F478846
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 315 | 735 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100534923|Ga0070665_1005349232 |
| Length | 140 |
| Sequence | MTIVVAYQETPEGRRALGHAMAEAGLRHTDLVVLTAPSRADGDPVTRLPEVPVPHLGGPPAADGSVATAEHPAVAVHLRNAVKPDHLADELLDLAGELDAELIVIGLRRRSPVGKLLLGSAAQHILLNSTVPVLAVRLPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 5 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 6 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 9 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 10 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 200 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 201 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 208 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 212 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 213 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 306 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 315 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.15 |
| Nodule | 0.13 |
| Rhizoplane | 10.86 |
| Rhizosphere | 68.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1004700 | 3300001977 | Bacteria | 2145 |
| 2 | JGI24747J21853_1004637 | 3300001978 | Bacteria | 1241 |
| 3 | JGI24739J22299_10076627 | 3300001989 | Bacteria | 1032 |
| 4 | JGI24743J22301_10036081 | 3300001991 | Bacteria | 984 |
| 5 | JGI24750J21931_1003756 | 3300002070 | Bacteria | 1828 |
| 6 | JGI24748J21848_1028046 | 3300002074 | Bacteria | 691 |
| 7 | JGI24738J21930_10017264 | 3300002075 | Bacteria | 1518 |
| 8 | JGI24749J21850_1033947 | 3300002076 | Bacteria | 737 |
| 9 | JGI24742J22300_10003250 | 3300002244 | Bacteria | 2632 |
| 10 | Ga0055540_1001555 | 3300003792 | Bacteria | 13435 |
| 11 | Ga0055540_1001762 | 3300003792 | Bacteria | 12361 |
| 12 | Ga0055540_1005999 | 3300003792 | Bacteria | 4924 |
| 13 | Ga0070676_10141824 | 3300005328 | Bacteria | 1531 |
| 14 | Ga0070690_100015282 | 3300005330 | Bacteria | 4575 |
| 15 | Ga0070682_100045623 | 3300005337 | Bacteria | 2717 |
| 16 | Ga0070682_100050564 | 3300005337 | Bacteria | 2595 |
| 17 | Ga0068868_100044111 | 3300005338 | Bacteria | 3486 |
| 18 | Ga0068868_101295860 | 3300005338 | Bacteria | 677 |
| 19 | Ga0068868_101760914 | 3300005338 | Bacteria | 585 |
| 20 | Ga0070660_100441054 | 3300005339 | Bacteria | 1079 |
| 21 | Ga0070689_100081268 | 3300005340 | Bacteria | 2544 |
| 22 | Ga0070689_100676428 | 3300005340 | Bacteria | 899 |
| 23 | Ga0070691_10020122 | 3300005341 | Bacteria | 3081 |
| 24 | Ga0070687_100165078 | 3300005343 | Bacteria | 1313 |
| 25 | Ga0070661_101290350 | 3300005344 | Bacteria | 612 |
| 26 | Ga0070692_10071891 | 3300005345 | Bacteria | 1844 |
| 27 | Ga0070692_10344252 | 3300005345 | Bacteria | 924 |
| 28 | Ga0070668_100018346 | 3300005347 | Bacteria | 5253 |
| 29 | Ga0070668_100552354 | 3300005347 | Bacteria | 1002 |
| 30 | Ga0070668_100780838 | 3300005347 | Bacteria | 847 |
| 31 | Ga0070668_101222450 | 3300005347 | Bacteria | 681 |
| 32 | Ga0070668_101240391 | 3300005347 | Bacteria | 676 |
| 33 | Ga0070669_100024054 | 3300005353 | Bacteria | 4365 |
| 34 | Ga0070669_100902614 | 3300005353 | Bacteria | 755 |
| 35 | Ga0070675_101291193 | 3300005354 | Bacteria | 672 |
| 36 | Ga0070671_100131523 | 3300005355 | Bacteria | 2108 |
| 37 | Ga0070671_100357800 | 3300005355 | Bacteria | 1246 |
| 38 | Ga0070674_100004138 | 3300005356 | Bacteria | 8242 |
| 39 | Ga0070674_100117581 | 3300005356 | Bacteria | 1963 |
| 40 | Ga0070674_100425436 | 3300005356 | Bacteria | 1090 |
| 41 | Ga0070674_100537779 | 3300005356 | Bacteria | 978 |
| 42 | Ga0070673_100142429 | 3300005364 | Bacteria | 2024 |
| 43 | Ga0070688_100040946 | 3300005365 | Bacteria | 2841 |
| 44 | Ga0070688_100774567 | 3300005365 | Bacteria | 748 |
| 45 | Ga0070659_100320572 | 3300005366 | Bacteria | 1295 |
| 46 | Ga0070659_100325950 | 3300005366 | Bacteria | 1284 |
| 47 | Ga0070659_100677449 | 3300005366 | Bacteria | 890 |
| 48 | Ga0070659_100748433 | 3300005366 | Bacteria | 847 |
| 49 | Ga0070667_100000033 | 3300005367 | Bacteria | 175463 |
| 50 | Ga0070667_100286459 | 3300005367 | Bacteria | 1480 |
| 51 | Ga0070667_100303528 | 3300005367 | Bacteria | 1438 |
| 52 | Ga0070667_100429825 | 3300005367 | Bacteria | 1205 |
| 53 | Ga0070667_100698118 | 3300005367 | Bacteria | 939 |
| 54 | Ga0070667_100953261 | 3300005367 | Bacteria | 800 |
| 55 | Ga0070703_10152677 | 3300005406 | Bacteria | 869 |
| 56 | Ga0070709_10367815 | 3300005434 | Bacteria | 1066 |
| 57 | Ga0070709_10374096 | 3300005434 | Bacteria | 1058 |
| 58 | Ga0070709_11527633 | 3300005434 | Bacteria | 543 |
| 59 | Ga0070714_101058418 | 3300005435 | Bacteria | 790 |
| 60 | Ga0070714_101631999 | 3300005435 | Bacteria | 630 |
| 61 | Ga0070713_100525764 | 3300005436 | Bacteria | 1118 |
| 62 | Ga0070713_100617057 | 3300005436 | Bacteria | 1031 |
| 63 | Ga0070710_10033816 | 3300005437 | Bacteria | 2778 |
| 64 | Ga0070710_10492806 | 3300005437 | Bacteria | 838 |
| 65 | Ga0070701_10056707 | 3300005438 | Bacteria | 2050 |
| 66 | Ga0070711_100090815 | 3300005439 | Bacteria | 2200 |
| 67 | Ga0070711_100144645 | 3300005439 | Bacteria | 1786 |
| 68 | Ga0070711_100447176 | 3300005439 | Bacteria | 1057 |
| 69 | Ga0070711_101636906 | 3300005439 | Bacteria | 563 |
| 70 | Ga0070705_100422947 | 3300005440 | Bacteria | 992 |
| 71 | Ga0070705_100483190 | 3300005440 | Bacteria | 936 |
| 72 | Ga0070705_100491612 | 3300005440 | Bacteria | 929 |
| 73 | Ga0070700_100063497 | 3300005441 | Bacteria | 2336 |
| 74 | Ga0070700_100067467 | 3300005441 | Bacteria | 2272 |
| 75 | Ga0070694_100307995 | 3300005444 | Bacteria | 1215 |
| 76 | Ga0070694_100669458 | 3300005444 | Bacteria | 841 |
| 77 | Ga0070663_100060596 | 3300005455 | Bacteria | 2723 |
| 78 | Ga0070678_100024639 | 3300005456 | Bacteria | 4033 |
| 79 | Ga0070678_100094887 | 3300005456 | Bacteria | 2297 |
| 80 | Ga0070678_100354492 | 3300005456 | Bacteria | 1262 |
| 81 | Ga0070678_100545073 | 3300005456 | Bacteria | 1029 |
| 82 | Ga0070678_101454227 | 3300005456 | Bacteria | 641 |
| 83 | Ga0070662_100050929 | 3300005457 | Bacteria | 2988 |
| 84 | Ga0070662_100483152 | 3300005457 | Bacteria | 1031 |
| 85 | Ga0068867_100038013 | 3300005459 | Bacteria | 3502 |
| 86 | Ga0068867_100758334 | 3300005459 | Bacteria | 862 |
| 87 | Ga0070685_10074114 | 3300005466 | Bacteria | 2025 |
| 88 | Ga0070685_11283852 | 3300005466 | Bacteria | 559 |
| 89 | Ga0068853_100101330 | 3300005539 | Bacteria | 2546 |
| 90 | Ga0070672_100185834 | 3300005543 | Bacteria | 1733 |
| 91 | Ga0070672_100295908 | 3300005543 | Bacteria | 1371 |
| 92 | Ga0070686_100335988 | 3300005544 | Bacteria | 1131 |
| 93 | Ga0070686_100605690 | 3300005544 | Bacteria | 864 |
| 94 | Ga0070686_100980936 | 3300005544 | Bacteria | 692 |
| 95 | Ga0070695_100338423 | 3300005545 | Bacteria | 1124 |
| 96 | Ga0070695_100501856 | 3300005545 | Bacteria | 938 |
| 97 | Ga0070696_100014832 | 3300005546 | Bacteria | 5230 |
| 98 | Ga0070696_100811813 | 3300005546 | Bacteria | 770 |
| 99 | Ga0070693_100063599 | 3300005547 | Bacteria | 2151 |
| 100 | Ga0070693_100195834 | 3300005547 | Bacteria | 1309 |
| 101 | Ga0070665_100003442 | 3300005548 | Bacteria | 16878 |
| 102 | Ga0070665_100012426 | 3300005548 | Bacteria | 8584 |
| 103 | Ga0070665_100225233 | 3300005548 | Bacteria | 1875 |
| 104 | Ga0070665_100534923 | 3300005548 | Bacteria | 1184 |
| 105 | Ga0070665_100578672 | 3300005548 | Bacteria | 1136 |
| 106 | Ga0070665_101793508 | 3300005548 | Bacteria | 620 |
| 107 | Ga0070665_101871361 | 3300005548 | Bacteria | 606 |
| 108 | Ga0070704_100167139 | 3300005549 | Bacteria | 1745 |
| 109 | Ga0070704_100581033 | 3300005549 | Bacteria | 982 |
| 110 | Ga0068855_100566982 | 3300005563 | Bacteria | 1228 |
| 111 | Ga0068855_100694287 | 3300005563 | Bacteria | 1090 |
| 112 | Ga0068854_100009094 | 3300005578 | Bacteria | 6403 |
| 113 | Ga0068854_100582206 | 3300005578 | Bacteria | 953 |
| 114 | Ga0068854_101942456 | 3300005578 | Bacteria | 541 |
| 115 | Ga0068856_100549468 | 3300005614 | Bacteria | 1176 |
| 116 | Ga0068856_100711503 | 3300005614 | Bacteria | 1025 |
| 117 | Ga0070702_100018741 | 3300005615 | Bacteria | 3595 |
| 118 | Ga0070702_100060631 | 3300005615 | Bacteria | 2200 |
| 119 | Ga0070702_100467820 | 3300005615 | Bacteria | 918 |
| 120 | Ga0070702_100544281 | 3300005615 | Bacteria | 860 |
| 121 | Ga0070702_100998899 | 3300005615 | Bacteria | 662 |
| 122 | Ga0068852_100737360 | 3300005616 | Bacteria | 997 |
| 123 | Ga0068852_100976185 | 3300005616 | Bacteria | 865 |
| 124 | Ga0068859_100001651 | 3300005617 | Bacteria | 22756 |
| 125 | Ga0068859_100120223 | 3300005617 | Bacteria | 2693 |
| 126 | Ga0068864_100206429 | 3300005618 | Bacteria | 1807 |
| 127 | Ga0068864_100593589 | 3300005618 | Bacteria | 1074 |
| 128 | Ga0068864_101224531 | 3300005618 | Bacteria | 750 |
| 129 | Ga0068866_10011313 | 3300005718 | Bacteria | 3857 |
| 130 | Ga0068866_10269219 | 3300005718 | Bacteria | 1050 |
| 131 | Ga0068861_100084809 | 3300005719 | Bacteria | 2487 |
| 132 | Ga0068861_100724008 | 3300005719 | Bacteria | 927 |
| 133 | Ga0068863_100000193 | 3300005841 | Bacteria | 64832 |
| 134 | Ga0068863_100003240 | 3300005841 | Bacteria | 16104 |
| 135 | Ga0068863_100083739 | 3300005841 | Bacteria | 3022 |
| 136 | Ga0068863_100089147 | 3300005841 | Bacteria | 2924 |
| 137 | Ga0068863_100189191 | 3300005841 | Bacteria | 1978 |
| 138 | Ga0068858_100105154 | 3300005842 | Bacteria | 2634 |
| 139 | Ga0068858_100110610 | 3300005842 | Bacteria | 2565 |
| 140 | Ga0068858_100441945 | 3300005842 | Bacteria | 1253 |
| 141 | Ga0068858_100541723 | 3300005842 | Bacteria | 1126 |
| 142 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 143 | Ga0068860_100057620 | 3300005843 | Bacteria | 3693 |
| 144 | Ga0068860_100183892 | 3300005843 | Bacteria | 2020 |
| 145 | Ga0068860_101472776 | 3300005843 | Bacteria | 702 |
| 146 | Ga0068862_100000205 | 3300005844 | Bacteria | 65575 |
| 147 | Ga0068862_100220630 | 3300005844 | Bacteria | 1716 |
| 148 | Ga0068862_101086914 | 3300005844 | Bacteria | 794 |
| 149 | Ga0068862_102288505 | 3300005844 | Bacteria | 552 |
| 150 | Ga0081455_10250827 | 3300005937 | Bacteria | 1294 |
| 151 | Ga0081455_10279618 | 3300005937 | Bacteria | 1206 |
| 152 | Ga0081538_10057611 | 3300005981 | Bacteria | 2261 |
| 153 | Ga0075365_10063360 | 3300006038 | Bacteria | 2475 |
| 154 | Ga0075365_10123630 | 3300006038 | Bacteria | 1787 |
| 155 | Ga0075365_10169666 | 3300006038 | Bacteria | 1523 |
| 156 | Ga0075365_10358456 | 3300006038 | Bacteria | 1028 |
| 157 | Ga0075365_10634095 | 3300006038 | Bacteria | 755 |
| 158 | Ga0075365_10705190 | 3300006038 | Bacteria | 713 |
| 159 | Ga0075368_10187911 | 3300006042 | Bacteria | 872 |
| 160 | Ga0075363_100001201 | 3300006048 | Bacteria | 9562 |
| 161 | Ga0075363_100001555 | 3300006048 | Bacteria | 8806 |
| 162 | Ga0075363_100026491 | 3300006048 | Bacteria | 2967 |
| 163 | Ga0075363_100033718 | 3300006048 | Bacteria | 2669 |
| 164 | Ga0075363_100067306 | 3300006048 | Bacteria | 1940 |
| 165 | Ga0075363_100080002 | 3300006048 | Bacteria | 1786 |
| 166 | Ga0075364_10002712 | 3300006051 | Bacteria | 9948 |
| 167 | Ga0075364_10004244 | 3300006051 | Bacteria | 8230 |
| 168 | Ga0075364_10190757 | 3300006051 | Bacteria | 1388 |
| 169 | Ga0075364_10210105 | 3300006051 | Bacteria | 1320 |
| 170 | Ga0075364_10268302 | 3300006051 | Bacteria | 1161 |
| 171 | Ga0075364_10338707 | 3300006051 | Bacteria | 1025 |
| 172 | Ga0075364_10464259 | 3300006051 | Bacteria | 865 |
| 173 | Ga0075364_10725905 | 3300006051 | Bacteria | 678 |
| 174 | Ga0075364_11045142 | 3300006051 | Bacteria | 555 |
| 175 | Ga0070715_10627003 | 3300006163 | Bacteria | 633 |
| 176 | Ga0070716_100579852 | 3300006173 | Bacteria | 841 |
| 177 | Ga0070716_101277733 | 3300006173 | Bacteria | 592 |
| 178 | Ga0070712_100009919 | 3300006175 | Bacteria | 6003 |
| 179 | Ga0070712_100023386 | 3300006175 | Bacteria | 4082 |
| 180 | Ga0075362_10022933 | 3300006177 | Bacteria | 2634 |
| 181 | Ga0075362_10054166 | 3300006177 | Bacteria | 1802 |
| 182 | Ga0075362_10112778 | 3300006177 | Bacteria | 1281 |
| 183 | Ga0075362_10155013 | 3300006177 | Bacteria | 1101 |
| 184 | Ga0075367_10021805 | 3300006178 | Bacteria | 3585 |
| 185 | Ga0075367_10440053 | 3300006178 | Bacteria | 826 |
| 186 | Ga0075369_10000601 | 3300006186 | Bacteria | 11423 |
| 187 | Ga0075369_10003984 | 3300006186 | Bacteria | 5419 |
| 188 | Ga0075369_10010261 | 3300006186 | Bacteria | 3661 |
| 189 | Ga0075369_10181622 | 3300006186 | Bacteria | 968 |
| 190 | Ga0075369_10290178 | 3300006186 | Bacteria | 763 |
| 191 | Ga0075369_10535737 | 3300006186 | Bacteria | 558 |
| 192 | Ga0097621_100011755 | 3300006237 | Bacteria | 6464 |
