F478846

General Info

Members Datasets Scaffolds Average Seq Length
746 315 735 130

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100534923|Ga0070665_1005349232
Length 140
Sequence MTIVVAYQETPEGRRALGHAMAEAGLRHTDLVVLTAPSRADGDPVTRLPEVPVPHLGGPPAADGSVATAEHPAVAVHLRNAVKPDHLADELLDLAGELDAELIVIGLRRRSPVGKLLLGSAAQHILLNSTVPVLAVRLPD

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
306 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.15
Nodule 0.13
Rhizoplane 10.86
Rhizosphere 68.63
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004700 3300001977 Bacteria 2145
2 JGI24747J21853_1004637 3300001978 Bacteria 1241
3 JGI24739J22299_10076627 3300001989 Bacteria 1032
4 JGI24743J22301_10036081 3300001991 Bacteria 984
5 JGI24750J21931_1003756 3300002070 Bacteria 1828
6 JGI24748J21848_1028046 3300002074 Bacteria 691
7 JGI24738J21930_10017264 3300002075 Bacteria 1518
8 JGI24749J21850_1033947 3300002076 Bacteria 737
9 JGI24742J22300_10003250 3300002244 Bacteria 2632
10 Ga0055540_1001555 3300003792 Bacteria 13435
11 Ga0055540_1001762 3300003792 Bacteria 12361
12 Ga0055540_1005999 3300003792 Bacteria 4924
13 Ga0070676_10141824 3300005328 Bacteria 1531
14 Ga0070690_100015282 3300005330 Bacteria 4575
15 Ga0070682_100045623 3300005337 Bacteria 2717
16 Ga0070682_100050564 3300005337 Bacteria 2595
17 Ga0068868_100044111 3300005338 Bacteria 3486
18 Ga0068868_101295860 3300005338 Bacteria 677
19 Ga0068868_101760914 3300005338 Bacteria 585
20 Ga0070660_100441054 3300005339 Bacteria 1079
21 Ga0070689_100081268 3300005340 Bacteria 2544
22 Ga0070689_100676428 3300005340 Bacteria 899
23 Ga0070691_10020122 3300005341 Bacteria 3081
24 Ga0070687_100165078 3300005343 Bacteria 1313
25 Ga0070661_101290350 3300005344 Bacteria 612
26 Ga0070692_10071891 3300005345 Bacteria 1844
27 Ga0070692_10344252 3300005345 Bacteria 924
28 Ga0070668_100018346 3300005347 Bacteria 5253
29 Ga0070668_100552354 3300005347 Bacteria 1002
30 Ga0070668_100780838 3300005347 Bacteria 847
31 Ga0070668_101222450 3300005347 Bacteria 681
32 Ga0070668_101240391 3300005347 Bacteria 676
33 Ga0070669_100024054 3300005353 Bacteria 4365
34 Ga0070669_100902614 3300005353 Bacteria 755
35 Ga0070675_101291193 3300005354 Bacteria 672
36 Ga0070671_100131523 3300005355 Bacteria 2108
37 Ga0070671_100357800 3300005355 Bacteria 1246
38 Ga0070674_100004138 3300005356 Bacteria 8242
39 Ga0070674_100117581 3300005356 Bacteria 1963
40 Ga0070674_100425436 3300005356 Bacteria 1090
41 Ga0070674_100537779 3300005356 Bacteria 978
42 Ga0070673_100142429 3300005364 Bacteria 2024
43 Ga0070688_100040946 3300005365 Bacteria 2841
44 Ga0070688_100774567 3300005365 Bacteria 748
45 Ga0070659_100320572 3300005366 Bacteria 1295
46 Ga0070659_100325950 3300005366 Bacteria 1284
47 Ga0070659_100677449 3300005366 Bacteria 890
48 Ga0070659_100748433 3300005366 Bacteria 847
49 Ga0070667_100000033 3300005367 Bacteria 175463
50 Ga0070667_100286459 3300005367 Bacteria 1480
51 Ga0070667_100303528 3300005367 Bacteria 1438
52 Ga0070667_100429825 3300005367 Bacteria 1205
53 Ga0070667_100698118 3300005367 Bacteria 939
54 Ga0070667_100953261 3300005367 Bacteria 800
55 Ga0070703_10152677 3300005406 Bacteria 869
56 Ga0070709_10367815 3300005434 Bacteria 1066
57 Ga0070709_10374096 3300005434 Bacteria 1058
58 Ga0070709_11527633 3300005434 Bacteria 543
59 Ga0070714_101058418 3300005435 Bacteria 790
60 Ga0070714_101631999 3300005435 Bacteria 630
61 Ga0070713_100525764 3300005436 Bacteria 1118
62 Ga0070713_100617057 3300005436 Bacteria 1031
63 Ga0070710_10033816 3300005437 Bacteria 2778
64 Ga0070710_10492806 3300005437 Bacteria 838
65 Ga0070701_10056707 3300005438 Bacteria 2050
66 Ga0070711_100090815 3300005439 Bacteria 2200
67 Ga0070711_100144645 3300005439 Bacteria 1786
68 Ga0070711_100447176 3300005439 Bacteria 1057
69 Ga0070711_101636906 3300005439 Bacteria 563
70 Ga0070705_100422947 3300005440 Bacteria 992
71 Ga0070705_100483190 3300005440 Bacteria 936
72 Ga0070705_100491612 3300005440 Bacteria 929
73 Ga0070700_100063497 3300005441 Bacteria 2336
74 Ga0070700_100067467 3300005441 Bacteria 2272
75 Ga0070694_100307995 3300005444 Bacteria 1215
76 Ga0070694_100669458 3300005444 Bacteria 841
77 Ga0070663_100060596 3300005455 Bacteria 2723
78 Ga0070678_100024639 3300005456 Bacteria 4033
79 Ga0070678_100094887 3300005456 Bacteria 2297
80 Ga0070678_100354492 3300005456 Bacteria 1262
81 Ga0070678_100545073 3300005456 Bacteria 1029
82 Ga0070678_101454227 3300005456 Bacteria 641
83 Ga0070662_100050929 3300005457 Bacteria 2988
84 Ga0070662_100483152 3300005457 Bacteria 1031
85 Ga0068867_100038013 3300005459 Bacteria 3502
86 Ga0068867_100758334 3300005459 Bacteria 862
87 Ga0070685_10074114 3300005466 Bacteria 2025
88 Ga0070685_11283852 3300005466 Bacteria 559
89 Ga0068853_100101330 3300005539 Bacteria 2546
90 Ga0070672_100185834 3300005543 Bacteria 1733
91 Ga0070672_100295908 3300005543 Bacteria 1371
92 Ga0070686_100335988 3300005544 Bacteria 1131
93 Ga0070686_100605690 3300005544 Bacteria 864
94 Ga0070686_100980936 3300005544 Bacteria 692
95 Ga0070695_100338423 3300005545 Bacteria 1124
96 Ga0070695_100501856 3300005545 Bacteria 938
97 Ga0070696_100014832 3300005546 Bacteria 5230
98 Ga0070696_100811813 3300005546 Bacteria 770
99 Ga0070693_100063599 3300005547 Bacteria 2151
100 Ga0070693_100195834 3300005547 Bacteria 1309
101 Ga0070665_100003442 3300005548 Bacteria 16878
102 Ga0070665_100012426 3300005548 Bacteria 8584
103 Ga0070665_100225233 3300005548 Bacteria 1875
104 Ga0070665_100534923 3300005548 Bacteria 1184
105 Ga0070665_100578672 3300005548 Bacteria 1136
106 Ga0070665_101793508 3300005548 Bacteria 620
107 Ga0070665_101871361 3300005548 Bacteria 606
108 Ga0070704_100167139 3300005549 Bacteria 1745
109 Ga0070704_100581033 3300005549 Bacteria 982
110 Ga0068855_100566982 3300005563 Bacteria 1228
111 Ga0068855_100694287 3300005563 Bacteria 1090
112 Ga0068854_100009094 3300005578 Bacteria 6403
113 Ga0068854_100582206 3300005578 Bacteria 953
114 Ga0068854_101942456 3300005578 Bacteria 541
115 Ga0068856_100549468 3300005614 Bacteria 1176
116 Ga0068856_100711503 3300005614 Bacteria 1025
117 Ga0070702_100018741 3300005615 Bacteria 3595
118 Ga0070702_100060631 3300005615 Bacteria 2200
119 Ga0070702_100467820 3300005615 Bacteria 918
120 Ga0070702_100544281 3300005615 Bacteria 860
121 Ga0070702_100998899 3300005615 Bacteria 662
122 Ga0068852_100737360 3300005616 Bacteria 997
123 Ga0068852_100976185 3300005616 Bacteria 865
124 Ga0068859_100001651 3300005617 Bacteria 22756
125 Ga0068859_100120223 3300005617 Bacteria 2693
126 Ga0068864_100206429 3300005618 Bacteria 1807
127 Ga0068864_100593589 3300005618 Bacteria 1074
128 Ga0068864_101224531 3300005618 Bacteria 750
129 Ga0068866_10011313 3300005718 Bacteria 3857
130 Ga0068866_10269219 3300005718 Bacteria 1050
