0036479
1203 Ga0466965_0004611
1204 Ga0466965_0008522
1205 Ga0466965_0402951
1206 Ga0466966_0012287
1207 Ga0466966_0033465
1208 Ga0466966_0046339
1209 Ga0466966_0052060
1210 Ga0466966_0111423
1211 Ga0466961_0002562
1212 Ga0466961_0005046
1213 Ga0466961_0380613
1214 Ga0466961_0395874
1215 Ga0466961_0481960
1216 Ga0466963_0000555
1217 Ga0466963_0078297
1218 Ga0466963_0709096
1219 Ga0466971_0005854
1220 Ga0466971_0007549
1221 Ga0466971_0046736
1222 Ga0466971_0241679
1223 Ga0466968_0002955
1224 Ga0466968_0527306
1225 Ga0466970_0000125
1226 Ga0466970_0002361
1227 Ga0466970_0142227
1228 Ga0466957_0000483
1229 Ga0466957_0024315
1230 Ga0466957_0812040
1231 Ga0466957_1235630
1232 Ga0466959_0002703
1233 Ga0466959_0010704
1234 Ga0466959_0072414
1235 Ga0466959_0245289
1236 Ga0466959_0539751
1237 Ga0466959_0573672
1238 Ga0466958_0007333
1239 Ga0466958_0021607
1240 Ga0466958_0449876
1241 Ga0466967_0000622
1242 Ga0466967_0002131
1243 Ga0466967_0008073
1244 Ga0466967_0353044
1245 Ga0466967_2122787
1246 Ga0495617_162563
1247 Ga0495603_0001309
1248 Ga0495603_0010457
1249 Ga0495603_0031301
1250 Ga0495603_0038491
1251 Ga0495590_0044178
1252 Ga0495629_0004899
1253 Ga0495629_0052191
1254 Ga0495629_0061693
1255 Ga0495629_0517185
1256 Ga0495638_0238014
1257 Ga0495641_0306726
1258 Ga0495653_0478003
1259 Ga0495580_0129080
1260 Ga0495580_0904673
1261 Ga0495582_0078537
1262 Ga0495582_0232935
1263 Ga0495582_0254813
1264 Ga0495605_0041947
1265 Ga0495605_0221049
1266 Ga0495662_0022994
1267 Ga0495662_0028046
1268 Ga0495585_0048714
1269 Ga0495585_0054093
1270 Ga0495594_0000804
1271 Ga0495594_0022335
1272 Ga0495594_0033766
1273 Ga0495594_0219032
1274 Ga0495594_0325722
1275 Ga0495596_0316016
1276 Ga0495607_0044142
1277 Ga0495607_0107516
1278 Ga0495583_0111140
1279 Ga0495583_0202440
1280 Ga0495606_0009993
1281 Ga0495616_0298137
1282 Ga0495620_0075927
1283 Ga0495620_0249491
1284 Ga0495630_0253272
1285 Ga0495630_0863476
1286 Ga0495630_1116156
1287 Ga0495631_0083044
1288 Ga0495631_0380910
1289 Ga0495643_0303389
1290 Ga0495644_0120279
1291 Ga0495648_0027270
1292 Ga0495640_0329979
1293 Ga0495597_0133888
1294 Ga0495622_0179196
1295 Ga0495622_0279231
1296 Ga0495633_0276619
1297 Ga0495667_0095485
1298 Ga0495667_0528056
1299 Ga0495656_0360892
1300 Ga0495668_0292548
1301 Ga0495611_0001285
1302 Ga0495611_0203129
1303 Ga0495625_0002090
1304 Ga0495625_0148976
1305 Ga0495625_0264505
1306 Ga0495625_0280402
1307 Ga0495635_0036377
1308 Ga0495661_0013927
1309 Ga0495661_0238490
1310 Ga0495588_0040348
1311 Ga0495657_0033911
1312 Ga0495657_0575161
1313 Ga0495613_0007917
1314 Ga0495613_0086134
1315 Ga0495613_0398815
1316 Ga0495624_0170817
1317 Ga0495670_0066397
1318 Ga0495671_0043143
1319 Ga0495649_0293018
1320 Ga0495649_0397092
1321 Ga0495589_0009637
1322 Ga0495589_0103089
1323 Ga0495589_0113144
1324 Ga0495589_0143079
1325 Ga0495600_0424912
1326 Ga0495600_0659237
1327 Ga0495660_0185404
1328 Ga0495581_0178637
1329 Ga0495581_0251608
1330 Ga0495581_0638872
1331 Ga0495581_0868757
1332 Ga0495636_0104675
1333 Ga0495674_1060278
1334 Ga0495672_0187508
1335 Ga0495672_0390117
1336 Ga0495676_0297283
1337 Ga0495676_0471731
1338 Ga0495680_0712868
1339 Ga0495683_0024420
1340 Ga0495687_044073
1341 Ga0495675_0060735
1342 Ga0495677_0180284
1343 Ga0495685_004834
1344 Ga0495685_006386
1345 Ga0495685_029095
1346 Ga0495685_052393
1347 Ga0495685_153156
1348 Ga0495681_0000769
1349 Ga0495681_0141476
1350 Ga0495684_0913689
1351 Ga0495593_0468408
1352 Ga0495614_0003970
1353 Ga0495626_0042425
1354 Ga0496100_0067404
1355 Ga0496100_0354341
1356 Ga0496101_0139581
1357 Ga0496102_0017163
1358 Ga0496102_0029147
1359 Ga0496102_0129067
1360 Ga0496102_0284066
1361 Ga0496102_0974292
1362 Ga0496103_0040629
1363 Ga0496104_0001358
1364 Ga0496104_0012419
1365 Ga0496104_0028221
1366 Ga0496104_0883510
1367 Ga0496105_0001459
1368 Ga0496105_0070908
1369 Ga0496106_0108866
1370 Ga0496107_0304765
1371 Ga0496108_0001129
1372 Ga0496108_0016141
1373 Ga0496108_0017340
1374 Ga0496108_0302033
1375 Ga0496109_0001069