| 193 | Ga0097621_100406308 | 3300006237 | Bacteria | 1220 |
| 194 | Ga0075370_10004679 | 3300006353 | Bacteria | 6677 |
| 195 | Ga0075370_10062011 | 3300006353 | Bacteria | 2130 |
| 196 | Ga0075370_10143790 | 3300006353 | Bacteria | 1395 |
| 197 | Ga0075370_10146843 | 3300006353 | Bacteria | 1381 |
| 198 | Ga0068871_100122197 | 3300006358 | Bacteria | 2201 |
| 199 | Ga0068871_100612742 | 3300006358 | Bacteria | 991 |
| 200 | Ga0075428_100010132 | 3300006844 | Bacteria | 10471 |
| 201 | Ga0075430_100002450 | 3300006846 | Bacteria | 15454 |
| 202 | Ga0075431_100002383 | 3300006847 | Bacteria | 18066 |
| 203 | Ga0075433_10582228 | 3300006852 | Bacteria | 983 |
| 204 | Ga0075434_100916699 | 3300006871 | Bacteria | 891 |
| 205 | Ga0075434_101207075 | 3300006871 | Bacteria | 768 |
| 206 | Ga0075429_100003191 | 3300006880 | Bacteria | 13944 |
| 207 | Ga0068865_100050587 | 3300006881 | Bacteria | 2871 |
| 208 | Ga0068865_100063078 | 3300006881 | Bacteria | 2603 |
| 209 | Ga0068865_100427524 | 3300006881 | Bacteria | 1090 |
| 210 | Ga0097620_100001651 | 3300006931 | Bacteria | 22756 |
| 211 | Ga0097620_100120225 | 3300006931 | Bacteria | 2693 |
| 212 | Ga0097620_103074566 | 3300006931 | Bacteria | 509 |
| 213 | Ga0105251_10119064 | 3300009011 | Bacteria | 1200 |
| 214 | Ga0105250_10460122 | 3300009092 | Bacteria | 572 |
| 215 | Ga0105240_11204588 | 3300009093 | Bacteria | 802 |
| 216 | Ga0105245_10051087 | 3300009098 | Bacteria | 3706 |
| 217 | Ga0105245_10761590 | 3300009098 | Bacteria | 1004 |
| 218 | Ga0105247_10000082 | 3300009101 | Bacteria | 106460 |
| 219 | Ga0105247_10069419 | 3300009101 | Bacteria | 2199 |
| 220 | Ga0105247_10138777 | 3300009101 | Bacteria | 1591 |
| 221 | Ga0105247_10171891 | 3300009101 | Bacteria | 1441 |
| 222 | Ga0105247_10188098 | 3300009101 | Bacteria | 1381 |
| 223 | Ga0105247_10383025 | 3300009101 | Bacteria | 998 |
| 224 | Ga0114129_10004429 | 3300009147 | Bacteria | 19823 |
| 225 | Ga0105243_10124009 | 3300009148 | Bacteria | 2183 |
| 226 | Ga0105243_10193596 | 3300009148 | Bacteria | 1778 |
| 227 | Ga0105243_10491911 | 3300009148 | Bacteria | 1160 |
| 228 | Ga0105243_10836171 | 3300009148 | Unclassified | 910 |
| 229 | Ga0105243_12277337 | 3300009148 | Bacteria | 579 |
| 230 | Ga0105241_10187101 | 3300009174 | Bacteria | 1722 |
| 231 | Ga0105241_10592499 | 3300009174 | Bacteria | 1000 |
| 232 | Ga0105241_10889712 | 3300009174 | Bacteria | 826 |
| 233 | Ga0105242_10212148 | 3300009176 | Bacteria | 1726 |
| 234 | Ga0105242_10636241 | 3300009176 | Bacteria | 1035 |
| 235 | Ga0105248_10000084 | 3300009177 | Bacteria | 110380 |
| 236 | Ga0105248_10045541 | 3300009177 | Bacteria | 4919 |
| 237 | Ga0105248_10079301 | 3300009177 | Bacteria | 3690 |
| 238 | Ga0105248_10384927 | 3300009177 | Bacteria | 1579 |
| 239 | Ga0105248_10425874 | 3300009177 | Bacteria | 1495 |
| 240 | Ga0105248_10648813 | 3300009177 | Bacteria | 1191 |
| 241 | Ga0105248_10894011 | 3300009177 | Bacteria | 1003 |
| 242 | Ga0105237_10001322 | 3300009545 | Bacteria | 32861 |
| 243 | Ga0105237_10323336 | 3300009545 | Bacteria | 1546 |
| 244 | Ga0105237_10579900 | 3300009545 | Bacteria | 1128 |
| 245 | Ga0105238_10071422 | 3300009551 | Bacteria | 3469 |
| 246 | Ga0105238_10411270 | 3300009551 | Bacteria | 1347 |
| 247 | Ga0105238_10627594 | 3300009551 | Bacteria | 1084 |
| 248 | Ga0105238_12447126 | 3300009551 | Bacteria | 558 |
| 249 | Ga0105249_10000285 | 3300009553 | Bacteria | 52372 |
| 250 | Ga0105249_10255109 | 3300009553 | Bacteria | 1740 |
| 251 | Ga0105249_10604345 | 3300009553 | Bacteria | 1152 |
| 252 | Ga0105249_11287530 | 3300009553 | Bacteria | 802 |
| 253 | Ga0105249_11768580 | 3300009553 | Bacteria | 691 |
| 254 | Ga0105249_11826317 | 3300009553 | Bacteria | 680 |
| 255 | Ga0105239_10011658 | 3300010375 | Bacteria | 9812 |
| 256 | Ga0105239_10024619 | 3300010375 | Bacteria | 6631 |
| 257 | Ga0105239_10752324 | 3300010375 | Bacteria | 1115 |
| 258 | Ga0105239_11865801 | 3300010375 | Bacteria | 697 |
| 259 | Ga0105239_12052310 | 3300010375 | Bacteria | 664 |
| 260 | Ga0105246_10164337 | 3300011119 | Bacteria | 1694 |
| 261 | Ga0105246_10184996 | 3300011119 | Bacteria | 1607 |
| 262 | Ga0105246_10531246 | 3300011119 | Bacteria | 1004 |
| 263 | Ga0157371_10367199 | 3300013102 | Bacteria | 1049 |
| 264 | Ga0157371_10859013 | 3300013102 | Bacteria | 686 |
| 265 | Ga0157369_11766139 | 3300013105 | Bacteria | 628 |
| 266 | Ga0157374_10511398 | 3300013296 | Bacteria | 1206 |
| 267 | Ga0157374_12693069 | 3300013296 | Bacteria | 525 |
| 268 | Ga0157378_10178812 | 3300013297 | Bacteria | 1994 |
| 269 | Ga0157378_10264821 | 3300013297 | Bacteria | 1651 |
| 270 | Ga0157378_10449534 | 3300013297 | Bacteria | 1278 |
| 271 | Ga0163162_10028509 | 3300013306 | Bacteria | 5525 |
| 272 | Ga0163162_10681207 | 3300013306 | Bacteria | 1151 |
| 273 | Ga0163162_12092277 | 3300013306 | Bacteria | 649 |
| 274 | Ga0157372_10392164 | 3300013307 | Bacteria | 1618 |
| 275 | Ga0157372_10444451 | 3300013307 | Bacteria | 1511 |
| 276 | Ga0157372_10871701 | 3300013307 | Bacteria | 1045 |
| 277 | Ga0157375_10896535 | 3300013308 | Bacteria | 1031 |
| 278 | Ga0157375_11086150 | 3300013308 | Bacteria | 936 |
| 279 | Ga0157375_11675328 | 3300013308 | Bacteria | 753 |
| 280 | Ga0163163_10206354 | 3300014325 | Bacteria | 2013 |
| 281 | Ga0163163_10294424 | 3300014325 | Bacteria | 1675 |
| 282 | Ga0163163_10748389 | 3300014325 | Bacteria | 1041 |
| 283 | Ga0157380_10061839 | 3300014326 | Bacteria | 2998 |
| 284 | Ga0157380_10417625 | 3300014326 | Bacteria | 1278 |
| 285 | Ga0157377_10923607 | 3300014745 | Bacteria | 654 |
| 286 | Ga0157379_10052581 | 3300014968 | Bacteria | 3639 |
| 287 | Ga0157379_10360750 | 3300014968 | Bacteria | 1332 |
| 288 | Ga0157379_10454283 | 3300014968 | Bacteria | 1183 |
| 289 | Ga0157379_10910640 | 3300014968 | Bacteria | 835 |
| 290 | Ga0157376_10200898 | 3300014969 | Bacteria | 1834 |
| 291 | Ga0157376_10479904 | 3300014969 | Bacteria | 1218 |
| 292 | Ga0157376_10713778 | 3300014969 | Bacteria | 1009 |
| 293 | Ga0157376_11641378 | 3300014969 | Bacteria | 677 |
| 294 | Ga0163161_10096797 | 3300017792 | Bacteria | 2191 |
| 295 | Ga0163161_10426864 | 3300017792 | Bacteria | 1067 |
| 296 | Ga0163161_10616422 | 3300017792 | Bacteria | 896 |
| 297 | Ga0163161_10853020 | 3300017792 | Bacteria | 769 |
| 298 | Ga0209673_1041609 | 3300025273 | Bacteria | 1302 |
| 299 | Ga0209673_1090871 | 3300025273 | Bacteria | 676 |
| 300 | Ga0209051_1000594 | 3300025303 | Bacteria | 42766 |
| 301 | Ga0209051_1001327 | 3300025303 | Bacteria | 21574 |
| 302 | Ga0209051_1002457 | 3300025303 | Bacteria | 13267 |
| 303 | Ga0209051_1019705 | 3300025303 | Bacteria | 2933 |
| 304 | Ga0209051_1023237 | 3300025303 | Bacteria | 2583 |
| 305 | Ga0207653_10034056 | 3300025885 | Bacteria | 1654 |
| 306 | Ga0207692_10099142 | 3300025898 | Bacteria | 1596 |
| 307 | Ga0207692_10317478 | 3300025898 | Bacteria | 952 |
| 308 | Ga0207642_10068498 | 3300025899 | Bacteria | 1679 |
| 309 | Ga0207642_10344377 | 3300025899 | Bacteria | 877 |
| 310 | Ga0207710_10000263 | 3300025900 | Bacteria | 43581 |
| 311 | Ga0207710_10079942 | 3300025900 | Bacteria | 1515 |
| 312 | Ga0207710_10140800 | 3300025900 | Bacteria | 1164 |
| 313 | Ga0207710_10196341 | 3300025900 | Bacteria | 995 |
| 314 | Ga0207710_10340513 | 3300025900 | Bacteria | 763 |
| 315 | Ga0207688_10019300 | 3300025901 | Bacteria | 3712 |
| 316 | Ga0207688_10506750 | 3300025901 | Bacteria | 756 |
| 317 | Ga0207680_10035392 | 3300025903 | Bacteria | 2867 |
| 318 | Ga0207680_11099990 | 3300025903 | Bacteria | 568 |
| 319 | Ga0207647_10034828 | 3300025904 | Bacteria | 3211 |
| 320 | Ga0207685_10143931 | 3300025905 | Bacteria | 1072 |
| 321 | Ga0207685_10184472 | 3300025905 | Bacteria | 969 |
| 322 | Ga0207699_10069074 | 3300025906 | Bacteria | 2153 |
| 323 | Ga0207699_10427800 | 3300025906 | Bacteria | 947 |
| 324 | Ga0207699_10679700 | 3300025906 | Bacteria | 753 |
| 325 | Ga0207645_10010653 | 3300025907 | Bacteria | 6308 |
| 326 | Ga0207643_10260856 | 3300025908 | Bacteria | 1070 |
| 327 | Ga0207705_10163937 | 3300025909 | Bacteria | 1671 |
| 328 | Ga0207654_10160709 | 3300025911 | Bacteria | 1451 |
| 329 | Ga0207671_10020933 | 3300025914 | Bacteria | 4972 |
| 330 | Ga0207671_10672702 | 3300025914 | Bacteria | 824 |
| 331 | Ga0207693_10015796 | 3300025915 | Bacteria | 6049 |
| 332 | Ga0207693_10129064 | 3300025915 | Bacteria | 1987 |
| 333 | Ga0207663_10050302 | 3300025916 | Bacteria | 2589 |
| 334 | Ga0207663_10286176 | 3300025916 | Bacteria | 1226 |
| 335 | Ga0207663_11107342 | 3300025916 | Bacteria | 637 |
| 336 | Ga0207662_10091817 | 3300025918 | Bacteria | 1868 |
| 337 | Ga0207649_11133589 | 3300025920 | Bacteria | 617 |
| 338 | Ga0207681_10004263 | 3300025923 | Bacteria | 8826 |
| 339 | Ga0207681_10862482 | 3300025923 | Bacteria | 757 |
| 340 | Ga0207694_10400410 | 3300025924 | Bacteria | 1141 |
| 341 | Ga0207694_10461393 | 3300025924 | Bacteria | 1061 |
| 342 | Ga0207694_10621533 | 3300025924 | Bacteria | 909 |
| 343 | Ga0207650_11008347 | 3300025925 | Bacteria | 708 |
| 344 | Ga0207687_10080878 | 3300025927 | Bacteria | 2347 |
| 345 | Ga0207687_10789280 | 3300025927 | Bacteria | 810 |
| 346 | Ga0207687_10815187 | 3300025927 | Bacteria | 796 |
| 347 | Ga0207700_10364492 | 3300025928 | Bacteria | 1260 |
| 348 | Ga0207700_10532690 | 3300025928 | Bacteria | 1041 |
| 349 | Ga0207644_10023915 | 3300025931 | Bacteria | 4190 |
| 350 | Ga0207644_10224507 | 3300025931 | Bacteria | 1490 |
| 351 | Ga0207644_11441206 | 3300025931 | Bacteria | 578 |
| 352 | Ga0207690_10282556 | 3300025932 | Bacteria | 1293 |
| 353 | Ga0207690_10525368 | 3300025932 | Bacteria | 960 |
| 354 | Ga0207706_10011311 | 3300025933 | Bacteria | 8131 |
| 355 | Ga0207706_10471147 | 3300025933 | Bacteria | 1085 |
| 356 | Ga0207706_11264658 | 3300025933 | Bacteria | 611 |
| 357 | Ga0207686_10062265 | 3300025934 | Bacteria | 2368 |
| 358 | Ga0207709_10100118 | 3300025935 | Bacteria | 1914 |
| 359 | Ga0207709_10121588 | 3300025935 | Bacteria | 1764 |
| 360 | Ga0207709_10800589 | 3300025935 | Bacteria | 761 |
| 361 | Ga0207709_11565935 | 3300025935 | Bacteria | 547 |
| 362 | Ga0207670_10257882 | 3300025936 | Bacteria | 1350 |
| 363 | Ga0207670_10531148 | 3300025936 | Bacteria | 959 |
| 364 | Ga0207669_10069211 | 3300025937 | Bacteria | 2207 |
| 365 | Ga0207669_10088478 | 3300025937 | Bacteria | 2008 |
| 366 | Ga0207669_10234010 | 3300025937 | Bacteria | 1357 |
| 367 | Ga0207704_10050726 | 3300025938 | Bacteria | 2505 |
| 368 | Ga0207704_10080189 | 3300025938 | Bacteria | 2106 |
| 369 | Ga0207704_10093216 | 3300025938 | Bacteria | 1984 |
| 370 | Ga0207704_10389140 | 3300025938 | Bacteria | 1097 |
| 371 | Ga0207665_10013432 | 3300025939 | Bacteria | 5384 |
| 372 | Ga0207665_10021303 | 3300025939 | Bacteria | 4262 |
| 373 | Ga0207665_10458465 | 3300025939 | Bacteria | 979 |
| 374 | Ga0207665_10607145 | 3300025939 | Bacteria | 855 |
| 375 | Ga0207691_10121641 | 3300025940 | Bacteria | 2313 |
| 376 | Ga0207691_10145610 | 3300025940 | Bacteria | 2085 |
| 377 | Ga0207711_10002374 | 3300025941 | Bacteria | 16853 |
| 378 | Ga0207711_10133249 | 3300025941 | Bacteria | 2230 |
| 379 | Ga0207711_10327481 | 3300025941 | Bacteria | 1416 |
| 380 | Ga0207711_10623806 | 3300025941 | Bacteria | 1006 |
| 381 | Ga0207711_10874221 | 3300025941 | Bacteria | 836 |
| 382 | Ga0207689_10018584 | 3300025942 | Bacteria | 5864 |
| 383 | Ga0207667_10138782 | 3300025949 | Bacteria | 2503 |
| 384 | Ga0207667_10259210 | 3300025949 | Bacteria | 1778 |
| 385 | Ga0207651_10763336 | 3300025960 | Bacteria | 855 |
| 386 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 387 | Ga0207712_10177806 | 3300025961 | Bacteria | 1669 |
| 388 | Ga0207712_10695480 | 3300025961 | Bacteria | 887 |
| 389 | Ga0207668_10000743 | 3300025972 | Bacteria | 19893 |
| 390 | Ga0207668_10121415 | 3300025972 | Bacteria | 1979 |
| 391 | Ga0207668_10130203 | 3300025972 | Bacteria | 1920 |
| 392 | Ga0207668_10172034 | 3300025972 | Bacteria | 1700 |
| 393 | Ga0207668_10607086 | 3300025972 | Bacteria | 953 |
| 394 | Ga0207640_10258523 | 3300025981 | Bacteria | 1355 |
| 395 | Ga0207640_10354149 | 3300025981 | Bacteria | 1180 |
| 396 | Ga0207640_10502487 | 3300025981 | Bacteria | 1010 |
| 397 | Ga0207640_10528075 | 3300025981 | Bacteria | 987 |
| 398 | Ga0207658_10000220 | 3300025986 | Bacteria | 59846 |
| 399 | Ga0207658_10020156 | 3300025986 | Bacteria | 4618 |
| 400 | Ga0207658_10023013 | 3300025986 | Bacteria | 4344 |
| 401 | Ga0207658_10029355 | 3300025986 | Bacteria | 3883 |
| 402 | Ga0207658_10053838 | 3300025986 | Bacteria | 2975 |
| 403 | Ga0207677_10488769 | 3300026023 | Bacteria | 1062 |
| 404 | Ga0207677_10536583 | 3300026023 | Bacteria | 1017 |
