F479007

General Info

Members Datasets Scaffolds Average Seq Length
749 221 1498 160

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10693259|Ga0163162_106932592
Length 190
Sequence LHGGAKLLNGRPEEGALQQDRRADGSWRVIRIPFFSCLTVLAIAACSAGDPVDDKVARTTVGLPDVNVAAPSTTGEPRGRTEPAKPLPAPSSAIPIALQGRWGLNPADCMPDRGDAKGLLTIGPAELRFYESRAVPTGDITPHEDSISGSFAFTGEGQSWTKYQALKVDKGRLIRTETKPAASFSYAKCG

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
215 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
216 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
217 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
220 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.34
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 14.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10693259 3300013306 Unclassified 1140
2 JGI24741J21665_1016368 3300001915 Bacteria 1211
3 JGI24752J21851_1004291 3300001976 Bacteria 1870
4 JGI24746J21847_1006910 3300001977 Bacteria 1744
5 JGI24739J22299_10019828 3300001989 Bacteria 2404
6 JGI24739J22299_10048375 3300001989 Unclassified 1384
7 JGI24737J22298_10001461 3300001990 Bacteria 8425
8 JGI24737J22298_10011456 3300001990 Bacteria 2906
9 JGI24743J22301_10004597 3300001991 Bacteria 2259
10 JGI24750J21931_1019072 3300002070 Bacteria 948
11 JGI24745J21846_1000689 3300002073 Bacteria 3059
12 JGI24738J21930_10107234 3300002075 Unclassified 600
13 JGI24744J21845_10000072 3300002077 Bacteria 12527
14 JGI24034J26672_10037531 3300002239 Bacteria 806
15 rootH2_10049478 3300003320 Bacteria 1312
16 rootH2_10050358 3300003320 Bacteria 1178
17 rootH1_10310624 3300003323 Bacteria 1839
18 Ga0065712_10143430 3300005290 Bacteria 1429
19 Ga0065715_10364347 3300005293 Bacteria 930
20 Ga0070658_10135322 3300005327 Bacteria 2055
21 Ga0070658_11342684 3300005327 Unclassified 621
22 Ga0070676_10008712 3300005328 Bacteria 5474
23 Ga0070676_10185868 3300005328 Bacteria 1354
24 Ga0070683_100018814 3300005329 Bacteria 6126
25 Ga0070683_100636020 3300005329 Bacteria 1021
26 Ga0070683_101529185 3300005329 Unclassified 641
27 Ga0070690_100007843 3300005330 Bacteria 6123
28 Ga0070670_100000918 3300005331 Bacteria 23133
29 Ga0070670_100001151 3300005331 Bacteria 20976
30 Ga0070670_100007733 3300005331 Bacteria 9141
31 Ga0070670_100071113 3300005331 Bacteria 2987
32 Ga0070670_100096175 3300005331 Bacteria 2548
33 Ga0070670_100588152 3300005331 Unclassified 995
34 Ga0070677_10023755 3300005333 Bacteria 2273
35 Ga0068869_100995106 3300005334 Bacteria 730
36 Ga0070666_10000415 3300005335 Bacteria 26514
37 Ga0070666_10001975 3300005335 Bacteria 12494
38 Ga0070666_10053025 3300005335 Bacteria 2735
39 Ga0070666_10092795 3300005335 Bacteria 2076
40 Ga0070666_10539520 3300005335 Bacteria 848
41 Ga0070666_10944997 3300005335 Unclassified 638
42 Ga0070680_100178684 3300005336 Bacteria 1787
43 Ga0070680_100234117 3300005336 Bacteria 1551
44 Ga0070680_100240300 3300005336 Bacteria 1531
45 Ga0070680_100258512 3300005336 Bacteria 1473
46 Ga0070682_100013858 3300005337 Bacteria 4649
47 Ga0070682_100315597 3300005337 Unclassified 1152
48 Ga0070682_100565879 3300005337 Bacteria 892
49 Ga0070682_101248358 3300005337 Unclassified 629
50 Ga0068868_100010517 3300005338 Bacteria 6706
51 Ga0068868_100026321 3300005338 Bacteria 4432
52 Ga0068868_100283100 3300005338 Unclassified 1404
53 Ga0068868_100607505 3300005338 Bacteria 970
54 Ga0070660_100015222 3300005339 Bacteria 5549
55 Ga0070660_100022714 3300005339 Bacteria 4643
56 Ga0070660_100206398 3300005339 Bacteria 1594
57 Ga0070660_100220223 3300005339 Bacteria 1542
58 Ga0070660_100266080 3300005339 Bacteria 1400
59 Ga0070660_100378699 3300005339 Unclassified 1168
60 Ga0070691_10032392 3300005341 Bacteria 2456
61 Ga0070661_100002551 3300005344 Bacteria 12479
62 Ga0070661_100022984 3300005344 Bacteria 4466
63 Ga0070661_100054648 3300005344 Bacteria 2925
64 Ga0070661_100077846 3300005344 Bacteria 2445
65 Ga0070661_100171049 3300005344 Bacteria 1650
66 Ga0070661_100291837 3300005344 Bacteria 1267
67 Ga0070661_100624677 3300005344 Bacteria 873
68 Ga0070661_100754498 3300005344 Bacteria 796
69 Ga0070692_10124817 3300005345 Unclassified 1440
70 Ga0070692_10311389 3300005345 Bacteria 965
71 Ga0070668_100088069 3300005347 Bacteria 2443
72 Ga0070668_100108286 3300005347 Bacteria 2210
73 Ga0070669_100082102 3300005353 Bacteria 2402
74 Ga0070675_100034964 3300005354 Bacteria 4081
75 Ga0070675_100036580 3300005354 Bacteria 3996
76 Ga0070675_100148934 3300005354 Bacteria 2005
77 Ga0070675_100826976 3300005354 Bacteria 847
78 Ga0070671_100002313 3300005355 Bacteria 14712
79 Ga0070671_100008818 3300005355 Bacteria 8091
80 Ga0070671_100023977 3300005355 Bacteria 4993
81 Ga0070671_100044064 3300005355 Bacteria 3707
82 Ga0070671_100049120 3300005355 Bacteria 3510
83 Ga0070671_100058169 3300005355 Bacteria 3218
84 Ga0070671_100058773 3300005355 Bacteria 3200
85 Ga0070671_100297078 3300005355 Bacteria 1375
86 Ga0070671_100666710 3300005355 Unclassified 901
87 Ga0070671_101555130 3300005355 Unclassified 586
88 Ga0070674_100009545 3300005356 Bacteria 5811
89 Ga0070674_100017405 3300005356 Bacteria 4521
90 Ga0070674_100040396 3300005356 Bacteria 3156
91 Ga0070674_100475091 3300005356 Bacteria 1036
92 Ga0070673_100001132 3300005364 Bacteria 15331
93 Ga0070673_100011600 3300005364 Bacteria 6020
94 Ga0070673_100016699 3300005364 Bacteria 5200
95 Ga0070673_100624481 3300005364 Unclassified 984
96 Ga0070673_100693134 3300005364 Unclassified 935
97 Ga0070659_100010935 3300005366 Bacteria 6698
98 Ga0070659_100016329 3300005366 Bacteria 5573
99 Ga0070659_100190601 3300005366 Bacteria 1685
100 Ga0070659_100215505 3300005366 Bacteria 1583
101 Ga0070659_100301020 3300005366 Bacteria 1337
102 Ga0070659_100449778 3300005366 Bacteria 1092
103 Ga0070659_100542706 3300005366 Bacteria 995
104 Ga0070659_101405676 3300005366 Bacteria 620
105 Ga0070659_101805929 3300005366 Unclassified 548
106 Ga0070667_100000839 3300005367 Bacteria 28510
107 Ga0070667_100005255 3300005367 Bacteria 10826
108 Ga0070667_100043117 3300005367 Bacteria 3786
109 Ga0070667_100066889 3300005367 Bacteria 3054
110 Ga0070667_100113066 3300005367 Bacteria 2356
111 Ga0070667_100195745 3300005367 Bacteria 1792
112 Ga0070667_100977292 3300005367 Unclassified 789
113 Ga0070667_101517398 3300005367 Bacteria 629
114 Ga0070714_101015485 3300005435 Unclassified 807
115 Ga0070714_101548543 3300005435 Unclassified 647
116 Ga0070713_100016594 3300005436 Bacteria 5538
117 Ga0070663_100005415 3300005455 Bacteria 7581
118 Ga0070663_100104051 3300005455 Bacteria 2123
119 Ga0070663_100122254 3300005455 Bacteria 1968
120 Ga0070663_100232432 3300005455 Bacteria 1452
121 Ga0070663_100409789 3300005455 Bacteria 1110
122 Ga0070678_100008398 3300005456 Bacteria 6183
123 Ga0070678_100059918 3300005456 Bacteria 2799
124 Ga0070678_100107504 3300005456 Bacteria 2176
125 Ga0070678_100643749 3300005456 Unclassified 950
126 Ga0070662_100005625 3300005457 Bacteria 8016
127 Ga0070662_100019530 3300005457 Bacteria 4601
128 Ga0070662_100059950 3300005457 Bacteria 2773
129 Ga0070662_100060032 3300005457 Bacteria 2772