131 Ga0068861_100084809 3300005719 Bacteria 2487
132 Ga0068861_100724008 3300005719 Bacteria 927
133 Ga0068863_100000193 3300005841 Bacteria 64832
134 Ga0068863_100003240 3300005841 Bacteria 16104
135 Ga0068863_100083739 3300005841 Bacteria 3022
136 Ga0068863_100089147 3300005841 Bacteria 2924
137 Ga0068863_100189191 3300005841 Bacteria 1978
138 Ga0068858_100105154 3300005842 Bacteria 2634
139 Ga0068858_100110610 3300005842 Bacteria 2565
140 Ga0068858_100441945 3300005842 Bacteria 1253
141 Ga0068858_100541723 3300005842 Bacteria 1126
142 Ga0068860_100000010 3300005843 Bacteria 359114
143 Ga0068860_100057620 3300005843 Bacteria 3693
144 Ga0068860_100183892 3300005843 Bacteria 2020
145 Ga0068860_101472776 3300005843 Bacteria 702
146 Ga0068862_100000205 3300005844 Bacteria 65575
147 Ga0068862_100220630 3300005844 Bacteria 1716
148 Ga0068862_101086914 3300005844 Bacteria 794
149 Ga0068862_102288505 3300005844 Bacteria 552
150 Ga0081455_10250827 3300005937 Bacteria 1294
151 Ga0081455_10279618 3300005937 Bacteria 1206
152 Ga0081538_10057611 3300005981 Bacteria 2261
153 Ga0075365_10063360 3300006038 Bacteria 2475
154 Ga0075365_10123630 3300006038 Bacteria 1787
155 Ga0075365_10169666 3300006038 Bacteria 1523
156 Ga0075365_10358456 3300006038 Bacteria 1028
157 Ga0075365_10634095 3300006038 Bacteria 755
158 Ga0075365_10705190 3300006038 Bacteria 713
159 Ga0075368_10187911 3300006042 Bacteria 872
160 Ga0075363_100001201 3300006048 Bacteria 9562
161 Ga0075363_100001555 3300006048 Bacteria 8806
162 Ga0075363_100026491 3300006048 Bacteria 2967
163 Ga0075363_100033718 3300006048 Bacteria 2669
164 Ga0075363_100067306 3300006048 Bacteria 1940
165 Ga0075363_100080002 3300006048 Bacteria 1786
166 Ga0075364_10002712 3300006051 Bacteria 9948
167 Ga0075364_10004244 3300006051 Bacteria 8230
168 Ga0075364_10190757 3300006051 Bacteria 1388
169 Ga0075364_10210105 3300006051 Bacteria 1320
170 Ga0075364_10268302 3300006051 Bacteria 1161
171 Ga0075364_10338707 3300006051 Bacteria 1025
172 Ga0075364_10464259 3300006051 Bacteria 865
173 Ga0075364_10725905 3300006051 Bacteria 678
174 Ga0075364_11045142 3300006051 Bacteria 555
175 Ga0070715_10627003 3300006163 Bacteria 633
176 Ga0070716_100579852 3300006173 Bacteria 841
177 Ga0070716_101277733 3300006173 Bacteria 592
178 Ga0070712_100009919 3300006175 Bacteria 6003
179 Ga0070712_100023386 3300006175 Bacteria 4082
180 Ga0075362_10022933 3300006177 Bacteria 2634
181 Ga0075362_10054166 3300006177 Bacteria 1802
182 Ga0075362_10112778 3300006177 Bacteria 1281
183 Ga0075362_10155013 3300006177 Bacteria 1101
184 Ga0075367_10021805 3300006178 Bacteria 3585
185 Ga0075367_10440053 3300006178 Bacteria 826
186 Ga0075369_10000601 3300006186 Bacteria 11423
187 Ga0075369_10003984 3300006186 Bacteria 5419
188 Ga0075369_10010261 3300006186 Bacteria 3661
189 Ga0075369_10181622 3300006186 Bacteria 968
190 Ga0075369_10290178 3300006186 Bacteria 763
191 Ga0075369_10535737 3300006186 Bacteria 558
192 Ga0097621_100011755 3300006237 Bacteria 6464
193 Ga0097621_100406308 3300006237 Bacteria 1220
194 Ga0075370_10004679 3300006353 Bacteria 6677
195 Ga0075370_10062011 3300006353 Bacteria 2130
196 Ga0075370_10143790 3300006353 Bacteria 1395
197 Ga0075370_10146843 3300006353 Bacteria 1381
198 Ga0068871_100122197 3300006358 Bacteria 2201
199 Ga0068871_100612742 3300006358 Bacteria 991
200 Ga0075428_100010132 3300006844 Bacteria 10471
201 Ga0075430_100002450 3300006846 Bacteria 15454
202 Ga0075431_100002383 3300006847 Bacteria 18066
203 Ga0075433_10582228 3300006852 Bacteria 983
204 Ga0075434_100916699 3300006871 Bacteria 891
205 Ga0075434_101207075 3300006871 Bacteria 768
206 Ga0075429_100003191 3300006880 Bacteria 13944
207 Ga0068865_100050587 3300006881 Bacteria 2871
208 Ga0068865_100063078 3300006881 Bacteria 2603
209 Ga0068865_100427524 3300006881 Bacteria 1090
210 Ga0097620_100001651 3300006931 Bacteria 22756
211 Ga0097620_100120225 3300006931 Bacteria 2693
212 Ga0097620_103074566 3300006931 Bacteria 509
213 Ga0105251_10119064 3300009011 Bacteria 1200
214 Ga0105250_10460122 3300009092 Bacteria 572
215 Ga0105240_11204588 3300009093 Bacteria 802
216 Ga0105245_10051087 3300009098 Bacteria 3706
217 Ga0105245_10761590 3300009098 Bacteria 1004
218 Ga0105247_10000082 3300009101 Bacteria 106460
219 Ga0105247_10069419 3300009101 Bacteria 2199
220 Ga0105247_10138777 3300009101 Bacteria 1591
221 Ga0105247_10171891 3300009101 Bacteria 1441
222 Ga0105247_10188098 3300009101 Bacteria 1381
223 Ga0105247_10383025 3300009101 Bacteria 998
224 Ga0114129_10004429 3300009147 Bacteria 19823
225 Ga0105243_10124009 3300009148 Bacteria 2183
226 Ga0105243_10193596 3300009148 Bacteria 1778
227 Ga0105243_10491911 3300009148 Bacteria 1160
228 Ga0105243_10836171 3300009148 Unclassified 910
229 Ga0105243_12277337 3300009148 Bacteria 579
230 Ga0105241_10187101 3300009174 Bacteria 1722
231 Ga0105241_10592499 3300009174 Bacteria 1000
232 Ga0105241_10889712 3300009174 Bacteria 826
233 Ga0105242_10212148 3300009176 Bacteria 1726
234 Ga0105242_10636241 3300009176 Bacteria 1035
235 Ga0105248_10000084 3300009177 Bacteria 110380
236 Ga0105248_10045541 3300009177 Bacteria 4919
237 Ga0105248_10079301 3300009177 Bacteria 3690
238 Ga0105248_10384927 3300009177 Bacteria 1579
239 Ga0105248_10425874 3300009177 Bacteria 1495
240 Ga0105248_10648813 3300009177 Bacteria 1191
241 Ga0105248_10894011 3300009177 Bacteria 1003
242 Ga0105237_10001322 3300009545 Bacteria 32861
243 Ga0105237_10323336 3300009545 Bacteria 1546
244 Ga0105237_10579900 3300009545 Bacteria 1128
245 Ga0105238_10071422 3300009551 Bacteria 3469
246 Ga0105238_10411270 3300009551 Bacteria 1347
247 Ga0105238_10627594 3300009551 Bacteria 1084
248 Ga0105238_12447126 3300009551 Bacteria 558
249 Ga0105249_10000285 3300009553 Bacteria 52372
250 Ga0105249_10255109 3300009553 Bacteria 1740
251 Ga0105249_10604345 3300009553 Bacteria 1152
252 Ga0105249_11287530 3300009553 Bacteria 802
253 Ga0105249_11768580 3300009553 Bacteria 691
254 Ga0105249_11826317 3300009553 Bacteria 680
255 Ga0105239_10011658 3300010375 Bacteria 9812
256 Ga0105239_10024619 3300010375 Bacteria 6631
257 Ga0105239_10752324 3300010375 Bacteria 1115
258 Ga0105239_11865801 3300010375 Bacteria 697
259 Ga0105239_12052310 3300010375 Bacteria 664
260 Ga0105246_10164337 3300011119 Bacteria 1694
261 Ga0105246_10184996 3300011119 Bacteria 1607
262 Ga0105246_10531246 3300011119 Bacteria 1004
263 Ga0157371_10367199 3300013102 Bacteria 1049
264 Ga0157371_10859013 3300013102 Bacteria 686
265 Ga0157369_11766139 3300013105 Bacteria 628
266 Ga0157374_10511398 3300013296 Bacteria 1206
267 Ga0157374_12693069 3300013296 Bacteria 525
268 Ga0157378_10178812 3300013297 Bacteria 1994
269 Ga0157378_10264821 3300013297 Bacteria 1651
270 Ga0157378_10449534 3300013297 Bacteria 1278