| 405 | Ga0207677_10988370 | 3300026023 | Bacteria | 762 |
| 406 | Ga0207703_10049187 | 3300026035 | Bacteria | 3407 |
| 407 | Ga0207703_10261012 | 3300026035 | Bacteria | 1566 |
| 408 | Ga0207703_10416162 | 3300026035 | Bacteria | 1250 |
| 409 | Ga0207703_10423477 | 3300026035 | Bacteria | 1239 |
| 410 | Ga0207703_10591277 | 3300026035 | Bacteria | 1049 |
| 411 | Ga0207639_10092003 | 3300026041 | Bacteria | 2430 |
| 412 | Ga0207639_10283850 | 3300026041 | Bacteria | 1457 |
| 413 | Ga0207678_10033813 | 3300026067 | Bacteria | 4453 |
| 414 | Ga0207678_10053695 | 3300026067 | Bacteria | 3472 |
| 415 | Ga0207678_10095518 | 3300026067 | Bacteria | 2540 |
| 416 | Ga0207708_10600069 | 3300026075 | Bacteria | 933 |
| 417 | Ga0207708_11051813 | 3300026075 | Bacteria | 708 |
| 418 | Ga0207702_10977708 | 3300026078 | Bacteria | 839 |
| 419 | Ga0207641_10000437 | 3300026088 | Bacteria | 47860 |
| 420 | Ga0207641_10079493 | 3300026088 | Bacteria | 2843 |
| 421 | Ga0207641_10232408 | 3300026088 | Bacteria | 1714 |
| 422 | Ga0207641_10453114 | 3300026088 | Bacteria | 1240 |
| 423 | Ga0207641_10659261 | 3300026088 | Bacteria | 1028 |
| 424 | Ga0207648_10023411 | 3300026089 | Bacteria | 5533 |
| 425 | Ga0207648_10754176 | 3300026089 | Bacteria | 904 |
| 426 | Ga0207676_10289069 | 3300026095 | Bacteria | 1492 |
| 427 | Ga0207676_10539344 | 3300026095 | Bacteria | 1113 |
| 428 | Ga0207676_10670217 | 3300026095 | Bacteria | 1002 |
| 429 | Ga0207675_100246115 | 3300026118 | Bacteria | 1729 |
| 430 | Ga0207675_100340011 | 3300026118 | Bacteria | 1469 |
| 431 | Ga0207675_100966983 | 3300026118 | Bacteria | 869 |
| 432 | Ga0207683_10039013 | 3300026121 | Bacteria | 4142 |
| 433 | Ga0207683_10154333 | 3300026121 | Bacteria | 2073 |
| 434 | Ga0207683_10202949 | 3300026121 | Bacteria | 1803 |
| 435 | Ga0207683_10297146 | 3300026121 | Bacteria | 1477 |
| 436 | Ga0207683_10458495 | 3300026121 | Bacteria | 1175 |
| 437 | Ga0207683_10728277 | 3300026121 | Bacteria | 920 |
| 438 | Ga0207698_10588684 | 3300026142 | Bacteria | 1095 |
| 439 | Ga0207698_10614838 | 3300026142 | Bacteria | 1073 |
| 440 | Ga0207698_11341409 | 3300026142 | Bacteria | 730 |
| 441 | Ga0209813_10041151 | 3300027866 | Bacteria | 1407 |
| 442 | Ga0209813_10155261 | 3300027866 | Bacteria | 822 |
| 443 | Ga0268266_10001362 | 3300028379 | Bacteria | 29491 |
| 444 | Ga0268266_10012103 | 3300028379 | Bacteria | 7467 |
| 445 | Ga0268266_10319251 | 3300028379 | Bacteria | 1453 |
| 446 | Ga0268266_11060641 | 3300028379 | Bacteria | 784 |
| 447 | Ga0268266_11256195 | 3300028379 | Bacteria | 716 |
| 448 | Ga0268266_11291575 | 3300028379 | Bacteria | 705 |
| 449 | Ga0268266_11464426 | 3300028379 | Bacteria | 658 |
| 450 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 451 | Ga0268265_10115130 | 3300028380 | Bacteria | 2203 |
| 452 | Ga0268265_10625650 | 3300028380 | Bacteria | 1032 |
| 453 | Ga0268265_10921125 | 3300028380 | Bacteria | 859 |
| 454 | Ga0268265_11040140 | 3300028380 | Bacteria | 810 |
| 455 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 456 | Ga0268264_10133110 | 3300028381 | Bacteria | 2207 |
| 457 | Ga0268264_11112020 | 3300028381 | Bacteria | 799 |
| 458 | Ga0307413_11603130 | 3300031824 | Bacteria | 578 |
| 459 | Ga0307410_10034512 | 3300031852 | Bacteria | 3277 |
| 460 | Ga0307410_11247926 | 3300031852 | Bacteria | 649 |
| 461 | Ga0307410_11804209 | 3300031852 | Bacteria | 543 |
| 462 | Ga0307407_10024784 | 3300031903 | Bacteria | 3152 |
| 463 | Ga0307407_10164583 | 3300031903 | Bacteria | 1455 |
| 464 | Ga0307412_10061732 | 3300031911 | Bacteria | 2521 |
| 465 | Ga0307412_10814369 | 3300031911 | Bacteria | 812 |
| 466 | Ga0307412_11485122 | 3300031911 | Bacteria | 616 |
| 467 | Ga0307409_100243326 | 3300031995 | Bacteria | 1639 |
| 468 | Ga0307414_10204497 | 3300032004 | Bacteria | 1609 |
| 469 | Ga0307414_10934793 | 3300032004 | Bacteria | 796 |
| 470 | Ga0307411_10322502 | 3300032005 | Bacteria | 1248 |
| 471 | Ga0307411_11884777 | 3300032005 | Bacteria | 556 |
| 472 | Ga0307415_100120642 | 3300032126 | Bacteria | 1965 |
| 473 | Ga0307415_100650165 | 3300032126 | Bacteria | 945 |
| 474 | Ga0373958_0201070 | 3300034819 | Bacteria | 522 |
| 475 | Ga0373952_0086123 | 3300035092 | Bacteria | 809 |
| 476 | Ga0373932_0101457 | 3300035112 | Bacteria | 937 |
| 477 | Ga0373961_0124879 | 3300035241 | Bacteria | 856 |
| 478 | Ga0373931_0085985 | 3300035691 | Bacteria | 1744 |
| 479 | Ga0373931_0234393 | 3300035691 | Bacteria | 1110 |
| 480 | Ga0439436_0098676 | 3300041404 | Bacteria | 814 |
| 481 | Ga0439461_0050756 | 3300041410 | Bacteria | 919 |
| 482 | Ga0439461_0056440 | 3300041410 | Bacteria | 882 |
| 483 | Ga0439466_0006222 | 3300041411 | Bacteria | 4544 |
| 484 | Ga0439466_0015440 | 3300041411 | Bacteria | 2773 |
| 485 | Ga0439465_0008521 | 3300041413 | Bacteria | 3234 |
| 486 | Ga0439465_0030042 | 3300041413 | Bacteria | 1727 |
| 487 | Ga0439465_0309382 | 3300041413 | Bacteria | 592 |
| 488 | Ga0451793_0382928 | 3300041452 | Bacteria | 1003 |
| 489 | Ga0451795_0332063 | 3300041456 | Bacteria | 1193 |
| 490 | Ga0451802_1020011 | 3300041460 | Bacteria | 954 |
| 491 | Ga0451806_234695 | 3300041462 | Bacteria | 836 |
| 492 | Ga0451849_1134475 | 3300041505 | Bacteria | 780 |
| 493 | Ga0451851_0386491 | 3300041507 | Bacteria | 2177 |
| 494 | Ga0451853_2082484 | 3300041512 | Bacteria | 1020 |
| 495 | Ga0439431_0004898 | 3300041997 | Bacteria | 2951 |
| 496 | Ga0439442_011258 | 3300042002 | Bacteria | 1819 |
| 497 | Ga0439445_0004645 | 3300042004 | Bacteria | 3114 |
| 498 | Ga0439445_0010971 | 3300042004 | Bacteria | 2152 |
| 499 | Ga0439450_022713 | 3300042008 | Bacteria | 1357 |
| 500 | Ga0439434_0021846 | 3300042435 | Bacteria | 1923 |
| 501 | Ga0466972_0008913 | 3300044658 | Bacteria | 5032 |
| 502 | Ga0466972_0015341 | 3300044658 | Bacteria | 3830 |
| 503 | Ga0466972_0030250 | 3300044658 | Bacteria | 2666 |
| 504 | Ga0466972_0071967 | 3300044658 | Bacteria | 1649 |
| 505 | Ga0466972_0099630 | 3300044658 | Bacteria | 1375 |
| 506 | Ga0466972_0319248 | 3300044658 | Bacteria | 726 |
| 507 | Ga0466965_0002694 | 3300044683 | Bacteria | 7604 |
| 508 | Ga0466965_0073984 | 3300044683 | Bacteria | 1716 |
| 509 | Ga0466961_0049062 | 3300044693 | Bacteria | 2699 |
| 510 | Ga0466964_0696466 | 3300044706 | Bacteria | 566 |
| 511 | Ga0466968_0050691 | 3300044735 | Bacteria | 1772 |
| 512 | Ga0466970_0054459 | 3300044765 | Bacteria | 2136 |
| 513 | Ga0466970_0173730 | 3300044765 | Bacteria | 1194 |
| 514 | Ga0466970_0701835 | 3300044765 | Bacteria | 590 |
| 515 | Ga0466957_0009124 | 3300044842 | Bacteria | 5656 |
| 516 | Ga0466957_0565758 | 3300044842 | Bacteria | 793 |
| 517 | Ga0466960_0050259 | 3300044901 | Bacteria | 2010 |
| 518 | Ga0466959_0046300 | 3300045049 | Bacteria | 3201 |
| 519 | Ga0466958_0085205 | 3300045836 | Bacteria | 1949 |
| 520 | Ga0466967_0263044 | 3300045976 | Bacteria | 1651 |
| 521 | Ga0466967_0355692 | 3300045976 | Bacteria | 1418 |
| 522 | Ga0495629_0004769 | 3300046459 | Bacteria | 10167 |
| 523 | Ga0495629_0234133 | 3300046459 | Bacteria | 1266 |
| 524 | Ga0495638_0005530 | 3300046460 | Bacteria | 9377 |
| 525 | Ga0495638_0334245 | 3300046460 | Bacteria | 805 |
| 526 | Ga0495582_0299622 | 3300046473 | Bacteria | 924 |
| 527 | Ga0495582_0454156 | 3300046473 | Bacteria | 740 |
| 528 | Ga0495662_0072499 | 3300046476 | Bacteria | 1670 |
| 529 | Ga0495594_0052719 | 3300046499 | Bacteria | 2240 |
| 530 | Ga0495583_0126820 | 3300046506 | Bacteria | 1070 |
| 531 | Ga0495606_0110052 | 3300046507 | Bacteria | 1663 |
| 532 | Ga0495618_0162594 | 3300046514 | Bacteria | 1423 |
| 533 | Ga0495643_0481491 | 3300046522 | Bacteria | 536 |
| 534 | Ga0495648_0011454 | 3300046524 | Bacteria | 6677 |
| 535 | Ga0495642_0263579 | 3300046528 | Bacteria | 754 |
| 536 | Ga0495640_0037508 | 3300046533 | Bacteria | 3419 |
| 537 | Ga0495640_0462616 | 3300046533 | Bacteria | 774 |
| 538 | Ga0495668_0034340 | 3300046616 | Bacteria | 2846 |
| 539 | Ga0495658_0191758 | 3300046683 | Bacteria | 1271 |
| 540 | Ga0495613_0004713 | 3300046689 | Bacteria | 10235 |
| 541 | Ga0495624_0655252 | 3300046690 | Bacteria | 624 |
| 542 | Ga0495649_0392751 | 3300046694 | Bacteria | 697 |
| 543 | Ga0495581_0215188 | 3300047315 | Bacteria | 1123 |
| 544 | Ga0495604_0089758 | 3300047317 | Bacteria | 2284 |
| 545 | Ga0495674_0495613 | 3300047319 | Bacteria | 978 |
| 546 | Ga0495672_0069647 | 3300047320 | Bacteria | 1996 |
| 547 | Ga0495672_0079706 | 3300047320 | Bacteria | 1828 |
| 548 | Ga0495672_0228303 | 3300047320 | Bacteria | 915 |
| 549 | Ga0495676_0001154 | 3300047321 | Bacteria | 22464 |
| 550 | Ga0495676_0101381 | 3300047321 | Bacteria | 2130 |
| 551 | Ga0495673_0002084 | 3300047469 | Bacteria | 14599 |
| 552 | Ga0495686_0006659 | 3300047472 | Bacteria | 8795 |
| 553 | Ga0495686_0339170 | 3300047472 | Bacteria | 820 |
| 554 | Ga0495593_0006679 | 3300047673 | Bacteria | 6753 |
| 555 | Ga0495614_0000610 | 3300048089 | Bacteria | 14964 |
| 556 | Ga0495626_0052874 | 3300048091 | Bacteria | 1871 |
| 557 | Ga0496100_0004047 | 3300048903 | Bacteria | 7725 |
| 558 | Ga0496100_0008578 | 3300048903 | Bacteria | 5705 |
| 559 | Ga0496100_0011790 | 3300048903 | Bacteria | 4988 |
| 560 | Ga0496100_0033241 | 3300048903 | Bacteria | 3226 |
| 561 | Ga0496100_0052355 | 3300048903 | Bacteria | 2654 |
| 562 | Ga0496100_0130670 | 3300048903 | Bacteria | 1768 |
| 563 | Ga0496100_0364298 | 3300048903 | Bacteria | 1094 |
| 564 | Ga0496101_0000299 | 3300048904 | Bacteria | 34617 |
| 565 | Ga0496101_0000926 | 3300048904 | Bacteria | 17310 |
| 566 | Ga0496101_0001429 | 3300048904 | Bacteria | 14266 |
| 567 | Ga0496101_0006786 | 3300048904 | Bacteria | 7383 |
| 568 | Ga0496101_0136105 | 3300048904 | Bacteria | 1869 |
| 569 | Ga0496101_0536336 | 3300048904 | Bacteria | 925 |
| 570 | Ga0496101_0641075 | 3300048904 | Bacteria | 839 |
| 571 | Ga0496101_0963587 | 3300048904 | Bacteria | 671 |
| 572 | Ga0496101_1147797 | 3300048904 | Bacteria | 609 |
| 573 | Ga0496102_0000007 | 3300048905 | Bacteria | 417224 |
| 574 | Ga0496102_0000249 | 3300048905 | Bacteria | 70385 |
| 575 | Ga0496102_0066057 | 3300048905 | Bacteria | 3315 |
| 576 | Ga0496102_0076689 | 3300048905 | Bacteria | 3075 |
| 577 | Ga0496102_0150467 | 3300048905 | Bacteria | 2187 |
| 578 | Ga0496102_0444591 | 3300048905 | Bacteria | 1216 |
| 579 | Ga0496102_0967732 | 3300048905 | Bacteria | 772 |
| 580 | Ga0496103_0000013 | 3300048906 | Bacteria | 297928 |
| 581 | Ga0496103_0023577 | 3300048906 | Bacteria | 3712 |
| 582 | Ga0496103_0067902 | 3300048906 | Bacteria | 2227 |
| 583 | Ga0496103_0069420 | 3300048906 | Bacteria | 2203 |
| 584 | Ga0496103_0085586 | 3300048906 | Bacteria | 1986 |
| 585 | Ga0496103_0142453 | 3300048906 | Bacteria | 1534 |
| 586 | Ga0496103_0534225 | 3300048906 | Bacteria | 749 |
| 587 | Ga0496104_0002493 | 3300048907 | Bacteria | 15843 |
| 588 | Ga0496104_0039487 | 3300048907 | Bacteria | 4419 |
| 589 | Ga0496104_0608122 | 3300048907 | Bacteria | 1003 |
| 590 | Ga0496105_0009048 | 3300048908 | Bacteria | 7771 |
| 591 | Ga0496105_0032385 | 3300048908 | Bacteria | 4289 |
| 592 | Ga0496105_0193940 | 3300048908 | Bacteria | 1660 |
| 593 | Ga0496105_0283327 | 3300048908 | Bacteria | 1336 |
| 594 | Ga0496105_1324089 | 3300048908 | Bacteria | 525 |
| 595 | Ga0496106_0014630 | 3300048909 | Bacteria | 5798 |
| 596 | Ga0496106_0031315 | 3300048909 | Bacteria | 3963 |
| 597 | Ga0496106_0032115 | 3300048909 | Bacteria | 3913 |
| 598 | Ga0496106_0056434 | 3300048909 | Bacteria | 2968 |
| 599 | Ga0496106_0082400 | 3300048909 | Bacteria | 2473 |
| 600 | Ga0496106_0216233 | 3300048909 | Bacteria | 1527 |
| 601 | Ga0496106_0970471 | 3300048909 | Bacteria | 669 |
| 602 | Ga0496107_0003186 | 3300048910 | Bacteria | 10911 |
| 603 | Ga0496107_0003918 | 3300048910 | Bacteria | 10006 |
| 604 | Ga0496107_0024700 | 3300048910 | Bacteria | 4252 |
| 605 | Ga0496107_0027942 | 3300048910 | Bacteria | 4007 |
| 606 | Ga0496107_0481503 | 3300048910 | Bacteria | 921 |
| 607 | Ga0496108_0012071 | 3300048911 | Bacteria | 7024 |
| 608 | Ga0496108_0135640 | 3300048911 | Bacteria | 2117 |
| 609 | Ga0496108_0189202 | 3300048911 | Bacteria | 1784 |
| 610 | Ga0496108_0463692 | 3300048911 | Bacteria | 1107 |
| 611 | Ga0496108_0981024 | 3300048911 | Bacteria | 722 |
| 612 | Ga0496109_0077885 | 3300048912 | Bacteria | 3051 |
| 613 | Ga0496109_0167489 | 3300048912 | Bacteria | 2061 |
| 614 | Ga0496109_1098843 | 3300048912 | Bacteria | 732 |
| 615 | Ga0496110_0790590 | 3300048913 | Bacteria | 853 |
| 616 | Ga0496110_0852603 | 3300048913 | Bacteria | 816 |
| 617 | Ga0496111_0167722 | 3300048914 | Bacteria | 1631 |
| 618 | Ga0496112_0021987 | 3300048915 | Bacteria | 6071 |