130 Ga0070662_100060899 3300005457 Bacteria 2754
131 Ga0070662_100063152 3300005457 Bacteria 2708
132 Ga0070662_100111010 3300005457 Bacteria 2089
133 Ga0070662_100154850 3300005457 Bacteria 1788
134 Ga0070662_100311508 3300005457 Bacteria 1281
135 Ga0070662_100388969 3300005457 Unclassified 1149
136 Ga0070662_100428960 3300005457 Bacteria 1095
137 Ga0070662_100630876 3300005457 Bacteria 903
138 Ga0070662_100676006 3300005457 Unclassified 872
139 Ga0070662_100776606 3300005457 Unclassified 814
140 Ga0070681_10396624 3300005458 Bacteria 1291
141 Ga0070681_10860867 3300005458 Bacteria 824
142 Ga0070681_11290370 3300005458 Bacteria 653
143 Ga0068867_100020782 3300005459 Bacteria 4680
144 Ga0068867_100043753 3300005459 Bacteria 3279
145 Ga0068867_100365275 3300005459 Unclassified 1208
146 Ga0070685_10345819 3300005466 Bacteria 1015
147 Ga0070679_100122703 3300005530 Bacteria 2582
148 Ga0070679_100212177 3300005530 Bacteria 1900
149 Ga0070679_100264040 3300005530 Bacteria 1677
150 Ga0070679_100284894 3300005530 Bacteria 1604
151 Ga0070679_100448771 3300005530 Unclassified 1234
152 Ga0070679_100507306 3300005530 Unclassified 1150
153 Ga0070684_100081034 3300005535 Bacteria 2872
154 Ga0070684_100535934 3300005535 Bacteria 1086
155 Ga0070684_100784056 3300005535 Bacteria 890
156 Ga0068853_100018252 3300005539 Bacteria 5804
157 Ga0068853_100077555 3300005539 Bacteria 2903
158 Ga0068853_100320905 3300005539 Bacteria 1436
159 Ga0068853_100333731 3300005539 Bacteria 1408
160 Ga0068853_100355001 3300005539 Unclassified 1364
161 Ga0068853_100433357 3300005539 Unclassified 1234
162 Ga0068853_101211394 3300005539 Unclassified 729
163 Ga0068853_101515235 3300005539 Unclassified 649
164 Ga0070672_100001538 3300005543 Bacteria 14280
165 Ga0070672_100081779 3300005543 Bacteria 2590
166 Ga0070672_100143105 3300005543 Bacteria 1974
167 Ga0070672_100158358 3300005543 Bacteria 1877
168 Ga0070672_100320904 3300005543 Bacteria 1317
169 Ga0070672_100814465 3300005543 Unclassified 822
170 Ga0070672_101601401 3300005543 Unclassified 584
171 Ga0070695_100621565 3300005545 Bacteria 850
172 Ga0070696_100192593 3300005546 Bacteria 1518
173 Ga0070696_100338792 3300005546 Bacteria 1162
174 Ga0070693_100073176 3300005547 Bacteria 2024
175 Ga0070665_100043142 3300005548 Bacteria 4533
176 Ga0070665_100077073 3300005548 Bacteria 3340
177 Ga0070665_101921970 3300005548 Unclassified 597
178 Ga0068855_100089078 3300005563 Bacteria 3563
179 Ga0068855_100329611 3300005563 Bacteria 1685
180 Ga0068855_100464580 3300005563 Bacteria 1380
181 Ga0068855_100644228 3300005563 Bacteria 1138
182 Ga0068855_100780946 3300005563 Unclassified 1016
183 Ga0068855_101068156 3300005563 Unclassified 845
184 Ga0070664_100000464 3300005564 Bacteria 30816
185 Ga0070664_100001697 3300005564 Bacteria 17648
186 Ga0070664_100005415 3300005564 Bacteria 10246
187 Ga0070664_100021250 3300005564 Bacteria 5347
188 Ga0070664_100040431 3300005564 Bacteria 3931
189 Ga0070664_100061003 3300005564 Bacteria 3213
190 Ga0070664_100095575 3300005564 Bacteria 2577
191 Ga0070664_100113138 3300005564 Bacteria 2370
192 Ga0070664_100143057 3300005564 Bacteria 2107
193 Ga0070664_100237430 3300005564 Bacteria 1635
194 Ga0070664_100260008 3300005564 Bacteria 1562
195 Ga0070664_100280096 3300005564 Bacteria 1504
196 Ga0070664_100386016 3300005564 Bacteria 1279
197 Ga0070664_100501218 3300005564 Unclassified 1119
198 Ga0068857_100014379 3300005577 Bacteria 6900
199 Ga0068857_100052549 3300005577 Bacteria 3615
200 Ga0068857_100065924 3300005577 Bacteria 3221
201 Ga0068857_100107520 3300005577 Bacteria 2505
202 Ga0068857_100749303 3300005577 Bacteria 930
203 Ga0068854_100019650 3300005578 Bacteria 4556
204 Ga0068854_100057379 3300005578 Bacteria 2808
205 Ga0068854_100102694 3300005578 Bacteria 2145
206 Ga0068854_100470411 3300005578 Unclassified 1053
207 Ga0068856_100009131 3300005614 Bacteria 9641
208 Ga0068856_100099551 3300005614 Bacteria 2898
209 Ga0068856_100168369 3300005614 Bacteria 2202
210 Ga0068856_100344900 3300005614 Unclassified 1508
211 Ga0068856_100715709 3300005614 Bacteria 1021
212 Ga0068856_100722251 3300005614 Unclassified 1016
213 Ga0068856_100825119 3300005614 Unclassified 947
214 Ga0068856_101663346 3300005614 Bacteria 651
215 Ga0070702_100261832 3300005615 Bacteria 1178
216 Ga0068852_100175449 3300005616 Bacteria 2012
217 Ga0068852_100183534 3300005616 Bacteria 1969
218 Ga0068852_100257475 3300005616 Bacteria 1674
219 Ga0068852_100352756 3300005616 Bacteria 1437
220 Ga0068852_100354533 3300005616 Bacteria 1433
221 Ga0068852_100705121 3300005616 Bacteria 1019
222 Ga0068852_100939392 3300005616 Bacteria 883
223 Ga0068859_100007890 3300005617 Bacteria 10800
224 Ga0068859_100068845 3300005617 Bacteria 3574
225 Ga0068859_100214298 3300005617 Bacteria 2013
226 Ga0068859_100214503 3300005617 Bacteria 2012
227 Ga0068859_100576428 3300005617 Bacteria 1219
228 Ga0068864_100000986 3300005618 Bacteria 23851
229 Ga0068864_100001642 3300005618 Bacteria 18433
230 Ga0068864_100021140 3300005618 Bacteria 5448
231 Ga0068864_100056390 3300005618 Bacteria 3394
232 Ga0068864_100153413 3300005618 Bacteria 2089
233 Ga0068864_100421018 3300005618 Bacteria 1273
234 Ga0068864_100663594 3300005618 Bacteria 1016
235 Ga0068866_10037119 3300005718 Bacteria 2391
236 Ga0068861_100178485 3300005719 Bacteria 1766
237 Ga0068851_10013471 3300005834 Bacteria 3870
238 Ga0068851_10033973 3300005834 Bacteria 2544
239 Ga0068851_10076057 3300005834 Bacteria 1746
240 Ga0068851_10432053 3300005834 Bacteria 779
241 Ga0068851_10729521 3300005834 Unclassified 612
242 Ga0068870_10032800 3300005840 Bacteria 2644
243 Ga0068870_10283793 3300005840 Unclassified 1039
244 Ga0068863_100005345 3300005841 Bacteria 12666
245 Ga0068863_100022151 3300005841 Bacteria 6066
246 Ga0068863_100056265 3300005841 Bacteria 3724
247 Ga0068863_100093601 3300005841 Bacteria 2852
248 Ga0068858_100002249 3300005842 Bacteria 19508
249 Ga0068858_100002545 3300005842 Bacteria 18388
250 Ga0068858_100147703 3300005842 Bacteria 2209
251 Ga0068858_100681958 3300005842 Unclassified 999
252 Ga0068860_100068609 3300005843 Bacteria 3369
253 Ga0068860_100317627 3300005843 Bacteria 1528
254 Ga0068860_100967741 3300005843 Bacteria 868
255 Ga0068862_100239994 3300005844 Bacteria 1647
256 Ga0097621_100019287 3300006237 Bacteria 5231
257 Ga0097621_100049233 3300006237 Bacteria 3423
258 Ga0097621_100118003 3300006237 Bacteria 2249
259 Ga0068871_100033153 3300006358 Bacteria 4087
260 Ga0068871_100092560 3300006358 Bacteria 2521
261 Ga0068871_100157496 3300006358 Bacteria 1940
262 Ga0068871_100227498 3300006358 Bacteria 1618
263 Ga0068871_100742227 3300006358 Unclassified 902
264 Ga0068865_100025155 3300006881 Bacteria 3913
265 Ga0068865_100047517 3300006881 Bacteria 2950
266 Ga0068865_100218439 3300006881 Unclassified 1489
267 Ga0068865_100298076 3300006881 Bacteria 1289
268 Ga0097620_100007889 3300006931 Bacteria 10800
269 Ga0097620_100068846 3300006931 Bacteria 3574
270 Ga0097620_100214298 3300006931 Bacteria 2013
271 Ga0097620_100214499 3300006931 Bacteria 2012
272 Ga0097620_100576401 3300006931 Bacteria 1219