271 Ga0163162_10028509 3300013306 Bacteria 5525
272 Ga0163162_10681207 3300013306 Bacteria 1151
273 Ga0163162_12092277 3300013306 Bacteria 649
274 Ga0157372_10392164 3300013307 Bacteria 1618
275 Ga0157372_10444451 3300013307 Bacteria 1511
276 Ga0157372_10871701 3300013307 Bacteria 1045
277 Ga0157375_10896535 3300013308 Bacteria 1031
278 Ga0157375_11086150 3300013308 Bacteria 936
279 Ga0157375_11675328 3300013308 Bacteria 753
280 Ga0163163_10206354 3300014325 Bacteria 2013
281 Ga0163163_10294424 3300014325 Bacteria 1675
282 Ga0163163_10748389 3300014325 Bacteria 1041
283 Ga0157380_10061839 3300014326 Bacteria 2998
284 Ga0157380_10417625 3300014326 Bacteria 1278
285 Ga0157377_10923607 3300014745 Bacteria 654
286 Ga0157379_10052581 3300014968 Bacteria 3639
287 Ga0157379_10360750 3300014968 Bacteria 1332
288 Ga0157379_10454283 3300014968 Bacteria 1183
289 Ga0157379_10910640 3300014968 Bacteria 835
290 Ga0157376_10200898 3300014969 Bacteria 1834
291 Ga0157376_10479904 3300014969 Bacteria 1218
292 Ga0157376_10713778 3300014969 Bacteria 1009
293 Ga0157376_11641378 3300014969 Bacteria 677
294 Ga0163161_10096797 3300017792 Bacteria 2191
295 Ga0163161_10426864 3300017792 Bacteria 1067
296 Ga0163161_10616422 3300017792 Bacteria 896
297 Ga0163161_10853020 3300017792 Bacteria 769
298 Ga0209673_1041609 3300025273 Bacteria 1302
299 Ga0209673_1090871 3300025273 Bacteria 676
300 Ga0209051_1000594 3300025303 Bacteria 42766
301 Ga0209051_1001327 3300025303 Bacteria 21574
302 Ga0209051_1002457 3300025303 Bacteria 13267
303 Ga0209051_1019705 3300025303 Bacteria 2933
304 Ga0209051_1023237 3300025303 Bacteria 2583
305 Ga0207653_10034056 3300025885 Bacteria 1654
306 Ga0207692_10099142 3300025898 Bacteria 1596
307 Ga0207692_10317478 3300025898 Bacteria 952
308 Ga0207642_10068498 3300025899 Bacteria 1679
309 Ga0207642_10344377 3300025899 Bacteria 877
310 Ga0207710_10000263 3300025900 Bacteria 43581
311 Ga0207710_10079942 3300025900 Bacteria 1515
312 Ga0207710_10140800 3300025900 Bacteria 1164
313 Ga0207710_10196341 3300025900 Bacteria 995
314 Ga0207710_10340513 3300025900 Bacteria 763
315 Ga0207688_10019300 3300025901 Bacteria 3712
316 Ga0207688_10506750 3300025901 Bacteria 756
317 Ga0207680_10035392 3300025903 Bacteria 2867
318 Ga0207680_11099990 3300025903 Bacteria 568
319 Ga0207647_10034828 3300025904 Bacteria 3211
320 Ga0207685_10143931 3300025905 Bacteria 1072
321 Ga0207685_10184472 3300025905 Bacteria 969
322 Ga0207699_10069074 3300025906 Bacteria 2153
323 Ga0207699_10427800 3300025906 Bacteria 947
324 Ga0207699_10679700 3300025906 Bacteria 753
325 Ga0207645_10010653 3300025907 Bacteria 6308
326 Ga0207643_10260856 3300025908 Bacteria 1070
327 Ga0207705_10163937 3300025909 Bacteria 1671
328 Ga0207654_10160709 3300025911 Bacteria 1451
329 Ga0207671_10020933 3300025914 Bacteria 4972
330 Ga0207671_10672702 3300025914 Bacteria 824
331 Ga0207693_10015796 3300025915 Bacteria 6049
332 Ga0207693_10129064 3300025915 Bacteria 1987
333 Ga0207663_10050302 3300025916 Bacteria 2589
334 Ga0207663_10286176 3300025916 Bacteria 1226
335 Ga0207663_11107342 3300025916 Bacteria 637
336 Ga0207662_10091817 3300025918 Bacteria 1868
337 Ga0207649_11133589 3300025920 Bacteria 617
338 Ga0207681_10004263 3300025923 Bacteria 8826
339 Ga0207681_10862482 3300025923 Bacteria 757
340 Ga0207694_10400410 3300025924 Bacteria 1141
341 Ga0207694_10461393 3300025924 Bacteria 1061
342 Ga0207694_10621533 3300025924 Bacteria 909
343 Ga0207650_11008347 3300025925 Bacteria 708
344 Ga0207687_10080878 3300025927 Bacteria 2347
345 Ga0207687_10789280 3300025927 Bacteria 810
346 Ga0207687_10815187 3300025927 Bacteria 796
347 Ga0207700_10364492 3300025928 Bacteria 1260
348 Ga0207700_10532690 3300025928 Bacteria 1041
349 Ga0207644_10023915 3300025931 Bacteria 4190
350 Ga0207644_10224507 3300025931 Bacteria 1490
351 Ga0207644_11441206 3300025931 Bacteria 578
352 Ga0207690_10282556 3300025932 Bacteria 1293
353 Ga0207690_10525368 3300025932 Bacteria 960
354 Ga0207706_10011311 3300025933 Bacteria 8131
355 Ga0207706_10471147 3300025933 Bacteria 1085
356 Ga0207706_11264658 3300025933 Bacteria 611
357 Ga0207686_10062265 3300025934 Bacteria 2368
358 Ga0207709_10100118 3300025935 Bacteria 1914
359 Ga0207709_10121588 3300025935 Bacteria 1764
360 Ga0207709_10800589 3300025935 Bacteria 761
361 Ga0207709_11565935 3300025935 Bacteria 547
362 Ga0207670_10257882 3300025936 Bacteria 1350
363 Ga0207670_10531148 3300025936 Bacteria 959
364 Ga0207669_10069211 3300025937 Bacteria 2207
365 Ga0207669_10088478 3300025937 Bacteria 2008
366 Ga0207669_10234010 3300025937 Bacteria 1357
367 Ga0207704_10050726 3300025938 Bacteria 2505
368 Ga0207704_10080189 3300025938 Bacteria 2106
369 Ga0207704_10093216 3300025938 Bacteria 1984
370 Ga0207704_10389140 3300025938 Bacteria 1097
371 Ga0207665_10013432 3300025939 Bacteria 5384
372 Ga0207665_10021303 3300025939 Bacteria 4262
373 Ga0207665_10458465 3300025939 Bacteria 979
374 Ga0207665_10607145 3300025939 Bacteria 855
375 Ga0207691_10121641 3300025940 Bacteria 2313
376 Ga0207691_10145610 3300025940 Bacteria 2085
377 Ga0207711_10002374 3300025941 Bacteria 16853
378 Ga0207711_10133249 3300025941 Bacteria 2230
379 Ga0207711_10327481 3300025941 Bacteria 1416
380 Ga0207711_10623806 3300025941 Bacteria 1006
381 Ga0207711_10874221 3300025941 Bacteria 836
382 Ga0207689_10018584 3300025942 Bacteria 5864
383 Ga0207667_10138782 3300025949 Bacteria 2503
384 Ga0207667_10259210 3300025949 Bacteria 1778
385 Ga0207651_10763336 3300025960 Bacteria 855
386 Ga0207712_10000011 3300025961 Bacteria 412321
387 Ga0207712_10177806 3300025961 Bacteria 1669
388 Ga0207712_10695480 3300025961 Bacteria 887
389 Ga0207668_10000743 3300025972 Bacteria 19893
390 Ga0207668_10121415 3300025972 Bacteria 1979
391 Ga0207668_10130203 3300025972 Bacteria 1920
392 Ga0207668_10172034 3300025972 Bacteria 1700
393 Ga0207668_10607086 3300025972 Bacteria 953
394 Ga0207640_10258523 3300025981 Bacteria 1355
395 Ga0207640_10354149 3300025981 Bacteria 1180
396 Ga0207640_10502487 3300025981 Bacteria 1010
397 Ga0207640_10528075 3300025981 Bacteria 987
398 Ga0207658_10000220 3300025986 Bacteria 59846
399 Ga0207658_10020156 3300025986 Bacteria 4618
400 Ga0207658_10023013 3300025986 Bacteria 4344
401 Ga0207658_10029355 3300025986 Bacteria 3883
402 Ga0207658_10053838 3300025986 Bacteria 2975
403 Ga0207677_10488769 3300026023 Bacteria 1062
404 Ga0207677_10536583 3300026023 Bacteria 1017
405 Ga0207677_10988370 3300026023 Bacteria 762
406 Ga0207703_10049187 3300026035 Bacteria 3407
407 Ga0207703_10261012 3300026035 Bacteria 1566
408 Ga0207703_10416162 3300026035 Bacteria 1250
409 Ga0207703_10423477 3300026035 Bacteria 1239
410 Ga0207703_10591277 3300026035 Bacteria 1049
411 Ga0207639_10092003 3300026041 Bacteria 2430
412 Ga0207639_10283850 3300026041 Bacteria 1457