| 619 | Ga0496112_0146419 | 3300048915 | Bacteria | 2330 |
| 620 | Ga0496112_0498561 | 3300048915 | Bacteria | 1153 |
| 621 | Ga0496112_0810557 | 3300048915 | Bacteria | 861 |
| 622 | Ga0496113_0087906 | 3300048916 | Bacteria | 2390 |
| 623 | Ga0496113_0159075 | 3300048916 | Bacteria | 1785 |
| 624 | Ga0496114_0002207 | 3300048917 | Bacteria | 14830 |
| 625 | Ga0496114_0002582 | 3300048917 | Bacteria | 13831 |
| 626 | Ga0496114_0004034 | 3300048917 | Bacteria | 11338 |
| 627 | Ga0496114_0586778 | 3300048917 | Bacteria | 983 |
| 628 | Ga0496115_0008694 | 3300048918 | Bacteria | 7524 |
| 629 | Ga0496115_0022166 | 3300048918 | Bacteria | 4916 |
| 630 | Ga0496115_0088000 | 3300048918 | Bacteria | 2535 |
| 631 | Ga0496115_0566752 | 3300048918 | Bacteria | 906 |
| 632 | Ga0496115_0584670 | 3300048918 | Bacteria | 889 |
| 633 | Ga0496115_1307168 | 3300048918 | Bacteria | 540 |
| 634 | Ga0496116_0000033 | 3300048919 | Bacteria | 418191 |
| 635 | Ga0496116_0034457 | 3300048919 | Bacteria | 3571 |
| 636 | Ga0496117_0000025 | 3300048920 | Bacteria | 418106 |
| 637 | Ga0496117_0006852 | 3300048920 | Bacteria | 11321 |
| 638 | Ga0496118_0000023 | 3300048921 | Bacteria | 418106 |
| 639 | Ga0496118_0069537 | 3300048921 | Bacteria | 2548 |
| 640 | Ga0496119_0001166 | 3300048922 | Bacteria | 32898 |
| 641 | Ga0496119_0011509 | 3300048922 | Bacteria | 7313 |
| 642 | Ga0496119_0573306 | 3300048922 | Bacteria | 516 |
| 643 | Ga0496120_0007290 | 3300048923 | Bacteria | 8259 |
| 644 | Ga0496120_0011731 | 3300048923 | Bacteria | 6007 |
| 645 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 646 | Ga0496121_0005272 | 3300048924 | Bacteria | 16684 |
| 647 | Ga0496121_0467679 | 3300048924 | Bacteria | 808 |
| 648 | Ga0496121_0486587 | 3300048924 | Bacteria | 787 |
| 649 | Ga0496122_0019511 | 3300048925 | Bacteria | 6188 |
| 650 | Ga0496123_0038368 | 3300048926 | Bacteria | 3368 |
| 651 | Ga0496123_0430720 | 3300048926 | Bacteria | 592 |
| 652 | Ga0496124_0196177 | 3300048927 | Bacteria | 1540 |
| 653 | Ga0496124_0264191 | 3300048927 | Bacteria | 1264 |
| 654 | Ga0496125_0028720 | 3300048928 | Bacteria | 5015 |
| 655 | Ga0496126_0000968 | 3300048929 | Bacteria | 49270 |
| 656 | Ga0496126_0047629 | 3300048929 | Bacteria | 3924 |
| 657 | Ga0496126_0073297 | 3300048929 | Bacteria | 3044 |
| 658 | Ga0496126_0116218 | 3300048929 | Bacteria | 2325 |
| 659 | Ga0496126_0331723 | 3300048929 | Bacteria | 1248 |
| 660 | Ga0496126_0979878 | 3300048929 | Bacteria | 636 |
| 661 | Ga0501034_0218530 | 3300049571 | Bacteria | 1859 |
| 662 | Ga0501043_0443588 | 3300049579 | Bacteria | 976 |
| 663 | Ga0501067_0213017 | 3300049583 | Bacteria | 1076 |
| 664 | nmdc:mga03683_141464_c1 | 3300050489 | Bacteria | 1082 |
| 665 | nmdc:mga03683_171812_c1 | 3300050489 | Bacteria | 985 |
| 666 | nmdc:mga03683_74400_c1 | 3300050489 | Bacteria | 1457 |
| 667 | nmdc:mga03683_85083_c1 | 3300050489 | Bacteria | 1371 |
| 668 | nmdc:mga03n38_150708_c1 | 3300050490 | Bacteria | 1170 |
| 669 | nmdc:mga03n38_19058_c1 | 3300050490 | Bacteria | 2719 |
| 670 | nmdc:mga03n38_298764_c1 | 3300050490 | Bacteria | 864 |
| 671 | nmdc:mga03n38_331717_c1 | 3300050490 | Bacteria | 824 |
| 672 | nmdc:mga03n38_481962_c1 | 3300050490 | Bacteria | 694 |
| 673 | nmdc:mga03n38_57144_c1 | 3300050490 | Bacteria | 1763 |
| 674 | nmdc:mga03n38_610_c1 | 3300050490 | Bacteria | 9139 |
| 675 | nmdc:mga03n38_76983_c1 | 3300050490 | Bacteria | 1558 |
| 676 | nmdc:mga03n38_9017_c1 | 3300050490 | Bacteria | 3607 |
| 677 | nmdc:mga00v17_15989_c1 | 3300050491 | Bacteria | 4223 |
| 678 | nmdc:mga00v17_184532_c1 | 3300050491 | Bacteria | 1346 |
| 679 | nmdc:mga00v17_300693_c1 | 3300050491 | Bacteria | 1042 |
| 680 | nmdc:mga00v17_318641_c1 | 3300050491 | Bacteria | 1010 |
| 681 | nmdc:mga00v17_365278_c1 | 3300050491 | Bacteria | 938 |
| 682 | nmdc:mga00v17_3800_c1 | 3300050491 | Bacteria | 7789 |
| 683 | nmdc:mga00v17_383905_c1 | 3300050491 | Bacteria | 913 |
| 684 | nmdc:mga00v17_799436_c1 | 3300050491 | Bacteria | 601 |
| 685 | nmdc:mga00v17_84857_c1 | 3300050491 | Bacteria | 1983 |
| 686 | nmdc:mga00v17_857210_c1 | 3300050491 | Bacteria | 577 |
| 687 | nmdc:mga0yw44_100082_c1 | 3300050492 | Bacteria | 1845 |
| 688 | nmdc:mga0yw44_224746_c1 | 3300050492 | Bacteria | 1245 |
| 689 | nmdc:mga0yw44_571134_c1 | 3300050492 | Bacteria | 768 |
| 690 | nmdc:mga0yw44_73536_c2 | 3300050492 | Bacteria | 1692 |
| 691 | nmdc:mga0yw44_77624_c1 | 3300050492 | Bacteria | 2075 |
| 692 | nmdc:mga0yw44_777334_c1 | 3300050492 | Bacteria | 650 |
| 693 | nmdc:mga0yw44_847394_c1 | 3300050492 | Bacteria | 620 |
| 694 | nmdc:mga0yw44_883689_c1 | 3300050492 | Bacteria | 606 |
| 695 | nmdc:mga06z11_30276_c1 | 3300050494 | Bacteria | 2618 |
| 696 | nmdc:mga06z11_324424_c1 | 3300050494 | Bacteria | 919 |
| 697 | nmdc:mga06z11_374274_c1 | 3300050494 | Bacteria | 855 |
| 698 | nmdc:mga06z11_874971_c1 | 3300050494 | Bacteria | 547 |
| 699 | nmdc:mga04h51_49218_c1 | 3300050495 | Bacteria | 1407 |
| 700 | nmdc:mga04h51_88445_c1 | 3300050495 | Bacteria | 1111 |
| 701 | nmdc:mga07m45_233913_c1 | 3300050496 | Bacteria | 1069 |
| 702 | nmdc:mga07m45_24331_c1 | 3300050496 | Bacteria | 3316 |
| 703 | nmdc:mga07m45_274345_c1 | 3300050496 | Bacteria | 981 |
| 704 | nmdc:mga07m45_323692_c1 | 3300050496 | Bacteria | 896 |
| 705 | nmdc:mga05p37_5263_c1 | 3300050507 | Bacteria | 15185 |
| 706 | nmdc:mga09592_8133_c1 | 3300050508 | Bacteria | 8528 |
| 707 | nmdc:mga0qj67_6961_c1 | 3300050509 | Bacteria | 8327 |
| 708 | nmdc:mga06r32_6833_c1 | 3300050510 | Bacteria | 10257 |
| 709 | nmdc:mga0n895_1051935_c1 | 3300050512 | Bacteria | 793 |
| 710 | nmdc:mga0a205_567464_c1 | 3300050515 | Bacteria | 989 |
| 711 | nmdc:mga0sz30_113875_c1 | 3300050516 | Bacteria | 1186 |
| 712 | nmdc:mga0sz30_192740_c1 | 3300050516 | Bacteria | 905 |
| 713 | nmdc:mga0sz30_49125_c1 | 3300050516 | Bacteria | 1787 |
| 714 | nmdc:mga0sz30_509936_c1 | 3300050516 | Bacteria | 541 |
| 715 | nmdc:mga0sz30_63539_c1 | 3300050516 | Bacteria | 1580 |
| 716 | nmdc:mga0sz30_688_c1 | 3300050516 | Bacteria | 12503 |
| 717 | Ga0495601_0264247 | 3300053077 | Bacteria | 1123 |
| 718 | Ga0500635_0002835 | 3300053080 | Bacteria | 4308 |
| 719 | Ga0495619_0205580 | 3300053085 | Bacteria | 1363 |
| 720 | Ga0500578_0558782 | 3300053086 | Bacteria | 635 |
| 721 | Ga0500643_001472 | 3300053087 | Bacteria | 13514 |
| 722 | Ga0500643_002249 | 3300053087 | Bacteria | 10167 |
| 723 | Ga0500641_0234943 | 3300053096 | Bacteria | 773 |
| 724 | Ga0500556_0056120 | 3300053104 | Bacteria | 1438 |
| 725 | Ga0500562_014800 | 3300053108 | Bacteria | 1999 |
| 726 | Ga0500569_239856 | 3300053109 | Bacteria | 615 |
| 727 | Ga0500572_157678 | 3300053111 | Bacteria | 742 |
| 728 | Ga0500652_002611 | 3300053131 | Bacteria | 5448 |
| 729 | Ga0500559_0037018 | 3300053136 | Bacteria | 2114 |
| 730 | Ga0500568_0093889 | 3300053139 | Bacteria | 1130 |
| 731 | Ga0500588_0286849 | 3300053146 | Bacteria | 622 |
| 732 | Ga0500604_0108397 | 3300053151 | Bacteria | 921 |
| 733 | Ga0500616_0003418 | 3300053153 | Bacteria | 12160 |
| 734 | Ga0500633_0053075 | 3300053160 | Bacteria | 1405 |
| 735 | Ga0466962_0023406 | 3300061719 | Bacteria | 2969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100534923 | Ga0070665_1005349232 | 118 |
| 2 | 3300028379 | Ga0268266_11291575 | Ga0268266_112915751 | 118 |
| 3 | 3300041452 | Ga0451793_0382928 | Ga0451793_0382928_256_678 | 118 |
| 4 | 3300005456 | Ga0070678_100545073 | Ga0070678_1005450732 | 122 |
| 5 | 3300026121 | Ga0207683_10458495 | Ga0207683_104584952 | 122 |
| 6 | iso_pu_bacteria | 2738541274 | 2738703972 | 124 |
| 7 | iso_pu_bacteria | 2738543028 | 2739330845 | 124 |
| 8 | iso_pu_bacteria | 2643221687 | 2644488797 | 125 |
| 9 | iso_pu_bacteria | 2902837492 | 2902838672 | 125 |
| 10 | iso_pu_bacteria | 2939582691 | 2939588329 | 125 |
| 11 | iso_pu_bacteria | 2643221715 | 2644635231 | 126 |
| 12 | iso_pu_bacteria | 2842134933 | 2842137541 | 126 |
| 13 | iso_pu_bacteria | 2862507626 | 2862513710 | 126 |
| 14 | iso_pu_bacteria | 2902792274 | 2902794799 | 126 |
| 15 | iso_pu_bacteria | 2902810491 | 2902812890 | 126 |
| 16 | iso_pu_bacteria | 8025530807 | 8025538195 | 126 |
| 17 | 3300006186 | Ga0075369_10010261 | Ga0075369_100102614 | 128 |
| 18 | 3300006186 | Ga0075369_10535737 | Ga0075369_105357371 | 128 |
| 19 | 3300006844 | Ga0075428_100010132 | Ga0075428_1000101326 | 128 |
| 20 | 3300006846 | Ga0075430_100002450 | Ga0075430_10000245017 | 128 |
| 21 | 3300006847 | Ga0075431_100002383 | Ga0075431_10000238315 | 128 |
| 22 | 3300006880 | Ga0075429_100003191 | Ga0075429_10000319112 | 128 |
| 23 | 3300009147 | Ga0114129_10004429 | Ga0114129_100044294 | 128 |
| 24 | 3300025303 | Ga0209051_1023237 | Ga0209051_10232372 | 128 |
| 25 | 3300041507 | Ga0451851_0386491 | Ga0451851_0386491_1215_1601 | 128 |
| 26 | 3300046460 | Ga0495638_0334245 | Ga0495638_0334245_257_643 | 128 |
| 27 | 3300047320 | Ga0495672_0079706 | Ga0495672_0079706_1414_1800 | 128 |
| 28 | 3300048904 | Ga0496101_0536336 | Ga0496101_0536336_206_592 | 128 |
| 29 | 3300048924 | Ga0496121_0467679 | Ga0496121_0467679_233_619 | 128 |
| 30 | 3300048924 | Ga0496121_0486587 | Ga0496121_0486587_300_686 | 128 |
| 31 | 3300048929 | Ga0496126_0047629 | Ga0496126_0047629_2819_3205 | 128 |
| 32 | 3300050492 | nmdc:mga0yw44_847394_c1 | nmdc:mga0yw44_847394_c1_193_579 | 128 |
| 33 | 3300050507 | nmdc:mga05p37_5263_c1 | nmdc:mga05p37_5263_c1_1727_2119 | 128 |
| 34 | 3300050508 | nmdc:mga09592_8133_c1 | nmdc:mga09592_8133_c1_1828_2220 | 128 |
| 35 | 3300050509 | nmdc:mga0qj67_6961_c1 | nmdc:mga0qj67_6961_c1_3785_4177 | 128 |
| 36 | 3300050510 | nmdc:mga06r32_6833_c1 | nmdc:mga06r32_6833_c1_1783_2175 | 128 |
| 37 | 3300050516 | nmdc:mga0sz30_509936_c1 | nmdc:mga0sz30_509936_c1_117_503 | 128 |
| 38 | 3300053086 | Ga0500578_0558782 | Ga0500578_0558782_32_418 | 128 |
| 39 | 3300053087 | Ga0500643_002249 | Ga0500643_002249_3641_4027 | 128 |
| 40 | 3300053096 | Ga0500641_0234943 | Ga0500641_0234943_157_543 | 128 |
| 41 | 3300053111 | Ga0500572_157678 | Ga0500572_157678_52_438 | 128 |
| 42 | 3300053136 | Ga0500559_0037018 | Ga0500559_0037018_1028_1414 | 128 |
| 43 | 3300053146 | Ga0500588_0286849 | Ga0500588_0286849_71_457 | 128 |
| 44 | 3300003792 | Ga0055540_1001555 | Ga0055540_10015553 | 129 |
| 45 | 3300003792 | Ga0055540_1001762 | Ga0055540_10017628 | 129 |
| 46 | 3300003792 | Ga0055540_1005999 | Ga0055540_10059992 | 129 |
| 47 | 3300005347 | Ga0070668_100780838 | Ga0070668_1007808382 | 129 |
| 48 | 3300005355 | Ga0070671_100357800 | Ga0070671_1003578002 | 129 |
| 49 | 3300005356 | Ga0070674_100117581 | Ga0070674_1001175812 | 129 |
| 50 | 3300005365 | Ga0070688_100774567 | Ga0070688_1007745672 | 129 |
| 51 | 3300005439 | Ga0070711_101636906 | Ga0070711_1016369061 | 129 |
| 52 | 3300005466 | Ga0070685_11283852 | Ga0070685_112838521 | 129 |
| 53 | 3300005548 | Ga0070665_100578672 | Ga0070665_1005786722 | 129 |
| 54 | 3300005578 | Ga0068854_100582206 | Ga0068854_1005822062 | 129 |
| 55 | 3300005841 | Ga0068863_100083739 | Ga0068863_1000837394 | 129 |
| 56 | 3300006038 | Ga0075365_10123630 | Ga0075365_101236302 | 129 |
| 57 | 3300006038 | Ga0075365_10169666 | Ga0075365_101696662 | 129 |
| 58 | 3300006038 | Ga0075365_10358456 | Ga0075365_103584562 | 129 |
| 59 | 3300006051 | Ga0075364_10190757 | Ga0075364_101907572 | 129 |
| 60 | 3300006051 | Ga0075364_10338707 | Ga0075364_103387071 | 129 |
| 61 | 3300006051 | Ga0075364_10464259 | Ga0075364_104642592 | 129 |
| 62 | 3300006051 | Ga0075364_10725905 | Ga0075364_107259052 | 129 |
| 63 | 3300006177 | Ga0075362_10054166 | Ga0075362_100541662 | 129 |
| 64 | 3300006353 | Ga0075370_10143790 | Ga0075370_101437902 | 129 |
| 65 | 3300006881 | Ga0068865_100427524 | Ga0068865_1004275242 | 129 |
| 66 | 3300009093 | Ga0105240_11204588 | Ga0105240_112045882 | 129 |
| 67 | 3300009101 | Ga0105247_10069419 | Ga0105247_100694193 | 129 |
| 68 | 3300009148 | Ga0105243_12277337 | Ga0105243_122773371 | 129 |
| 69 | 3300009177 | Ga0105248_10894011 | Ga0105248_108940111 | 129 |
| 70 | 3300014968 | Ga0157379_10454283 | Ga0157379_104542832 | 129 |
| 71 | 3300025273 | Ga0209673_1041609 | Ga0209673_10416092 | 129 |
| 72 | 3300025273 | Ga0209673_1090871 | Ga0209673_10908711 | 129 |
| 73 | 3300025303 | Ga0209051_1000594 | Ga0209051_10005948 | 129 |
| 74 | 3300025303 | Ga0209051_1001327 | Ga0209051_100132721 | 129 |
| 75 | 3300025303 | Ga0209051_1002457 | Ga0209051_100245712 | 129 |
| 76 | 3300025303 | Ga0209051_1019705 | Ga0209051_10197052 | 129 |
| 77 | 3300025900 | Ga0207710_10140800 | Ga0207710_101408002 | 129 |
| 78 | 3300025916 | Ga0207663_11107342 | Ga0207663_111073421 | 129 |