273 Ga0105251_10112187 3300009011 Bacteria 1241
274 Ga0105250_10019406 3300009092 Bacteria 2749
275 Ga0105240_10066058 3300009093 Bacteria 4489
276 Ga0105240_10404878 3300009093 Bacteria 1536
277 Ga0105245_10097844 3300009098 Bacteria 2710
278 Ga0105245_10664587 3300009098 Unclassified 1073
279 Ga0105245_10775596 3300009098 Bacteria 996
280 Ga0105247_10053827 3300009101 Bacteria 2483
281 Ga0105243_10029912 3300009148 Bacteria 4191
282 Ga0105243_10457685 3300009148 Unclassified 1199
283 Ga0105241_10015362 3300009174 Bacteria 5607
284 Ga0105241_10056262 3300009174 Bacteria 3016
285 Ga0105241_10099163 3300009174 Bacteria 2313
286 Ga0105241_10416867 3300009174 Bacteria 1181
287 Ga0105242_10376055 3300009176 Bacteria 1319
288 Ga0105242_10454188 3300009176 Unclassified 1209
289 Ga0105248_10001057 3300009177 Bacteria 30519
290 Ga0105248_10002050 3300009177 Bacteria 22321
291 Ga0105248_10007323 3300009177 Bacteria 12111
292 Ga0105248_10026023 3300009177 Bacteria 6508
293 Ga0105248_10062464 3300009177 Bacteria 4182
294 Ga0105248_10176481 3300009177 Bacteria 2407
295 Ga0105248_10309435 3300009177 Bacteria 1779
296 Ga0105248_10343084 3300009177 Bacteria 1681
297 Ga0105248_10621711 3300009177 Unclassified 1219
298 Ga0105248_10765843 3300009177 Bacteria 1089
299 Ga0105248_10907835 3300009177 Bacteria 995
300 Ga0105237_10557828 3300009545 Bacteria 1152
301 Ga0105238_10839549 3300009551 Bacteria 935
302 Ga0105238_11426205 3300009551 Unclassified 720
303 Ga0105238_11426208 3300009551 Unclassified 720
304 Ga0105249_10133927 3300009553 Bacteria 2369
305 Ga0105239_10220297 3300010375 Bacteria 2128
306 Ga0105239_10597794 3300010375 Bacteria 1258
307 Ga0105246_10043210 3300011119 Bacteria 3057
308 Ga0105246_10564405 3300011119 Bacteria 978
309 Ga0157373_10094680 3300013100 Bacteria 2103
310 Ga0157373_10103705 3300013100 Bacteria 2000
311 Ga0157373_10231197 3300013100 Bacteria 1306
312 Ga0157373_10364636 3300013100 Unclassified 1032
313 Ga0157373_10374228 3300013100 Bacteria 1018
314 Ga0157373_10459042 3300013100 Bacteria 917
315 Ga0157373_10622768 3300013100 Bacteria 787
316 Ga0157371_10072228 3300013102 Bacteria 2443
317 Ga0157371_10099800 3300013102 Bacteria 2059
318 Ga0157371_10185682 3300013102 Bacteria 1488
319 Ga0157371_10234742 3300013102 Bacteria 1318
320 Ga0157370_10068533 3300013104 Bacteria 3353
321 Ga0157370_10101103 3300013104 Bacteria 2700
322 Ga0157370_11050820 3300013104 Unclassified 736
323 Ga0157370_11093672 3300013104 Unclassified 720
324 Ga0157370_11093674 3300013104 Bacteria 720
325 Ga0157370_11233186 3300013104 Unclassified 674
326 Ga0157369_10130538 3300013105 Bacteria 2663
327 Ga0157369_10273781 3300013105 Bacteria 1759
328 Ga0157369_10331794 3300013105 Bacteria 1580
329 Ga0157369_10482822 3300013105 Bacteria 1282
330 Ga0157369_11370592 3300013105 Unclassified 720
331 Ga0157374_10002527 3300013296 Bacteria 15425
332 Ga0157374_10017514 3300013296 Bacteria 6310
333 Ga0157374_10216137 3300013296 Bacteria 1880
334 Ga0157374_10250655 3300013296 Bacteria 1742
335 Ga0157374_10293304 3300013296 Unclassified 1608
336 Ga0157378_10020899 3300013297 Bacteria 5758
337 Ga0157378_10079104 3300013297 Bacteria 2968
338 Ga0163162_10000908 3300013306 Bacteria 27533
339 Ga0163162_10204707 3300013306 Bacteria 2103
340 Ga0163162_11336452 3300013306 Unclassified 815
341 Ga0157372_10043021 3300013307 Bacteria 4999
342 Ga0157372_10138106 3300013307 Bacteria 2808
343 Ga0157372_10155411 3300013307 Bacteria 2642
344 Ga0157372_10201761 3300013307 Bacteria 2304
345 Ga0157372_10566347 3300013307 Bacteria 1324
346 Ga0157375_10005079 3300013308 Bacteria 11417
347 Ga0157375_10025519 3300013308 Bacteria 5493
348 Ga0157375_10041720 3300013308 Bacteria 4433
349 Ga0163163_10002969 3300014325 Bacteria 14347
350 Ga0163163_10002975 3300014325 Bacteria 14335
351 Ga0163163_10104218 3300014325 Bacteria 2861
352 Ga0157380_11241876 3300014326 Unclassified 790
353 Ga0182008_10440637 3300014497 Bacteria 706
354 Ga0157377_10014703 3300014745 Bacteria 3987
355 Ga0157377_10464497 3300014745 Unclassified 877
356 Ga0157379_10002869 3300014968 Bacteria 14535
357 Ga0157379_10058560 3300014968 Bacteria 3445
358 Ga0157379_10077529 3300014968 Bacteria 2975
359 Ga0163161_10293802 3300017792 Bacteria 1278
360 Ga0213876_10376028 3300021384 Unclassified 755
361 Ga0207697_10005519 3300025315 Bacteria 5867
362 Ga0207697_10012922 3300025315 Bacteria 3490
363 Ga0207656_10025039 3300025321 Bacteria 2420
364 Ga0207656_10239859 3300025321 Unclassified 885
365 Ga0207682_10014554 3300025893 Bacteria 3066
366 Ga0207642_10046327 3300025899 Bacteria 1937
367 Ga0207688_10012845 3300025901 Bacteria 4553
368 Ga0207688_10025745 3300025901 Bacteria 3233
369 Ga0207680_10042486 3300025903 Bacteria 2659
370 Ga0207680_10055109 3300025903 Bacteria 2395
371 Ga0207680_10097076 3300025903 Bacteria 1886
372 Ga0207680_10455414 3300025903 Bacteria 908
373 Ga0207680_10797682 3300025903 Unclassified 677
374 Ga0207680_10824857 3300025903 Unclassified 665
375 Ga0207647_10004293 3300025904 Bacteria 10574
376 Ga0207647_10011091 3300025904 Bacteria 6332
377 Ga0207647_10028491 3300025904 Bacteria 3626
378 Ga0207647_10058900 3300025904 Bacteria 2351
379 Ga0207647_10087032 3300025904 Bacteria 1867
380 Ga0207647_10088245 3300025904 Bacteria 1852
381 Ga0207645_10015256 3300025907 Bacteria 5112
382 Ga0207645_10094982 3300025907 Bacteria 1920
383 Ga0207645_10096885 3300025907 Bacteria 1901
384 Ga0207645_10143534 3300025907 Bacteria 1556
385 Ga0207645_10211070 3300025907 Bacteria 1279
386 Ga0207643_10052106 3300025908 Bacteria 2324
387 Ga0207643_10245610 3300025908 Unclassified 1101
388 Ga0207705_10001651 3300025909 Bacteria 17706
389 Ga0207705_10004116 3300025909 Bacteria 11023
390 Ga0207705_10012877 3300025909 Bacteria 6038
391 Ga0207705_10034945 3300025909 Bacteria 3595
392 Ga0207705_10053127 3300025909 Bacteria 2918
393 Ga0207705_10070759 3300025909 Bacteria 2528
394 Ga0207705_10389362 3300025909 Unclassified 1077
395 Ga0207654_10233862 3300025911 Unclassified 1225
396 Ga0207654_10396663 3300025911 Bacteria 958
397 Ga0207707_10762835 3300025912 Bacteria 808
398 Ga0207695_10003427 3300025913 Bacteria 22376
399 Ga0207695_11286898 3300025913 Unclassified 612
400 Ga0207660_10081066 3300025917 Bacteria 2384
401 Ga0207660_10214218 3300025917 Bacteria 1509
402 Ga0207660_10335177 3300025917 Unclassified 1210
403 Ga0207662_10594150 3300025918 Unclassified 770
404 Ga0207657_10005882 3300025919 Bacteria 12778
405 Ga0207657_10021578 3300025919 Bacteria 6056
406 Ga0207657_10022716 3300025919 Bacteria 5860
407 Ga0207657_10031437 3300025919 Bacteria 4808
408 Ga0207657_10043028 3300025919 Bacteria 3981
409 Ga0207657_10064311 3300025919 Bacteria 3131
410 Ga0207657_10126496 3300025919 Bacteria 2099
411 Ga0207657_10359587 3300025919 Bacteria 1148
412 Ga0207657_10420892 3300025919 Unclassified 1050
413 Ga0207657_10575121 3300025919 Bacteria 880
414 Ga0207657_11212030 3300025919 Bacteria 573
415 Ga0207649_10005063 3300025920 Bacteria 7128
416 Ga0207649_10007270 3300025920 Bacteria 6020
417 Ga0207649_10014092 3300025920 Bacteria 4474