1376 Ga0496109_0024444
1377 Ga0496109_0039884
1378 Ga0496109_0274524
1379 Ga0496109_0616667
1380 Ga0496109_0729143
1381 Ga0496109_0796154
1382 Ga0496109_1375531
1383 Ga0496110_0000330
1384 Ga0496110_0040819
1385 Ga0496110_0085855
1386 Ga0496110_0603950
1387 Ga0496110_0770151
1388 Ga0496111_0000343
1389 Ga0496111_0010404
1390 Ga0496111_0013179
1391 Ga0496112_0238051
1392 Ga0496112_0448726
1393 Ga0496113_0014467
1394 Ga0496113_0018510
1395 Ga0496114_0035699
1396 Ga0496114_0042246
1397 Ga0496114_0557570
1398 Ga0496115_0032294
1399 Ga0496115_0331677
1400 Ga0496115_0424322
1401 Ga0496124_0665023
1402 Ga0496124_0686982
1403 Ga0496125_0268827
1404 Ga0496126_0314481
1405 Ga0496126_0390223
1406 Ga0495682_0368376
1407 Ga0501034_0002786
1408 Ga0501034_0017642
1409 Ga0501034_1539311
1410 Ga0501036_0014024
1411 Ga0501037_0077748
1412 Ga0501038_0001860
1413 Ga0501038_0006557
1414 Ga0501038_0363995
1415 Ga0501039_1434416
1416 Ga0501042_0006050
1417 Ga0501043_0001862
1418 Ga0501043_0084213
1419 Ga0501047_0008254
1420 Ga0501047_0101855
1421 Ga0501048_0000285
1422 Ga0501048_0090478
1423 Ga0501068_0766668
1424 Ga0501070_0308573
1425 Ga0501073_0169165
1426 Ga0501073_0213776
1427 Ga0501074_0005579
1428 Ga0501074_0404843
1429 Ga0501076_0377739
1430 Ga0501080_0077012
1431 Ga0501080_0187660
1432 Ga0501083_0504528
1433 Ga0501035_0128333
1434 Ga0501044_0009166
1435 Ga0501044_0023453
1436 Ga0501044_0094122
1437 nmdc:mga03n38_4590_c1
1438 nmdc:mga0yw44_623034_c1
1439 nmdc:mga05p37_109765_c1
1440 nmdc:mga05p37_1143246_c1
1441 nmdc:mga05p37_1207929_c1
1442 nmdc:mga09592_610361_c1
1443 nmdc:mga09592_763_c1
1444 nmdc:mga0qj67_15422_c1
1445 nmdc:mga06r32_1142_c1
1446 nmdc:mga06r32_1188134_c1
1447 nmdc:mga06r32_228696_c1
1448 nmdc:mga08y16_5733_c1
1449 nmdc:mga08y16_959_c1
1450 nmdc:mga0n895_493863_c1
1451 nmdc:mga0n895_652552_c1
1452 nmdc:mga0n895_936661_c1
1453 nmdc:mga0rr50_1556405_c1
1454 nmdc:mga0rr50_39330_c1
1455 nmdc:mga08x19_17668_c1
1456 nmdc:mga0a205_195131_c1
1457 nmdc:mga0a205_66522_c1
1458 Ga0495601_0053094
1459 Ga0495612_0065462
1460 Ga0495612_0185284
1461 Ga0500610_0077777
1462 Ga0495655_0044769
1463 Ga0500583_0025021
1464 Ga0500650_0468784
1465 Ga0500579_237270
1466 Ga0500600_0166654
1467 Ga0500600_0265516
1468 Ga0500630_051665
1469 Ga0501084_0698600
1470 Ga0501084_1577494
1471 Ga0466962_0000081
1472 Ga0466962_0008583
1473 Ga0466962_0021999
1474 2585305867
1475 2585315251
1476 2644270241
1477 2785366366
1478 2786667355
1479 2808847006
1480 2827630523
1481 2856747688
1482 2862282508
1483 2867437548
1484 2877684150
1485 2884699626
1486 2891557716
1487 2895443171
1488 2919470112
1489 2954008329
1490 2954389458
1491 2954673509
1492 2954690481
1493 2954700236
1494 2954701993
1495 2954719005
1496 2954728976
1497 2954732835
1498 2954747875
1499 2954751713
1500 2954767001
1501 3006498385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

13

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8789 5 106
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.8696 5 106
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8456 7 113
2dcl-assembly1.cif.gz_A-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.7817 7 113
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.7791 5 107
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8737 7 106 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8545 7 106 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7791 5 107 3.30.70.120
af_P34523_55_169_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7393 25 49 3.30.460.10
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7355 5 107 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A7Y3J1S5-F1-model_v4 DUF190 domain-containing protein 0.8409 1 108
AF-A0A2N6EHV2-F1-model_v4 Uncharacterized protein 0.8357 1 108
AF-A0A2H0LUP4-F1-model_v4 Uncharacterized protein 0.8307 6 108
AF-A0A2H0M287-F1-model_v4 Uncharacterized protein 0.829 6 108
AF-A0A534PRD1-F1-model_v4 DUF190 domain-containing protein 0.8288 1 108

Map