| 79 | 3300025931 | Ga0207644_11441206 | Ga0207644_114412061 | 129 |
| 80 | 3300025935 | Ga0207709_11565935 | Ga0207709_115659351 | 129 |
| 81 | 3300025937 | Ga0207669_10234010 | Ga0207669_102340102 | 129 |
| 82 | 3300025938 | Ga0207704_10389140 | Ga0207704_103891402 | 129 |
| 83 | 3300025941 | Ga0207711_10623806 | Ga0207711_106238062 | 129 |
| 84 | 3300025981 | Ga0207640_10502487 | Ga0207640_105024872 | 129 |
| 85 | 3300026067 | Ga0207678_10095518 | Ga0207678_100955182 | 129 |
| 86 | 3300026088 | Ga0207641_10079493 | Ga0207641_100794932 | 129 |
| 87 | 3300026121 | Ga0207683_10202949 | Ga0207683_102029492 | 129 |
| 88 | 3300031852 | Ga0307410_11247926 | Ga0307410_112479262 | 129 |
| 89 | 3300031911 | Ga0307412_10814369 | Ga0307412_108143691 | 129 |
| 90 | 3300032005 | Ga0307411_11884777 | Ga0307411_118847772 | 129 |
| 91 | 3300041456 | Ga0451795_0332063 | Ga0451795_0332063_95_484 | 129 |
| 92 | 3300041460 | Ga0451802_1020011 | Ga0451802_1020011_481_870 | 129 |
| 93 | 3300041462 | Ga0451806_234695 | Ga0451806_234695_112_501 | 129 |
| 94 | 3300041505 | Ga0451849_1134475 | Ga0451849_1134475_248_637 | 129 |
| 95 | 3300041512 | Ga0451853_2082484 | Ga0451853_2082484_303_692 | 129 |
| 96 | 3300046459 | Ga0495629_0004769 | Ga0495629_0004769_590_985 | 129 |
| 97 | 3300046473 | Ga0495582_0454156 | Ga0495582_0454156_211_606 | 129 |
| 98 | 3300046533 | Ga0495640_0462616 | Ga0495640_0462616_212_607 | 129 |
| 99 | 3300046689 | Ga0495613_0004713 | Ga0495613_0004713_3940_4335 | 129 |
| 100 | 3300047320 | Ga0495672_0228303 | Ga0495672_0228303_218_607 | 129 |
| 101 | 3300047321 | Ga0495676_0001154 | Ga0495676_0001154_13538_13933 | 129 |
| 102 | 3300047472 | Ga0495686_0006659 | Ga0495686_0006659_2364_2753 | 129 |
| 103 | 3300047472 | Ga0495686_0339170 | Ga0495686_0339170_293_682 | 129 |
| 104 | 3300047673 | Ga0495593_0006679 | Ga0495593_0006679_4834_5229 | 129 |
| 105 | 3300048089 | Ga0495614_0000610 | Ga0495614_0000610_7608_8003 | 129 |
| 106 | 3300048903 | Ga0496100_0004047 | Ga0496100_0004047_3136_3525 | 129 |
| 107 | 3300048904 | Ga0496101_0000299 | Ga0496101_0000299_2112_2501 | 129 |
| 108 | 3300048905 | Ga0496102_0444591 | Ga0496102_0444591_457_846 | 129 |
| 109 | 3300048907 | Ga0496104_0002493 | Ga0496104_0002493_1983_2372 | 129 |
| 110 | 3300048908 | Ga0496105_0032385 | Ga0496105_0032385_3580_3969 | 129 |
| 111 | 3300048909 | Ga0496106_0014630 | Ga0496106_0014630_4248_4637 | 129 |
| 112 | 3300048910 | Ga0496107_0003918 | Ga0496107_0003918_4017_4406 | 129 |
| 113 | 3300048911 | Ga0496108_0981024 | Ga0496108_0981024_261_650 | 129 |
| 114 | 3300048917 | Ga0496114_0002207 | Ga0496114_0002207_11352_11741 | 129 |
| 115 | 3300048918 | Ga0496115_0022166 | Ga0496115_0022166_859_1248 | 129 |
| 116 | 3300048926 | Ga0496123_0430720 | Ga0496123_0430720_10_399 | 129 |
| 117 | 3300048929 | Ga0496126_0979878 | Ga0496126_0979878_146_535 | 129 |
| 118 | 3300050489 | nmdc:mga03683_74400_c1 | nmdc:mga03683_74400_c1_363_752 | 129 |
| 119 | 3300050491 | nmdc:mga00v17_184532_c1 | nmdc:mga00v17_184532_c1_136_525 | 129 |
| 120 | 3300050491 | nmdc:mga00v17_300693_c1 | nmdc:mga00v17_300693_c1_571_960 | 129 |
| 121 | 3300050491 | nmdc:mga00v17_318641_c1 | nmdc:mga00v17_318641_c1_334_723 | 129 |
| 122 | 3300050491 | nmdc:mga00v17_365278_c1 | nmdc:mga00v17_365278_c1_211_600 | 129 |
| 123 | 3300050491 | nmdc:mga00v17_799436_c1 | nmdc:mga00v17_799436_c1_55_447 | 129 |
| 124 | 3300050492 | nmdc:mga0yw44_100082_c1 | nmdc:mga0yw44_100082_c1_137_529 | 129 |
| 125 | 3300050492 | nmdc:mga0yw44_224746_c1 | nmdc:mga0yw44_224746_c1_231_620 | 129 |
| 126 | 3300050492 | nmdc:mga0yw44_73536_c2 | nmdc:mga0yw44_73536_c2_256_645 | 129 |
| 127 | 3300050496 | nmdc:mga07m45_233913_c1 | nmdc:mga07m45_233913_c1_44_433 | 129 |
| 128 | 3300050516 | nmdc:mga0sz30_49125_c1 | nmdc:mga0sz30_49125_c1_1326_1715 | 129 |
| 129 | 3300053153 | Ga0500616_0003418 | Ga0500616_0003418_7890_8279 | 129 |
| 130 | 3300001977 | JGI24746J21847_1004700 | JGI24746J21847_10047002 | 130 |
| 131 | 3300001978 | JGI24747J21853_1004637 | JGI24747J21853_10046372 | 130 |
| 132 | 3300001989 | JGI24739J22299_10076627 | JGI24739J22299_100766271 | 130 |
| 133 | 3300001991 | JGI24743J22301_10036081 | JGI24743J22301_100360812 | 130 |
| 134 | 3300002070 | JGI24750J21931_1003756 | JGI24750J21931_10037562 | 130 |
| 135 | 3300002074 | JGI24748J21848_1028046 | JGI24748J21848_10280462 | 130 |
| 136 | 3300002075 | JGI24738J21930_10017264 | JGI24738J21930_100172642 | 130 |
| 137 | 3300002076 | JGI24749J21850_1033947 | JGI24749J21850_10339472 | 130 |
| 138 | 3300002244 | JGI24742J22300_10003250 | JGI24742J22300_100032502 | 130 |
| 139 | 3300005328 | Ga0070676_10141824 | Ga0070676_101418241 | 130 |
| 140 | 3300005330 | Ga0070690_100015282 | Ga0070690_1000152824 | 130 |
| 141 | 3300005337 | Ga0070682_100045623 | Ga0070682_1000456233 | 130 |
| 142 | 3300005337 | Ga0070682_100050564 | Ga0070682_1000505642 | 130 |
| 143 | 3300005338 | Ga0068868_100044111 | Ga0068868_1000441112 | 130 |
| 144 | 3300005338 | Ga0068868_101295860 | Ga0068868_1012958601 | 130 |
| 145 | 3300005338 | Ga0068868_101760914 | Ga0068868_1017609141 | 130 |
| 146 | 3300005339 | Ga0070660_100441054 | Ga0070660_1004410541 | 130 |
| 147 | 3300005340 | Ga0070689_100081268 | Ga0070689_1000812681 | 130 |
| 148 | 3300005340 | Ga0070689_100676428 | Ga0070689_1006764282 | 130 |
| 149 | 3300005341 | Ga0070691_10020122 | Ga0070691_100201222 | 130 |
| 150 | 3300005343 | Ga0070687_100165078 | Ga0070687_1001650782 | 130 |
| 151 | 3300005344 | Ga0070661_101290350 | Ga0070661_1012903501 | 130 |
| 152 | 3300005345 | Ga0070692_10071891 | Ga0070692_100718912 | 130 |
| 153 | 3300005345 | Ga0070692_10344252 | Ga0070692_103442522 | 130 |
| 154 | 3300005347 | Ga0070668_100018346 | Ga0070668_1000183465 | 130 |
| 155 | 3300005347 | Ga0070668_100552354 | Ga0070668_1005523542 | 130 |
| 156 | 3300005347 | Ga0070668_101222450 | Ga0070668_1012224501 | 130 |
| 157 | 3300005347 | Ga0070668_101240391 | Ga0070668_1012403911 | 130 |
| 158 | 3300005353 | Ga0070669_100024054 | Ga0070669_1000240545 | 130 |
| 159 | 3300005353 | Ga0070669_100902614 | Ga0070669_1009026141 | 130 |
| 160 | 3300005354 | Ga0070675_101291193 | Ga0070675_1012911931 | 130 |
| 161 | 3300005355 | Ga0070671_100131523 | Ga0070671_1001315232 | 130 |
| 162 | 3300005356 | Ga0070674_100004138 | Ga0070674_10000413810 | 130 |
| 163 | 3300005356 | Ga0070674_100425436 | Ga0070674_1004254362 | 130 |
| 164 | 3300005356 | Ga0070674_100537779 | Ga0070674_1005377792 | 130 |
| 165 | 3300005364 | Ga0070673_100142429 | Ga0070673_1001424292 | 130 |
| 166 | 3300005365 | Ga0070688_100040946 | Ga0070688_1000409462 | 130 |
| 167 | 3300005366 | Ga0070659_100320572 | Ga0070659_1003205722 | 130 |
| 168 | 3300005366 | Ga0070659_100325950 | Ga0070659_1003259501 | 130 |
| 169 | 3300005366 | Ga0070659_100677449 | Ga0070659_1006774491 | 130 |
| 170 | 3300005366 | Ga0070659_100748433 | Ga0070659_1007484332 | 130 |
| 171 | 3300005367 | Ga0070667_100000033 | Ga0070667_10000003320 | 130 |
| 172 | 3300005367 | Ga0070667_100286459 | Ga0070667_1002864592 | 130 |
| 173 | 3300005367 | Ga0070667_100303528 | Ga0070667_1003035282 | 130 |
| 174 | 3300005367 | Ga0070667_100429825 | Ga0070667_1004298251 | 130 |
| 175 | 3300005367 | Ga0070667_100698118 | Ga0070667_1006981181 | 130 |
| 176 | 3300005367 | Ga0070667_100953261 | Ga0070667_1009532611 | 130 |
| 177 | 3300005406 | Ga0070703_10152677 | Ga0070703_101526771 | 130 |
| 178 | 3300005434 | Ga0070709_10367815 | Ga0070709_103678152 | 130 |
| 179 | 3300005434 | Ga0070709_10374096 | Ga0070709_103740961 | 130 |
| 180 | 3300005434 | Ga0070709_11527633 | Ga0070709_115276331 | 130 |
| 181 | 3300005435 | Ga0070714_101058418 | Ga0070714_1010584182 | 130 |
| 182 | 3300005435 | Ga0070714_101631999 | Ga0070714_1016319991 | 130 |
| 183 | 3300005436 | Ga0070713_100525764 | Ga0070713_1005257642 | 130 |
| 184 | 3300005436 | Ga0070713_100617057 | Ga0070713_1006170572 | 130 |
| 185 | 3300005437 | Ga0070710_10033816 | Ga0070710_100338162 | 130 |
| 186 | 3300005437 | Ga0070710_10492806 | Ga0070710_104928062 | 130 |
| 187 | 3300005438 | Ga0070701_10056707 | Ga0070701_100567072 | 130 |
| 188 | 3300005439 | Ga0070711_100090815 | Ga0070711_1000908153 | 130 |
| 189 | 3300005439 | Ga0070711_100144645 | Ga0070711_1001446452 | 130 |
| 190 | 3300005439 | Ga0070711_100447176 | Ga0070711_1004471761 | 130 |
| 191 | 3300005440 | Ga0070705_100422947 | Ga0070705_1004229472 | 130 |
| 192 | 3300005440 | Ga0070705_100483190 | Ga0070705_1004831902 | 130 |
| 193 | 3300005440 | Ga0070705_100491612 | Ga0070705_1004916122 | 130 |
| 194 | 3300005441 | Ga0070700_100063497 | Ga0070700_1000634972 | 130 |
| 195 | 3300005441 | Ga0070700_100067467 | Ga0070700_1000674672 | 130 |
| 196 | 3300005444 | Ga0070694_100307995 | Ga0070694_1003079952 | 130 |
| 197 | 3300005444 | Ga0070694_100669458 | Ga0070694_1006694582 | 130 |
| 198 | 3300005455 | Ga0070663_100060596 | Ga0070663_1000605962 | 130 |
| 199 | 3300005456 | Ga0070678_100024639 | Ga0070678_1000246396 | 130 |
| 200 | 3300005456 | Ga0070678_100094887 | Ga0070678_1000948872 | 130 |
| 201 | 3300005456 | Ga0070678_100354492 | Ga0070678_1003544922 | 130 |
| 202 | 3300005456 | Ga0070678_101454227 | Ga0070678_1014542271 | 130 |
| 203 | 3300005457 | Ga0070662_100050929 | Ga0070662_1000509292 | 130 |
| 204 | 3300005457 | Ga0070662_100483152 | Ga0070662_1004831522 | 130 |
| 205 | 3300005459 | Ga0068867_100038013 | Ga0068867_1000380132 | 130 |
| 206 | 3300005459 | Ga0068867_100758334 | Ga0068867_1007583342 | 130 |
| 207 | 3300005466 | Ga0070685_10074114 | Ga0070685_100741142 | 130 |
| 208 | 3300005539 | Ga0068853_100101330 | Ga0068853_1001013302 | 130 |
| 209 | 3300005543 | Ga0070672_100185834 | Ga0070672_1001858342 | 130 |
| 210 | 3300005543 | Ga0070672_100295908 | Ga0070672_1002959082 | 130 |
| 211 | 3300005544 | Ga0070686_100335988 | Ga0070686_1003359882 | 130 |
| 212 | 3300005544 | Ga0070686_100605690 | Ga0070686_1006056902 | 130 |
| 213 | 3300005544 | Ga0070686_100980936 | Ga0070686_1009809361 | 130 |
| 214 | 3300005545 | Ga0070695_100338423 | Ga0070695_1003384232 | 130 |
| 215 | 3300005545 | Ga0070695_100501856 | Ga0070695_1005018562 | 130 |
| 216 | 3300005546 | Ga0070696_100014832 | Ga0070696_1000148326 | 130 |
| 217 | 3300005546 | Ga0070696_100811813 | Ga0070696_1008118132 | 130 |
| 218 | 3300005547 | Ga0070693_100063599 | Ga0070693_1000635992 | 130 |
| 219 | 3300005547 | Ga0070693_100195834 | Ga0070693_1001958342 | 130 |
| 220 | 3300005548 | Ga0070665_100003442 | Ga0070665_10000344213 | 130 |
| 221 | 3300005548 | Ga0070665_100012426 | Ga0070665_1000124265 | 130 |
| 222 | 3300005548 | Ga0070665_100225233 | Ga0070665_1002252332 | 130 |
| 223 | 3300005548 | Ga0070665_101793508 | Ga0070665_1017935082 | 130 |
| 224 | 3300005548 | Ga0070665_101871361 | Ga0070665_1018713611 | 130 |
| 225 | 3300005549 | Ga0070704_100167139 | Ga0070704_1001671392 | 130 |
| 226 | 3300005549 | Ga0070704_100581033 | Ga0070704_1005810332 | 130 |
| 227 | 3300005563 | Ga0068855_100566982 | Ga0068855_1005669822 | 130 |
| 228 | 3300005563 | Ga0068855_100694287 | Ga0068855_1006942872 | 130 |
| 229 | 3300005578 | Ga0068854_100009094 | Ga0068854_1000090942 | 130 |
| 230 | 3300005578 | Ga0068854_101942456 | Ga0068854_1019424562 | 130 |
| 231 | 3300005614 | Ga0068856_100549468 | Ga0068856_1005494681 | 130 |
| 232 | 3300005614 | Ga0068856_100711503 | Ga0068856_1007115032 | 130 |
| 233 | 3300005615 | Ga0070702_100018741 | Ga0070702_1000187411 | 130 |
| 234 | 3300005615 | Ga0070702_100060631 | Ga0070702_1000606312 | 130 |
| 235 | 3300005615 | Ga0070702_100467820 | Ga0070702_1004678202 | 130 |
| 236 | 3300005615 | Ga0070702_100544281 | Ga0070702_1005442811 | 130 |
| 237 | 3300005615 | Ga0070702_100998899 | Ga0070702_1009988991 | 130 |
| 238 | 3300005616 | Ga0068852_100737360 | Ga0068852_1007373602 | 130 |
| 239 | 3300005616 | Ga0068852_100976185 | Ga0068852_1009761852 | 130 |
| 240 | 3300005617 | Ga0068859_100001651 | Ga0068859_1000016519 | 130 |
| 241 | 3300005617 | Ga0068859_100120223 | Ga0068859_1001202233 | 130 |
| 242 | 3300005618 | Ga0068864_100206429 | Ga0068864_1002064291 | 130 |
| 243 | 3300005618 | Ga0068864_100593589 | Ga0068864_1005935892 | 130 |
| 244 | 3300005618 | Ga0068864_101224531 | Ga0068864_1012245312 | 130 |
| 245 | 3300005718 | Ga0068866_10011313 | Ga0068866_100113132 | 130 |
| 246 | 3300005718 | Ga0068866_10269219 | Ga0068866_102692192 | 130 |
| 247 | 3300005719 | Ga0068861_100084809 | Ga0068861_1000848093 | 130 |
| 248 | 3300005719 | Ga0068861_100724008 | Ga0068861_1007240082 | 130 |
| 249 | 3300005841 | Ga0068863_100000193 | Ga0068863_10000019330 | 130 |
| 250 | 3300005841 | Ga0068863_100003240 | Ga0068863_10000324016 | 130 |