418 Ga0207649_10030427 3300025920 Bacteria 3197
419 Ga0207649_10115567 3300025920 Bacteria 1800
420 Ga0207649_10172941 3300025920 Bacteria 1506
421 Ga0207649_10219810 3300025920 Bacteria 1352
422 Ga0207649_10335968 3300025920 Unclassified 1114
423 Ga0207652_10102750 3300025921 Bacteria 2526
424 Ga0207652_10188268 3300025921 Bacteria 1856
425 Ga0207652_10321008 3300025921 Bacteria 1398
426 Ga0207681_10113042 3300025923 Bacteria 1979
427 Ga0207681_10204403 3300025923 Bacteria 1518
428 Ga0207694_10328728 3300025924 Bacteria 1263
429 Ga0207694_10423484 3300025924 Bacteria 1109
430 Ga0207694_11052118 3300025924 Unclassified 689
431 Ga0207650_10001833 3300025925 Bacteria 15000
432 Ga0207650_10060779 3300025925 Bacteria 2820
433 Ga0207650_10087278 3300025925 Bacteria 2377
434 Ga0207650_10129216 3300025925 Bacteria 1975
435 Ga0207650_10740949 3300025925 Bacteria 831
436 Ga0207650_11027105 3300025925 Bacteria 701
437 Ga0207659_10033605 3300025926 Bacteria 3532
438 Ga0207659_10039707 3300025926 Bacteria 3285
439 Ga0207659_10206090 3300025926 Unclassified 1573
440 Ga0207659_10519156 3300025926 Bacteria 1010
441 Ga0207687_10214012 3300025927 Bacteria 1513
442 Ga0207664_10073915 3300025929 Bacteria 2752
443 Ga0207664_10862538 3300025929 Unclassified 814
444 Ga0207644_10000061 3300025931 Bacteria 79079
445 Ga0207644_10001036 3300025931 Bacteria 17813
446 Ga0207644_10002053 3300025931 Bacteria 13049
447 Ga0207644_10032343 3300025931 Bacteria 3649
448 Ga0207644_10077779 3300025931 Bacteria 2444
449 Ga0207644_10090730 3300025931 Bacteria 2277
450 Ga0207644_10165707 3300025931 Bacteria 1721
451 Ga0207644_10313728 3300025931 Unclassified 1266
452 Ga0207644_10587108 3300025931 Unclassified 924
453 Ga0207690_10011498 3300025932 Bacteria 5291
454 Ga0207690_10011664 3300025932 Bacteria 5253
455 Ga0207690_10074042 3300025932 Bacteria 2358
456 Ga0207690_10191372 3300025932 Bacteria 1548
457 Ga0207690_10301778 3300025932 Bacteria 1253
458 Ga0207690_10524606 3300025932 Bacteria 960
459 Ga0207690_10969221 3300025932 Unclassified 707
460 Ga0207706_10002923 3300025933 Bacteria 16502
461 Ga0207706_10020981 3300025933 Bacteria 5867
462 Ga0207706_10032705 3300025933 Bacteria 4630
463 Ga0207706_10037361 3300025933 Bacteria 4313
464 Ga0207706_10073189 3300025933 Bacteria 3013
465 Ga0207706_10079040 3300025933 Bacteria 2893
466 Ga0207706_10117191 3300025933 Bacteria 2342
467 Ga0207706_10191769 3300025933 Bacteria 1794
468 Ga0207706_10346249 3300025933 Bacteria 1292
469 Ga0207706_10654810 3300025933 Bacteria 899
470 Ga0207706_11010167 3300025933 Unclassified 698
471 Ga0207686_10213019 3300025934 Unclassified 1390
472 Ga0207709_10039866 3300025935 Bacteria 2808
473 Ga0207709_10439887 3300025935 Bacteria 1005
474 Ga0207669_10001507 3300025937 Bacteria 9927
475 Ga0207669_10007586 3300025937 Bacteria 5031
476 Ga0207669_10102218 3300025937 Bacteria 1898
477 Ga0207669_10802830 3300025937 Unclassified 780
478 Ga0207704_10255584 3300025938 Bacteria 1318
479 Ga0207704_10266040 3300025938 Bacteria 1295
480 Ga0207691_10004370 3300025940 Bacteria 13701
481 Ga0207691_10105953 3300025940 Bacteria 2504
482 Ga0207691_10342292 3300025940 Bacteria 1280
483 Ga0207691_10478595 3300025940 Unclassified 1058
484 Ga0207691_10483712 3300025940 Bacteria 1052
485 Ga0207691_11345356 3300025940 Unclassified 588
486 Ga0207691_11503456 3300025940 Unclassified 550
487 Ga0207711_10000372 3300025941 Bacteria 47656
488 Ga0207711_10000665 3300025941 Bacteria 34189
489 Ga0207711_10003024 3300025941 Bacteria 14701
490 Ga0207711_10084436 3300025941 Bacteria 2779
491 Ga0207711_10219071 3300025941 Bacteria 1740
492 Ga0207711_10290313 3300025941 Bacteria 1507
493 Ga0207689_10183943 3300025942 Bacteria 1723
494 Ga0207661_10409154 3300025944 Unclassified 1231
495 Ga0207661_10628544 3300025944 Bacteria 986
496 Ga0207679_10002303 3300025945 Bacteria 11761
497 Ga0207679_10011569 3300025945 Bacteria 5723
498 Ga0207679_10012101 3300025945 Bacteria 5614
499 Ga0207679_10014106 3300025945 Bacteria 5244
500 Ga0207679_10054089 3300025945 Bacteria 2954
501 Ga0207679_10079451 3300025945 Bacteria 2501
502 Ga0207679_10154209 3300025945 Bacteria 1873
503 Ga0207679_10157781 3300025945 Bacteria 1854
504 Ga0207679_10344584 3300025945 Bacteria 1297
505 Ga0207679_10496963 3300025945 Bacteria 1088
506 Ga0207679_11074412 3300025945 Unclassified 738
507 Ga0207679_11671028 3300025945 Unclassified 583
508 Ga0207679_11744387 3300025945 Unclassified 569
509 Ga0207667_10045507 3300025949 Bacteria 4647
510 Ga0207667_10057341 3300025949 Bacteria 4088
511 Ga0207667_10066629 3300025949 Bacteria 3753
512 Ga0207667_10073546 3300025949 Bacteria 3551
513 Ga0207667_10091540 3300025949 Bacteria 3141
514 Ga0207667_10604777 3300025949 Unclassified 1105
515 Ga0207651_10008478 3300025960 Bacteria 5557
516 Ga0207651_10015049 3300025960 Bacteria 4484
517 Ga0207651_10074018 3300025960 Bacteria 2424
518 Ga0207651_10098505 3300025960 Bacteria 2162
519 Ga0207651_10173152 3300025960 Bacteria 1704
520 Ga0207651_10860145 3300025960 Bacteria 806
521 Ga0207651_11261627 3300025960 Unclassified 664
522 Ga0207712_10088689 3300025961 Bacteria 2272
523 Ga0207668_10072232 3300025972 Bacteria 2468
524 Ga0207668_10258240 3300025972 Bacteria 1418
525 Ga0207668_10324402 3300025972 Bacteria 1279
526 Ga0207640_10018545 3300025981 Bacteria 4091
527 Ga0207640_10030387 3300025981 Bacteria 3326
528 Ga0207640_10073820 3300025981 Bacteria 2306
529 Ga0207640_10445470 3300025981 Unclassified 1066
530 Ga0207658_10001814 3300025986 Bacteria 15968
531 Ga0207658_10011395 3300025986 Bacteria 6051
532 Ga0207658_10175043 3300025986 Bacteria 1771
533 Ga0207658_10223476 3300025986 Bacteria 1585
534 Ga0207658_10761124 3300025986 Bacteria 877
535 Ga0207658_11105414 3300025986 Unclassified 724
536 Ga0207677_10000892 3300026023 Bacteria 16759
537 Ga0207677_10452149 3300026023 Unclassified 1101
538 Ga0207677_10714956 3300026023 Bacteria 890
539 Ga0207703_10001264 3300026035 Bacteria 23607
540 Ga0207703_10001293 3300026035 Bacteria 23178
541 Ga0207703_10013390 3300026035 Bacteria 6393
542 Ga0207703_10201567 3300026035 Bacteria 1768
543 Ga0207703_10651749 3300026035 Unclassified 999
544 Ga0207639_10023592 3300026041 Bacteria 4442
545 Ga0207639_10081221 3300026041 Bacteria 2567
546 Ga0207639_10112208 3300026041 Bacteria 2224
547 Ga0207639_10241635 3300026041 Bacteria 1570
548 Ga0207639_10280681 3300026041 Bacteria 1465
549 Ga0207639_11010134 3300026041 Unclassified 779
550 Ga0207639_11614496 3300026041 Bacteria 608
551 Ga0207639_11809610 3300026041 Unclassified 571
552 Ga0207678_10000961 3300026067 Bacteria 26351
553 Ga0207678_10008244 3300026067 Bacteria 9182
554 Ga0207678_10020592 3300026067 Bacteria 5783
555 Ga0207678_10021227 3300026067 Bacteria 5692
556 Ga0207678_10055827 3300026067 Bacteria 3401
557 Ga0207678_10075802 3300026067 Bacteria 2881
558 Ga0207678_10215094 3300026067 Bacteria 1644
559 Ga0207702_10030684 3300026078 Bacteria 4478
560 Ga0207702_10032934 3300026078 Bacteria 4326
561 Ga0207702_10082849 3300026078 Bacteria 2790
562 Ga0207702_10193758 3300026078 Bacteria 1880