413 Ga0207678_10033813 3300026067 Bacteria 4453
414 Ga0207678_10053695 3300026067 Bacteria 3472
415 Ga0207678_10095518 3300026067 Bacteria 2540
416 Ga0207708_10600069 3300026075 Bacteria 933
417 Ga0207708_11051813 3300026075 Bacteria 708
418 Ga0207702_10977708 3300026078 Bacteria 839
419 Ga0207641_10000437 3300026088 Bacteria 47860
420 Ga0207641_10079493 3300026088 Bacteria 2843
421 Ga0207641_10232408 3300026088 Bacteria 1714
422 Ga0207641_10453114 3300026088 Bacteria 1240
423 Ga0207641_10659261 3300026088 Bacteria 1028
424 Ga0207648_10023411 3300026089 Bacteria 5533
425 Ga0207648_10754176 3300026089 Bacteria 904
426 Ga0207676_10289069 3300026095 Bacteria 1492
427 Ga0207676_10539344 3300026095 Bacteria 1113
428 Ga0207676_10670217 3300026095 Bacteria 1002
429 Ga0207675_100246115 3300026118 Bacteria 1729
430 Ga0207675_100340011 3300026118 Bacteria 1469
431 Ga0207675_100966983 3300026118 Bacteria 869
432 Ga0207683_10039013 3300026121 Bacteria 4142
433 Ga0207683_10154333 3300026121 Bacteria 2073
434 Ga0207683_10202949 3300026121 Bacteria 1803
435 Ga0207683_10297146 3300026121 Bacteria 1477
436 Ga0207683_10458495 3300026121 Bacteria 1175
437 Ga0207683_10728277 3300026121 Bacteria 920
438 Ga0207698_10588684 3300026142 Bacteria 1095
439 Ga0207698_10614838 3300026142 Bacteria 1073
440 Ga0207698_11341409 3300026142 Bacteria 730
441 Ga0209813_10041151 3300027866 Bacteria 1407
442 Ga0209813_10155261 3300027866 Bacteria 822
443 Ga0268266_10001362 3300028379 Bacteria 29491
444 Ga0268266_10012103 3300028379 Bacteria 7467
445 Ga0268266_10319251 3300028379 Bacteria 1453
446 Ga0268266_11060641 3300028379 Bacteria 784
447 Ga0268266_11256195 3300028379 Bacteria 716
448 Ga0268266_11291575 3300028379 Bacteria 705
449 Ga0268266_11464426 3300028379 Bacteria 658
450 Ga0268265_10000007 3300028380 Bacteria 431817
451 Ga0268265_10115130 3300028380 Bacteria 2203
452 Ga0268265_10625650 3300028380 Bacteria 1032
453 Ga0268265_10921125 3300028380 Bacteria 859
454 Ga0268265_11040140 3300028380 Bacteria 810
455 Ga0268264_10000007 3300028381 Bacteria 815790
456 Ga0268264_10133110 3300028381 Bacteria 2207
457 Ga0268264_11112020 3300028381 Bacteria 799
458 Ga0307413_11603130 3300031824 Bacteria 578
459 Ga0307410_10034512 3300031852 Bacteria 3277
460 Ga0307410_11247926 3300031852 Bacteria 649
461 Ga0307410_11804209 3300031852 Bacteria 543
462 Ga0307407_10024784 3300031903 Bacteria 3152
463 Ga0307407_10164583 3300031903 Bacteria 1455
464 Ga0307412_10061732 3300031911 Bacteria 2521
465 Ga0307412_10814369 3300031911 Bacteria 812
466 Ga0307412_11485122 3300031911 Bacteria 616
467 Ga0307409_100243326 3300031995 Bacteria 1639
468 Ga0307414_10204497 3300032004 Bacteria 1609
469 Ga0307414_10934793 3300032004 Bacteria 796
470 Ga0307411_10322502 3300032005 Bacteria 1248
471 Ga0307411_11884777 3300032005 Bacteria 556
472 Ga0307415_100120642 3300032126 Bacteria 1965
473 Ga0307415_100650165 3300032126 Bacteria 945
474 Ga0373958_0201070 3300034819 Bacteria 522
475 Ga0373952_0086123 3300035092 Bacteria 809
476 Ga0373932_0101457 3300035112 Bacteria 937
477 Ga0373961_0124879 3300035241 Bacteria 856
478 Ga0373931_0085985 3300035691 Bacteria 1744
479 Ga0373931_0234393 3300035691 Bacteria 1110
480 Ga0439436_0098676 3300041404 Bacteria 814
481 Ga0439461_0050756 3300041410 Bacteria 919
482 Ga0439461_0056440 3300041410 Bacteria 882
483 Ga0439466_0006222 3300041411 Bacteria 4544
484 Ga0439466_0015440 3300041411 Bacteria 2773
485 Ga0439465_0008521 3300041413 Bacteria 3234
486 Ga0439465_0030042 3300041413 Bacteria 1727
487 Ga0439465_0309382 3300041413 Bacteria 592
488 Ga0451793_0382928 3300041452 Bacteria 1003
489 Ga0451795_0332063 3300041456 Bacteria 1193
490 Ga0451802_1020011 3300041460 Bacteria 954
491 Ga0451806_234695 3300041462 Bacteria 836
492 Ga0451849_1134475 3300041505 Bacteria 780
493 Ga0451851_0386491 3300041507 Bacteria 2177
494 Ga0451853_2082484 3300041512 Bacteria 1020
495 Ga0439431_0004898 3300041997 Bacteria 2951
496 Ga0439442_011258 3300042002 Bacteria 1819
497 Ga0439445_0004645 3300042004 Bacteria 3114
498 Ga0439445_0010971 3300042004 Bacteria 2152
499 Ga0439450_022713 3300042008 Bacteria 1357
500 Ga0439434_0021846 3300042435 Bacteria 1923
501 Ga0466972_0008913 3300044658 Bacteria 5032
502 Ga0466972_0015341 3300044658 Bacteria 3830
503 Ga0466972_0030250 3300044658 Bacteria 2666
504 Ga0466972_0071967 3300044658 Bacteria 1649
505 Ga0466972_0099630 3300044658 Bacteria 1375
506 Ga0466972_0319248 3300044658 Bacteria 726
507 Ga0466965_0002694 3300044683 Bacteria 7604
508 Ga0466965_0073984 3300044683 Bacteria 1716
509 Ga0466961_0049062 3300044693 Bacteria 2699
510 Ga0466964_0696466 3300044706 Bacteria 566
511 Ga0466968_0050691 3300044735 Bacteria 1772
512 Ga0466970_0054459 3300044765 Bacteria 2136
513 Ga0466970_0173730 3300044765 Bacteria 1194
514 Ga0466970_0701835 3300044765 Bacteria 590
515 Ga0466957_0009124 3300044842 Bacteria 5656
516 Ga0466957_0565758 3300044842 Bacteria 793
517 Ga0466960_0050259 3300044901 Bacteria 2010
518 Ga0466959_0046300 3300045049 Bacteria 3201
519 Ga0466958_0085205 3300045836 Bacteria 1949
520 Ga0466967_0263044 3300045976 Bacteria 1651
521 Ga0466967_0355692 3300045976 Bacteria 1418
522 Ga0495629_0004769 3300046459 Bacteria 10167
523 Ga0495629_0234133 3300046459 Bacteria 1266
524 Ga0495638_0005530 3300046460 Bacteria 9377
525 Ga0495638_0334245 3300046460 Bacteria 805
526 Ga0495582_0299622 3300046473 Bacteria 924
527 Ga0495582_0454156 3300046473 Bacteria 740
528 Ga0495662_0072499 3300046476 Bacteria 1670
529 Ga0495594_0052719 3300046499 Bacteria 2240
530 Ga0495583_0126820 3300046506 Bacteria 1070
531 Ga0495606_0110052 3300046507 Bacteria 1663
532 Ga0495618_0162594 3300046514 Bacteria 1423
533 Ga0495643_0481491 3300046522 Bacteria 536
534 Ga0495648_0011454 3300046524 Bacteria 6677
535 Ga0495642_0263579 3300046528 Bacteria 754
536 Ga0495640_0037508 3300046533 Bacteria 3419
537 Ga0495640_0462616 3300046533 Bacteria 774
538 Ga0495668_0034340 3300046616 Bacteria 2846
539 Ga0495658_0191758 3300046683 Bacteria 1271
540 Ga0495613_0004713 3300046689 Bacteria 10235
541 Ga0495624_0655252 3300046690 Bacteria 624
542 Ga0495649_0392751 3300046694 Bacteria 697
543 Ga0495581_0215188 3300047315 Bacteria 1123
544 Ga0495604_0089758 3300047317 Bacteria 2284
545 Ga0495674_0495613 3300047319 Bacteria 978
546 Ga0495672_0069647 3300047320 Bacteria 1996
547 Ga0495672_0079706 3300047320 Bacteria 1828
548 Ga0495672_0228303 3300047320 Bacteria 915
549 Ga0495676_0001154 3300047321 Bacteria 22464
550 Ga0495676_0101381 3300047321 Bacteria 2130
551 Ga0495673_0002084 3300047469 Bacteria 14599
552 Ga0495686_0006659 3300047472 Bacteria 8795
553 Ga0495686_0339170 3300047472 Bacteria 820
554 Ga0495593_0006679 3300047673 Bacteria 6753
555 Ga0495614_0000610 3300048089 Bacteria 14964