| 251 | 3300005841 | Ga0068863_100089147 | Ga0068863_1000891474 | 130 |
| 252 | 3300005841 | Ga0068863_100189191 | Ga0068863_1001891913 | 130 |
| 253 | 3300005842 | Ga0068858_100105154 | Ga0068858_1001051544 | 130 |
| 254 | 3300005842 | Ga0068858_100110610 | Ga0068858_1001106102 | 130 |
| 255 | 3300005842 | Ga0068858_100441945 | Ga0068858_1004419452 | 130 |
| 256 | 3300005842 | Ga0068858_100541723 | Ga0068858_1005417232 | 130 |
| 257 | 3300005843 | Ga0068860_100000010 | Ga0068860_10000001021 | 130 |
| 258 | 3300005843 | Ga0068860_100057620 | Ga0068860_1000576204 | 130 |
| 259 | 3300005843 | Ga0068860_100183892 | Ga0068860_1001838922 | 130 |
| 260 | 3300005843 | Ga0068860_101472776 | Ga0068860_1014727762 | 130 |
| 261 | 3300005844 | Ga0068862_100000205 | Ga0068862_10000020552 | 130 |
| 262 | 3300005844 | Ga0068862_100220630 | Ga0068862_1002206302 | 130 |
| 263 | 3300005844 | Ga0068862_101086914 | Ga0068862_1010869142 | 130 |
| 264 | 3300005844 | Ga0068862_102288505 | Ga0068862_1022885052 | 130 |
| 265 | 3300005937 | Ga0081455_10250827 | Ga0081455_102508272 | 130 |
| 266 | 3300005937 | Ga0081455_10279618 | Ga0081455_102796182 | 130 |
| 267 | 3300005981 | Ga0081538_10057611 | Ga0081538_100576112 | 130 |
| 268 | 3300006038 | Ga0075365_10063360 | Ga0075365_100633603 | 130 |
| 269 | 3300006038 | Ga0075365_10634095 | Ga0075365_106340951 | 130 |
| 270 | 3300006038 | Ga0075365_10705190 | Ga0075365_107051901 | 130 |
| 271 | 3300006042 | Ga0075368_10187911 | Ga0075368_101879112 | 130 |
| 272 | 3300006048 | Ga0075363_100001201 | Ga0075363_1000012018 | 130 |
| 273 | 3300006048 | Ga0075363_100001555 | Ga0075363_1000015559 | 130 |
| 274 | 3300006048 | Ga0075363_100026491 | Ga0075363_1000264913 | 130 |
| 275 | 3300006048 | Ga0075363_100033718 | Ga0075363_1000337184 | 130 |
| 276 | 3300006048 | Ga0075363_100067306 | Ga0075363_1000673062 | 130 |
| 277 | 3300006048 | Ga0075363_100080002 | Ga0075363_1000800022 | 130 |
| 278 | 3300006051 | Ga0075364_10002712 | Ga0075364_100027123 | 130 |
| 279 | 3300006051 | Ga0075364_10004244 | Ga0075364_100042445 | 130 |
| 280 | 3300006051 | Ga0075364_10210105 | Ga0075364_102101052 | 130 |
| 281 | 3300006051 | Ga0075364_10268302 | Ga0075364_102683022 | 130 |
| 282 | 3300006051 | Ga0075364_11045142 | Ga0075364_110451421 | 130 |
| 283 | 3300006163 | Ga0070715_10627003 | Ga0070715_106270032 | 130 |
| 284 | 3300006173 | Ga0070716_100579852 | Ga0070716_1005798522 | 130 |
| 285 | 3300006173 | Ga0070716_101277733 | Ga0070716_1012777332 | 130 |
| 286 | 3300006175 | Ga0070712_100009919 | Ga0070712_1000099193 | 130 |
| 287 | 3300006175 | Ga0070712_100023386 | Ga0070712_1000233862 | 130 |
| 288 | 3300006177 | Ga0075362_10022933 | Ga0075362_100229332 | 130 |
| 289 | 3300006177 | Ga0075362_10112778 | Ga0075362_101127782 | 130 |
| 290 | 3300006177 | Ga0075362_10155013 | Ga0075362_101550132 | 130 |
| 291 | 3300006178 | Ga0075367_10021805 | Ga0075367_100218053 | 130 |
| 292 | 3300006178 | Ga0075367_10440053 | Ga0075367_104400532 | 130 |
| 293 | 3300006186 | Ga0075369_10000601 | Ga0075369_100006016 | 130 |
| 294 | 3300006186 | Ga0075369_10003984 | Ga0075369_100039842 | 130 |
| 295 | 3300006186 | Ga0075369_10181622 | Ga0075369_101816222 | 130 |
| 296 | 3300006186 | Ga0075369_10290178 | Ga0075369_102901782 | 130 |
| 297 | 3300006237 | Ga0097621_100011755 | Ga0097621_1000117552 | 130 |
| 298 | 3300006237 | Ga0097621_100406308 | Ga0097621_1004063082 | 130 |
| 299 | 3300006353 | Ga0075370_10004679 | Ga0075370_100046791 | 130 |
| 300 | 3300006353 | Ga0075370_10062011 | Ga0075370_100620112 | 130 |
| 301 | 3300006353 | Ga0075370_10146843 | Ga0075370_101468432 | 130 |
| 302 | 3300006358 | Ga0068871_100122197 | Ga0068871_1001221972 | 130 |
| 303 | 3300006358 | Ga0068871_100612742 | Ga0068871_1006127422 | 130 |
| 304 | 3300006852 | Ga0075433_10582228 | Ga0075433_105822282 | 130 |
| 305 | 3300006871 | Ga0075434_100916699 | Ga0075434_1009166992 | 130 |
| 306 | 3300006871 | Ga0075434_101207075 | Ga0075434_1012070752 | 130 |
| 307 | 3300006881 | Ga0068865_100050587 | Ga0068865_1000505874 | 130 |
| 308 | 3300006881 | Ga0068865_100063078 | Ga0068865_1000630782 | 130 |
| 309 | 3300006931 | Ga0097620_100001651 | Ga0097620_10000165112 | 130 |
| 310 | 3300006931 | Ga0097620_100120225 | Ga0097620_1001202252 | 130 |
| 311 | 3300006931 | Ga0097620_103074566 | Ga0097620_1030745661 | 130 |
| 312 | 3300009011 | Ga0105251_10119064 | Ga0105251_101190642 | 130 |
| 313 | 3300009092 | Ga0105250_10460122 | Ga0105250_104601222 | 130 |
| 314 | 3300009098 | Ga0105245_10051087 | Ga0105245_100510872 | 130 |
| 315 | 3300009098 | Ga0105245_10761590 | Ga0105245_107615902 | 130 |
| 316 | 3300009101 | Ga0105247_10000082 | Ga0105247_1000008246 | 130 |
| 317 | 3300009101 | Ga0105247_10138777 | Ga0105247_101387772 | 130 |
| 318 | 3300009101 | Ga0105247_10171891 | Ga0105247_101718912 | 130 |
| 319 | 3300009101 | Ga0105247_10188098 | Ga0105247_101880982 | 130 |
| 320 | 3300009101 | Ga0105247_10383025 | Ga0105247_103830252 | 130 |
| 321 | 3300009148 | Ga0105243_10124009 | Ga0105243_101240092 | 130 |
| 322 | 3300009148 | Ga0105243_10193596 | Ga0105243_101935962 | 130 |
| 323 | 3300009148 | Ga0105243_10491911 | Ga0105243_104919112 | 130 |
| 324 | 3300009148 | Ga0105243_10836171 | Ga0105243_108361712 | 130 |
| 325 | 3300009174 | Ga0105241_10187101 | Ga0105241_101871012 | 130 |
| 326 | 3300009174 | Ga0105241_10592499 | Ga0105241_105924993 | 130 |
| 327 | 3300009174 | Ga0105241_10889712 | Ga0105241_108897122 | 130 |
| 328 | 3300009176 | Ga0105242_10212148 | Ga0105242_102121482 | 130 |
| 329 | 3300009176 | Ga0105242_10636241 | Ga0105242_106362413 | 130 |
| 330 | 3300009177 | Ga0105248_10000084 | Ga0105248_1000008489 | 130 |
| 331 | 3300009177 | Ga0105248_10045541 | Ga0105248_100455413 | 130 |
| 332 | 3300009177 | Ga0105248_10079301 | Ga0105248_100793013 | 130 |
| 333 | 3300009177 | Ga0105248_10384927 | Ga0105248_103849272 | 130 |
| 334 | 3300009177 | Ga0105248_10425874 | Ga0105248_104258742 | 130 |
| 335 | 3300009177 | Ga0105248_10648813 | Ga0105248_106488132 | 130 |
| 336 | 3300009545 | Ga0105237_10001322 | Ga0105237_100013228 | 130 |
| 337 | 3300009545 | Ga0105237_10323336 | Ga0105237_103233362 | 130 |
| 338 | 3300009545 | Ga0105237_10579900 | Ga0105237_105799002 | 130 |
| 339 | 3300009551 | Ga0105238_10071422 | Ga0105238_100714222 | 130 |
| 340 | 3300009551 | Ga0105238_10411270 | Ga0105238_104112702 | 130 |
| 341 | 3300009551 | Ga0105238_10627594 | Ga0105238_106275942 | 130 |
| 342 | 3300009551 | Ga0105238_12447126 | Ga0105238_124471262 | 130 |
| 343 | 3300009553 | Ga0105249_10000285 | Ga0105249_1000028521 | 130 |
| 344 | 3300009553 | Ga0105249_10255109 | Ga0105249_102551092 | 130 |
| 345 | 3300009553 | Ga0105249_10604345 | Ga0105249_106043452 | 130 |
| 346 | 3300009553 | Ga0105249_11287530 | Ga0105249_112875302 | 130 |
| 347 | 3300009553 | Ga0105249_11768580 | Ga0105249_117685801 | 130 |
| 348 | 3300009553 | Ga0105249_11826317 | Ga0105249_118263172 | 130 |
| 349 | 3300010375 | Ga0105239_10011658 | Ga0105239_100116583 | 130 |
| 350 | 3300010375 | Ga0105239_10024619 | Ga0105239_100246194 | 130 |
| 351 | 3300010375 | Ga0105239_10752324 | Ga0105239_107523242 | 130 |
| 352 | 3300010375 | Ga0105239_11865801 | Ga0105239_118658012 | 130 |
| 353 | 3300010375 | Ga0105239_12052310 | Ga0105239_120523101 | 130 |
| 354 | 3300011119 | Ga0105246_10164337 | Ga0105246_101643372 | 130 |
| 355 | 3300011119 | Ga0105246_10184996 | Ga0105246_101849962 | 130 |
| 356 | 3300011119 | Ga0105246_10531246 | Ga0105246_105312462 | 130 |
| 357 | 3300013102 | Ga0157371_10367199 | Ga0157371_103671991 | 130 |
| 358 | 3300013102 | Ga0157371_10859013 | Ga0157371_108590132 | 130 |
| 359 | 3300013105 | Ga0157369_11766139 | Ga0157369_117661392 | 130 |
| 360 | 3300013296 | Ga0157374_10511398 | Ga0157374_105113981 | 130 |
| 361 | 3300013296 | Ga0157374_12693069 | Ga0157374_126930692 | 130 |
| 362 | 3300013297 | Ga0157378_10178812 | Ga0157378_101788122 | 130 |
| 363 | 3300013297 | Ga0157378_10264821 | Ga0157378_102648213 | 130 |
| 364 | 3300013297 | Ga0157378_10449534 | Ga0157378_104495342 | 130 |
| 365 | 3300013306 | Ga0163162_10028509 | Ga0163162_100285096 | 130 |
| 366 | 3300013306 | Ga0163162_10681207 | Ga0163162_106812072 | 130 |
| 367 | 3300013306 | Ga0163162_12092277 | Ga0163162_120922771 | 130 |
| 368 | 3300013307 | Ga0157372_10392164 | Ga0157372_103921642 | 130 |
| 369 | 3300013307 | Ga0157372_10444451 | Ga0157372_104444512 | 130 |
| 370 | 3300013307 | Ga0157372_10871701 | Ga0157372_108717012 | 130 |
| 371 | 3300013308 | Ga0157375_10896535 | Ga0157375_108965352 | 130 |
| 372 | 3300013308 | Ga0157375_11086150 | Ga0157375_110861502 | 130 |
| 373 | 3300013308 | Ga0157375_11675328 | Ga0157375_116753282 | 130 |
| 374 | 3300014325 | Ga0163163_10206354 | Ga0163163_102063542 | 130 |
| 375 | 3300014325 | Ga0163163_10294424 | Ga0163163_102944242 | 130 |
| 376 | 3300014325 | Ga0163163_10748389 | Ga0163163_107483892 | 130 |
| 377 | 3300014326 | Ga0157380_10061839 | Ga0157380_100618392 | 130 |
| 378 | 3300014326 | Ga0157380_10417625 | Ga0157380_104176253 | 130 |
| 379 | 3300014745 | Ga0157377_10923607 | Ga0157377_109236072 | 130 |
| 380 | 3300014968 | Ga0157379_10052581 | Ga0157379_100525812 | 130 |
| 381 | 3300014968 | Ga0157379_10360750 | Ga0157379_103607503 | 130 |
| 382 | 3300014968 | Ga0157379_10910640 | Ga0157379_109106401 | 130 |
| 383 | 3300014969 | Ga0157376_10200898 | Ga0157376_102008982 | 130 |
| 384 | 3300014969 | Ga0157376_10479904 | Ga0157376_104799041 | 130 |
| 385 | 3300014969 | Ga0157376_10713778 | Ga0157376_107137782 | 130 |
| 386 | 3300014969 | Ga0157376_11641378 | Ga0157376_116413781 | 130 |
| 387 | 3300017792 | Ga0163161_10096797 | Ga0163161_100967972 | 130 |
| 388 | 3300017792 | Ga0163161_10426864 | Ga0163161_104268642 | 130 |
| 389 | 3300017792 | Ga0163161_10616422 | Ga0163161_106164223 | 130 |
| 390 | 3300017792 | Ga0163161_10853020 | Ga0163161_108530202 | 130 |
| 391 | 3300025885 | Ga0207653_10034056 | Ga0207653_100340562 | 130 |
| 392 | 3300025898 | Ga0207692_10099142 | Ga0207692_100991422 | 130 |
| 393 | 3300025898 | Ga0207692_10317478 | Ga0207692_103174782 | 130 |
| 394 | 3300025899 | Ga0207642_10068498 | Ga0207642_100684982 | 130 |
| 395 | 3300025899 | Ga0207642_10344377 | Ga0207642_103443772 | 130 |
| 396 | 3300025900 | Ga0207710_10000263 | Ga0207710_1000026342 | 130 |
| 397 | 3300025900 | Ga0207710_10079942 | Ga0207710_100799422 | 130 |
| 398 | 3300025900 | Ga0207710_10196341 | Ga0207710_101963412 | 130 |
| 399 | 3300025900 | Ga0207710_10340513 | Ga0207710_103405132 | 130 |
| 400 | 3300025901 | Ga0207688_10019300 | Ga0207688_100193002 | 130 |
| 401 | 3300025901 | Ga0207688_10506750 | Ga0207688_105067502 | 130 |
| 402 | 3300025903 | Ga0207680_10035392 | Ga0207680_100353923 | 130 |
| 403 | 3300025903 | Ga0207680_11099990 | Ga0207680_110999901 | 130 |
| 404 | 3300025904 | Ga0207647_10034828 | Ga0207647_100348284 | 130 |
| 405 | 3300025905 | Ga0207685_10143931 | Ga0207685_101439312 | 130 |
| 406 | 3300025905 | Ga0207685_10184472 | Ga0207685_101844722 | 130 |
| 407 | 3300025906 | Ga0207699_10069074 | Ga0207699_100690742 | 130 |
| 408 | 3300025906 | Ga0207699_10427800 | Ga0207699_104278001 | 130 |
| 409 | 3300025906 | Ga0207699_10679700 | Ga0207699_106797002 | 130 |
| 410 | 3300025907 | Ga0207645_10010653 | Ga0207645_100106535 | 130 |
| 411 | 3300025908 | Ga0207643_10260856 | Ga0207643_102608562 | 130 |
| 412 | 3300025909 | Ga0207705_10163937 | Ga0207705_101639372 | 130 |
| 413 | 3300025911 | Ga0207654_10160709 | Ga0207654_101607092 | 130 |
| 414 | 3300025914 | Ga0207671_10020933 | Ga0207671_100209335 | 130 |
| 415 | 3300025914 | Ga0207671_10672702 | Ga0207671_106727022 | 130 |
| 416 | 3300025915 | Ga0207693_10015796 | Ga0207693_100157967 | 130 |
| 417 | 3300025915 | Ga0207693_10129064 | Ga0207693_101290642 | 130 |
| 418 | 3300025916 | Ga0207663_10050302 | Ga0207663_100503022 | 130 |
| 419 | 3300025916 | Ga0207663_10286176 | Ga0207663_102861762 | 130 |
| 420 | 3300025918 | Ga0207662_10091817 | Ga0207662_100918172 | 130 |
| 421 | 3300025920 | Ga0207649_11133589 | Ga0207649_111335892 | 130 |
| 422 | 3300025923 | Ga0207681_10004263 | Ga0207681_100042635 | 130 |
| 423 | 3300025923 | Ga0207681_10862482 | Ga0207681_108624822 | 130 |
| 424 | 3300025924 | Ga0207694_10400410 | Ga0207694_104004102 | 130 |
| 425 | 3300025924 | Ga0207694_10461393 | Ga0207694_104613931 | 130 |
| 426 | 3300025924 | Ga0207694_10621533 | Ga0207694_106215332 | 130 |
| 427 | 3300025925 | Ga0207650_11008347 | Ga0207650_110083472 | 130 |
| 428 | 3300025927 | Ga0207687_10080878 | Ga0207687_100808782 | 130 |
| 429 | 3300025927 | Ga0207687_10789280 | Ga0207687_107892802 | 130 |
| 430 | 3300025927 | Ga0207687_10815187 | Ga0207687_108151872 | 130 |