563 Ga0207702_10276316 3300026078 Bacteria 1586
564 Ga0207702_10367567 3300026078 Bacteria 1380
565 Ga0207702_11487939 3300026078 Bacteria 671
566 Ga0207641_10000908 3300026088 Bacteria 30712
567 Ga0207641_10003662 3300026088 Bacteria 13540
568 Ga0207641_10036657 3300026088 Bacteria 4093
569 Ga0207641_10101765 3300026088 Bacteria 2532
570 Ga0207648_10003806 3300026089 Bacteria 15770
571 Ga0207676_10007262 3300026095 Bacteria 7849
572 Ga0207676_10010426 3300026095 Bacteria 6616
573 Ga0207676_10010543 3300026095 Bacteria 6584
574 Ga0207676_10060996 3300026095 Bacteria 2985
575 Ga0207676_10158633 3300026095 Bacteria 1957
576 Ga0207676_10857064 3300026095 Unclassified 889
577 Ga0207676_10880763 3300026095 Unclassified 877
578 Ga0207674_10000780 3300026116 Bacteria 41514
579 Ga0207674_10004321 3300026116 Bacteria 17130
580 Ga0207674_10039779 3300026116 Bacteria 4873
581 Ga0207674_10042454 3300026116 Bacteria 4696
582 Ga0207674_10249825 3300026116 Bacteria 1721
583 Ga0207674_10452201 3300026116 Bacteria 1241
584 Ga0207674_10622296 3300026116 Bacteria 1043
585 Ga0207675_100331504 3300026118 Bacteria 1488
586 Ga0207683_10001537 3300026121 Bacteria 20804
587 Ga0207683_10014454 3300026121 Bacteria 6721
588 Ga0207683_10148858 3300026121 Bacteria 2112
589 Ga0207683_10665307 3300026121 Unclassified 965
590 Ga0207698_10007496 3300026142 Bacteria 6839
591 Ga0207698_10017222 3300026142 Bacteria 4896
592 Ga0207698_10042305 3300026142 Bacteria 3402
593 Ga0207698_10462480 3300026142 Bacteria 1227
594 Ga0207698_10481502 3300026142 Bacteria 1204
595 Ga0207698_10539065 3300026142 Bacteria 1142
596 Ga0207698_10911941 3300026142 Unclassified 886
597 Ga0207698_11415838 3300026142 Bacteria 710
598 Ga0268266_10039745 3300028379 Bacteria 4007
599 Ga0268266_10096994 3300028379 Bacteria 2592
600 Ga0268265_10929813 3300028380 Bacteria 855
601 Ga0268264_10004230 3300028381 Bacteria 12253
602 Ga0268264_10325014 3300028381 Bacteria 1456
603 Ga0307408_100004305 3300031548 Bacteria 9661
604 Ga0307405_10040352 3300031731 Bacteria 2826
605 Ga0307413_10037041 3300031824 Bacteria 2814
606 Ga0307413_10208620 3300031824 Bacteria 1417
607 Ga0307413_11058900 3300031824 Bacteria 698
608 Ga0307410_10019043 3300031852 Bacteria 4165
609 Ga0307410_10109176 3300031852 Bacteria 1999
610 Ga0307410_10113190 3300031852 Bacteria 1966
611 Ga0307406_10052245 3300031901 Bacteria 2598
612 Ga0307406_10300578 3300031901 Bacteria 1233
613 Ga0307412_10152277 3300031911 Bacteria 1708
614 Ga0307409_100070747 3300031995 Bacteria 2770
615 Ga0307409_101081704 3300031995 Bacteria 822
616 Ga0307416_100006649 3300032002 Bacteria 7256
617 Ga0307416_100234010 3300032002 Bacteria 1773
618 Ga0307416_100318634 3300032002 Bacteria 1556
619 Ga0307414_10080732 3300032004 Bacteria 2379
620 Ga0307411_10029095 3300032005 Bacteria 3369
621 Ga0307411_10051864 3300032005 Bacteria 2679
622 Ga0307415_101025390 3300032126 Bacteria 768
623 Ga0373948_0122594 3300034817 Bacteria 629
624 Ga0373931_0117506 3300035691 Bacteria 1516
625 Ga0395899_0000224 3300037312 Bacteria 76706
626 Ga0395899_0001948 3300037312 Bacteria 16981
627 Ga0395899_0008499 3300037312 Bacteria 7909
628 Ga0395899_0023576 3300037312 Bacteria 4658
629 Ga0395899_0048675 3300037312 Bacteria 3153
630 Ga0395899_0140707 3300037312 Bacteria 1717
631 Ga0395899_0374409 3300037312 Unclassified 947
632 Ga0395899_0606173 3300037312 Bacteria 697
633 Ga0395900_0000294 3300037418 Bacteria 75260
634 Ga0395900_0014145 3300037418 Bacteria 8148
635 Ga0395900_0044847 3300037418 Bacteria 4554
636 Ga0395900_0047138 3300037418 Bacteria 4437
637 Ga0395900_0055849 3300037418 Bacteria 4065
638 Ga0395900_0147016 3300037418 Bacteria 2409
639 Ga0395900_0180379 3300037418 Bacteria 2146
640 Ga0395900_0229706 3300037418 Bacteria 1866
641 Ga0395900_0420248 3300037418 Bacteria 1298
642 Ga0395900_0742187 3300037418 Unclassified 912
643 Ga0395898_0000192 3300037466 Bacteria 156121
644 Ga0395898_0001747 3300037466 Bacteria 28657
645 Ga0395898_0002761 3300037466 Bacteria 20224
646 Ga0395898_0022572 3300037466 Bacteria 6372
647 Ga0395898_0099379 3300037466 Bacteria 2794
648 Ga0395898_0101703 3300037466 Bacteria 2759
649 Ga0395898_0269475 3300037466 Bacteria 1624
650 Ga0395898_0526499 3300037466 Unclassified 1123
651 Ga0395898_1339588 3300037466 Unclassified 644
652 Ga0395905_0000066 3300037471 Bacteria 183121
653 Ga0395905_0000358 3300037471 Bacteria 64883
654 Ga0395905_0001563 3300037471 Bacteria 27336
655 Ga0395905_0036230 3300037471 Bacteria 4633
656 Ga0395905_0036399 3300037471 Bacteria 4622
657 Ga0395905_0059301 3300037471 Bacteria 3577
658 Ga0395905_0073168 3300037471 Bacteria 3212
659 Ga0395905_0078062 3300037471 Bacteria 3102
660 Ga0395905_0087321 3300037471 Bacteria 2924
661 Ga0395905_0097825 3300037471 Bacteria 2756
662 Ga0395905_0336196 3300037471 Bacteria 1401
663 Ga0395905_0416348 3300037471 Bacteria 1239
664 Ga0395905_0522401 3300037471 Bacteria 1087
665 Ga0395905_0525672 3300037471 Bacteria 1083
666 Ga0395905_0683240 3300037471 Bacteria 929
667 Ga0395905_0930469 3300037471 Bacteria 772
668 Ga0395901_0001222 3300038443 Bacteria 27379
669 Ga0395901_0007044 3300038443 Bacteria 11365
670 Ga0395901_0010259 3300038443 Bacteria 9488
671 Ga0395901_0143388 3300038443 Bacteria 2510
672 Ga0395901_0317569 3300038443 Unclassified 1612
673 Ga0395901_0329907 3300038443 Bacteria 1577
674 Ga0395901_0359785 3300038443 Bacteria 1501
675 Ga0395901_0672597 3300038443 Bacteria 1036
676 Ga0395901_1219039 3300038443 Bacteria 717
677 Ga0436365_1068382 3300039437 Bacteria 1629
678 Ga0439432_068766 3300042006 Bacteria 1082
679 Ga0439449_0153923 3300042007 Bacteria 858
680 Ga0439458_0000074 3300042157 Bacteria 18402
681 Ga0466966_0034110 3300044684 Bacteria 3293
682 Ga0466961_0045902 3300044693 Bacteria 2795
683 Ga0466963_0011975 3300044694 Bacteria 5297
684 Ga0466963_0159129 3300044694 Bacteria 1571
685 Ga0466971_0249208 3300044719 Bacteria 846
686 Ga0466970_0043821 3300044765 Bacteria 2382
687 Ga0466957_0105456 3300044842 Bacteria 1781
688 Ga0466960_0906744 3300044901 Unclassified 538
689 Ga0466958_0013696 3300045836 Bacteria 4621
690 Ga0466958_0697542 3300045836 Bacteria 661
691 Ga0466967_0067318 3300045976 Bacteria 3194
692 Ga0466967_0075733 3300045976 Bacteria 3025
693 Ga0466967_0428219 3300045976 Unclassified 1291
694 Ga0495669_0004679 3300046684 Bacteria 5673
695 Ga0495669_0065443 3300046684 Bacteria 1650
696 Ga0495670_0013847 3300046691 Bacteria 3966
697 Ga0495677_0008645 3300047445 Bacteria 3780
698 Ga0495677_0045855 3300047445 Bacteria 1604
699 Ga0495685_153269 3300047447 Unclassified 748
700 Ga0496100_0034330 3300048903 Bacteria 3182
701 Ga0496100_0112074 3300048903 Bacteria 1897
702 Ga0496101_0003714 3300048904 Bacteria 9522
703 Ga0496101_0134646 3300048904 Bacteria 1879
704 Ga0496101_0341470 3300048904 Bacteria 1176
705 Ga0496101_0554546 3300048904 Bacteria 909
706 Ga0496102_0130204 3300048905 Bacteria 2354
707 Ga0496102_0268933 3300048905 Bacteria 1607
708 Ga0496102_0326808 3300048905 Bacteria 1445
709 Ga0496103_0044151 3300048906 Bacteria 2746
710 Ga0496103_0081370 3300048906 Bacteria 2037