556 Ga0495626_0052874 3300048091 Bacteria 1871
557 Ga0496100_0004047 3300048903 Bacteria 7725
558 Ga0496100_0008578 3300048903 Bacteria 5705
559 Ga0496100_0011790 3300048903 Bacteria 4988
560 Ga0496100_0033241 3300048903 Bacteria 3226
561 Ga0496100_0052355 3300048903 Bacteria 2654
562 Ga0496100_0130670 3300048903 Bacteria 1768
563 Ga0496100_0364298 3300048903 Bacteria 1094
564 Ga0496101_0000299 3300048904 Bacteria 34617
565 Ga0496101_0000926 3300048904 Bacteria 17310
566 Ga0496101_0001429 3300048904 Bacteria 14266
567 Ga0496101_0006786 3300048904 Bacteria 7383
568 Ga0496101_0136105 3300048904 Bacteria 1869
569 Ga0496101_0536336 3300048904 Bacteria 925
570 Ga0496101_0641075 3300048904 Bacteria 839
571 Ga0496101_0963587 3300048904 Bacteria 671
572 Ga0496101_1147797 3300048904 Bacteria 609
573 Ga0496102_0000007 3300048905 Bacteria 417224
574 Ga0496102_0000249 3300048905 Bacteria 70385
575 Ga0496102_0066057 3300048905 Bacteria 3315
576 Ga0496102_0076689 3300048905 Bacteria 3075
577 Ga0496102_0150467 3300048905 Bacteria 2187
578 Ga0496102_0444591 3300048905 Bacteria 1216
579 Ga0496102_0967732 3300048905 Bacteria 772
580 Ga0496103_0000013 3300048906 Bacteria 297928
581 Ga0496103_0023577 3300048906 Bacteria 3712
582 Ga0496103_0067902 3300048906 Bacteria 2227
583 Ga0496103_0069420 3300048906 Bacteria 2203
584 Ga0496103_0085586 3300048906 Bacteria 1986
585 Ga0496103_0142453 3300048906 Bacteria 1534
586 Ga0496103_0534225 3300048906 Bacteria 749
587 Ga0496104_0002493 3300048907 Bacteria 15843
588 Ga0496104_0039487 3300048907 Bacteria 4419
589 Ga0496104_0608122 3300048907 Bacteria 1003
590 Ga0496105_0009048 3300048908 Bacteria 7771
591 Ga0496105_0032385 3300048908 Bacteria 4289
592 Ga0496105_0193940 3300048908 Bacteria 1660
593 Ga0496105_0283327 3300048908 Bacteria 1336
594 Ga0496105_1324089 3300048908 Bacteria 525
595 Ga0496106_0014630 3300048909 Bacteria 5798
596 Ga0496106_0031315 3300048909 Bacteria 3963
597 Ga0496106_0032115 3300048909 Bacteria 3913
598 Ga0496106_0056434 3300048909 Bacteria 2968
599 Ga0496106_0082400 3300048909 Bacteria 2473
600 Ga0496106_0216233 3300048909 Bacteria 1527
601 Ga0496106_0970471 3300048909 Bacteria 669
602 Ga0496107_0003186 3300048910 Bacteria 10911
603 Ga0496107_0003918 3300048910 Bacteria 10006
604 Ga0496107_0024700 3300048910 Bacteria 4252
605 Ga0496107_0027942 3300048910 Bacteria 4007
606 Ga0496107_0481503 3300048910 Bacteria 921
607 Ga0496108_0012071 3300048911 Bacteria 7024
608 Ga0496108_0135640 3300048911 Bacteria 2117
609 Ga0496108_0189202 3300048911 Bacteria 1784
610 Ga0496108_0463692 3300048911 Bacteria 1107
611 Ga0496108_0981024 3300048911 Bacteria 722
612 Ga0496109_0077885 3300048912 Bacteria 3051
613 Ga0496109_0167489 3300048912 Bacteria 2061
614 Ga0496109_1098843 3300048912 Bacteria 732
615 Ga0496110_0790590 3300048913 Bacteria 853
616 Ga0496110_0852603 3300048913 Bacteria 816
617 Ga0496111_0167722 3300048914 Bacteria 1631
618 Ga0496112_0021987 3300048915 Bacteria 6071
619 Ga0496112_0146419 3300048915 Bacteria 2330
620 Ga0496112_0498561 3300048915 Bacteria 1153
621 Ga0496112_0810557 3300048915 Bacteria 861
622 Ga0496113_0087906 3300048916 Bacteria 2390
623 Ga0496113_0159075 3300048916 Bacteria 1785
624 Ga0496114_0002207 3300048917 Bacteria 14830
625 Ga0496114_0002582 3300048917 Bacteria 13831
626 Ga0496114_0004034 3300048917 Bacteria 11338
627 Ga0496114_0586778 3300048917 Bacteria 983
628 Ga0496115_0008694 3300048918 Bacteria 7524
629 Ga0496115_0022166 3300048918 Bacteria 4916
630 Ga0496115_0088000 3300048918 Bacteria 2535
631 Ga0496115_0566752 3300048918 Bacteria 906
632 Ga0496115_0584670 3300048918 Bacteria 889
633 Ga0496115_1307168 3300048918 Bacteria 540
634 Ga0496116_0000033 3300048919 Bacteria 418191
635 Ga0496116_0034457 3300048919 Bacteria 3571
636 Ga0496117_0000025 3300048920 Bacteria 418106
637 Ga0496117_0006852 3300048920 Bacteria 11321
638 Ga0496118_0000023 3300048921 Bacteria 418106
639 Ga0496118_0069537 3300048921 Bacteria 2548
640 Ga0496119_0001166 3300048922 Bacteria 32898
641 Ga0496119_0011509 3300048922 Bacteria 7313
642 Ga0496119_0573306 3300048922 Bacteria 516
643 Ga0496120_0007290 3300048923 Bacteria 8259
644 Ga0496120_0011731 3300048923 Bacteria 6007
645 Ga0496121_0000039 3300048924 Bacteria 351444
646 Ga0496121_0005272 3300048924 Bacteria 16684
647 Ga0496121_0467679 3300048924 Bacteria 808
648 Ga0496121_0486587 3300048924 Bacteria 787
649 Ga0496122_0019511 3300048925 Bacteria 6188
650 Ga0496123_0038368 3300048926 Bacteria 3368
651 Ga0496123_0430720 3300048926 Bacteria 592
652 Ga0496124_0196177 3300048927 Bacteria 1540
653 Ga0496124_0264191 3300048927 Bacteria 1264
654 Ga0496125_0028720 3300048928 Bacteria 5015
655 Ga0496126_0000968 3300048929 Bacteria 49270
656 Ga0496126_0047629 3300048929 Bacteria 3924
657 Ga0496126_0073297 3300048929 Bacteria 3044
658 Ga0496126_0116218 3300048929 Bacteria 2325
659 Ga0496126_0331723 3300048929 Bacteria 1248
660 Ga0496126_0979878 3300048929 Bacteria 636
661 Ga0501034_0218530 3300049571 Bacteria 1859
662 Ga0501043_0443588 3300049579 Bacteria 976
663 Ga0501067_0213017 3300049583 Bacteria 1076
664 nmdc:mga03683_141464_c1 3300050489 Bacteria 1082
665 nmdc:mga03683_171812_c1 3300050489 Bacteria 985
666 nmdc:mga03683_74400_c1 3300050489 Bacteria 1457
667 nmdc:mga03683_85083_c1 3300050489 Bacteria 1371
668 nmdc:mga03n38_150708_c1 3300050490 Bacteria 1170
669 nmdc:mga03n38_19058_c1 3300050490 Bacteria 2719
670 nmdc:mga03n38_298764_c1 3300050490 Bacteria 864
671 nmdc:mga03n38_331717_c1 3300050490 Bacteria 824
672 nmdc:mga03n38_481962_c1 3300050490 Bacteria 694
673 nmdc:mga03n38_57144_c1 3300050490 Bacteria 1763
674 nmdc:mga03n38_610_c1 3300050490 Bacteria 9139
675 nmdc:mga03n38_76983_c1 3300050490 Bacteria 1558
676 nmdc:mga03n38_9017_c1 3300050490 Bacteria 3607
677 nmdc:mga00v17_15989_c1 3300050491 Bacteria 4223
678 nmdc:mga00v17_184532_c1 3300050491 Bacteria 1346
679 nmdc:mga00v17_300693_c1 3300050491 Bacteria 1042
680 nmdc:mga00v17_318641_c1 3300050491 Bacteria 1010
681 nmdc:mga00v17_365278_c1 3300050491 Bacteria 938
682 nmdc:mga00v17_3800_c1 3300050491 Bacteria 7789
683 nmdc:mga00v17_383905_c1 3300050491 Bacteria 913
684 nmdc:mga00v17_799436_c1 3300050491 Bacteria 601
685 nmdc:mga00v17_84857_c1 3300050491 Bacteria 1983
686 nmdc:mga00v17_857210_c1 3300050491 Bacteria 577
687 nmdc:mga0yw44_100082_c1 3300050492 Bacteria 1845
688 nmdc:mga0yw44_224746_c1 3300050492 Bacteria 1245
689 nmdc:mga0yw44_571134_c1 3300050492 Bacteria 768
690 nmdc:mga0yw44_73536_c2 3300050492 Bacteria 1692
691 nmdc:mga0yw44_77624_c1 3300050492 Bacteria 2075
692 nmdc:mga0yw44_777334_c1 3300050492 Bacteria 650
693 nmdc:mga0yw44_847394_c1 3300050492 Bacteria 620
694 nmdc:mga0yw44_883689_c1 3300050492 Bacteria 606
695 nmdc:mga06z11_30276_c1 3300050494 Bacteria 2618
696 nmdc:mga06z11_324424_c1 3300050494 Bacteria 919