| 431 | 3300025928 | Ga0207700_10364492 | Ga0207700_103644922 | 130 |
| 432 | 3300025928 | Ga0207700_10532690 | Ga0207700_105326902 | 130 |
| 433 | 3300025931 | Ga0207644_10023915 | Ga0207644_100239154 | 130 |
| 434 | 3300025931 | Ga0207644_10224507 | Ga0207644_102245072 | 130 |
| 435 | 3300025932 | Ga0207690_10282556 | Ga0207690_102825561 | 130 |
| 436 | 3300025932 | Ga0207690_10525368 | Ga0207690_105253682 | 130 |
| 437 | 3300025933 | Ga0207706_10011311 | Ga0207706_100113114 | 130 |
| 438 | 3300025933 | Ga0207706_10471147 | Ga0207706_104711472 | 130 |
| 439 | 3300025933 | Ga0207706_11264658 | Ga0207706_112646582 | 130 |
| 440 | 3300025934 | Ga0207686_10062265 | Ga0207686_100622652 | 130 |
| 441 | 3300025935 | Ga0207709_10100118 | Ga0207709_101001182 | 130 |
| 442 | 3300025935 | Ga0207709_10121588 | Ga0207709_101215882 | 130 |
| 443 | 3300025935 | Ga0207709_10800589 | Ga0207709_108005892 | 130 |
| 444 | 3300025936 | Ga0207670_10257882 | Ga0207670_102578822 | 130 |
| 445 | 3300025936 | Ga0207670_10531148 | Ga0207670_105311482 | 130 |
| 446 | 3300025937 | Ga0207669_10069211 | Ga0207669_100692113 | 130 |
| 447 | 3300025937 | Ga0207669_10088478 | Ga0207669_100884782 | 130 |
| 448 | 3300025938 | Ga0207704_10050726 | Ga0207704_100507262 | 130 |
| 449 | 3300025938 | Ga0207704_10080189 | Ga0207704_100801892 | 130 |
| 450 | 3300025938 | Ga0207704_10093216 | Ga0207704_100932162 | 130 |
| 451 | 3300025939 | Ga0207665_10013432 | Ga0207665_100134325 | 130 |
| 452 | 3300025939 | Ga0207665_10021303 | Ga0207665_100213034 | 130 |
| 453 | 3300025939 | Ga0207665_10458465 | Ga0207665_104584652 | 130 |
| 454 | 3300025939 | Ga0207665_10607145 | Ga0207665_106071452 | 130 |
| 455 | 3300025940 | Ga0207691_10121641 | Ga0207691_101216412 | 130 |
| 456 | 3300025940 | Ga0207691_10145610 | Ga0207691_101456103 | 130 |
| 457 | 3300025941 | Ga0207711_10002374 | Ga0207711_100023744 | 130 |
| 458 | 3300025941 | Ga0207711_10133249 | Ga0207711_101332492 | 130 |
| 459 | 3300025941 | Ga0207711_10327481 | Ga0207711_103274812 | 130 |
| 460 | 3300025941 | Ga0207711_10874221 | Ga0207711_108742212 | 130 |
| 461 | 3300025942 | Ga0207689_10018584 | Ga0207689_100185843 | 130 |
| 462 | 3300025949 | Ga0207667_10138782 | Ga0207667_101387822 | 130 |
| 463 | 3300025949 | Ga0207667_10259210 | Ga0207667_102592101 | 130 |
| 464 | 3300025960 | Ga0207651_10763336 | Ga0207651_107633362 | 130 |
| 465 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011338 | 130 |
| 466 | 3300025961 | Ga0207712_10177806 | Ga0207712_101778062 | 130 |
| 467 | 3300025961 | Ga0207712_10695480 | Ga0207712_106954802 | 130 |
| 468 | 3300025972 | Ga0207668_10000743 | Ga0207668_100007435 | 130 |
| 469 | 3300025972 | Ga0207668_10121415 | Ga0207668_101214152 | 130 |
| 470 | 3300025972 | Ga0207668_10130203 | Ga0207668_101302033 | 130 |
| 471 | 3300025972 | Ga0207668_10172034 | Ga0207668_101720342 | 130 |
| 472 | 3300025972 | Ga0207668_10607086 | Ga0207668_106070862 | 130 |
| 473 | 3300025981 | Ga0207640_10258523 | Ga0207640_102585232 | 130 |
| 474 | 3300025981 | Ga0207640_10354149 | Ga0207640_103541492 | 130 |
| 475 | 3300025981 | Ga0207640_10528075 | Ga0207640_105280752 | 130 |
| 476 | 3300025986 | Ga0207658_10000220 | Ga0207658_100002208 | 130 |
| 477 | 3300025986 | Ga0207658_10020156 | Ga0207658_100201563 | 130 |
| 478 | 3300025986 | Ga0207658_10023013 | Ga0207658_100230135 | 130 |
| 479 | 3300025986 | Ga0207658_10029355 | Ga0207658_100293551 | 130 |
| 480 | 3300025986 | Ga0207658_10053838 | Ga0207658_100538383 | 130 |
| 481 | 3300026023 | Ga0207677_10488769 | Ga0207677_104887692 | 130 |
| 482 | 3300026023 | Ga0207677_10536583 | Ga0207677_105365832 | 130 |
| 483 | 3300026023 | Ga0207677_10988370 | Ga0207677_109883702 | 130 |
| 484 | 3300026035 | Ga0207703_10049187 | Ga0207703_100491874 | 130 |
| 485 | 3300026035 | Ga0207703_10261012 | Ga0207703_102610122 | 130 |
| 486 | 3300026035 | Ga0207703_10416162 | Ga0207703_104161623 | 130 |
| 487 | 3300026035 | Ga0207703_10423477 | Ga0207703_104234772 | 130 |
| 488 | 3300026035 | Ga0207703_10591277 | Ga0207703_105912772 | 130 |
| 489 | 3300026041 | Ga0207639_10092003 | Ga0207639_100920032 | 130 |
| 490 | 3300026041 | Ga0207639_10283850 | Ga0207639_102838502 | 130 |
| 491 | 3300026067 | Ga0207678_10033813 | Ga0207678_100338132 | 130 |
| 492 | 3300026067 | Ga0207678_10053695 | Ga0207678_100536954 | 130 |
| 493 | 3300026075 | Ga0207708_10600069 | Ga0207708_106000692 | 130 |
| 494 | 3300026075 | Ga0207708_11051813 | Ga0207708_110518132 | 130 |
| 495 | 3300026078 | Ga0207702_10977708 | Ga0207702_109777082 | 130 |
| 496 | 3300026088 | Ga0207641_10000437 | Ga0207641_1000043740 | 130 |
| 497 | 3300026088 | Ga0207641_10232408 | Ga0207641_102324082 | 130 |
| 498 | 3300026088 | Ga0207641_10453114 | Ga0207641_104531143 | 130 |
| 499 | 3300026088 | Ga0207641_10659261 | Ga0207641_106592612 | 130 |
| 500 | 3300026089 | Ga0207648_10023411 | Ga0207648_100234116 | 130 |
| 501 | 3300026089 | Ga0207648_10754176 | Ga0207648_107541762 | 130 |
| 502 | 3300026095 | Ga0207676_10289069 | Ga0207676_102890693 | 130 |
| 503 | 3300026095 | Ga0207676_10539344 | Ga0207676_105393442 | 130 |
| 504 | 3300026095 | Ga0207676_10670217 | Ga0207676_106702171 | 130 |
| 505 | 3300026118 | Ga0207675_100246115 | Ga0207675_1002461152 | 130 |
| 506 | 3300026118 | Ga0207675_100340011 | Ga0207675_1003400112 | 130 |
| 507 | 3300026118 | Ga0207675_100966983 | Ga0207675_1009669831 | 130 |
| 508 | 3300026121 | Ga0207683_10039013 | Ga0207683_100390136 | 130 |
| 509 | 3300026121 | Ga0207683_10154333 | Ga0207683_101543332 | 130 |
| 510 | 3300026121 | Ga0207683_10297146 | Ga0207683_102971462 | 130 |
| 511 | 3300026121 | Ga0207683_10728277 | Ga0207683_107282772 | 130 |
| 512 | 3300026142 | Ga0207698_10588684 | Ga0207698_105886842 | 130 |
| 513 | 3300026142 | Ga0207698_10614838 | Ga0207698_106148382 | 130 |
| 514 | 3300026142 | Ga0207698_11341409 | Ga0207698_113414092 | 130 |
| 515 | 3300027866 | Ga0209813_10041151 | Ga0209813_100411512 | 130 |
| 516 | 3300027866 | Ga0209813_10155261 | Ga0209813_101552612 | 130 |
| 517 | 3300028379 | Ga0268266_10001362 | Ga0268266_1000136230 | 130 |
| 518 | 3300028379 | Ga0268266_10012103 | Ga0268266_100121036 | 130 |
| 519 | 3300028379 | Ga0268266_10319251 | Ga0268266_103192512 | 130 |
| 520 | 3300028379 | Ga0268266_11060641 | Ga0268266_110606412 | 130 |
| 521 | 3300028379 | Ga0268266_11256195 | Ga0268266_112561952 | 130 |
| 522 | 3300028379 | Ga0268266_11464426 | Ga0268266_114644262 | 130 |
| 523 | 3300028380 | Ga0268265_10000007 | Ga0268265_10000007298 | 130 |
| 524 | 3300028380 | Ga0268265_10115130 | Ga0268265_101151302 | 130 |
| 525 | 3300028380 | Ga0268265_10625650 | Ga0268265_106256502 | 130 |
| 526 | 3300028380 | Ga0268265_10921125 | Ga0268265_109211252 | 130 |
| 527 | 3300028380 | Ga0268265_11040140 | Ga0268265_110401402 | 130 |
| 528 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007429 | 130 |
| 529 | 3300028381 | Ga0268264_10133110 | Ga0268264_101331102 | 130 |
| 530 | 3300028381 | Ga0268264_11112020 | Ga0268264_111120201 | 130 |
| 531 | 3300031824 | Ga0307413_11603130 | Ga0307413_116031301 | 130 |
| 532 | 3300031852 | Ga0307410_10034512 | Ga0307410_100345123 | 130 |
| 533 | 3300031852 | Ga0307410_11804209 | Ga0307410_118042091 | 130 |
| 534 | 3300031903 | Ga0307407_10024784 | Ga0307407_100247843 | 130 |
| 535 | 3300031903 | Ga0307407_10164583 | Ga0307407_101645832 | 130 |
| 536 | 3300031911 | Ga0307412_10061732 | Ga0307412_100617323 | 130 |
| 537 | 3300031911 | Ga0307412_11485122 | Ga0307412_114851222 | 130 |
| 538 | 3300031995 | Ga0307409_100243326 | Ga0307409_1002433262 | 130 |
| 539 | 3300032004 | Ga0307414_10204497 | Ga0307414_102044972 | 130 |
| 540 | 3300032004 | Ga0307414_10934793 | Ga0307414_109347932 | 130 |
| 541 | 3300032005 | Ga0307411_10322502 | Ga0307411_103225022 | 130 |
| 542 | 3300032126 | Ga0307415_100120642 | Ga0307415_1001206422 | 130 |
| 543 | 3300032126 | Ga0307415_100650165 | Ga0307415_1006501651 | 130 |
| 544 | 3300034819 | Ga0373958_0201070 | Ga0373958_0201070_49_441 | 130 |
| 545 | 3300035092 | Ga0373952_0086123 | Ga0373952_0086123_72_464 | 130 |
| 546 | 3300035112 | Ga0373932_0101457 | Ga0373932_0101457_406_798 | 130 |
| 547 | 3300035241 | Ga0373961_0124879 | Ga0373961_0124879_149_541 | 130 |
| 548 | 3300035691 | Ga0373931_0085985 | Ga0373931_0085985_1087_1479 | 130 |
| 549 | 3300035691 | Ga0373931_0234393 | Ga0373931_0234393_294_686 | 130 |
| 550 | 3300041404 | Ga0439436_0098676 | Ga0439436_0098676_233_625 | 130 |
| 551 | 3300041410 | Ga0439461_0050756 | Ga0439461_0050756_390_782 | 130 |
| 552 | 3300041410 | Ga0439461_0056440 | Ga0439461_0056440_140_535 | 130 |
| 553 | 3300041411 | Ga0439466_0006222 | Ga0439466_0006222_212_604 | 130 |
| 554 | 3300041411 | Ga0439466_0015440 | Ga0439466_0015440_1589_1984 | 130 |
| 555 | 3300041413 | Ga0439465_0008521 | Ga0439465_0008521_143_538 | 130 |
| 556 | 3300041413 | Ga0439465_0030042 | Ga0439465_0030042_1319_1711 | 130 |
| 557 | 3300041413 | Ga0439465_0309382 | Ga0439465_0309382_46_438 | 130 |
| 558 | 3300041997 | Ga0439431_0004898 | Ga0439431_0004898_601_993 | 130 |
| 559 | 3300042002 | Ga0439442_011258 | Ga0439442_011258_862_1257 | 130 |
| 560 | 3300042004 | Ga0439445_0004645 | Ga0439445_0004645_55_447 | 130 |
| 561 | 3300042004 | Ga0439445_0010971 | Ga0439445_0010971_325_720 | 130 |
| 562 | 3300042008 | Ga0439450_022713 | Ga0439450_022713_880_1272 | 130 |
| 563 | 3300042435 | Ga0439434_0021846 | Ga0439434_0021846_1040_1435 | 130 |
| 564 | 3300044658 | Ga0466972_0008913 | Ga0466972_0008913_1977_2372 | 130 |
| 565 | 3300044658 | Ga0466972_0015341 | Ga0466972_0015341_248_640 | 130 |
| 566 | 3300044658 | Ga0466972_0030250 | Ga0466972_0030250_836_1231 | 130 |
| 567 | 3300044658 | Ga0466972_0071967 | Ga0466972_0071967_108_503 | 130 |
| 568 | 3300044658 | Ga0466972_0099630 | Ga0466972_0099630_531_926 | 130 |
| 569 | 3300044658 | Ga0466972_0319248 | Ga0466972_0319248_254_646 | 130 |
| 570 | 3300044683 | Ga0466965_0002694 | Ga0466965_0002694_5978_6370 | 130 |
| 571 | 3300044683 | Ga0466965_0073984 | Ga0466965_0073984_199_594 | 130 |
| 572 | 3300044693 | Ga0466961_0049062 | Ga0466961_0049062_641_1036 | 130 |
| 573 | 3300044706 | Ga0466964_0696466 | Ga0466964_0696466_21_416 | 130 |
| 574 | 3300044735 | Ga0466968_0050691 | Ga0466968_0050691_1346_1741 | 130 |
| 575 | 3300044765 | Ga0466970_0054459 | Ga0466970_0054459_414_806 | 130 |
| 576 | 3300044765 | Ga0466970_0173730 | Ga0466970_0173730_416_811 | 130 |
| 577 | 3300044765 | Ga0466970_0701835 | Ga0466970_0701835_112_504 | 130 |
| 578 | 3300044842 | Ga0466957_0009124 | Ga0466957_0009124_3523_3918 | 130 |
| 579 | 3300044842 | Ga0466957_0565758 | Ga0466957_0565758_223_615 | 130 |
| 580 | 3300044901 | Ga0466960_0050259 | Ga0466960_0050259_476_871 | 130 |
| 581 | 3300045049 | Ga0466959_0046300 | Ga0466959_0046300_160_555 | 130 |
| 582 | 3300045836 | Ga0466958_0085205 | Ga0466958_0085205_1473_1868 | 130 |
| 583 | 3300045976 | Ga0466967_0263044 | Ga0466967_0263044_1224_1619 | 130 |
| 584 | 3300045976 | Ga0466967_0355692 | Ga0466967_0355692_162_554 | 130 |
| 585 | 3300046459 | Ga0495629_0234133 | Ga0495629_0234133_182_574 | 130 |
| 586 | 3300046460 | Ga0495638_0005530 | Ga0495638_0005530_811_1203 | 130 |
| 587 | 3300046473 | Ga0495582_0299622 | Ga0495582_0299622_480_872 | 130 |
| 588 | 3300046476 | Ga0495662_0072499 | Ga0495662_0072499_448_840 | 130 |
| 589 | 3300046499 | Ga0495594_0052719 | Ga0495594_0052719_37_429 | 130 |
| 590 | 3300046506 | Ga0495583_0126820 | Ga0495583_0126820_197_589 | 130 |
| 591 | 3300046507 | Ga0495606_0110052 | Ga0495606_0110052_974_1366 | 130 |
| 592 | 3300046514 | Ga0495618_0162594 | Ga0495618_0162594_729_1121 | 130 |
| 593 | 3300046522 | Ga0495643_0481491 | Ga0495643_0481491_111_503 | 130 |
| 594 | 3300046524 | Ga0495648_0011454 | Ga0495648_0011454_5596_5988 | 130 |
| 595 | 3300046528 | Ga0495642_0263579 | Ga0495642_0263579_231_623 | 130 |
| 596 | 3300046533 | Ga0495640_0037508 | Ga0495640_0037508_581_973 | 130 |
| 597 | 3300046616 | Ga0495668_0034340 | Ga0495668_0034340_542_934 | 130 |
| 598 | 3300046683 | Ga0495658_0191758 | Ga0495658_0191758_867_1259 | 130 |
| 599 | 3300046690 | Ga0495624_0655252 | Ga0495624_0655252_91_483 | 130 |
| 600 | 3300046694 | Ga0495649_0392751 | Ga0495649_0392751_61_456 | 130 |
| 601 | 3300047315 | Ga0495581_0215188 | Ga0495581_0215188_76_468 | 130 |
| 602 | 3300047317 | Ga0495604_0089758 | Ga0495604_0089758_869_1261 | 130 |
| 603 | 3300047319 | Ga0495674_0495613 | Ga0495674_0495613_344_736 | 130 |
| 604 | 3300047320 | Ga0495672_0069647 | Ga0495672_0069647_1506_1898 | 130 |
| 605 | 3300047321 | Ga0495676_0101381 | Ga0495676_0101381_1431_1823 | 130 |
| 606 | 3300047469 | Ga0495673_0002084 | Ga0495673_0002084_6906_7298 | 130 |