711 Ga0496103_0099635 3300048906 Bacteria 1838
712 Ga0496106_0100085 3300048909 Bacteria 2248
713 Ga0496106_0100153 3300048909 Bacteria 2247
714 Ga0496106_0185425 3300048909 Bacteria 1653
715 Ga0496106_0207028 3300048909 Bacteria 1562
716 Ga0496107_0029196 3300048910 Bacteria 3922
717 Ga0496107_0032936 3300048910 Bacteria 3706
718 Ga0496107_0104659 3300048910 Bacteria 2077
719 Ga0496107_0113933 3300048910 Bacteria 1989
720 Ga0496108_0003009 3300048911 Bacteria 13547
721 Ga0496108_0008946 3300048911 Bacteria 8114
722 Ga0496109_0004627 3300048912 Bacteria 11488
723 Ga0496109_0032528 3300048912 Bacteria 4688
724 Ga0496109_0136450 3300048912 Bacteria 2292
725 Ga0496110_0011986 3300048913 Bacteria 7121
726 Ga0496110_0030052 3300048913 Bacteria 4682
727 Ga0496110_0045176 3300048913 Bacteria 3849
728 Ga0496111_0063761 3300048914 Bacteria 2672
729 Ga0496111_0825656 3300048914 Unclassified 670
730 Ga0496112_0010453 3300048915 Bacteria 8419
731 Ga0496112_0028727 3300048915 Bacteria 5372
732 Ga0496112_0058587 3300048915 Bacteria 3793
733 Ga0496112_0075833 3300048915 Bacteria 3325
734 Ga0496112_0737879 3300048915 Bacteria 911
735 Ga0496113_0009324 3300048916 Bacteria 6434
736 Ga0496113_0104363 3300048916 Bacteria 2199
737 Ga0496114_0017037 3300048917 Bacteria 5860
738 Ga0496114_0502376 3300048917 Unclassified 1073
739 Ga0496115_0067906 3300048918 Bacteria 2885
740 Ga0501067_0114075 3300049583 Bacteria 1503
741 Ga0501069_0296277 3300049585 Bacteria 948
742 Ga0501239_003742 3300049672 Bacteria 1462
743 Ga0501242_051841 3300049674 Bacteria 604
744 Ga0501262_011154 3300049759 Bacteria 1134
745 Ga0501270_013498 3300049767 Bacteria 1133
746 Ga0501273_001868 3300049770 Bacteria 2075
747 Ga0501204_005999 3300049850 Bacteria 1343
748 Ga0587106_019292 3300059605 Unclassified 994
749 Ga0466962_0079482 3300061719 Bacteria 1568
750 Ga0163162_10693259
751 JGI24741J21665_1016368
752 JGI24752J21851_1004291
753 JGI24746J21847_1006910
754 JGI24739J22299_10019828
755 JGI24739J22299_10048375
756 JGI24737J22298_10001461
757 JGI24737J22298_10011456
758 JGI24743J22301_10004597
759 JGI24750J21931_1019072
760 JGI24745J21846_1000689
761 JGI24738J21930_10107234
762 JGI24744J21845_10000072
763 JGI24034J26672_10037531
764 rootH2_10049478
765 rootH2_10050358
766 rootH1_10310624
767 Ga0065712_10143430
768 Ga0065715_10364347
769 Ga0070658_10135322
770 Ga0070658_11342684
771 Ga0070676_10008712
772 Ga0070676_10185868
773 Ga0070683_100018814
774 Ga0070683_100636020
775 Ga0070683_101529185
776 Ga0070690_100007843
777 Ga0070670_100000918
778 Ga0070670_100001151
779 Ga0070670_100007733
780 Ga0070670_100071113
781 Ga0070670_100096175
782 Ga0070670_100588152
783 Ga0070677_10023755
784 Ga0068869_100995106
785 Ga0070666_10000415
786 Ga0070666_10001975
787 Ga0070666_10053025
788 Ga0070666_10092795
789 Ga0070666_10539520
790 Ga0070666_10944997
791 Ga0070680_100178684
792 Ga0070680_100234117
793 Ga0070680_100240300
794 Ga0070680_100258512
795 Ga0070682_100013858
796 Ga0070682_100315597
797 Ga0070682_100565879
798 Ga0070682_101248358
799 Ga0068868_100010517
800 Ga0068868_100026321
801 Ga0068868_100283100
802 Ga0068868_100607505
803 Ga0070660_100015222
804 Ga0070660_100022714
805 Ga0070660_100206398
806 Ga0070660_100220223
807 Ga0070660_100266080
808 Ga0070660_100378699
809 Ga0070691_10032392
810 Ga0070661_100002551
811 Ga0070661_100022984
812 Ga0070661_100054648
813 Ga0070661_100077846
814 Ga0070661_100171049
815 Ga0070661_100291837
816 Ga0070661_100624677
817 Ga0070661_100754498
818 Ga0070692_10124817
819 Ga0070692_10311389
820 Ga0070668_100088069
821 Ga0070668_100108286
822 Ga0070669_100082102
823 Ga0070675_100034964
824 Ga0070675_100036580
825 Ga0070675_100148934
826 Ga0070675_100826976
827 Ga0070671_100002313
828 Ga0070671_100008818
829 Ga0070671_100023977
830 Ga0070671_100044064
831 Ga0070671_100049120
832 Ga0070671_100058169
833 Ga0070671_100058773
834 Ga0070671_100297078
835 Ga0070671_100666710
836 Ga0070671_101555130
837 Ga0070674_100009545
838 Ga0070674_100017405
839 Ga0070674_100040396
840 Ga0070674_100475091
841 Ga0070673_100001132
842 Ga0070673_100011600
843 Ga0070673_100016699
844 Ga0070673_100624481
845 Ga0070673_100693134
846 Ga0070659_100010935
847 Ga0070659_100016329
848 Ga0070659_100190601
849 Ga0070659_100215505
850 Ga0070659_100301020
851 Ga0070659_100449778
852 Ga0070659_100542706
853 Ga0070659_101405676
854 Ga0070659_101805929
855 Ga0070667_100000839
856 Ga0070667_100005255
857 Ga0070667_100043117
858 Ga0070667_100066889
859 Ga0070667_100113066
860 Ga0070667_100195745
861 Ga0070667_100977292
862 Ga0070667_101517398
863 Ga0070714_101015485
864 Ga0070714_101548543
865 Ga0070713_100016594
866 Ga0070663_100005415
867 Ga0070663_100104051
868 Ga0070663_100122254
869 Ga0070663_100232432
870 Ga0070663_100409789
871 Ga0070678_100008398
872 Ga0070678_100059918
873 Ga0070678_100107504
874 Ga0070678_100643749
875 Ga0070662_100005625
876 Ga0070662_100019530
877 Ga0070662_100059950
878 Ga0070662_100060032
879 Ga0070662_100060899
880 Ga0070662_100063152
881 Ga0070662_100111010
882 Ga0070662_100154850
883 Ga0070662_100311508
884 Ga0070662_100388969
885 Ga0070662_100428960
886 Ga0070662_100630876
887 Ga0070662_100676006
888 Ga0070662_100776606
889 Ga0070681_10396624
890 Ga0070681_10860867
891 Ga0070681_11290370
892 Ga0068867_100020782
893 Ga0068867_100043753
894 Ga0068867_100365275
895 Ga0070685_10345819
896 Ga0070679_100122703
897 Ga0070679_100212177
898 Ga0070679_100264040
899 Ga0070679_100284894
900 Ga0070679_100448771
901 Ga0070679_100507306
902 Ga0070684_100081034
903 Ga0070684_100535934
904 Ga0070684_100784056
905 Ga0068853_100018252
906 Ga0068853_100077555
907 Ga0068853_100320905
908 Ga0068853_100333731
909 Ga0068853_100355001
910 Ga0068853_100433357
911 Ga0068853_101211394
912 Ga0068853_101515235
913 Ga0070672_100001538
914 Ga0070672_100081779
915 Ga0070672_100143105
916 Ga0070672_100158358
917 Ga0070672_100320904
918 Ga0070672_100814465
919 Ga0070672_101601401
920 Ga0070695_100621565
921 Ga0070696_100192593
922 Ga0070696_100338792
923 Ga0070693_100073176
924 Ga0070665_100043142
925 Ga0070665_100077073
926 Ga0070665_101921970
927 Ga0068855_100089078
928 Ga0068855_100329611
929 Ga0068855_100464580
930 Ga0068855_100644228
931 Ga0068855_100780946
932 Ga0068855_101068156
933 Ga0070664_100000464
934 Ga0070664_100001697
935 Ga0070664_100005415
936 Ga0070664_100021250
937 Ga0070664_100040431
938 Ga0070664_100061003
939 Ga0070664_100095575
940 Ga0070664_100113138
941 Ga0070664_100143057
942 Ga0070664_100237430
943 Ga0070664_100260008
944 Ga0070664_100280096
945 Ga0070664_100386016
946 Ga0070664_100501218
947 Ga0068857_100014379
948 Ga0068857_100052549
949 Ga0068857_100065924
950 Ga0068857_100107520
951 Ga0068857_100749303
952 Ga0068854_100019650
953 Ga0068854_100057379
954 Ga0068854_100102694
955 Ga0068854_100470411
956 Ga0068856_100009131
957 Ga0068856_100099551
958 Ga0068856_100168369
959 Ga0068856_100344900
960 Ga0068856_100715709
961 Ga0068856_100722251
962 Ga0068856_100825119
963 Ga0068856_101663346
964 Ga0070702_100261832
965 Ga0068852_100175449
966 Ga0068852_100183534
967 Ga0068852_100257475
968 Ga0068852_100352756
969 Ga0068852_100354533
970 Ga0068852_100705121
971 Ga0068852_100939392
972 Ga0068859_100007890
973 Ga0068859_100068845
974 Ga0068859_100214298
975 Ga0068859_100214503
976 Ga0068859_100576428
977 Ga0068864_100000986
978 Ga0068864_100001642
979 Ga0068864_100021140
980 Ga0068864_100056390
981 Ga0068864_100153413
982 Ga0068864_100421018
983 Ga0068864_100663594
984 Ga0068866_10037119
985 Ga0068861_100178485
986 Ga0068851_10013471
987 Ga0068851_10033973
988 Ga0068851_10076057
989 Ga0068851_10432053
990 Ga0068851_10729521
991 Ga0068870_10032800
992 Ga0068870_10283793
993 Ga0068863_100005345
994 Ga0068863_100022151
995 Ga0068863_100056265
996 Ga0068863_100093601
997 Ga0068858_100002249
998 Ga0068858_100002545
999 Ga0068858_100147703
1000 Ga0068858_100681958
1001 Ga0068860_100068609
1002 Ga0068860_100317627
1003 Ga0068860_100967741
1004 Ga0068862_100239994
1005 Ga0097621_100019287
1006 Ga0097621_100049233
1007 Ga0097621_100118003
1008 Ga0068871_100033153
1009 Ga0068871_100092560
1010 Ga0068871_100157496
1011 Ga0068871_100227498
1012 Ga0068871_100742227
1013 Ga0068865_100025155
1014 Ga0068865_100047517
1015 Ga0068865_100218439
1016 Ga0068865_100298076
1017 Ga0097620_100007889
1018 Ga0097620_100068846
1019 Ga0097620_100214298
1020 Ga0097620_100214499
1021 Ga0097620_100576401
1022 Ga0105251_10112187
1023 Ga0105250_10019406
1024 Ga0105240_10066058
1025 Ga0105240_10404878
1026 Ga0105245_10097844
1027 Ga0105245_10664587
1028 Ga0105245_10775596
1029 Ga0105247_10053827
1030 Ga0105243_10029912
1031 Ga0105243_10457685
1032 Ga0105241_10015362
1033 Ga0105241_10056262
1034 Ga0105241_10099163
1035 Ga0105241_10416867
1036 Ga0105242_10376055
1037 Ga0105242_10454188
1038 Ga0105248_10001057
1039 Ga0105248_10002050
1040 Ga0105248_10007323
1041 Ga0105248_10026023
1042 Ga0105248_10062464
1043 Ga0105248_10176481
1044 Ga0105248_10309435
1045 Ga0105248_10343084
1046 Ga0105248_10621711
1047 Ga0105248_10765843
1048 Ga0105248_10907835
1049 Ga0105237_10557828
1050 Ga0105238_10839549
1051 Ga0105238_11426205
1052 Ga0105238_11426208
1053 Ga0105249_10133927
1054 Ga0105239_10220297
1055 Ga0105239_10597794
1056 Ga0105246_10043210
1057 Ga0105246_10564405
1058 Ga0157373_10094680
1059 Ga0157373_10103705
1060 Ga0157373_10231197
1061 Ga0157373_10364636
1062 Ga0157373_10374228
1063 Ga0157373_10459042
1064 Ga0157373_10622768
1065 Ga0157371_10072228
1066 Ga0157371_10099800
1067 Ga0157371_10185682
1068 Ga0157371_10234742
1069 Ga0157370_10068533
1070 Ga0157370_10101103
1071 Ga0157370_11050820
1072 Ga0157370_11093672
1073 Ga0157370_11093674
1074 Ga0157370_11233186
1075 Ga0157369_10130538
1076 Ga0157369_10273781
1077 Ga0157369_10331794
1078 Ga0157369_10482822
1079 Ga0157369_11370592
1080 Ga0157374_10002527
1081 Ga0157374_10017514
1082 Ga0157374_10216137
1083 Ga0157374_10250655
1084 Ga0157374_10293304
1085 Ga0157378_10020899
1086 Ga0157378_10079104
1087 Ga0163162_10000908
1088 Ga0163162_10204707
1089 Ga0163162_11336452
1090 Ga0157372_10043021
1091 Ga0157372_10138106
1092 Ga0157372_10155411
1093 Ga0157372_10201761
1094 Ga0157372_10566347
1095 Ga0157375_10005079
1096 Ga0157375_10025519
1097 Ga0157375_10041720
1098 Ga0163163_10002969
1099 Ga0163163_10002975
1100 Ga0163163_10104218
1101 Ga0157380_11241876
1102 Ga0182008_10440637
1103 Ga0157377_10014703
1104 Ga0157377_10464497
1105 Ga0157379_10002869
1106 Ga0157379_10058560
1107 Ga0157379_10077529
1108 Ga0163161_10293802
1109 Ga0213876_10376028
1110 Ga0207697_10005519
1111 Ga0207697_10012922
1112 Ga0207656_10025039
1113 Ga0207656_10239859
1114 Ga0207682_10014554
1115 Ga0207642_10046327
1116 Ga0207688_10012845
1117 Ga0207688_10025745
1118 Ga0207680_10042486
1119 Ga0207680_10055109
1120 Ga0207680_10097076
1121 Ga0207680_10455414
1122 Ga0207680_10797682
1123 Ga0207680_10824857
1124 Ga0207647_10004293
1125 Ga0207647_10011091
1126 Ga0207647_10028491
1127 Ga0207647_10058900
1128 Ga0207647_10087032
1129 Ga0207647_10088245
1130 Ga0207645_10015256
1131 Ga0207645_10094982
1132 Ga0207645_10096885
1133 Ga0207645_10143534
1134 Ga0207645_10211070
1135 Ga0207643_10052106
1136 Ga0207643_10245610
1137 Ga0207705_10001651
1138 Ga0207705_10004116
1139 Ga0207705_10012877
1140 Ga0207705_10034945
1141 Ga0207705_10053127
1142 Ga0207705_10070759
1143 Ga0207705_10389362
1144 Ga0207654_10233862
1145 Ga0207654_10396663
1146 Ga0207707_10762835
1147 Ga0207695_10003427
1148 Ga0207695_11286898
1149 Ga0207660_10081066
1150 Ga0207660_10214218
1151 Ga0207660_10335177
1152 Ga0207662_10594150
1153 Ga0207657_10005882
1154 Ga0207657_10021578
1155 Ga0207657_10022716
1156 Ga0207657_10031437
1157 Ga0207657_10043028
1158 Ga0207657_10064311
1159 Ga0207657_10126496
1160 Ga0207657_10359587
1161 Ga0207657_10420892
1162 Ga0207657_10575121
1163 Ga0207657_11212030
1164 Ga0207649_10005063
1165 Ga0207649_10007270
1166 Ga0207649_10014092
1167 Ga0207649_10030427
1168 Ga0207649_10115567
1169 Ga0207649_10172941
1170 Ga0207649_10219810
1171 Ga0207649_10335968
1172 Ga0207652_10102750
1173 Ga0207652_10188268
1174 Ga0207652_10321008
1175 Ga0207681_10113042
1176 Ga0207681_10204403
1177 Ga0207694_10328728
1178 Ga0207694_10423484
1179 Ga0207694_11052118
1180 Ga0207650_10001833
1181 Ga0207650_10060779
1182 Ga0207650_10087278
1183 Ga0207650_10129216
1184 Ga0207650_10740949
1185 Ga0207650_11027105
1186 Ga0207659_10033605
1187 Ga0207659_10039707
1188 Ga0207659_10206090
1189 Ga0207659_10519156
1190 Ga0207687_10214012
1191 Ga0207664_10073915
1192 Ga0207664_10862538
1193 Ga0207644_10000061
1194 Ga0207644_10001036
1195 Ga0207644_10002053
1196 Ga0207644_10032343
1197 Ga0207644_10077779
1198 Ga0207644_10090730
1199 Ga0207644_10165707
1200 Ga0207644_10313728
1201 Ga0207644_10587108
1202 Ga0207690_10011498
1203 Ga0207690_10011664
1204 Ga0207690_10074042
1205 Ga0207690_10191372
1206 Ga0207690_10301778
1207 Ga0207690_10524606
1208 Ga0207690_10969221
1209 Ga0207706_10002923
1210 Ga0207706_10020981
1211 Ga0207706_10032705
1212 Ga0207706_10037361
1213 Ga0207706_10073189
1214 Ga0207706_10079040
1215 Ga0207706_10117191
1216 Ga0207706_10191769
1217 Ga0207706_10346249
1218 Ga0207706_10654810
1219 Ga0207706_11010167
1220 Ga0207686_10213019
1221 Ga0207709_10039866
1222 Ga0207709_10439887
1223 Ga0207669_10001507
1224 Ga0207669_10007586
1225 Ga0207669_10102218
1226 Ga0207669_10802830
1227 Ga0207704_10255584
1228 Ga0207704_10266040
1229 Ga0207691_10004370
1230 Ga0207691_10105953
1231 Ga0207691_10342292
1232 Ga0207691_10478595
1233 Ga0207691_10483712
1234 Ga0207691_11345356
1235 Ga0207691_11503456
1236 Ga0207711_10000372
1237 Ga0207711_10000665
1238 Ga0207711_10003024
1239 Ga0207711_10084436
1240 Ga0207711_10219071
1241 Ga0207711_10290313
1242 Ga0207689_10183943
1243 Ga0207661_10409154
1244 Ga0207661_10628544
1245 Ga0207679_10002303
1246 Ga0207679_10011569
1247 Ga0207679_10012101
1248 Ga0207679_10014106
1249 Ga0207679_10054089
1250 Ga0207679_10079451
1251 Ga0207679_10154209
1252 Ga0207679_10157781
1253 Ga0207679_10344584
1254 Ga0207679_10496963
1255 Ga0207679_11074412
1256 Ga0207679_11671028
1257 Ga0207679_11744387
1258 Ga0207667_10045507
1259 Ga0207667_10057341
1260 Ga0207667_10066629
1261 Ga0207667_10073546