697 nmdc:mga06z11_374274_c1 3300050494 Bacteria 855
698 nmdc:mga06z11_874971_c1 3300050494 Bacteria 547
699 nmdc:mga04h51_49218_c1 3300050495 Bacteria 1407
700 nmdc:mga04h51_88445_c1 3300050495 Bacteria 1111
701 nmdc:mga07m45_233913_c1 3300050496 Bacteria 1069
702 nmdc:mga07m45_24331_c1 3300050496 Bacteria 3316
703 nmdc:mga07m45_274345_c1 3300050496 Bacteria 981
704 nmdc:mga07m45_323692_c1 3300050496 Bacteria 896
705 nmdc:mga05p37_5263_c1 3300050507 Bacteria 15185
706 nmdc:mga09592_8133_c1 3300050508 Bacteria 8528
707 nmdc:mga0qj67_6961_c1 3300050509 Bacteria 8327
708 nmdc:mga06r32_6833_c1 3300050510 Bacteria 10257
709 nmdc:mga0n895_1051935_c1 3300050512 Bacteria 793
710 nmdc:mga0a205_567464_c1 3300050515 Bacteria 989
711 nmdc:mga0sz30_113875_c1 3300050516 Bacteria 1186
712 nmdc:mga0sz30_192740_c1 3300050516 Bacteria 905
713 nmdc:mga0sz30_49125_c1 3300050516 Bacteria 1787
714 nmdc:mga0sz30_509936_c1 3300050516 Bacteria 541
715 nmdc:mga0sz30_63539_c1 3300050516 Bacteria 1580
716 nmdc:mga0sz30_688_c1 3300050516 Bacteria 12503
717 Ga0495601_0264247 3300053077 Bacteria 1123
718 Ga0500635_0002835 3300053080 Bacteria 4308
719 Ga0495619_0205580 3300053085 Bacteria 1363
720 Ga0500578_0558782 3300053086 Bacteria 635
721 Ga0500643_001472 3300053087 Bacteria 13514
722 Ga0500643_002249 3300053087 Bacteria 10167
723 Ga0500641_0234943 3300053096 Bacteria 773
724 Ga0500556_0056120 3300053104 Bacteria 1438
725 Ga0500562_014800 3300053108 Bacteria 1999
726 Ga0500569_239856 3300053109 Bacteria 615
727 Ga0500572_157678 3300053111 Bacteria 742
728 Ga0500652_002611 3300053131 Bacteria 5448
729 Ga0500559_0037018 3300053136 Bacteria 2114
730 Ga0500568_0093889 3300053139 Bacteria 1130
731 Ga0500588_0286849 3300053146 Bacteria 622
732 Ga0500604_0108397 3300053151 Bacteria 921
733 Ga0500616_0003418 3300053153 Bacteria 12160
734 Ga0500633_0053075 3300053160 Bacteria 1405
735 Ga0466962_0023406 3300061719 Bacteria 2969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100534923 Ga0070665_1005349232 118
2 3300028379 Ga0268266_11291575 Ga0268266_112915751 118
3 3300041452 Ga0451793_0382928 Ga0451793_0382928_256_678 118
4 3300005456 Ga0070678_100545073 Ga0070678_1005450732 122
5 3300026121 Ga0207683_10458495 Ga0207683_104584952 122
6 iso_pu_bacteria 2738541274 2738703972 124
7 iso_pu_bacteria 2738543028 2739330845 124
8 iso_pu_bacteria 2643221687 2644488797 125
9 iso_pu_bacteria 2902837492 2902838672 125
10 iso_pu_bacteria 2939582691 2939588329 125
11 iso_pu_bacteria 2643221715 2644635231 126
12 iso_pu_bacteria 2842134933 2842137541 126
13 iso_pu_bacteria 2862507626 2862513710 126
14 iso_pu_bacteria 2902792274 2902794799 126
15 iso_pu_bacteria 2902810491 2902812890 126
16 iso_pu_bacteria 8025530807 8025538195 126
17 3300006186 Ga0075369_10010261 Ga0075369_100102614 128
18 3300006186 Ga0075369_10535737 Ga0075369_105357371 128
19 3300006844 Ga0075428_100010132 Ga0075428_1000101326 128
20 3300006846 Ga0075430_100002450 Ga0075430_10000245017 128
21 3300006847 Ga0075431_100002383 Ga0075431_10000238315 128
22 3300006880 Ga0075429_100003191 Ga0075429_10000319112 128
23 3300009147 Ga0114129_10004429 Ga0114129_100044294 128
24 3300025303 Ga0209051_1023237 Ga0209051_10232372 128
25 3300041507 Ga0451851_0386491 Ga0451851_0386491_1215_1601 128
26 3300046460 Ga0495638_0334245 Ga0495638_0334245_257_643 128
27 3300047320 Ga0495672_0079706 Ga0495672_0079706_1414_1800 128
28 3300048904 Ga0496101_0536336 Ga0496101_0536336_206_592 128
29 3300048924 Ga0496121_0467679 Ga0496121_0467679_233_619 128
30 3300048924 Ga0496121_0486587 Ga0496121_0486587_300_686 128
31 3300048929 Ga0496126_0047629 Ga0496126_0047629_2819_3205 128
32 3300050492 nmdc:mga0yw44_847394_c1 nmdc:mga0yw44_847394_c1_193_579 128
33 3300050507 nmdc:mga05p37_5263_c1 nmdc:mga05p37_5263_c1_1727_2119 128
34 3300050508 nmdc:mga09592_8133_c1 nmdc:mga09592_8133_c1_1828_2220 128
35 3300050509 nmdc:mga0qj67_6961_c1 nmdc:mga0qj67_6961_c1_3785_4177 128
36 3300050510 nmdc:mga06r32_6833_c1 nmdc:mga06r32_6833_c1_1783_2175 128
37 3300050516 nmdc:mga0sz30_509936_c1 nmdc:mga0sz30_509936_c1_117_503 128
38 3300053086 Ga0500578_0558782 Ga0500578_0558782_32_418 128
39 3300053087 Ga0500643_002249 Ga0500643_002249_3641_4027 128
40 3300053096 Ga0500641_0234943 Ga0500641_0234943_157_543 128
41 3300053111 Ga0500572_157678 Ga0500572_157678_52_438 128
42 3300053136 Ga0500559_0037018 Ga0500559_0037018_1028_1414 128
43 3300053146 Ga0500588_0286849 Ga0500588_0286849_71_457 128
44 3300003792 Ga0055540_1001555 Ga0055540_10015553 129
45 3300003792 Ga0055540_1001762 Ga0055540_10017628 129
46 3300003792 Ga0055540_1005999 Ga0055540_10059992 129
47 3300005347 Ga0070668_100780838 Ga0070668_1007808382 129
48 3300005355 Ga0070671_100357800 Ga0070671_1003578002 129
49 3300005356 Ga0070674_100117581 Ga0070674_1001175812 129
50 3300005365 Ga0070688_100774567 Ga0070688_1007745672 129
51 3300005439 Ga0070711_101636906 Ga0070711_1016369061 129
52 3300005466 Ga0070685_11283852 Ga0070685_112838521 129
53 3300005548 Ga0070665_100578672 Ga0070665_1005786722 129
54 3300005578 Ga0068854_100582206 Ga0068854_1005822062 129
55 3300005841 Ga0068863_100083739 Ga0068863_1000837394 129
56 3300006038 Ga0075365_10123630 Ga0075365_101236302 129
57 3300006038 Ga0075365_10169666 Ga0075365_101696662 129
58 3300006038 Ga0075365_10358456 Ga0075365_103584562 129
59 3300006051 Ga0075364_10190757 Ga0075364_101907572 129
60 3300006051 Ga0075364_10338707 Ga0075364_103387071 129
61 3300006051 Ga0075364_10464259 Ga0075364_104642592 129
62 3300006051 Ga0075364_10725905 Ga0075364_107259052 129
63 3300006177 Ga0075362_10054166 Ga0075362_100541662 129
64 3300006353 Ga0075370_10143790 Ga0075370_101437902 129
65 3300006881 Ga0068865_100427524 Ga0068865_1004275242 129
66 3300009093 Ga0105240_11204588 Ga0105240_112045882 129
67 3300009101 Ga0105247_10069419 Ga0105247_100694193 129
68 3300009148 Ga0105243_12277337 Ga0105243_122773371 129
69 3300009177 Ga0105248_10894011 Ga0105248_108940111 129
70 3300014968 Ga0157379_10454283 Ga0157379_104542832 129
71 3300025273 Ga0209673_1041609 Ga0209673_10416092 129
72 3300025273 Ga0209673_1090871 Ga0209673_10908711 129
73 3300025303 Ga0209051_1000594 Ga0209051_10005948 129
74 3300025303 Ga0209051_1001327 Ga0209051_100132721 129
75 3300025303 Ga0209051_1002457 Ga0209051_100245712 129
76 3300025303 Ga0209051_1019705 Ga0209051_10197052 129
77 3300025900 Ga0207710_10140800 Ga0207710_101408002 129
78 3300025916 Ga0207663_11107342 Ga0207663_111073421 129
79 3300025931 Ga0207644_11441206 Ga0207644_114412061 129
80 3300025935 Ga0207709_11565935 Ga0207709_115659351 129
81 3300025937 Ga0207669_10234010 Ga0207669_102340102 129
82 3300025938 Ga0207704_10389140 Ga0207704_103891402 129
83 3300025941 Ga0207711_10623806 Ga0207711_106238062 129