| 607 | 3300048091 | Ga0495626_0052874 | Ga0495626_0052874_1369_1761 | 130 |
| 608 | 3300048903 | Ga0496100_0008578 | Ga0496100_0008578_4567_4968 | 130 |
| 609 | 3300048903 | Ga0496100_0011790 | Ga0496100_0011790_1887_2282 | 130 |
| 610 | 3300048903 | Ga0496100_0033241 | Ga0496100_0033241_1748_2140 | 130 |
| 611 | 3300048903 | Ga0496100_0052355 | Ga0496100_0052355_570_962 | 130 |
| 612 | 3300048903 | Ga0496100_0130670 | Ga0496100_0130670_677_1069 | 130 |
| 613 | 3300048903 | Ga0496100_0364298 | Ga0496100_0364298_75_467 | 130 |
| 614 | 3300048904 | Ga0496101_0000926 | Ga0496101_0000926_5718_6110 | 130 |
| 615 | 3300048904 | Ga0496101_0001429 | Ga0496101_0001429_8785_9186 | 130 |
| 616 | 3300048904 | Ga0496101_0006786 | Ga0496101_0006786_156_551 | 130 |
| 617 | 3300048904 | Ga0496101_0136105 | Ga0496101_0136105_26_418 | 130 |
| 618 | 3300048904 | Ga0496101_0641075 | Ga0496101_0641075_254_646 | 130 |
| 619 | 3300048904 | Ga0496101_0963587 | Ga0496101_0963587_73_468 | 130 |
| 620 | 3300048904 | Ga0496101_1147797 | Ga0496101_1147797_83_475 | 130 |
| 621 | 3300048905 | Ga0496102_0000007 | Ga0496102_0000007_405287_405679 | 130 |
| 622 | 3300048905 | Ga0496102_0000249 | Ga0496102_0000249_47882_48277 | 130 |
| 623 | 3300048905 | Ga0496102_0066057 | Ga0496102_0066057_2397_2789 | 130 |
| 624 | 3300048905 | Ga0496102_0076689 | Ga0496102_0076689_561_953 | 130 |
| 625 | 3300048905 | Ga0496102_0150467 | Ga0496102_0150467_934_1329 | 130 |
| 626 | 3300048905 | Ga0496102_0967732 | Ga0496102_0967732_18_410 | 130 |
| 627 | 3300048906 | Ga0496103_0000013 | Ga0496103_0000013_286144_286536 | 130 |
| 628 | 3300048906 | Ga0496103_0023577 | Ga0496103_0023577_2138_2533 | 130 |
| 629 | 3300048906 | Ga0496103_0067902 | Ga0496103_0067902_268_660 | 130 |
| 630 | 3300048906 | Ga0496103_0069420 | Ga0496103_0069420_961_1356 | 130 |
| 631 | 3300048906 | Ga0496103_0085586 | Ga0496103_0085586_1195_1587 | 130 |
| 632 | 3300048906 | Ga0496103_0142453 | Ga0496103_0142453_966_1361 | 130 |
| 633 | 3300048906 | Ga0496103_0534225 | Ga0496103_0534225_213_605 | 130 |
| 634 | 3300048907 | Ga0496104_0039487 | Ga0496104_0039487_3113_3514 | 130 |
| 635 | 3300048907 | Ga0496104_0608122 | Ga0496104_0608122_375_767 | 130 |
| 636 | 3300048908 | Ga0496105_0009048 | Ga0496105_0009048_6511_6912 | 130 |
| 637 | 3300048908 | Ga0496105_0193940 | Ga0496105_0193940_645_1037 | 130 |
| 638 | 3300048908 | Ga0496105_0283327 | Ga0496105_0283327_627_1022 | 130 |
| 639 | 3300048908 | Ga0496105_1324089 | Ga0496105_1324089_36_431 | 130 |
| 640 | 3300048909 | Ga0496106_0031315 | Ga0496106_0031315_3277_3672 | 130 |
| 641 | 3300048909 | Ga0496106_0032115 | Ga0496106_0032115_1165_1566 | 130 |
| 642 | 3300048909 | Ga0496106_0056434 | Ga0496106_0056434_2182_2574 | 130 |
| 643 | 3300048909 | Ga0496106_0082400 | Ga0496106_0082400_1907_2299 | 130 |
| 644 | 3300048909 | Ga0496106_0216233 | Ga0496106_0216233_640_1032 | 130 |
| 645 | 3300048909 | Ga0496106_0970471 | Ga0496106_0970471_45_437 | 130 |
| 646 | 3300048910 | Ga0496107_0003186 | Ga0496107_0003186_6354_6755 | 130 |
| 647 | 3300048910 | Ga0496107_0024700 | Ga0496107_0024700_2269_2661 | 130 |
| 648 | 3300048910 | Ga0496107_0027942 | Ga0496107_0027942_2698_3090 | 130 |
| 649 | 3300048910 | Ga0496107_0481503 | Ga0496107_0481503_254_646 | 130 |
| 650 | 3300048911 | Ga0496108_0012071 | Ga0496108_0012071_1621_2013 | 130 |
| 651 | 3300048911 | Ga0496108_0135640 | Ga0496108_0135640_1177_1569 | 130 |
| 652 | 3300048911 | Ga0496108_0189202 | Ga0496108_0189202_848_1240 | 130 |
| 653 | 3300048911 | Ga0496108_0463692 | Ga0496108_0463692_111_506 | 130 |
| 654 | 3300048912 | Ga0496109_0077885 | Ga0496109_0077885_2148_2540 | 130 |
| 655 | 3300048912 | Ga0496109_0167489 | Ga0496109_0167489_523_915 | 130 |
| 656 | 3300048912 | Ga0496109_1098843 | Ga0496109_1098843_178_573 | 130 |
| 657 | 3300048913 | Ga0496110_0790590 | Ga0496110_0790590_276_671 | 130 |
| 658 | 3300048913 | Ga0496110_0852603 | Ga0496110_0852603_388_783 | 130 |
| 659 | 3300048914 | Ga0496111_0167722 | Ga0496111_0167722_49_441 | 130 |
| 660 | 3300048915 | Ga0496112_0021987 | Ga0496112_0021987_1388_1780 | 130 |
| 661 | 3300048915 | Ga0496112_0146419 | Ga0496112_0146419_1920_2315 | 130 |
| 662 | 3300048915 | Ga0496112_0498561 | Ga0496112_0498561_419_811 | 130 |
| 663 | 3300048915 | Ga0496112_0810557 | Ga0496112_0810557_10_402 | 130 |
| 664 | 3300048916 | Ga0496113_0087906 | Ga0496113_0087906_103_498 | 130 |
| 665 | 3300048916 | Ga0496113_0159075 | Ga0496113_0159075_77_469 | 130 |
| 666 | 3300048917 | Ga0496114_0002582 | Ga0496114_0002582_13095_13487 | 130 |
| 667 | 3300048917 | Ga0496114_0004034 | Ga0496114_0004034_4809_5210 | 130 |
| 668 | 3300048917 | Ga0496114_0586778 | Ga0496114_0586778_127_519 | 130 |
| 669 | 3300048918 | Ga0496115_0008694 | Ga0496115_0008694_6484_6885 | 130 |
| 670 | 3300048918 | Ga0496115_0088000 | Ga0496115_0088000_259_654 | 130 |
| 671 | 3300048918 | Ga0496115_0566752 | Ga0496115_0566752_254_646 | 130 |
| 672 | 3300048918 | Ga0496115_0584670 | Ga0496115_0584670_222_614 | 130 |
| 673 | 3300048918 | Ga0496115_1307168 | Ga0496115_1307168_85_477 | 130 |
| 674 | 3300048919 | Ga0496116_0000033 | Ga0496116_0000033_12492_12884 | 130 |
| 675 | 3300048919 | Ga0496116_0034457 | Ga0496116_0034457_583_978 | 130 |
| 676 | 3300048920 | Ga0496117_0000025 | Ga0496117_0000025_12422_12814 | 130 |
| 677 | 3300048920 | Ga0496117_0006852 | Ga0496117_0006852_746_1141 | 130 |
| 678 | 3300048921 | Ga0496118_0000023 | Ga0496118_0000023_405293_405685 | 130 |
| 679 | 3300048921 | Ga0496118_0069537 | Ga0496118_0069537_245_640 | 130 |
| 680 | 3300048922 | Ga0496119_0001166 | Ga0496119_0001166_5775_6167 | 130 |
| 681 | 3300048922 | Ga0496119_0011509 | Ga0496119_0011509_57_452 | 130 |
| 682 | 3300048922 | Ga0496119_0573306 | Ga0496119_0573306_93_485 | 130 |
| 683 | 3300048923 | Ga0496120_0007290 | Ga0496120_0007290_674_1066 | 130 |
| 684 | 3300048923 | Ga0496120_0011731 | Ga0496120_0011731_103_498 | 130 |
| 685 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_241065_241457 | 130 |
| 686 | 3300048924 | Ga0496121_0005272 | Ga0496121_0005272_4779_5174 | 130 |
| 687 | 3300048925 | Ga0496122_0019511 | Ga0496122_0019511_4404_4796 | 130 |
| 688 | 3300048926 | Ga0496123_0038368 | Ga0496123_0038368_1320_1712 | 130 |
| 689 | 3300048927 | Ga0496124_0196177 | Ga0496124_0196177_151_543 | 130 |
| 690 | 3300048927 | Ga0496124_0264191 | Ga0496124_0264191_442_837 | 130 |
| 691 | 3300048928 | Ga0496125_0028720 | Ga0496125_0028720_529_924 | 130 |
| 692 | 3300048929 | Ga0496126_0000968 | Ga0496126_0000968_33332_33724 | 130 |
| 693 | 3300048929 | Ga0496126_0073297 | Ga0496126_0073297_437_829 | 130 |
| 694 | 3300048929 | Ga0496126_0116218 | Ga0496126_0116218_746_1141 | 130 |
| 695 | 3300048929 | Ga0496126_0331723 | Ga0496126_0331723_782_1174 | 130 |
| 696 | 3300049571 | Ga0501034_0218530 | Ga0501034_0218530_87_482 | 130 |
| 697 | 3300049579 | Ga0501043_0443588 | Ga0501043_0443588_458_850 | 130 |
| 698 | 3300049583 | Ga0501067_0213017 | Ga0501067_0213017_73_465 | 130 |
| 699 | 3300050489 | nmdc:mga03683_141464_c1 | nmdc:mga03683_141464_c1_211_603 | 130 |
| 700 | 3300050489 | nmdc:mga03683_171812_c1 | nmdc:mga03683_171812_c1_75_467 | 130 |
| 701 | 3300050489 | nmdc:mga03683_85083_c1 | nmdc:mga03683_85083_c1_457_849 | 130 |
| 702 | 3300050490 | nmdc:mga03n38_150708_c1 | nmdc:mga03n38_150708_c1_422_814 | 130 |
| 703 | 3300050490 | nmdc:mga03n38_19058_c1 | nmdc:mga03n38_19058_c1_617_1009 | 130 |
| 704 | 3300050490 | nmdc:mga03n38_298764_c1 | nmdc:mga03n38_298764_c1_278_673 | 130 |
| 705 | 3300050490 | nmdc:mga03n38_331717_c1 | nmdc:mga03n38_331717_c1_194_586 | 130 |
| 706 | 3300050490 | nmdc:mga03n38_481962_c1 | nmdc:mga03n38_481962_c1_26_421 | 130 |
| 707 | 3300050490 | nmdc:mga03n38_57144_c1 | nmdc:mga03n38_57144_c1_1066_1458 | 130 |
| 708 | 3300050490 | nmdc:mga03n38_610_c1 | nmdc:mga03n38_610_c1_7303_7695 | 130 |
| 709 | 3300050490 | nmdc:mga03n38_76983_c1 | nmdc:mga03n38_76983_c1_423_815 | 130 |
| 710 | 3300050490 | nmdc:mga03n38_9017_c1 | nmdc:mga03n38_9017_c1_2673_3065 | 130 |
| 711 | 3300050491 | nmdc:mga00v17_15989_c1 | nmdc:mga00v17_15989_c1_148_540 | 130 |
| 712 | 3300050491 | nmdc:mga00v17_3800_c1 | nmdc:mga00v17_3800_c1_569_961 | 130 |
| 713 | 3300050491 | nmdc:mga00v17_383905_c1 | nmdc:mga00v17_383905_c1_481_873 | 130 |
| 714 | 3300050491 | nmdc:mga00v17_84857_c1 | nmdc:mga00v17_84857_c1_900_1292 | 130 |
| 715 | 3300050491 | nmdc:mga00v17_857210_c1 | nmdc:mga00v17_857210_c1_148_540 | 130 |
| 716 | 3300050492 | nmdc:mga0yw44_571134_c1 | nmdc:mga0yw44_571134_c1_345_737 | 130 |
| 717 | 3300050492 | nmdc:mga0yw44_77624_c1 | nmdc:mga0yw44_77624_c1_621_1013 | 130 |
| 718 | 3300050492 | nmdc:mga0yw44_777334_c1 | nmdc:mga0yw44_777334_c1_74_466 | 130 |
| 719 | 3300050492 | nmdc:mga0yw44_883689_c1 | nmdc:mga0yw44_883689_c1_33_425 | 130 |
| 720 | 3300050494 | nmdc:mga06z11_30276_c1 | nmdc:mga06z11_30276_c1_2015_2407 | 130 |
| 721 | 3300050494 | nmdc:mga06z11_324424_c1 | nmdc:mga06z11_324424_c1_174_566 | 130 |
| 722 | 3300050494 | nmdc:mga06z11_374274_c1 | nmdc:mga06z11_374274_c1_184_576 | 130 |
| 723 | 3300050494 | nmdc:mga06z11_874971_c1 | nmdc:mga06z11_874971_c1_104_496 | 130 |
| 724 | 3300050495 | nmdc:mga04h51_49218_c1 | nmdc:mga04h51_49218_c1_703_1095 | 130 |
| 725 | 3300050495 | nmdc:mga04h51_88445_c1 | nmdc:mga04h51_88445_c1_508_900 | 130 |
| 726 | 3300050496 | nmdc:mga07m45_24331_c1 | nmdc:mga07m45_24331_c1_272_664 | 130 |
| 727 | 3300050496 | nmdc:mga07m45_274345_c1 | nmdc:mga07m45_274345_c1_62_457 | 130 |
| 728 | 3300050496 | nmdc:mga07m45_323692_c1 | nmdc:mga07m45_323692_c1_361_753 | 130 |
| 729 | 3300050512 | nmdc:mga0n895_1051935_c1 | nmdc:mga0n895_1051935_c1_133_525 | 130 |
| 730 | 3300050515 | nmdc:mga0a205_567464_c1 | nmdc:mga0a205_567464_c1_501_893 | 130 |
| 731 | 3300050516 | nmdc:mga0sz30_113875_c1 | nmdc:mga0sz30_113875_c1_119_511 | 130 |
| 732 | 3300050516 | nmdc:mga0sz30_192740_c1 | nmdc:mga0sz30_192740_c1_100_495 | 130 |
| 733 | 3300050516 | nmdc:mga0sz30_63539_c1 | nmdc:mga0sz30_63539_c1_610_1002 | 130 |
| 734 | 3300050516 | nmdc:mga0sz30_688_c1 | nmdc:mga0sz30_688_c1_5748_6140 | 130 |
| 735 | 3300053077 | Ga0495601_0264247 | Ga0495601_0264247_346_738 | 130 |
| 736 | 3300053080 | Ga0500635_0002835 | Ga0500635_0002835_2314_2706 | 130 |
| 737 | 3300053085 | Ga0495619_0205580 | Ga0495619_0205580_643_1035 | 130 |
| 738 | 3300053087 | Ga0500643_001472 | Ga0500643_001472_8606_8998 | 130 |
| 739 | 3300053104 | Ga0500556_0056120 | Ga0500556_0056120_117_509 | 130 |
| 740 | 3300053108 | Ga0500562_014800 | Ga0500562_014800_1482_1874 | 130 |
| 741 | 3300053109 | Ga0500569_239856 | Ga0500569_239856_165_557 | 130 |
| 742 | 3300053131 | Ga0500652_002611 | Ga0500652_002611_518_910 | 130 |
| 743 | 3300053139 | Ga0500568_0093889 | Ga0500568_0093889_606_998 | 130 |
| 744 | 3300053151 | Ga0500604_0108397 | Ga0500604_0108397_103_495 | 130 |
| 745 | 3300053160 | Ga0500633_0053075 | Ga0500633_0053075_27_419 | 130 |
| 746 | 3300061719 | Ga0466962_0023406 | Ga0466962_0023406_2483_2878 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3loq-assembly2.cif.gz_B | the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 | 0.8565 | 2 | 127 |
| 3ab7-assembly3.cif.gz_B | crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 | 0.8418 | 2 | 125 |
| 3loq-assembly1.cif.gz_A | the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 | 0.8355 | 2 | 127 |
| 3ab7-assembly2.cif.gz_A | crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 | 0.8207 | 2 | 125 |
| 5ahw-assembly3.cif.gz_E | crystal structure of universal stress protein msmeg_3811 in complex with camp | 0.8166 | 2 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3loqB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8205 | 2 | 126 | 3.40.50.620 |
| 5ahwB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8096 | 2 | 128 | 3.40.50.620 |
| af_P9WGL3_237_367_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7957 | 2 | 117 | 3.40.50.620 |
| af_Q84JS5_13_201_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.793 | 2 | 130 | 3.40.50.620 |
| 3ab8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7926 | 2 | 125 | 3.40.50.12370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A563DUN2-F1-model_v4 | Universal stress protein | 0.9637 | 2 | 127 |
|
| AF-A0A1H0T9J0-F1-model_v4 | Nucleotide-binding universal stress protein, UspA family | 0.958 | 2 | 129 |
|
| AF-A0A0T1WAK1-F1-model_v4 | Universal stress protein UspA | 0.9557 | 1 | 129 |
|
| AF-A0A0A0IU55-F1-model_v4 | deleted | 0.9486 | 1 | 129 |
|
| AF-A0A0T1WAK1-F1-model_v4 | Universal stress protein UspA | 0.9486 | 1 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar