F478934

General Info

Members Datasets Scaffolds Average Seq Length
747 425 1494 133

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_218115_c1|nmdc:mga03n38_218115_c1_82_534
Length 150
Sequence MNELIGSTGGDCEPMLVRDAMSTVVLTIGPAHTLRQAAALMSARRVGAAVVLDPDGTGTGILTERDILNSVGLGQSPDTEYAHAHTTTDVVFATPTWTLEEAAQAMAHGGFRHLIVLDHGEPTGIVSVRDIIRCWAPAPRRVPATTGSPH

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
141 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
142 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
156 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
157 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
158 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
159 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
160 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
161 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
162 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
279 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
280 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
309 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
310 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
311 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
312 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
321 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
322 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
326 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
350 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
351 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
352 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
353 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
354 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
355 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
356 2643221548 Streptomyces sp. Root55 Isolate Unclassified
357 2643221578 Streptomyces sp. Root63 Isolate Unclassified
358 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
359 2643221647 Streptomyces sp. Root369 Isolate Unclassified
360 2643221670 Streptomyces sp. Root431 Isolate Unclassified
361 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
362 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
363 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
364 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
365 2643221714 Streptomyces sp. Root264 Isolate Unclassified
366 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
367 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
368 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
369 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
370 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
371 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
372 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
373 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
374 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
375 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
376 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
377 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
378 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
379 2862574272 Streptomyces sp. AcE210 Isolate Nodule
380 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
381 2867369537 Streptomyces sp. Z26 Isolate Unclassified
382 2867428634 Streptomyces sp. RP5T Isolate Unclassified
383 2867475112 Streptomyces sp. TM32 Isolate Unclassified
384 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
385 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
386 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
387 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
388 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
389 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
390 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
391 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
392 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
393 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
394 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
395 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
396 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
397 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
398 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
399 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
400 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
401 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
402 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
403 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
404 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
405 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
406 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
407 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
408 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
409 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
410 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
411 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
412 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
413 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
414 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
415 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
416 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
417 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
418 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
419 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
420 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
421 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
422 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
423 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
424 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
425 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.27
Metatranscriptomes 6.43
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0.67
Rhizoplane 2.54
Rhizosphere 80.32
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_218115_c1 3300050490 Bacteria 994
2 JGI24737J22298_10021826 3300001990 Bacteria 2036
3 rootH1_10019195 3300003316 Bacteria 3884
4 rootH1_10080830 3300003316 Bacteria 1532
5 rootH2_10040067 3300003320 Bacteria 8912
6 rootH2_10217107 3300003320 Bacteria 1021
7 rootH1_10017685 3300003323 Bacteria 1843
8 rootH1_10091162 3300003323 Bacteria 1685
9 rootH1_10178559 3300003323 Bacteria 1842
10 JGI25160J50197_1033513 3300003354 Bacteria 1290
11 JGI25160J50197_1035808 3300003354 Bacteria 1213
12 JGI25160J50197_1036056 3300003354 Bacteria 1205
13 Ga0006562J51391_1044019 3300003578 Bacteria 810
14 Ga0006562J51391_1130510 3300003578 Bacteria 1670
15 Ga0006562J51391_1130511 3300003578 Bacteria 1656
16 Ga0058863_11226352 3300004799 Bacteria 600
17 Ga0058862_12670130 3300004803 Bacteria 519
18 Ga0070682_100046806 3300005337 Bacteria 2686
19 Ga0068868_100005573 3300005338 Bacteria 8854
20 Ga0070691_10076958 3300005341 Bacteria 1628
21 Ga0070659_101902934 3300005366 Bacteria 533
22 Ga0070709_10892199 3300005434 Bacteria 703
23 Ga0070714_100461616 3300005435 Bacteria 1207
24 Ga0070713_101037832 3300005436 Bacteria 791
25 Ga0070711_100036179 3300005439 Bacteria 3307
26 Ga0070705_100474532 3300005440 Bacteria 944
27 Ga0070708_100469459 3300005445 Bacteria 1187
28 Ga0070681_10091417 3300005458 Bacteria 2994
29 Ga0070685_10052437 3300005466 Bacteria 2360
30 Ga0070707_100062789 3300005468 Bacteria 3564
31 Ga0070684_100174499 3300005535 Bacteria 1953
32 Ga0068853_100093609 3300005539 Bacteria 2646
33 Ga0070686_100555896 3300005544 Bacteria 898
34 Ga0070686_101224166 3300005544 Bacteria 624
35 Ga0070665_100167946 3300005548 Bacteria 2196
36 Ga0070704_100171955 3300005549 Bacteria 1724
37 Ga0068855_100132732 3300005563 Bacteria 2843
38 Ga0068855_100213914 3300005563 Bacteria 2165
39 Ga0070664_100377792 3300005564 Bacteria 1293
40 Ga0068857_100522691 3300005577 Bacteria 1115
41 Ga0068854_100412849 3300005578 Bacteria 1120
42 Ga0068854_102144232 3300005578 Bacteria 516
43 Ga0068856_100057484 3300005614 Bacteria 3840
44 Ga0068856_100126077 3300005614 Bacteria 2563
45 Ga0068856_100484683 3300005614 Bacteria 1258
46 Ga0068864_100058542 3300005618 Bacteria 3331
47 Ga0068864_101707311 3300005618 Bacteria 634
48 Ga0068866_10079829 3300005718 Unclassified 1754
49 Ga0068863_101470662 3300005841 Bacteria 690
50 Ga0068858_100142698 3300005842 Bacteria 2249
51 Ga0068860_100156734 3300005843 Bacteria 2195
52 Ga0081455_10195754 3300005937 Bacteria 1518
53 Ga0075363_100560356 3300006048 Bacteria 682
54 Ga0070716_100073556 3300006173 Bacteria 2016
55 Ga0070712_100758843 3300006175 Bacteria 830
56 Ga0070712_100821183 3300006175 Bacteria 798
57 Ga0070712_100825366 3300006175 Bacteria 796
58 Ga0070712_101336267 3300006175 Bacteria 625
59 Ga0075367_10003746 3300006178 Bacteria 7319
60 Ga0075370_10076640 3300006353 Bacteria 1918
61 Ga0068871_102039528 3300006358 Bacteria 546
62 Ga0075428_101693119 3300006844 Bacteria 660
63 Ga0075433_10675322 3300006852 Bacteria 905
64 Ga0068865_101039796 3300006881 Bacteria 719
65 Ga0099826_10067827 3300006948 Bacteria 2281
66 Ga0075435_100070671 3300007076 Bacteria 2849
67 Ga0105251_10060354 3300009011 Bacteria 1785
68 Ga0105244_10122288 3300009036 Bacteria 1260
69 Ga0105250_10059204 3300009092 Bacteria 1538
70 Ga0105245_10098489 3300009098 Bacteria 2702
71 Ga0105245_10134622 3300009098 Bacteria 2321
72 Ga0105245_10142376 3300009098 Bacteria 2260
73 Ga0105243_10646484 3300009148 Bacteria 1024
74 Ga0105241_10615957 3300009174 Bacteria 982
75 Ga0105248_10365069 3300009177 Bacteria 1625
76 Ga0105237_10191741 3300009545 Bacteria 2044
77 Ga0105238_10118711 3300009551 Bacteria 2625
78 Ga0105238_10522624 3300009551 Bacteria 1189
79 Ga0105249_10650002 3300009553 Unclassified 1112
80 Ga0105239_10082718 3300010375 Bacteria 3535
81 Ga0105246_10249858 3300011119 Bacteria 1407
82 Ga0105246_10667927 3300011119 Unclassified 907
83 Ga0105246_11748045 3300011119 Bacteria 592
84 Ga0157370_10144068 3300013104 Bacteria 2219
85 Ga0157369_10087579 3300013105 Bacteria 3325
86 Ga0157369_10592981 3300013105 Bacteria 1144
87 Ga0157374_10070724 3300013296 Bacteria 3289
88 Ga0157378_10717988 3300013297 Bacteria 1020
89 Ga0163162_10031791 3300013306 Bacteria 5237
90 Ga0157372_10137947 3300013307 Bacteria 2809
91 Ga0157375_10085836 3300013308 Bacteria 3198
92 Ga0157375_10176735 3300013308 Bacteria 2285
93 Ga0163163_10006307 3300014325 Bacteria 10356
94 Ga0182008_10001423 3300014497 Bacteria 16047
95 Ga0157379_10028186 3300014968 Bacteria 4999
96 Ga0157376_10097190 3300014969 Bacteria 2565
97 Ga0182007_10002422 3300015262 Bacteria 9315
98 Ga0183367_1002 3300015688 Bacteria 1101531
99 Ga0197907_10381786 3300020069 Bacteria 530
100 Ga0206356_10995431 3300020070 Bacteria 771
101 Ga0206356_11206245 3300020070 Bacteria 932
102 Ga0206356_11219520 3300020070 Bacteria 1002
103 Ga0206355_1208892 3300020076 Bacteria 1013
104 Ga0206352_10401905 3300020078 Bacteria 934
105 Ga0206352_11348545 3300020078 Bacteria 596
106 Ga0206354_10196881 3300020081 Bacteria 606
107 Ga0206354_10216677 3300020081 Bacteria 557
108 Ga0224712_10531268 3300022467 Bacteria 570
109 Ga0209758_1013617 3300025297 Bacteria 4413
110 Ga0207426_1001513 3300025302 Bacteria 18969
111 Ga0207426_1003399 3300025302 Bacteria 8709
112 Ga0207426_1006696 3300025302 Bacteria 4946
113 Ga0207426_1025201 3300025302 Bacteria 2006
114 Ga0207426_1100418 3300025302 Bacteria 748
115 Ga0207647_10005240 3300025904 Bacteria 9543
116 Ga0207685_10234473 3300025905 Bacteria 880
117 Ga0207654_10578735 3300025911 Bacteria 800
118 Ga0207707_11159889 3300025912 Bacteria 627
119 Ga0207671_10281426 3300025914 Bacteria 1312
120 Ga0207693_10918745 3300025915 Bacteria 671
121 Ga0207663_10637261 3300025916 Bacteria 840
122 Ga0207663_11216645 3300025916 Bacteria 606
123 Ga0207652_11647249 3300025921 Bacteria 546
124 Ga0207646_10580955 3300025922 Bacteria 1006
125 Ga0207694_10104344 3300025924 Bacteria 2249
126 Ga0207687_10059664 3300025927 Bacteria 2688
127 Ga0207687_10060309 3300025927 Bacteria 2675
128 Ga0207664_10608710 3300025929 Bacteria 981
129 Ga0207709_10168473 3300025935 Bacteria 1535
130 Ga0207665_10036601 3300025939 Bacteria 3265
131 Ga0207711_10296652 3300025941 Bacteria 1490
132 Ga0207661_11886983 3300025944 Bacteria 543
133 Ga0207667_10408358 3300025949 Bacteria 1382
134 Ga0207667_10499254 3300025949 Bacteria 1234
135 Ga0207640_10069392 3300025981 Bacteria 2366
136 Ga0207677_10006535 3300026023 Bacteria 6402
137 Ga0207702_10116605 3300026078 Bacteria 2383
138 Ga0207702_11461414 3300026078 Bacteria 677
139 Ga0207702_12164519 3300026078 Bacteria 545
140 Ga0207676_10026782 3300026095 Bacteria 4289
141 Ga0209371_1021986 3300027312 Bacteria 1534
142 Ga0209282_1100910 3300027666 Bacteria 1486
143 Ga0268266_10439512 3300028379 Bacteria 1239
144 Ga0268264_10817089 3300028381 Bacteria 932
145 Ga0307517_10004597 3300028786 Bacteria 21141
146 Ga0307515_10000699 3300028794 Bacteria 77489
147 Ga0307515_10088843 3300028794 Bacteria 3899
148 Ga0307515_10672081 3300028794 Bacteria 649
149 Ga0268256_1018141 3300030500 Bacteria 1963
150 Ga0307511_10000438 3300030521 Bacteria 44529
151 Ga0307511_10064014 3300030521 Bacteria 2770
152 Ga0307512_10004518 3300030522 Bacteria 15212
153 Ga0307512_10099826 3300030522 Bacteria 1973
154 Ga0307513_10009135 3300031456 Bacteria 12558
155 Ga0307513_10174813 3300031456 Bacteria 2019
156 Ga0307513_10974988 3300031456 Bacteria 557
157 Ga0307509_10039154 3300031507 Bacteria 5166
158 Ga0307508_10006837 3300031616 Bacteria 10669
159 Ga0307508_10006908 3300031616 Bacteria 10607
160 Ga0307508_10007827 3300031616 Bacteria 9923
161 Ga0307508_10050424 3300031616 Bacteria 3705
162 Ga0307508_10190740 3300031616 Bacteria 1651
163 Ga0307514_10049324 3300031649 Bacteria 3274
164 Ga0307514_10050574 3300031649 Bacteria 3224
165 Ga0307514_10059521 3300031649 Bacteria 2918
166 Ga0307514_10126484 3300031649 Bacteria 1770
167 Ga0307516_10002231 3300031730 Bacteria 26212
168 Ga0307516_10417422 3300031730 Bacteria 1000
169 Ga0307516_10516121 3300031730 Bacteria 849
170 Ga0307516_10588871 3300031730 Bacteria 766
171 Ga0307518_10063769 3300031838 Bacteria 2674
172 Ga0307518_10336111 3300031838 Bacteria 890
173 Ga0307518_10621871 3300031838 Bacteria 508
174 Ga0307416_100849287 3300032002 Bacteria 1011
175 Ga0307416_101486896 3300032002 Bacteria 783
176 Ga0307416_103424366 3300032002 Bacteria 531
177 Ga0307507_10045296 3300033179 Bacteria 4330
178 Ga0307507_10079103 3300033179 Bacteria 2909
179 Ga0307507_10115847 3300033179 Bacteria 2166
180 Ga0307507_10539758 3300033179 Bacteria 618
181 Ga0307510_10011458 3300033180 Bacteria 10534
182 Ga0307510_10023835 3300033180 Bacteria 7085
183 Ga0307510_10240025 3300033180 Bacteria 1307