84 3300025981 Ga0207640_10502487 Ga0207640_105024872 129
85 3300026067 Ga0207678_10095518 Ga0207678_100955182 129
86 3300026088 Ga0207641_10079493 Ga0207641_100794932 129
87 3300026121 Ga0207683_10202949 Ga0207683_102029492 129
88 3300031852 Ga0307410_11247926 Ga0307410_112479262 129
89 3300031911 Ga0307412_10814369 Ga0307412_108143691 129
90 3300032005 Ga0307411_11884777 Ga0307411_118847772 129
91 3300041456 Ga0451795_0332063 Ga0451795_0332063_95_484 129
92 3300041460 Ga0451802_1020011 Ga0451802_1020011_481_870 129
93 3300041462 Ga0451806_234695 Ga0451806_234695_112_501 129
94 3300041505 Ga0451849_1134475 Ga0451849_1134475_248_637 129
95 3300041512 Ga0451853_2082484 Ga0451853_2082484_303_692 129
96 3300046459 Ga0495629_0004769 Ga0495629_0004769_590_985 129
97 3300046473 Ga0495582_0454156 Ga0495582_0454156_211_606 129
98 3300046533 Ga0495640_0462616 Ga0495640_0462616_212_607 129
99 3300046689 Ga0495613_0004713 Ga0495613_0004713_3940_4335 129
100 3300047320 Ga0495672_0228303 Ga0495672_0228303_218_607 129
101 3300047321 Ga0495676_0001154 Ga0495676_0001154_13538_13933 129
102 3300047472 Ga0495686_0006659 Ga0495686_0006659_2364_2753 129
103 3300047472 Ga0495686_0339170 Ga0495686_0339170_293_682 129
104 3300047673 Ga0495593_0006679 Ga0495593_0006679_4834_5229 129
105 3300048089 Ga0495614_0000610 Ga0495614_0000610_7608_8003 129
106 3300048903 Ga0496100_0004047 Ga0496100_0004047_3136_3525 129
107 3300048904 Ga0496101_0000299 Ga0496101_0000299_2112_2501 129
108 3300048905 Ga0496102_0444591 Ga0496102_0444591_457_846 129
109 3300048907 Ga0496104_0002493 Ga0496104_0002493_1983_2372 129
110 3300048908 Ga0496105_0032385 Ga0496105_0032385_3580_3969 129
111 3300048909 Ga0496106_0014630 Ga0496106_0014630_4248_4637 129
112 3300048910 Ga0496107_0003918 Ga0496107_0003918_4017_4406 129
113 3300048911 Ga0496108_0981024 Ga0496108_0981024_261_650 129
114 3300048917 Ga0496114_0002207 Ga0496114_0002207_11352_11741 129
115 3300048918 Ga0496115_0022166 Ga0496115_0022166_859_1248 129
116 3300048926 Ga0496123_0430720 Ga0496123_0430720_10_399 129
117 3300048929 Ga0496126_0979878 Ga0496126_0979878_146_535 129
118 3300050489 nmdc:mga03683_74400_c1 nmdc:mga03683_74400_c1_363_752 129
119 3300050491 nmdc:mga00v17_184532_c1 nmdc:mga00v17_184532_c1_136_525 129
120 3300050491 nmdc:mga00v17_300693_c1 nmdc:mga00v17_300693_c1_571_960 129
121 3300050491 nmdc:mga00v17_318641_c1 nmdc:mga00v17_318641_c1_334_723 129
122 3300050491 nmdc:mga00v17_365278_c1 nmdc:mga00v17_365278_c1_211_600 129
123 3300050491 nmdc:mga00v17_799436_c1 nmdc:mga00v17_799436_c1_55_447 129
124 3300050492 nmdc:mga0yw44_100082_c1 nmdc:mga0yw44_100082_c1_137_529 129
125 3300050492 nmdc:mga0yw44_224746_c1 nmdc:mga0yw44_224746_c1_231_620 129
126 3300050492 nmdc:mga0yw44_73536_c2 nmdc:mga0yw44_73536_c2_256_645 129
127 3300050496 nmdc:mga07m45_233913_c1 nmdc:mga07m45_233913_c1_44_433 129
128 3300050516 nmdc:mga0sz30_49125_c1 nmdc:mga0sz30_49125_c1_1326_1715 129
129 3300053153 Ga0500616_0003418 Ga0500616_0003418_7890_8279 129
130 3300001977 JGI24746J21847_1004700 JGI24746J21847_10047002 130
131 3300001978 JGI24747J21853_1004637 JGI24747J21853_10046372 130
132 3300001989 JGI24739J22299_10076627 JGI24739J22299_100766271 130
133 3300001991 JGI24743J22301_10036081 JGI24743J22301_100360812 130
134 3300002070 JGI24750J21931_1003756 JGI24750J21931_10037562 130
135 3300002074 JGI24748J21848_1028046 JGI24748J21848_10280462 130
136 3300002075 JGI24738J21930_10017264 JGI24738J21930_100172642 130
137 3300002076 JGI24749J21850_1033947 JGI24749J21850_10339472 130
138 3300002244 JGI24742J22300_10003250 JGI24742J22300_100032502 130
139 3300005328 Ga0070676_10141824 Ga0070676_101418241 130
140 3300005330 Ga0070690_100015282 Ga0070690_1000152824 130
141 3300005337 Ga0070682_100045623 Ga0070682_1000456233 130
142 3300005337 Ga0070682_100050564 Ga0070682_1000505642 130
143 3300005338 Ga0068868_100044111 Ga0068868_1000441112 130
144 3300005338 Ga0068868_101295860 Ga0068868_1012958601 130
145 3300005338 Ga0068868_101760914 Ga0068868_1017609141 130
146 3300005339 Ga0070660_100441054 Ga0070660_1004410541 130
147 3300005340 Ga0070689_100081268 Ga0070689_1000812681 130
148 3300005340 Ga0070689_100676428 Ga0070689_1006764282 130
149 3300005341 Ga0070691_10020122 Ga0070691_100201222 130
150 3300005343 Ga0070687_100165078 Ga0070687_1001650782 130
151 3300005344 Ga0070661_101290350 Ga0070661_1012903501 130
152 3300005345 Ga0070692_10071891 Ga0070692_100718912 130
153 3300005345 Ga0070692_10344252 Ga0070692_103442522 130
154 3300005347 Ga0070668_100018346 Ga0070668_1000183465 130
155 3300005347 Ga0070668_100552354 Ga0070668_1005523542 130
156 3300005347 Ga0070668_101222450 Ga0070668_1012224501 130
157 3300005347 Ga0070668_101240391 Ga0070668_1012403911 130
158 3300005353 Ga0070669_100024054 Ga0070669_1000240545 130
159 3300005353 Ga0070669_100902614 Ga0070669_1009026141 130
160 3300005354 Ga0070675_101291193 Ga0070675_1012911931 130
161 3300005355 Ga0070671_100131523 Ga0070671_1001315232 130
162 3300005356 Ga0070674_100004138 Ga0070674_10000413810 130
163 3300005356 Ga0070674_100425436 Ga0070674_1004254362 130
164 3300005356 Ga0070674_100537779 Ga0070674_1005377792 130
165 3300005364 Ga0070673_100142429 Ga0070673_1001424292 130
166 3300005365 Ga0070688_100040946 Ga0070688_1000409462 130
167 3300005366 Ga0070659_100320572 Ga0070659_1003205722 130
168 3300005366 Ga0070659_100325950 Ga0070659_1003259501 130
169 3300005366 Ga0070659_100677449 Ga0070659_1006774491 130
170 3300005366 Ga0070659_100748433 Ga0070659_1007484332 130
171 3300005367 Ga0070667_100000033 Ga0070667_10000003320 130
172 3300005367 Ga0070667_100286459 Ga0070667_1002864592 130
173 3300005367 Ga0070667_100303528 Ga0070667_1003035282 130
174 3300005367 Ga0070667_100429825 Ga0070667_1004298251 130
175 3300005367 Ga0070667_100698118 Ga0070667_1006981181 130
176 3300005367 Ga0070667_100953261 Ga0070667_1009532611 130
177 3300005406 Ga0070703_10152677 Ga0070703_101526771 130
178 3300005434 Ga0070709_10367815 Ga0070709_103678152 130
179 3300005434 Ga0070709_10374096 Ga0070709_103740961 130
180 3300005434 Ga0070709_11527633 Ga0070709_115276331 130
181 3300005435 Ga0070714_101058418 Ga0070714_1010584182 130
182 3300005435 Ga0070714_101631999 Ga0070714_1016319991 130
183 3300005436 Ga0070713_100525764 Ga0070713_1005257642 130
184 3300005436 Ga0070713_100617057 Ga0070713_1006170572 130
185 3300005437 Ga0070710_10033816 Ga0070710_100338162 130
186 3300005437 Ga0070710_10492806 Ga0070710_104928062 130
187 3300005438 Ga0070701_10056707 Ga0070701_100567072 130
188 3300005439 Ga0070711_100090815 Ga0070711_1000908153 130
189 3300005439 Ga0070711_100144645 Ga0070711_1001446452 130
190 3300005439 Ga0070711_100447176 Ga0070711_1004471761 130
191 3300005440 Ga0070705_100422947 Ga0070705_1004229472 130