1262 Ga0207667_10091540
1263 Ga0207667_10604777
1264 Ga0207651_10008478
1265 Ga0207651_10015049
1266 Ga0207651_10074018
1267 Ga0207651_10098505
1268 Ga0207651_10173152
1269 Ga0207651_10860145
1270 Ga0207651_11261627
1271 Ga0207712_10088689
1272 Ga0207668_10072232
1273 Ga0207668_10258240
1274 Ga0207668_10324402
1275 Ga0207640_10018545
1276 Ga0207640_10030387
1277 Ga0207640_10073820
1278 Ga0207640_10445470
1279 Ga0207658_10001814
1280 Ga0207658_10011395
1281 Ga0207658_10175043
1282 Ga0207658_10223476
1283 Ga0207658_10761124
1284 Ga0207658_11105414
1285 Ga0207677_10000892
1286 Ga0207677_10452149
1287 Ga0207677_10714956
1288 Ga0207703_10001264
1289 Ga0207703_10001293
1290 Ga0207703_10013390
1291 Ga0207703_10201567
1292 Ga0207703_10651749
1293 Ga0207639_10023592
1294 Ga0207639_10081221
1295 Ga0207639_10112208
1296 Ga0207639_10241635
1297 Ga0207639_10280681
1298 Ga0207639_11010134
1299 Ga0207639_11614496
1300 Ga0207639_11809610
1301 Ga0207678_10000961
1302 Ga0207678_10008244
1303 Ga0207678_10020592
1304 Ga0207678_10021227
1305 Ga0207678_10055827
1306 Ga0207678_10075802
1307 Ga0207678_10215094
1308 Ga0207702_10030684
1309 Ga0207702_10032934
1310 Ga0207702_10082849
1311 Ga0207702_10193758
1312 Ga0207702_10276316
1313 Ga0207702_10367567
1314 Ga0207702_11487939
1315 Ga0207641_10000908
1316 Ga0207641_10003662
1317 Ga0207641_10036657
1318 Ga0207641_10101765
1319 Ga0207648_10003806
1320 Ga0207676_10007262
1321 Ga0207676_10010426
1322 Ga0207676_10010543
1323 Ga0207676_10060996
1324 Ga0207676_10158633
1325 Ga0207676_10857064
1326 Ga0207676_10880763
1327 Ga0207674_10000780
1328 Ga0207674_10004321
1329 Ga0207674_10039779
1330 Ga0207674_10042454
1331 Ga0207674_10249825
1332 Ga0207674_10452201
1333 Ga0207674_10622296
1334 Ga0207675_100331504
1335 Ga0207683_10001537
1336 Ga0207683_10014454
1337 Ga0207683_10148858
1338 Ga0207683_10665307
1339 Ga0207698_10007496
1340 Ga0207698_10017222
1341 Ga0207698_10042305
1342 Ga0207698_10462480
1343 Ga0207698_10481502
1344 Ga0207698_10539065
1345 Ga0207698_10911941
1346 Ga0207698_11415838
1347 Ga0268266_10039745
1348 Ga0268266_10096994
1349 Ga0268265_10929813
1350 Ga0268264_10004230
1351 Ga0268264_10325014
1352 Ga0307408_100004305
1353 Ga0307405_10040352
1354 Ga0307413_10037041
1355 Ga0307413_10208620
1356 Ga0307413_11058900
1357 Ga0307410_10019043
1358 Ga0307410_10109176
1359 Ga0307410_10113190
1360 Ga0307406_10052245
1361 Ga0307406_10300578
1362 Ga0307412_10152277
1363 Ga0307409_100070747
1364 Ga0307409_101081704
1365 Ga0307416_100006649
1366 Ga0307416_100234010
1367 Ga0307416_100318634
1368 Ga0307414_10080732
1369 Ga0307411_10029095
1370 Ga0307411_10051864
1371 Ga0307415_101025390
1372 Ga0373948_0122594
1373 Ga0373931_0117506
1374 Ga0395899_0000224
1375 Ga0395899_0001948
1376 Ga0395899_0008499
1377 Ga0395899_0023576
1378 Ga0395899_0048675
1379 Ga0395899_0140707
1380 Ga0395899_0374409
1381 Ga0395899_0606173
1382 Ga0395900_0000294
1383 Ga0395900_0014145
1384 Ga0395900_0044847
1385 Ga0395900_0047138
1386 Ga0395900_0055849
1387 Ga0395900_0147016
1388 Ga0395900_0180379
1389 Ga0395900_0229706
1390 Ga0395900_0420248
1391 Ga0395900_0742187
1392 Ga0395898_0000192
1393 Ga0395898_0001747
1394 Ga0395898_0002761
1395 Ga0395898_0022572
1396 Ga0395898_0099379
1397 Ga0395898_0101703
1398 Ga0395898_0269475
1399 Ga0395898_0526499
1400 Ga0395898_1339588
1401 Ga0395905_0000066
1402 Ga0395905_0000358
1403 Ga0395905_0001563
1404 Ga0395905_0036230
1405 Ga0395905_0036399
1406 Ga0395905_0059301
1407 Ga0395905_0073168
1408 Ga0395905_0078062
1409 Ga0395905_0087321
1410 Ga0395905_0097825
1411 Ga0395905_0336196
1412 Ga0395905_0416348
1413 Ga0395905_0522401
1414 Ga0395905_0525672
1415 Ga0395905_0683240
1416 Ga0395905_0930469
1417 Ga0395901_0001222
1418 Ga0395901_0007044
1419 Ga0395901_0010259
1420 Ga0395901_0143388
1421 Ga0395901_0317569
1422 Ga0395901_0329907
1423 Ga0395901_0359785
1424 Ga0395901_0672597
1425 Ga0395901_1219039
1426 Ga0436365_1068382
1427 Ga0439432_068766
1428 Ga0439449_0153923
1429 Ga0439458_0000074
1430 Ga0466966_0034110
1431 Ga0466961_0045902
1432 Ga0466963_0011975
1433 Ga0466963_0159129
1434 Ga0466971_0249208
1435 Ga0466970_0043821
1436 Ga0466957_0105456
1437 Ga0466960_0906744
1438 Ga0466958_0013696
1439 Ga0466958_0697542
1440 Ga0466967_0067318
1441 Ga0466967_0075733
1442 Ga0466967_0428219
1443 Ga0495669_0004679
1444 Ga0495669_0065443
1445 Ga0495670_0013847
1446 Ga0495677_0008645
1447 Ga0495677_0045855
1448 Ga0495685_153269
1449 Ga0496100_0034330
1450 Ga0496100_0112074
1451 Ga0496101_0003714
1452 Ga0496101_0134646
1453 Ga0496101_0341470
1454 Ga0496101_0554546
1455 Ga0496102_0130204
1456 Ga0496102_0268933
1457 Ga0496102_0326808
1458 Ga0496103_0044151
1459 Ga0496103_0081370
1460 Ga0496103_0099635
1461 Ga0496106_0100085
1462 Ga0496106_0100153
1463 Ga0496106_0185425
1464 Ga0496106_0207028
1465 Ga0496107_0029196
1466 Ga0496107_0032936
1467 Ga0496107_0104659
1468 Ga0496107_0113933
1469 Ga0496108_0003009
1470 Ga0496108_0008946
1471 Ga0496109_0004627
1472 Ga0496109_0032528
1473 Ga0496109_0136450
1474 Ga0496110_0011986
1475 Ga0496110_0030052
1476 Ga0496110_0045176
1477 Ga0496111_0063761
1478 Ga0496111_0825656
1479 Ga0496112_0010453
1480 Ga0496112_0028727
1481 Ga0496112_0058587
1482 Ga0496112_0075833
1483 Ga0496112_0737879
1484 Ga0496113_0009324
1485 Ga0496113_0104363
1486 Ga0496114_0017037
1487 Ga0496114_0502376
1488 Ga0496115_0067906
1489 Ga0501067_0114075
1490 Ga0501069_0296277
1491 Ga0501239_003742
1492 Ga0501242_051841
1493 Ga0501262_011154
1494 Ga0501270_013498
1495 Ga0501273_001868
1496 Ga0501204_005999
1497 Ga0587106_019292
1498 Ga0466962_0079482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kpa-assembly3.cif.gz_C ubiquitin fold modifier conjugating enzyme from leishmania major (probable) 0.637 110 149
3zuo-assembly2.cif.gz_B omci in complex with leukotriene b4 0.6044 102 153
6wp0-assembly4.cif.gz_F the crystal structure of domain-swapped trimer q108k:t51d variant of hcrbpii 0.6036 102 158
5hcd-assembly1.cif.gz_C ternary complex of human complement c5 with ornithodoros moubata omci and rhipicephalus microplus raci2 0.602 102 153
1ei5-assembly1.cif.gz_A crystal structure of a d-aminopeptidase from ochrobactrum anthropi 0.6004 44 158
ID Description Score Start End Superfamily
af_B5DER2_2_107_2.60.40.4240 Mainly Beta;Sandwich;Immunoglobulin-like;Transcription activator, Churchill 0.6759 109 157 2.60.40.4240
1ei5A02 Mainly Beta;Beta Barrel;Lipocalin; 0.6397 64 158 2.40.128.50
af_A0A3B1DQT0_54_174_3.40.50.2060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Sec1/Munc18 (SM) protein, domain 1 0.6304 117 158 3.40.50.2060
af_Q54LJ3_8_162_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.6129 110 147 3.10.110.10
af_Q9U392_53_135_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.6123 110 153 3.10.110.10
ID Description Score Start End GO Terms
AF-A0A7H0G7S0-F1-model_v4 deleted 0.9607 64 160
AF-A0A7H0G7S0-F1-model_v4 deleted 0.9418 64 160
AF-A0A2G8R8C7-F1-model_v4 DUF4440 domain-containing protein 0.9239 63 160
AF-A0A2E2SEC1-F1-model_v4 deleted 0.9215 68 160
AF-A0A357RS01-F1-model_v4 deleted 0.9205 64 160

Map