184 Ga0373934_0294083 3300035086 Bacteria 673
185 Ga0373945_0098141 3300035116 Bacteria 1143
186 Ga0373945_0166859 3300035116 Bacteria 900
187 Ga0373954_0056855 3300035118 Bacteria 1842
188 Ga0373956_0192362 3300035119 Bacteria 966
189 Ga0373943_0164675 3300035170 Bacteria 1209
190 Ga0373946_0433400 3300035171 Bacteria 667
191 Ga0373931_0769697 3300035691 Bacteria 640
192 Ga0373937_0039588 3300036401 Bacteria 4295
193 Ga0373925_0443148 3300037068 Bacteria 1063
194 Ga0395900_0193003 3300037418 Bacteria 2065
195 Ga0395898_0003092 3300037466 Bacteria 18832
196 Ga0395898_0030289 3300037466 Bacteria 5416
197 Ga0395901_0074271 3300038443 Bacteria 3547
198 Ga0395901_0244404 3300038443 Bacteria 1871
199 Ga0439436_0002729 3300041404 Bacteria 5333
200 Ga0439436_0003166 3300041404 Bacteria 4989
201 Ga0439439_0007385 3300041406 Bacteria 2569
202 Ga0451789_0944422 3300041443 Bacteria 723
203 Ga0451800_1114010 3300041459 Bacteria 1389
204 Ga0451807_1614476 3300041486 Bacteria 895
205 Ga0451807_1804336 3300041486 Bacteria 708
206 Ga0451837_0010181 3300041494 Bacteria 2844
207 Ga0451841_1407059 3300041498 Bacteria 605
208 Ga0451845_0506071 3300041501 Bacteria 751
209 Ga0451847_0278125 3300041503 Bacteria 547
210 Ga0451843_1617188 3300041509 Bacteria 663
211 Ga0451853_0301595 3300041512 Bacteria 2221
212 Ga0451853_0393940 3300041512 Bacteria 1824
213 Ga0451853_1059851 3300041512 Bacteria 1060
214 Ga0451853_2009427 3300041512 Bacteria 2464
215 Ga0439431_0066081 3300041997 Bacteria 958
216 Ga0439433_0012142 3300041999 Bacteria 1887
217 Ga0439442_001532 3300042002 Bacteria 4535
218 Ga0439442_003644 3300042002 Bacteria 3051
219 Ga0439448_0004898 3300042005 Bacteria 3799
220 Ga0439449_0000358 3300042007 Bacteria 16753
221 Ga0439449_0041114 3300042007 Bacteria 1718
222 Ga0439449_0089795 3300042007 Bacteria 1134
223 Ga0439449_0122340 3300042007 Bacteria 966
224 Ga0439450_155205 3300042008 Bacteria 601
225 Ga0439454_016112 3300042011 Bacteria 1053
226 Ga0439457_002398 3300042014 Bacteria 5357
227 Ga0439457_004233 3300042014 Bacteria 3778
228 Ga0439457_061953 3300042014 Bacteria 848
229 Ga0439462_0010822 3300042015 Bacteria 2315
230 Ga0439463_142957 3300042016 Bacteria 620
231 Ga0450897_009761 3300042128 Bacteria 913
232 Ga0450894_000136 3300042131 Bacteria 12932
233 Ga0450898_000424 3300042134 Bacteria 4906
234 Ga0450899_018844 3300042135 Bacteria 799
235 Ga0450900_004670 3300042136 Bacteria 1585
236 Ga0450902_008532 3300042137 Bacteria 1602
237 Ga0450903_000233 3300042138 Bacteria 12380
238 Ga0450906_018467 3300042145 Bacteria 1251
239 Ga0439458_0018008 3300042157 Bacteria 1615
240 Ga0439458_0020162 3300042157 Bacteria 1539
241 Ga0450908_010768 3300042184 Bacteria 1683
242 Ga0466969_0083017 3300044656 Bacteria 1526
243 Ga0466969_0135318 3300044656 Bacteria 1141
244 Ga0466972_0004540 3300044658 Bacteria 6952
245 Ga0466972_0056941 3300044658 Bacteria 1878
246 Ga0466972_0067178 3300044658 Bacteria 1713
247 Ga0466972_0172952 3300044658 Bacteria 1013
248 Ga0466965_0031059 3300044683 Bacteria 2603
249 Ga0466965_0297837 3300044683 Bacteria 874
250 Ga0466965_0361990 3300044683 Bacteria 796
251 Ga0466965_0912746 3300044683 Bacteria 513
252 Ga0466966_0191081 3300044684 Bacteria 1240
253 Ga0466961_0017066 3300044693 Bacteria 4662
254 Ga0466961_0080676 3300044693 Bacteria 2059
255 Ga0466961_0190965 3300044693 Bacteria 1269
256 Ga0466961_0724040 3300044693 Bacteria 595
257 Ga0466963_0000213 3300044694 Bacteria 24764
258 Ga0466963_0031993 3300044694 Bacteria 3403
259 Ga0466963_0072827 3300044694 Bacteria 2315
260 Ga0466963_0168700 3300044694 Bacteria 1525
261 Ga0466963_0686842 3300044694 Bacteria 722
262 Ga0466964_0102966 3300044706 Bacteria 1261
263 Ga0466964_0518622 3300044706 Bacteria 642
264 Ga0466971_0000575 3300044719 Bacteria 14492
265 Ga0466971_0038665 3300044719 Bacteria 2141
266 Ga0466971_0647823 3300044719 Bacteria 529
267 Ga0466968_0169956 3300044735 Bacteria 1010
268 Ga0466970_0001274 3300044765 Bacteria 12183
269 Ga0466970_0006583 3300044765 Bacteria 5810
270 Ga0466970_0680531 3300044765 Bacteria 599
271 Ga0466957_0023199 3300044842 Bacteria 3666
272 Ga0466957_0205515 3300044842 Bacteria 1295
273 Ga0466957_0221160 3300044842 Bacteria 1250
274 Ga0466957_0996579 3300044842 Bacteria 602
275 Ga0466957_1003719 3300044842 Bacteria 599
276 Ga0466960_0121087 3300044901 Bacteria 1370
277 Ga0466960_0151254 3300044901 Bacteria 1240
278 Ga0466960_0507779 3300044901 Bacteria 707
279 Ga0466959_0003363 3300045049 Bacteria 10451
280 Ga0466959_0922397 3300045049 Unclassified 582
281 Ga0466958_0095111 3300045836 Bacteria 1846
282 Ga0466958_0132417 3300045836 Bacteria 1566
283 Ga0466967_0052759 3300045976 Bacteria 3571
284 Ga0466967_0108297 3300045976 Bacteria 2549
285 Ga0466967_0143729 3300045976 Bacteria 2224
286 Ga0466967_0174885 3300045976 Bacteria 2022
287 Ga0466967_0192631 3300045976 Bacteria 1927
288 Ga0466967_0212446 3300045976 Bacteria 1835
289 Ga0466967_0307766 3300045976 Bacteria 1525
290 Ga0466967_0440992 3300045976 Bacteria 1271
291 Ga0466967_0524071 3300045976 Bacteria 1165
292 Ga0466967_2195384 3300045976 Bacteria 548
293 Ga0466967_2224499 3300045976 Bacteria 544
294 Ga0495592_0000574 3300046454 Bacteria 26037
295 Ga0495592_0047991 3300046454 Bacteria 3178
296 Ga0495603_0004257 3300046455 Bacteria 8525
297 Ga0495603_0274076 3300046455 Bacteria 970
298 Ga0495603_0442957 3300046455 Bacteria 744
299 Ga0495603_0757155 3300046455 Bacteria 555
300 Ga0495590_0038675 3300046457 Bacteria 1664
301 Ga0495629_0002819 3300046459 Bacteria 13265
302 Ga0495629_0013612 3300046459 Bacteria 5869
303 Ga0495629_0023271 3300046459 Bacteria 4415
304 Ga0495629_0089361 3300046459 Bacteria 2149
305 Ga0495629_0107957 3300046459 Bacteria 1941
306 Ga0495629_0110270 3300046459 Bacteria 1918
307 Ga0495629_0146572 3300046459 Bacteria 1641
308 Ga0495629_0444279 3300046459 Bacteria 878
309 Ga0495638_0112665 3300046460 Bacteria 1614
310 Ga0495638_0269807 3300046460 Bacteria 929
311 Ga0495641_0173672 3300046461 Bacteria 964
312 Ga0495651_0017031 3300046462 Bacteria 5630
313 Ga0495651_0079211 3300046462 Bacteria 2483
314 Ga0495651_0102999 3300046462 Bacteria 2121
315 Ga0495651_0177354 3300046462 Bacteria 1511
316 Ga0495653_0090901 3300046463 Bacteria 2232
317 Ga0495653_0377002 3300046463 Bacteria 907
318 Ga0495653_0641302 3300046463 Bacteria 649
319 Ga0495580_0253921 3300046472 Bacteria 1203
320 Ga0495582_0100885 3300046473 Bacteria 1616
321 Ga0495605_0005349 3300046474 Bacteria 7481
322 Ga0495639_0075647 3300046475 Bacteria 1561
323 Ga0495662_0013250 3300046476 Bacteria 4013
324 Ga0495662_0018848 3300046476 Bacteria 3339
325 Ga0495662_0039237 3300046476 Bacteria 2287
326 Ga0495662_0101601 3300046476 Bacteria 1406
327 Ga0495662_0181113 3300046476 Bacteria 1038
328 Ga0495662_0559855 3300046476 Bacteria 560
329 Ga0495664_0007790 3300046477 Bacteria 5961
330 Ga0495664_0031093 3300046477 Bacteria 3128
331 Ga0495664_0037883 3300046477 Bacteria 2847
332 Ga0495664_0063719 3300046477 Bacteria 2197
333 Ga0495664_0085909 3300046477 Bacteria 1889
334 Ga0495664_0713314 3300046477 Bacteria 592
335 Ga0495584_0282451 3300046491 Bacteria 843
336 Ga0495584_0567137 3300046491 Bacteria 579
337 Ga0495585_0007795 3300046492 Bacteria 6523
338 Ga0495585_0058979 3300046492 Bacteria 2116
339 Ga0495594_0001816 3300046499 Bacteria 11101
340 Ga0495594_0081634 3300046499 Bacteria 1805
341 Ga0495594_0116525 3300046499 Bacteria 1508
342 Ga0495594_0157211 3300046499 Bacteria 1291
343 Ga0495594_0486532 3300046499 Bacteria 701
344 Ga0495596_0125752 3300046500 Bacteria 995
345 Ga0495596_0234521 3300046500 Bacteria 712
346 Ga0495607_0081677 3300046501 Bacteria 1775
347 Ga0495607_0096676 3300046501 Bacteria 1589
348 Ga0495583_0042610 3300046506 Bacteria 2118
349 Ga0495606_0013622 3300046507 Bacteria 6411
350 Ga0495608_0344690 3300046511 Bacteria 917
351 Ga0495608_0838235 3300046511 Bacteria 541
352 Ga0495610_0121162 3300046512 Bacteria 1146
353 Ga0495610_0146435 3300046512 Bacteria 1012
354 Ga0495610_0215045 3300046512 Bacteria 779
355 Ga0495616_0037258 3300046513 Bacteria 2503
356 Ga0495618_0062044 3300046514 Bacteria 2371
357 Ga0495618_0319690 3300046514 Bacteria 961
358 Ga0495620_0034741 3300046515 Bacteria 2274
359 Ga0495620_0088812 3300046515 Bacteria 1241
360 Ga0495620_0277766 3300046515 Bacteria 637
361 Ga0495628_0046823 3300046516 Bacteria 3433
362 Ga0495628_0080884 3300046516 Bacteria 2524
363 Ga0495628_0149536 3300046516 Bacteria 1779
364 Ga0495628_0178311 3300046516 Bacteria 1608
365 Ga0495628_0443471 3300046516 Bacteria 943
366 Ga0495630_0033011 3300046517 Bacteria 3860
367 Ga0495630_0162453 3300046517 Bacteria 1700
368 Ga0495630_0473812 3300046517 Bacteria 960
369 Ga0495630_0568209 3300046517 Bacteria 870
370 Ga0495631_0028031 3300046518 Bacteria 2571
371 Ga0495631_0069413 3300046518 Bacteria 1524
372 Ga0495637_0064870 3300046520 Bacteria 1488
373 Ga0495643_0005567 3300046522 Bacteria 8478
374 Ga0495644_0297976 3300046523 Bacteria 631
375 Ga0495648_0050550 3300046524 Bacteria 2538
376 Ga0495648_0193895 3300046524 Bacteria 1023
377 Ga0495648_0389007 3300046524 Bacteria 626
378 Ga0495666_0014863 3300046526 Bacteria 3873
379 Ga0495666_0123221 3300046526 Bacteria 1213
380 Ga0495642_0015555 3300046528 Bacteria 2959
381 Ga0495652_0028911 3300046529 Bacteria 4872
382 Ga0495652_0030071 3300046529 Bacteria 4766
383 Ga0495652_0139100 3300046529 Bacteria 1911
384 Ga0495652_0182024 3300046529 Bacteria 1611
385 Ga0495654_0026495 3300046530 Bacteria 2979
386 Ga0495665_0137705 3300046531 Bacteria 1276
387 Ga0495640_0010846 3300046533 Bacteria 7030
388 Ga0495640_0021884 3300046533 Bacteria 4683
389 Ga0495640_0035770 3300046533 Bacteria 3513
390 Ga0495640_0144317 3300046533 Bacteria 1532
391 Ga0495586_0092894 3300046535 Bacteria 1668
392 Ga0495586_0289667 3300046535 Bacteria 937
393 Ga0495587_0001011 3300046536 Bacteria 18494
394 Ga0495587_0003221 3300046536 Bacteria 10913
395 Ga0495587_0278099 3300046536 Bacteria 938
396 Ga0495609_0073982 3300046538 Bacteria 1494
397 Ga0495597_0023855 3300046542 Bacteria 2828
398 Ga0495645_0032240 3300046543 Bacteria 3821
399 Ga0495645_0049580 3300046543 Bacteria 3057
400 Ga0495645_0482447 3300046543 Bacteria 777
401 Ga0495622_0019957 3300046557 Bacteria 3119
402 Ga0495622_0027908 3300046557 Bacteria 2634
403 Ga0495622_0101327 3300046557 Bacteria 1320
404 Ga0495622_0192528 3300046557 Bacteria 911
405 Ga0495633_0037682 3300046558 Bacteria 2312
406 Ga0495633_0200017 3300046558 Bacteria 917
407 Ga0495667_0030504 3300046559 Bacteria 3622
408 Ga0495667_0195928 3300046559 Bacteria 1294
409 Ga0495667_0296114 3300046559 Bacteria 1025
410 Ga0495667_0320136 3300046559 Bacteria 981
411 Ga0495667_0988724 3300046559 Bacteria 513
412 Ga0495668_0017827 3300046616 Bacteria 4113
413 Ga0495668_0076764 3300046616 Bacteria 1834
414 Ga0495668_0099213 3300046616 Bacteria 1593
415 Ga0495634_0005531 3300046642 Bacteria 9699
416 Ga0495634_0017386 3300046642 Bacteria 5132
417 Ga0495634_0274406 3300046642 Bacteria 1025
418 Ga0495634_0586886 3300046642 Bacteria 647
419 Ga0495611_0145263 3300046648 Bacteria 1107
420 Ga0495611_0145976 3300046648 Bacteria 1104
421 Ga0495611_0207546 3300046648 Bacteria 913
422 Ga0495625_0164477 3300046660 Bacteria 1484
423 Ga0495625_0295332 3300046660 Bacteria 1038
424 Ga0495635_0098181 3300046663 Bacteria 2002
425 Ga0495635_0165153 3300046663 Bacteria 1506
426 Ga0495635_0201024 3300046663 Bacteria 1351
427 Ga0495635_0921331 3300046663 Bacteria 559
428 Ga0495661_0036094 3300046665 Bacteria 3097
429 Ga0495661_0262342 3300046665 Bacteria 877
430 Ga0495661_0439445 3300046665 Bacteria 629
431 Ga0495588_0001268 3300046674 Bacteria 10834
432 Ga0495588_0012467 3300046674 Bacteria 4019
433 Ga0495588_0263876 3300046674 Bacteria 907
434 Ga0495657_0001214 3300046675 Bacteria 22612
435 Ga0495657_0020442 3300046675 Bacteria 4757
436 Ga0495657_0030679 3300046675 Bacteria 3762
437 Ga0495657_0033179 3300046675 Bacteria 3596
438 Ga0495599_0005311 3300046678 Bacteria 7685
439 Ga0495599_0090794 3300046678 Bacteria 1906
440 Ga0495599_0194168 3300046678 Bacteria 1248
441 Ga0495646_0014451 3300046680 Bacteria 5020
442 Ga0495646_0283485 3300046680 Bacteria 880
443 Ga0495658_0116688 3300046683 Bacteria 1610
444 Ga0495658_0144361 3300046683 Bacteria 1457
445 Ga0495613_0003059 3300046689 Bacteria 12502
446 Ga0495613_0010395 3300046689 Bacteria 6912
447 Ga0495613_0012117 3300046689 Bacteria 6408
448 Ga0495613_0109870 3300046689 Bacteria 1987
449 Ga0495613_0135378 3300046689 Bacteria 1763
450 Ga0495613_0179258 3300046689 Bacteria 1501
451 Ga0495613_0229586 3300046689 Bacteria 1300
452 Ga0495613_0530936 3300046689 Bacteria 789
453 Ga0495613_0680743 3300046689 Bacteria 678
454 Ga0495624_0014389 3300046690 Bacteria 5370
455 Ga0495624_0110705 3300046690 Bacteria 1689
456 Ga0495624_0271689 3300046690 Bacteria 1024
457 Ga0495624_0480763 3300046690 Bacteria 743
458 Ga0495624_0559763 3300046690 Bacteria 682
459 Ga0495670_0379824 3300046691 Bacteria 762
460 Ga0495670_0508837 3300046691 Bacteria 654
461 Ga0495671_0022519 3300046692 Bacteria 3300
462 Ga0495671_0153702 3300046692 Bacteria 1120
463 Ga0495671_0173739 3300046692 Bacteria 1047
464 Ga0495649_0080389 3300046694 Bacteria 1743
465 Ga0495649_0154922 3300046694 Bacteria 1203
466 Ga0495649_0167813 3300046694 Bacteria 1149
467 Ga0495589_0014905 3300046794 Bacteria 4000
468 Ga0495589_0276114 3300046794 Bacteria 782
469 Ga0495600_0007018 3300046809 Bacteria 6879
470 Ga0495600_0019938 3300046809 Bacteria 4286
471 Ga0495600_0051201 3300046809 Bacteria 2695
472 Ga0495600_0383097 3300046809 Bacteria 877
473 Ga0495581_0005237 3300047315 Bacteria 7500
474 Ga0495581_0065540 3300047315 Bacteria 2100
475 Ga0495581_0248433 3300047315 Bacteria 1040
476 Ga0495581_0503292 3300047315 Bacteria 704
477 Ga0495604_0022719 3300047317 Bacteria 5008
478 Ga0495604_0056268 3300047317 Bacteria 3028
479 Ga0495604_0113627 3300047317 Bacteria 1970
480 Ga0495604_0129049 3300047317 Bacteria 1819
481 Ga0495604_0603621 3300047317 Bacteria 703
482 Ga0495636_0027201 3300047318 Bacteria 2330
483 Ga0495636_0036339 3300047318 Bacteria 2031
484 Ga0495636_0045783 3300047318 Bacteria 1824
485 Ga0495636_0049775 3300047318 Bacteria 1753
486 Ga0495674_0194508 3300047319 Bacteria 1684
487 Ga0495674_0213282 3300047319 Bacteria 1598
488 Ga0495674_0616145 3300047319 Bacteria 859
489 Ga0495674_1043863 3300047319 Bacteria 624
490 Ga0495672_0083211 3300047320 Bacteria 1778
491 Ga0495676_0002047 3300047321 Bacteria 17746
492 Ga0495676_0005451 3300047321 Bacteria 11667
493 Ga0495676_0012902 3300047321 Bacteria 7516
494 Ga0495676_0030974 3300047321 Bacteria 4530
495 Ga0495676_0073343 3300047321 Bacteria 2624
496 Ga0495676_0146274 3300047321 Bacteria 1687
497 Ga0495676_0151528 3300047321 Bacteria 1649
498 Ga0495676_0201737 3300047321 Bacteria 1382
499 Ga0495676_0926524 3300047321 Bacteria 557
500 Ga0495676_1044284 3300047321 Bacteria 520
501 Ga0495680_0010669 3300047322 Bacteria 8192
502 Ga0495680_0093253 3300047322 Bacteria 2254
503 Ga0495680_0417508 3300047322 Bacteria 923
504 Ga0495683_0273178 3300047323 Bacteria 734
505 Ga0495687_006392 3300047443 Bacteria 7232
506 Ga0495687_020416 3300047443 Bacteria 3227
507 Ga0495687_171719 3300047443 Bacteria 717
508 Ga0495675_0014147 3300047444 Bacteria 5045
509 Ga0495675_0142712 3300047444 Bacteria 1483
510 Ga0495675_0160163 3300047444 Bacteria 1386
511 Ga0495675_0228593 3300047444 Bacteria 1123
512 Ga0495677_0026186 3300047445 Bacteria 2116
513 Ga0495685_005303 3300047447 Bacteria 4203
514 Ga0495685_006989 3300047447 Bacteria 3714
515 Ga0495685_018741 3300047447 Bacteria 2376
516 Ga0495685_162261 3300047447 Bacteria 723
517 Ga0495673_0198446 3300047469 Bacteria 752
518 Ga0495681_0000567 3300047470 Bacteria 28271
519 Ga0495681_0302764 3300047470 Bacteria 618
520 Ga0495684_0000710 3300047471 Bacteria 26766
521 Ga0495684_0095811 3300047471 Bacteria 2246
522 Ga0495686_0015791 3300047472 Bacteria 5140
523 Ga0495686_0028044 3300047472 Bacteria 3669
524 Ga0495686_0084897 3300047472 Bacteria 1929
525 Ga0495593_0000488 3300047673 Bacteria 22326
526 Ga0495593_0023676 3300047673 Bacteria 3410
527 Ga0495593_0027313 3300047673 Bacteria 3142
528 Ga0495593_0651560 3300047673 Bacteria 529
529 Ga0495602_0018574 3300048088 Bacteria 6936
530 Ga0495602_0077375 3300048088 Bacteria 2815
531 Ga0495614_0001937 3300048089 Bacteria 9093
532 Ga0495614_0006857 3300048089 Bacteria 5094
533 Ga0495614_0007664 3300048089 Bacteria 4799
534 Ga0495614_0041221 3300048089 Bacteria 1980
535 Ga0495614_0119543 3300048089 Bacteria 1161
536 Ga0495614_0222866 3300048089 Bacteria 857
537 Ga0495626_0024655 3300048091 Bacteria 2947
538 Ga0496104_0555074 3300048907 Bacteria 1059
539 Ga0496105_0038560 3300048908 Bacteria 3936
540 Ga0496105_0522338 3300048908 Bacteria 930
541 Ga0496106_0214524 3300048909 Bacteria 1534
542 Ga0496107_0883835 3300048910 Bacteria 652
543 Ga0496108_0009740 3300048911 Bacteria 7784
544 Ga0496108_1097077 3300048911 Bacteria 676
545 Ga0496110_0010424 3300048913 Bacteria 7557
546 Ga0496110_1044945 3300048913 Bacteria 725
547 Ga0496112_0043029 3300048915 Bacteria 4421
548 Ga0496112_0208625 3300048915 Bacteria 1911
549 Ga0496113_0010985 3300048916 Bacteria 6017
550 Ga0496113_0635352 3300048916 Bacteria 854
551 Ga0496114_0430438 3300048917 Bacteria 1169
552 Ga0496119_0503949 3300048922 Bacteria 563
553 Ga0501306_041572 3300049127 Bacteria 715
554 Ga0501306_069041 3300049127 Bacteria 594
555 Ga0501308_032020 3300049128 Bacteria 709
556 Ga0501308_060874 3300049128 Bacteria 570
557 Ga0501310_034095 3300049130 Bacteria 687
558 Ga0495678_019245 3300049459 Bacteria 3050
559 Ga0495682_0231453 3300049460 Bacteria 654
560 Ga0501313_048544 3300049529 Bacteria 583
561 Ga0501314_043024 3300049530 Bacteria 531
562 Ga0501031_0174821 3300049568 Bacteria 1403
563 Ga0501032_0041778 3300049569 Bacteria 3112
564 Ga0501032_0161676 3300049569 Bacteria 1470
565 Ga0501032_0164657 3300049569 Bacteria 1455
566 Ga0501032_0242617 3300049569 Bacteria 1170
567 Ga0501033_0003519 3300049570 Bacteria 12825
568 Ga0501033_0053149 3300049570 Bacteria 3000
569 Ga0501033_0165927 3300049570 Bacteria 1587
570 Ga0501034_0746442 3300049571 Bacteria 874
571 Ga0501034_0785875 3300049571 Bacteria 845
572 Ga0501036_0112831 3300049572 Bacteria 2297
573 Ga0501036_0302546 3300049572 Bacteria 1337
574 Ga0501037_0194265 3300049573 Bacteria 1436
575 Ga0501037_0210513 3300049573 Bacteria 1371
576 Ga0501037_0240410 3300049573 Bacteria 1269
577 Ga0501037_0268436 3300049573 Bacteria 1191
578 Ga0501038_0311018 3300049574 Bacteria 1234
579 Ga0501039_0055212 3300049575 Bacteria 3075
580 Ga0501043_0031845 3300049579 Bacteria 4145
581 Ga0501043_0058599 3300049579 Bacteria 3023
582 Ga0501043_0108548 3300049579 Bacteria 2179
583 Ga0501043_0956633 3300049579 Bacteria 611
584 Ga0501047_0009843 3300049581 Bacteria 9033
585 Ga0501047_0081903 3300049581 Bacteria 3102
586 Ga0501047_0215681 3300049581 Bacteria 1776
587 Ga0501047_0297330 3300049581 Bacteria 1457
588 Ga0501048_0088148 3300049582 Bacteria 2189
589 Ga0501070_0169212 3300049586 Bacteria 1800
590 Ga0501070_0194908 3300049586 Bacteria 1664
591 Ga0501070_0335980 3300049586 Bacteria 1227
592 Ga0501257_251696 3300049686 Bacteria 524
593 Ga0501080_0025292 3300049742 Bacteria 5509
594 Ga0501035_0026105 3300049822 Bacteria 5349
595 Ga0501035_0101021 3300049822 Bacteria 2531
596 Ga0501035_0129751 3300049822 Bacteria 2198
597 Ga0501035_0150580 3300049822 Bacteria 2019
598 Ga0501035_1020781 3300049822 Bacteria 649
599 Ga0501044_0004420 3300049823 Bacteria 15724
600 Ga0501044_0020637 3300049823 Bacteria 7035
601 Ga0501044_0166315 3300049823 Bacteria 2179
602 Ga0501044_0172461 3300049823 Bacteria 2133
603 Ga0501044_0229901 3300049823 Bacteria 1803
604 Ga0501044_0237938 3300049823 Bacteria 1765
605 Ga0501044_1286194 3300049823 Bacteria 598
606 nmdc:mga06z11_1987_c1 3300050494 Bacteria 7736
607 nmdc:mga07m45_192230_c1 3300050496 Bacteria 1187
608 nmdc:mga06r32_1310712_c1 3300050510 Bacteria 668
609 nmdc:mga08x19_353497_c1 3300050514 Bacteria 1026
610 nmdc:mga08x19_935557_c1 3300050514 Bacteria 616
611 nmdc:mga0a205_542486_c1 3300050515 Bacteria 1018
612 Ga0495655_0196384 3300053083 Bacteria 658
613 Ga0495595_0085330 3300053084 Bacteria 1509
614 Ga0495595_0119330 3300053084 Bacteria 1284
615 Ga0495619_0015501 3300053085 Bacteria 4822
616 Ga0495619_0184798 3300053085 Bacteria 1442
617 Ga0500578_0746835 3300053086 Bacteria 522
618 Ga0500644_0028242 3300053088 Bacteria 1753
619 Ga0500640_015759 3300053095 Bacteria 3174
620 Ga0500660_155744 3300053100 Bacteria 876
621 Ga0500660_208455 3300053100 Bacteria 661
622 Ga0500553_180986 3300053101 Bacteria 756
623 Ga0500553_227331 3300053101 Bacteria 599
624 Ga0500560_001736 3300053107 Bacteria 3912
625 Ga0500560_152651 3300053107 Bacteria 766
626 Ga0500572_013583 3300053111 Bacteria 2018
627 Ga0500608_137041 3300053122 Bacteria 1090
628 Ga0500614_135620 3300053123 Bacteria 733
629 Ga0500642_0364987 3300053130 Bacteria 638
630 Ga0500655_112385 3300053133 Bacteria 575
631 Ga0500658_0394177 3300053134 Bacteria 634
632 Ga0500559_0294829 3300053136 Bacteria 762
633 Ga0500573_0199793 3300053140 Bacteria 1062
634 Ga0500573_0352528 3300053140 Bacteria 714
635 Ga0500586_176739 3300053145 Bacteria 715
636 Ga0500600_0037488 3300053149 Bacteria 2810
637 Ga0500624_013244 3300053157 Bacteria 1231
638 Ga0500634_0148320 3300053161 Bacteria 1100
639 Ga0500636_0150474 3300053177 Bacteria 1279
640 Ga0500599_020103 3300053736 Bacteria 943
641 Ga0587084_020241 3300059477 Bacteria 988
642 Ga0587066_046314 3300059490 Bacteria 839
643 Ga0587073_0109166 3300059492 Bacteria 730
644 Ga0587082_032635 3300059504 Bacteria 916
645 Ga0587083_0228452 3300059505 Bacteria 545
646 Ga0587085_040716 3300059506 Bacteria 808
647 Ga0587088_196680 3300059508 Bacteria 513
648 Ga0587089_107393 3300059509 Bacteria 512
649 Ga0587092_045216 3300059512 Bacteria 780
650 Ga0587092_105560 3300059512 Bacteria 586
651 Ga0587106_069618 3300059605 Bacteria 664
652 Ga0587106_143660 3300059605 Bacteria 525
653 Ga0587106_156557 3300059605 Bacteria 511
654 Ga0587109_094313 3300059624 Bacteria 679
655 Ga0587122_018406 3300059628 Bacteria 739
656 Ga0587122_050572 3300059628 Bacteria 538
657 Ga0587062_102097 3300059639 Bacteria 560
658 Ga0587067_175027 3300059640 Bacteria 555
659 Ga0587072_033100 3300059643 Bacteria 974
660 Ga0587100_029492 3300059648 Bacteria 576
661 Ga0587105_026240 3300059651 Bacteria 536
662 Ga0587107_151481 3300059652 Bacteria 504
663 Ga0587114_030091 3300059655 Bacteria 825
664 Ga0587120_030803 3300059659 Bacteria 547
665 Ga0587071_033775 3300060344 Bacteria 997
666 Ga0587111_0039359 3300060346 Bacteria 1002
667 Ga0466962_0004079 3300061719 Bacteria 6994
668 Ga0466962_0038489 3300061719 Bacteria 2290
669 Ga0466962_0040152 3300061719 Bacteria 2241
670 Ga0466962_0082227 3300061719 Bacteria 1540
671 2547408540 2547132111 Bacteria 8013147
672 2554256365 2554235005 Bacteria 6457341
673 2585296441 2582581312 Bacteria 7308206
674 2585306964 2582581313 Bacteria 10042643
675 2585318639 2582581314 Bacteria 11452267
676 2616697140 2616644814 Bacteria 11555299
677 2616900069 2616644941 Bacteria 8510691
678 2643763847 2643221548 Bacteria 8053412
679 2643902429 2643221578 Bacteria 9213798
680 2643945505 2643221587 Bacteria 7586415
681 2644265971 2643221647 Bacteria 10741251
682 2644386743 2643221670 Bacteria 6497041
683 2644404000 2643221673 Bacteria 9196637
684 2644431168 2643221677 Bacteria 7584031
685 2644439869 2643221678 Bacteria 9540101
686 2644461719 2643221682 Bacteria 6743283
687 2644632800 2643221714 Bacteria 9015452
688 2785341366 2784746763 Bacteria 9783172
689 2785371318 2784746768 Bacteria 10036182
690 2786672505 2786546132 Bacteria 10419719
691 2808843877 2808606359 Bacteria 9866990
692 2808913417 2808606375 Bacteria 9466072
693 2811844588 2808606982 Bacteria 7791042
694 2812356165 2811994879 Bacteria 9313447
695 2812478918 2811994917 Bacteria 7761064
696 2819694771 2818991463 Bacteria 7948711
697 2862179128 2862178590 Bacteria 8583590
698 2862284925 2862281513 Bacteria 9621493
699 2862295220 2862290372 Bacteria 7471434
700 2862388622 2862382967 Bacteria 10317375
701 2862577682 2862574272 Bacteria 10567477
702 2863408443 2863404153 Bacteria 9672205
703 2867373705 2867369537 Bacteria 6501581
704 2867434539 2867428634 Bacteria 9590268
705 2867477657 2867475112 Bacteria 6909112
706 2873154206 2873151551 Bacteria 8625867
707 2875396526 2875391855 Bacteria 7600475
708 2877679287 2877676314 Bacteria 9512378
709 2912717884 2912715099 Bacteria 9460473
710 2912762591 2912757875 Bacteria 7940295
711 2918506327 2918501144 Bacteria 8668083
712 2919471557 2919468124 Bacteria 9133025
713 2935394519 2935390628 Bacteria 7043367
714 2946048028 2946045630 Bacteria 8527308
715 2946069691 2946064051 Bacteria 8957905
716 2946077583 2946072368 Bacteria 8999607
717 2947227118 2947224130 Bacteria 9938529
718 2954005292 2954002825 Bacteria 9173742
719 2954384172 2954380949 Bacteria 10050426
720 2954678777 2954673503 Bacteria 9685905
721 2954685376 2954682443 Bacteria 9862841
722 2954694994 2954691527 Bacteria 10720516
723 2954710168 2954701450 Bacteria 10834262
724 2954714487 2954711539 Bacteria 10867210
725 2954724433 2954721474 Bacteria 10456478
726 2954737385 2954731030 Bacteria 10243860
727 2954743355 2954740390 Bacteria 10229294
728 2954756238 2954749733 Bacteria 10366972
729 2954762312 2954759201 Bacteria 9358192
730 2966601006 2966598605 Bacteria 7676064
731 2990092149 2990088156 Bacteria 6657676
732 3006397090 3006393351 Bacteria 6615579
733 3006430039 3006425503 Bacteria 6491253
734 3006489033 3006486233 Bacteria 8157040
735 3006498094 3006493962 Bacteria 8825450
736 8008562613 8008558824 Bacteria 10610750
737 8025482528 8025478263 Bacteria 8209203
738 8025537062 8025530807 Bacteria 8495698
739 8033686867 8033684223 Bacteria 6906479
740 8047896303 8047893842 Bacteria 11723082
741 8048128083 8048127548 Bacteria 11053136
742 8048362633 8048356638 Bacteria 11044339
743 8048373312 8048369669 Bacteria 11666822
744 8048384930 8048379754 Bacteria 11877923
745 8048406624 8048406513 Bacteria 8936924
746 8056671489 8056667051 Bacteria 6953971
747 8056831990 8056829672 Bacteria 9045328
748 nmdc:mga03n38_218115_c1
749 JGI24737J22298_10021826
750 rootH1_10019195
751 rootH1_10080830
752 rootH2_10040067
753 rootH2_10217107
754 rootH1_10017685
755 rootH1_10091162
756 rootH1_10178559
757 JGI25160J50197_1033513
758 JGI25160J50197_1035808
759 JGI25160J50197_1036056
760 Ga0006562J51391_1044019
761 Ga0006562J51391_1130510
762 Ga0006562J51391_1130511
763 Ga0058863_11226352
764 Ga0058862_12670130
765 Ga0070682_100046806
766 Ga0068868_100005573
767 Ga0070691_10076958
768 Ga0070659_101902934
769 Ga0070709_10892199
770 Ga0070714_100461616
771 Ga0070713_101037832
772 Ga0070711_100036179
773 Ga0070705_100474532
774 Ga0070708_100469459
775 Ga0070681_10091417
776 Ga0070685_10052437
777 Ga0070707_100062789
778 Ga0070684_100174499
779 Ga0068853_100093609
780 Ga0070686_100555896
781 Ga0070686_101224166
782 Ga0070665_100167946
783 Ga0070704_100171955
784 Ga0068855_100132732
785 Ga0068855_100213914
786 Ga0070664_100377792
787 Ga0068857_100522691
788 Ga0068854_100412849
789 Ga0068854_102144232
790 Ga0068856_100057484
791 Ga0068856_100126077
792 Ga0068856_100484683
793 Ga0068864_100058542
794 Ga0068864_101707311
795 Ga0068866_10079829
796 Ga0068863_101470662
797 Ga0068858_100142698
798 Ga0068860_100156734
799 Ga0081455_10195754
800 Ga0075363_100560356
801 Ga0070716_100073556
802 Ga0070712_100758843
803 Ga0070712_100821183
804 Ga0070712_100825366
805 Ga0070712_101336267
806 Ga0075367_10003746
807 Ga0075370_10076640
808 Ga0068871_102039528
809 Ga0075428_101693119
810 Ga0075433_10675322
811 Ga0068865_101039796
812 Ga0099826_10067827
813 Ga0075435_100070671
814 Ga0105251_10060354
815 Ga0105244_10122288
816 Ga0105250_10059204
817 Ga0105245_10098489
818 Ga0105245_10134622
819 Ga0105245_10142376
820 Ga0105243_10646484
821 Ga0105241_10615957
822 Ga0105248_10365069
823 Ga0105237_10191741
824 Ga0105238_10118711
825 Ga0105238_10522624
826 Ga0105249_10650002
827 Ga0105239_10082718
828 Ga0105246_10249858
829 Ga0105246_10667927
830 Ga0105246_11748045
831 Ga0157370_10144068
832 Ga0157369_10087579
833 Ga0157369_10592981
834 Ga0157374_10070724
835 Ga0157378_10717988
836 Ga0163162_10031791
837 Ga0157372_10137947
838 Ga0157375_10085836
839 Ga0157375_10176735
840 Ga0163163_10006307
841 Ga0182008_10001423
842 Ga0157379_10028186
843 Ga0157376_10097190
844 Ga0182007_10002422
845 Ga0183367_1002
846 Ga0197907_10381786
847 Ga0206356_10995431
848 Ga0206356_11206245
849 Ga0206356_11219520
850 Ga0206355_1208892
851 Ga0206352_10401905
852 Ga0206352_11348545
853 Ga0206354_10196881
854 Ga0206354_10216677
855 Ga0224712_10531268
856 Ga0209758_1013617
857 Ga0207426_1001513
858 Ga0207426_1003399
859 Ga0207426_1006696
860 Ga0207426_1025201
861 Ga0207426_1100418
862 Ga0207647_10005240
863 Ga0207685_10234473
864 Ga0207654_10578735
865 Ga0207707_11159889
866 Ga0207671_10281426
867 Ga0207693_10918745
868 Ga0207663_10637261
869 Ga0207663_11216645
870 Ga0207652_11647249
871 Ga0207646_10580955
872 Ga0207694_10104344
873 Ga0207687_10059664
874 Ga0207687_10060309
875 Ga0207664_10608710
876 Ga0207709_10168473
877 Ga0207665_10036601
878 Ga0207711_10296652
879 Ga0207661_11886983
880 Ga0207667_10408358
881 Ga0207667_10499254
882 Ga0207640_10069392
883 Ga0207677_10006535
884 Ga0207702_10116605
885 Ga0207702_11461414
886 Ga0207702_12164519
887 Ga0207676_10026782
888 Ga0209371_1021986
889 Ga0209282_1100910
890 Ga0268266_10439512
891 Ga0268264_10817089
892 Ga0307517_10004597
893 Ga0307515_10000699
894 Ga0307515_10088843
895 Ga0307515_10672081
896 Ga0268256_1018141
897 Ga0307511_10000438
898 Ga0307511_10064014
899 Ga0307512_10004518
900 Ga0307512_10099826
901 Ga0307513_10009135
902 Ga0307513_10174813
903 Ga0307513_10974988
904 Ga0307509_10039154
905 Ga0307508_10006837
906 Ga0307508_10006908
907 Ga0307508_10007827
908 Ga0307508_10050424
909 Ga0307508_10190740
910 Ga0307514_10049324
911 Ga0307514_10050574
912 Ga0307514_10059521
913 Ga0307514_10126484
914 Ga0307516_10002231
915 Ga0307516_10417422
916 Ga0307516_10516121
917 Ga0307516_10588871
918 Ga0307518_10063769
919 Ga0307518_10336111
920 Ga0307518_10621871
921 Ga0307416_100849287
922 Ga0307416_101486896
923 Ga0307416_103424366
924 Ga0307507_10045296
925 Ga0307507_10079103
926 Ga0307507_10115847
927 Ga0307507_10539758
928 Ga0307510_10011458
929 Ga0307510_10023835
930 Ga0307510_10240025
931 Ga0373934_0294083
932 Ga0373945_0098141
933 Ga0373945_0166859
934 Ga0373954_0056855
935 Ga0373956_0192362
936 Ga0373943_0164675
937 Ga0373946_0433400
938 Ga0373931_0769697
939 Ga0373937_0039588
940 Ga0373925_0443148
941 Ga0395900_0193003
942 Ga0395898_0003092
943 Ga0395898_0030289
944 Ga0395901_0074271
945 Ga0395901_0244404
946 Ga0439436_0002729
947 Ga0439436_0003166
948 Ga0439439_0007385
949 Ga0451789_0944422
950 Ga0451800_1114010
951 Ga0451807_1614476
952 Ga0451807_1804336
953 Ga0451837_0010181
954 Ga0451841_1407059
955 Ga0451845_0506071
956 Ga0451847_0278125
957 Ga0451843_1617188
958 Ga0451853_0301595
959 Ga0451853_0393940
960 Ga0451853_1059851
961 Ga0451853_2009427
962 Ga0439431_0066081
963 Ga0439433_0012142
964 Ga0439442_001532
965 Ga0439442_003644
966 Ga0439448_0004898
967 Ga0439449_0000358
968 Ga0439449_0041114
969 Ga0439449_0089795
970 Ga0439449_0122340
971 Ga0439450_155205
972 Ga0439454_016112
973 Ga0439457_002398
974 Ga0439457_004233
975 Ga0439457_061953
976 Ga0439462_0010822
977 Ga0439463_142957
978 Ga0450897_009761
979 Ga0450894_000136
980 Ga0450898_000424
981 Ga0450899_018844
982 Ga0450900_004670
983 Ga0450902_008532
984 Ga0450903_000233
985 Ga0450906_018467
986 Ga0439458_0018008
987 Ga0439458_0020162
988 Ga0450908_010768
989 Ga0466969_0083017
990 Ga0466969_0135318
991 Ga0466972_0004540
992 Ga0466972_0056941
993 Ga0466972_0067178
994 Ga0466972_0172952
995 Ga0466965_0031059
996 Ga0466965_0297837
997 Ga0466965_0361990
998 Ga0466965_0912746
999 Ga0466966_0191081
1000 Ga0466961_0017066
1001 Ga0466961_0080676
1002 Ga0466961_0190965
1003 Ga0466961_0724040
1004 Ga0466963_0000213
1005 Ga0466963_0031993
1006 Ga0466963_0072827
1007 Ga0466963_0168700
1008 Ga0466963_0686842
1009 Ga0466964_0102966
1010 Ga0466964_0518622
1011 Ga0466971_0000575
1012 Ga0466971_0038665
1013 Ga0466971_0647823
1014 Ga0466968_0169956
1015 Ga0466970_0001274
1016 Ga0466970_0006583
1017 Ga0466970_0680531
1018 Ga0466957_0023199
1019 Ga0466957_0205515
1020 Ga0466957_0221160
1021 Ga0466957_0996579
1022 Ga0466957_1003719
1023 Ga0466960_0121087
1024 Ga0466960_0151254
1025 Ga0466960_0507779
1026 Ga0466959_0003363
1027 Ga0466959_0922397
1028 Ga0466958_0095111
1029 Ga0466958_0132417
1030 Ga0466967_0052759
1031 Ga0466967_0108297
1032 Ga0466967_0143729
1033 Ga0466967_0174885
1034 Ga0466967_0192631
1035 Ga0466967_0212446
1036 Ga0466967_0307766
1037 Ga0466967_0440992
1038 Ga0466967_0524071
1039 Ga0466967_2195384
1040 Ga0466967_2224499
1041 Ga0495592_0000574
1042 Ga0495592_0047991
1043 Ga0495603_0004257
1044 Ga0495603_0274076
1045 Ga0495603_0442957
1046 Ga0495603_0757155
1047 Ga0495590_0038675
1048 Ga0495629_0002819
1049 Ga0495629_0013612
1050 Ga0495629_0023271
1051 Ga0495629_0089361
1052 Ga0495629_0107957
1053 Ga0495629_0110270
1054 Ga0495629_0146572
1055 Ga0495629_0444279
1056 Ga0495638_0112665
1057 Ga0495638_0269807
1058 Ga0495641_0173672
1059 Ga0495651_0017031
1060 Ga0495651_0079211
1061 Ga0495651_0102999
1062 Ga0495651_0177354
1063 Ga0495653_0090901
1064 Ga0495653_0377002
1065 Ga0495653_0641302
1066 Ga0495580_0253921
1067 Ga0495582_0100885
1068 Ga0495605_0005349
1069 Ga0495639_0075647
1070 Ga0495662_0013250
1071 Ga0495662_0018848
1072 Ga0495662_0039237
1073 Ga0495662_0101601
1074 Ga0495662_0181113
1075 Ga0495662_0559855
1076 Ga0495664_0007790
1077 Ga0495664_0031093
1078 Ga0495664_0037883
1079 Ga0495664_0063719
1080 Ga0495664_0085909
1081 Ga0495664_0713314
1082 Ga0495584_0282451
1083 Ga0495584_0567137
1084 Ga0495585_0007795
1085 Ga0495585_0058979
1086 Ga0495594_0001816
1087 Ga0495594_0081634
1088 Ga0495594_0116525
1089 Ga0495594_0157211
1090 Ga0495594_0486532
1091 Ga0495596_0125752
1092 Ga0495596_0234521
1093 Ga0495607_0081677
1094 Ga0495607_0096676
1095 Ga0495583_0042610
1096 Ga0495606_0013622
1097 Ga0495608_0344690
1098 Ga0495608_0838235
1099 Ga0495610_0121162
1100 Ga0495610_0146435
1101 Ga0495610_0215045
1102 Ga0495616_0037258
1103 Ga0495618_0062044
1104 Ga0495618_0319690
1105 Ga0495620_0034741
1106 Ga0495620_0088812
1107 Ga0495620_0277766
1108 Ga0495628_0046823
1109 Ga0495628_0080884
1110 Ga0495628_0149536
1111 Ga0495628_0178311
1112 Ga0495628_0443471
1113 Ga0495630_0033011
1114 Ga0495630_0162453
1115 Ga0495630_0473812
1116 Ga0495630_0568209
1117 Ga0495631_0028031
1118 Ga0495631_0069413
1119 Ga0495637_0064870
1120 Ga0495643_0005567
1121 Ga0495644_0297976
1122 Ga0495648_0050550
1123 Ga0495648_0193895
1124 Ga0495648_0389007
1125 Ga0495666_0014863
1126 Ga0495666_0123221
1127 Ga0495642_0015555
1128 Ga0495652_0028911
1129 Ga0495652_0030071
1130 Ga0495652_0139100
1131 Ga0495652_0182024
1132 Ga0495654_0026495
1133 Ga0495665_0137705
1134 Ga0495640_0010846
1135 Ga0495640_0021884
1136 Ga0495640_0035770
1137 Ga0495640_0144317
1138 Ga0495586_0092894
1139 Ga0495586_0289667
1140 Ga0495587_0001011
1141 Ga0495587_0003221
1142 Ga0495587_0278099
1143 Ga0495609_0073982
1144 Ga0495597_0023855
1145 Ga0495645_0032240
1146 Ga0495645_0049580
1147 Ga0495645_0482447
1148 Ga0495622_0019957
1149 Ga0495622_0027908
1150 Ga0495622_0101327
1151 Ga0495622_0192528
1152 Ga0495633_0037682
1153 Ga0495633_0200017
1154 Ga0495667_0030504
1155 Ga0495667_0195928
1156 Ga0495667_0296114
1157 Ga0495667_0320136
1158 Ga0495667_0988724
1159 Ga0495668_0017827
1160 Ga0495668_0076764
1161 Ga0495668_0099213
1162 Ga0495634_0005531
1163 Ga0495634_0017386
1164 Ga0495634_0274406
1165 Ga0495634_0586886
1166 Ga0495611_0145263
1167 Ga0495611_0145976
1168 Ga0495611_0207546
1169 Ga0495625_0164477
1170 Ga0495625_0295332
1171 Ga0495635_0098181
1172 Ga0495635_0165153
1173 Ga0495635_0201024
1174 Ga0495635_0921331
1175 Ga0495661_0036094
1176 Ga0495661_0262342
1177 Ga0495661_0439445
1178 Ga0495588_0001268
1179 Ga0495588_0012467
1180 Ga0495588_0263876
1181 Ga0495657_0001214
1182 Ga0495657_0020442
1183 Ga0495657_0030679
1184 Ga0495657_0033179
1185 Ga0495599_0005311
1186 Ga0495599_0090794
1187 Ga0495599_0194168
1188 Ga0495646_0014451
1189 Ga0495646_0283485
1190 Ga0495658_0116688
1191 Ga0495658_0144361
1192 Ga0495613_0003059
1193 Ga0495613_0010395
1194 Ga0495613_0012117
1195 Ga0495613_0109870
1196 Ga0495613_0135378
1197 Ga0495613_0179258
1198 Ga0495613_0229586
1199 Ga0495613_0530936
1200 Ga0495613_0680743
1201 Ga0495624_0014389
1202 Ga0495624_0110705
1203 Ga0495624_0271689
1204 Ga0495624_0480763
1205 Ga0495624_0559763
1206 Ga0495670_0379824
1207 Ga0495670_0508837
1208 Ga0495671_0022519
1209 Ga0495671_0153702
1210 Ga0495671_0173739
1211 Ga0495649_0080389
1212 Ga0495649_0154922
1213 Ga0495649_0167813
1214 Ga0495589_0014905
1215 Ga0495589_0276114
1216 Ga0495600_0007018
1217 Ga0495600_0019938
1218 Ga0495600_0051201
1219 Ga0495600_0383097
1220 Ga0495581_0005237
1221 Ga0495581_0065540
1222 Ga0495581_0248433
1223 Ga0495581_0503292
1224 Ga0495604_0022719
1225 Ga0495604_0056268
1226 Ga0495604_0113627
1227 Ga0495604_0129049
1228 Ga0495604_0603621
1229 Ga0495636_0027201
1230 Ga0495636_0036339
1231 Ga0495636_0045783
1232 Ga0495636_0049775
1233 Ga0495674_0194508
1234 Ga0495674_0213282
1235 Ga0495674_0616145
1236 Ga0495674_1043863
1237 Ga0495672_0083211
1238 Ga0495676_0002047
1239 Ga0495676_0005451
1240 Ga0495676_0012902
1241 Ga0495676_0030974
1242 Ga0495676_0073343
1243 Ga0495676_0146274
1244 Ga0495676_0151528
1245 Ga0495676_0201737
1246 Ga0495676_0926524
1247 Ga0495676_1044284
1248 Ga0495680_0010669
1249 Ga0495680_0093253
1250 Ga0495680_0417508
1251 Ga0495683_0273178
1252 Ga0495687_006392
1253 Ga0495687_020416
1254 Ga0495687_171719
1255 Ga0495675_0014147
1256 Ga0495675_0142712
1257 Ga0495675_0160163
1258 Ga0495675_0228593
1259 Ga0495677_0026186
1260 Ga0495685_005303
1261 Ga0495685_006989
1262 Ga0495685_018741
1263 Ga0495685_162261
1264 Ga0495673_0198446
1265 Ga0495681_0000567
1266 Ga0495681_0302764
1267 Ga0495684_0000710
1268 Ga0495684_0095811
1269 Ga0495686_0015791
1270 Ga0495686_0028044
1271 Ga0495686_0084897
1272 Ga0495593_0000488
1273 Ga0495593_0023676
1274 Ga0495593_0027313
1275 Ga0495593_0651560
1276 Ga0495602_0018574
1277 Ga0495602_0077375
1278 Ga0495614_0001937
1279 Ga0495614_0006857
1280 Ga0495614_0007664
1281 Ga0495614_0041221
1282 Ga0495614_0119543
1283 Ga0495614_0222866
1284 Ga0495626_0024655
1285 Ga0496104_0555074
1286 Ga0496105_0038560
1287 Ga0496105_0522338
1288 Ga0496106_0214524
1289 Ga0496107_0883835
1290 Ga0496108_0009740
1291 Ga0496108_1097077
1292 Ga0496110_0010424
1293 Ga0496110_1044945
1294 Ga0496112_0043029
1295 Ga0496112_0208625
1296 Ga0496113_0010985
1297 Ga0496113_0635352
1298 Ga0496114_0430438
1299 Ga0496119_0503949
1300 Ga0501306_041572
1301 Ga0501306_069041
1302 Ga0501308_032020
1303 Ga0501308_060874
1304 Ga0501310_034095
1305 Ga0495678_019245
1306 Ga0495682_0231453
1307 Ga0501313_048544
1308 Ga0501314_043024
1309 Ga0501031_0174821
1310 Ga0501032_0041778
1311 Ga0501032_0161676
1312 Ga0501032_0164657
1313 Ga0501032_0242617
1314 Ga0501033_0003519
1315 Ga0501033_0053149
1316 Ga0501033_0165927
1317 Ga0501034_0746442
1318 Ga0501034_0785875
1319 Ga0501036_0112831
1320 Ga0501036_0302546
1321 Ga0501037_0194265
1322 Ga0501037_0210513
1323 Ga0501037_0240410
1324 Ga0501037_0268436
1325 Ga0501038_0311018
1326 Ga0501039_0055212
1327 Ga0501043_0031845
1328 Ga0501043_0058599
1329 Ga0501043_0108548
1330 Ga0501043_0956633
1331 Ga0501047_0009843
1332 Ga0501047_0081903
1333 Ga0501047_0215681
1334 Ga0501047_0297330
1335 Ga0501048_0088148
1336 Ga0501070_0169212
1337 Ga0501070_0194908
1338 Ga0501070_0335980
1339 Ga0501257_251696
1340 Ga0501080_0025292
1341 Ga0501035_0026105
1342 Ga0501035_0101021
1343 Ga0501035_0129751
1344 Ga0501035_0150580
1345 Ga0501035_1020781
1346 Ga0501044_0004420
1347 Ga0501044_0020637
1348 Ga0501044_0166315
1349 Ga0501044_0172461
1350 Ga0501044_0229901
1351 Ga0501044_0237938
1352 Ga0501044_1286194
1353 nmdc:mga06z11_1987_c1
1354 nmdc:mga07m45_192230_c1
1355 nmdc:mga06r32_1310712_c1
1356 nmdc:mga08x19_353497_c1
1357 nmdc:mga08x19_935557_c1
1358 nmdc:mga0a205_542486_c1
1359 Ga0495655_0196384
1360 Ga0495595_0085330
1361 Ga0495595_0119330
1362 Ga0495619_0015501
1363 Ga0495619_0184798
1364 Ga0500578_0746835
1365 Ga0500644_0028242
1366 Ga0500640_015759
1367 Ga0500660_155744
1368 Ga0500660_208455
1369 Ga0500553_180986
1370 Ga0500553_227331
1371 Ga0500560_001736
1372 Ga0500560_152651
1373 Ga0500572_013583
1374 Ga0500608_137041
1375 Ga0500614_135620
1376 Ga0500642_0364987
1377 Ga0500655_112385
1378 Ga0500658_0394177
1379 Ga0500559_0294829
1380 Ga0500573_0199793
1381 Ga0500573_0352528
1382 Ga0500586_176739
1383 Ga0500600_0037488
1384 Ga0500624_013244
1385 Ga0500634_0148320
1386 Ga0500636_0150474
1387 Ga0500599_020103
1388 Ga0587084_020241
1389 Ga0587066_046314
1390 Ga0587073_0109166
1391 Ga0587082_032635
1392 Ga0587083_0228452
1393 Ga0587085_040716
1394 Ga0587088_196680
1395 Ga0587089_107393
1396 Ga0587092_045216
1397 Ga0587092_105560
1398 Ga0587106_069618
1399 Ga0587106_143660
1400 Ga0587106_156557
1401 Ga0587109_094313
1402 Ga0587122_018406
1403 Ga0587122_050572
1404 Ga0587062_102097
1405 Ga0587067_175027
1406 Ga0587072_033100
1407 Ga0587100_029492
1408 Ga0587105_026240
1409 Ga0587107_151481
1410 Ga0587114_030091
1411 Ga0587120_030803
1412 Ga0587071_033775
1413 Ga0587111_0039359
1414 Ga0466962_0004079
1415 Ga0466962_0038489
1416 Ga0466962_0040152
1417 Ga0466962_0082227
1418 2547408540
1419 2554256365
1420 2585296441
1421 2585306964
1422 2585318639
1423 2616697140
1424 2616900069
1425 2643763847
1426 2643902429
1427 2643945505
1428 2644265971
1429 2644386743
1430 2644404000
1431 2644431168
1432 2644439869
1433 2644461719
1434 2644632800
1435 2785341366
1436 2785371318
1437 2786672505
1438 2808843877
1439 2808913417
1440 2811844588
1441 2812356165
1442 2812478918
1443 2819694771
1444 2862179128
1445 2862284925
1446 2862295220
1447 2862388622
1448 2862577682
1449 2863408443
1450 2867373705
1451 2867434539
1452 2867477657
1453 2873154206
1454 2875396526
1455 2877679287
1456 2912717884
1457 2912762591
1458 2918506327
1459 2919471557
1460 2935394519
1461 2946048028
1462 2946069691
1463 2946077583
1464 2947227118
1465 2954005292
1466 2954384172
1467 2954678777
1468 2954685376
1469 2954694994
1470 2954710168
1471 2954714487
1472 2954724433
1473 2954737385
1474 2954743355
1475 2954756238
1476 2954762312
1477 2966601006
1478 2990092149
1479 3006397090
1480 3006430039
1481 3006489033
1482 3006498094
1483 8008562613
1484 8025482528
1485 8025537062
1486 8033686867
1487 8047896303
1488 8048128083
1489 8048362633
1490 8048373312
1491 8048384930
1492 8048406624
1493 8056671489
1494 8056831990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

17

72

0.93

PF00571

CBS

CBS domain

82

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npl-assembly1.cif.gz_A crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution 0.9226 1 118
5nmu-assembly1.cif.gz_B-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9221 1 118
5nmu-assembly1.cif.gz_C-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.8714 1 127
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.866 8 123
3kpd-assembly2.cif.gz_C crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. 0.8631 1 121
ID Description Score Start End Superfamily
af_Q5A3N2_197_353_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.905 1 119 3.10.580.10
af_Q57892_7_176_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8882 3 121 3.10.580.10
af_O13965_64_218_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8843 3 119 3.10.580.10
af_C0PHI9_226_352_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8838 3 121 3.10.580.10
af_A0A0R0JYS7_265_405_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8814 2 121 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A176LEH7-F1-model_v4 deleted 0.9479 1 129
AF-A0A533ZTU6-F1-model_v4 CBS domain-containing protein 0.9469 1 118 GO:0035438
AF-A0A286EIS5-F1-model_v4 CBS domain-containing protein 0.9451 1 130
AF-A0A6H0CSI7-F1-model_v4 CBS domain-containing protein 0.9441 1 130
AF-A0A2K8PCY1-F1-model_v4 Hypoxic response protein 1 0.942 1 121

Map