192 3300005440 Ga0070705_100483190 Ga0070705_1004831902 130
193 3300005440 Ga0070705_100491612 Ga0070705_1004916122 130
194 3300005441 Ga0070700_100063497 Ga0070700_1000634972 130
195 3300005441 Ga0070700_100067467 Ga0070700_1000674672 130
196 3300005444 Ga0070694_100307995 Ga0070694_1003079952 130
197 3300005444 Ga0070694_100669458 Ga0070694_1006694582 130
198 3300005455 Ga0070663_100060596 Ga0070663_1000605962 130
199 3300005456 Ga0070678_100024639 Ga0070678_1000246396 130
200 3300005456 Ga0070678_100094887 Ga0070678_1000948872 130
201 3300005456 Ga0070678_100354492 Ga0070678_1003544922 130
202 3300005456 Ga0070678_101454227 Ga0070678_1014542271 130
203 3300005457 Ga0070662_100050929 Ga0070662_1000509292 130
204 3300005457 Ga0070662_100483152 Ga0070662_1004831522 130
205 3300005459 Ga0068867_100038013 Ga0068867_1000380132 130
206 3300005459 Ga0068867_100758334 Ga0068867_1007583342 130
207 3300005466 Ga0070685_10074114 Ga0070685_100741142 130
208 3300005539 Ga0068853_100101330 Ga0068853_1001013302 130
209 3300005543 Ga0070672_100185834 Ga0070672_1001858342 130
210 3300005543 Ga0070672_100295908 Ga0070672_1002959082 130
211 3300005544 Ga0070686_100335988 Ga0070686_1003359882 130
212 3300005544 Ga0070686_100605690 Ga0070686_1006056902 130
213 3300005544 Ga0070686_100980936 Ga0070686_1009809361 130
214 3300005545 Ga0070695_100338423 Ga0070695_1003384232 130
215 3300005545 Ga0070695_100501856 Ga0070695_1005018562 130
216 3300005546 Ga0070696_100014832 Ga0070696_1000148326 130
217 3300005546 Ga0070696_100811813 Ga0070696_1008118132 130
218 3300005547 Ga0070693_100063599 Ga0070693_1000635992 130
219 3300005547 Ga0070693_100195834 Ga0070693_1001958342 130
220 3300005548 Ga0070665_100003442 Ga0070665_10000344213 130
221 3300005548 Ga0070665_100012426 Ga0070665_1000124265 130
222 3300005548 Ga0070665_100225233 Ga0070665_1002252332 130
223 3300005548 Ga0070665_101793508 Ga0070665_1017935082 130
224 3300005548 Ga0070665_101871361 Ga0070665_1018713611 130
225 3300005549 Ga0070704_100167139 Ga0070704_1001671392 130
226 3300005549 Ga0070704_100581033 Ga0070704_1005810332 130
227 3300005563 Ga0068855_100566982 Ga0068855_1005669822 130
228 3300005563 Ga0068855_100694287 Ga0068855_1006942872 130
229 3300005578 Ga0068854_100009094 Ga0068854_1000090942 130
230 3300005578 Ga0068854_101942456 Ga0068854_1019424562 130
231 3300005614 Ga0068856_100549468 Ga0068856_1005494681 130
232 3300005614 Ga0068856_100711503 Ga0068856_1007115032 130
233 3300005615 Ga0070702_100018741 Ga0070702_1000187411 130
234 3300005615 Ga0070702_100060631 Ga0070702_1000606312 130
235 3300005615 Ga0070702_100467820 Ga0070702_1004678202 130
236 3300005615 Ga0070702_100544281 Ga0070702_1005442811 130
237 3300005615 Ga0070702_100998899 Ga0070702_1009988991 130
238 3300005616 Ga0068852_100737360 Ga0068852_1007373602 130
239 3300005616 Ga0068852_100976185 Ga0068852_1009761852 130
240 3300005617 Ga0068859_100001651 Ga0068859_1000016519 130
241 3300005617 Ga0068859_100120223 Ga0068859_1001202233 130
242 3300005618 Ga0068864_100206429 Ga0068864_1002064291 130
243 3300005618 Ga0068864_100593589 Ga0068864_1005935892 130
244 3300005618 Ga0068864_101224531 Ga0068864_1012245312 130
245 3300005718 Ga0068866_10011313 Ga0068866_100113132 130
246 3300005718 Ga0068866_10269219 Ga0068866_102692192 130
247 3300005719 Ga0068861_100084809 Ga0068861_1000848093 130
248 3300005719 Ga0068861_100724008 Ga0068861_1007240082 130
249 3300005841 Ga0068863_100000193 Ga0068863_10000019330 130
250 3300005841 Ga0068863_100003240 Ga0068863_10000324016 130
251 3300005841 Ga0068863_100089147 Ga0068863_1000891474 130
252 3300005841 Ga0068863_100189191 Ga0068863_1001891913 130
253 3300005842 Ga0068858_100105154 Ga0068858_1001051544 130
254 3300005842 Ga0068858_100110610 Ga0068858_1001106102 130
255 3300005842 Ga0068858_100441945 Ga0068858_1004419452 130
256 3300005842 Ga0068858_100541723 Ga0068858_1005417232 130
257 3300005843 Ga0068860_100000010 Ga0068860_10000001021 130
258 3300005843 Ga0068860_100057620 Ga0068860_1000576204 130
259 3300005843 Ga0068860_100183892 Ga0068860_1001838922 130
260 3300005843 Ga0068860_101472776 Ga0068860_1014727762 130
261 3300005844 Ga0068862_100000205 Ga0068862_10000020552 130
262 3300005844 Ga0068862_100220630 Ga0068862_1002206302 130
263 3300005844 Ga0068862_101086914 Ga0068862_1010869142 130
264 3300005844 Ga0068862_102288505 Ga0068862_1022885052 130
265 3300005937 Ga0081455_10250827 Ga0081455_102508272 130
266 3300005937 Ga0081455_10279618 Ga0081455_102796182 130
267 3300005981 Ga0081538_10057611 Ga0081538_100576112 130
268 3300006038 Ga0075365_10063360 Ga0075365_100633603 130
269 3300006038 Ga0075365_10634095 Ga0075365_106340951 130
270 3300006038 Ga0075365_10705190 Ga0075365_107051901 130
271 3300006042 Ga0075368_10187911 Ga0075368_101879112 130
272 3300006048 Ga0075363_100001201 Ga0075363_1000012018 130
273 3300006048 Ga0075363_100001555 Ga0075363_1000015559 130
274 3300006048 Ga0075363_100026491 Ga0075363_1000264913 130
275 3300006048 Ga0075363_100033718 Ga0075363_1000337184 130
276 3300006048 Ga0075363_100067306 Ga0075363_1000673062 130
277 3300006048 Ga0075363_100080002 Ga0075363_1000800022 130
278 3300006051 Ga0075364_10002712 Ga0075364_100027123 130
279 3300006051 Ga0075364_10004244 Ga0075364_100042445 130
280 3300006051 Ga0075364_10210105 Ga0075364_102101052 130
281 3300006051 Ga0075364_10268302 Ga0075364_102683022 130
282 3300006051 Ga0075364_11045142 Ga0075364_110451421 130
283 3300006163 Ga0070715_10627003 Ga0070715_106270032 130
284 3300006173 Ga0070716_100579852 Ga0070716_1005798522 130
285 3300006173 Ga0070716_101277733 Ga0070716_1012777332 130
286 3300006175 Ga0070712_100009919 Ga0070712_1000099193 130
287 3300006175 Ga0070712_100023386 Ga0070712_1000233862 130
288 3300006177 Ga0075362_10022933 Ga0075362_100229332 130
289 3300006177 Ga0075362_10112778 Ga0075362_101127782 130
290 3300006177 Ga0075362_10155013 Ga0075362_101550132 130
291 3300006178 Ga0075367_10021805 Ga0075367_100218053 130
292 3300006178 Ga0075367_10440053 Ga0075367_104400532 130
293 3300006186 Ga0075369_10000601 Ga0075369_100006016 130
294 3300006186 Ga0075369_10003984 Ga0075369_100039842 130
295 3300006186 Ga0075369_10181622 Ga0075369_101816222 130
296 3300006186 Ga0075369_10290178 Ga0075369_102901782 130
297 3300006237 Ga0097621_100011755 Ga0097621_1000117552 130
298 3300006237 Ga0097621_100406308 Ga0097621_1004063082 130
299 3300006353 Ga0075370_10004679 Ga0075370_100046791 130
300 3300006353 Ga0075370_10062011 Ga0075370_100620112 130
301 3300006353 Ga0075370_10146843 Ga0075370_101468432 130
302 3300006358 Ga0068871_100122197 Ga0068871_1001221972 130
303 3300006358 Ga0068871_100612742 Ga0068871_1006127422 130
304 3300006852 Ga0075433_10582228 Ga0075433_105822282 130
305 3300006871 Ga0075434_100916699 Ga0075434_1009166992 130
306 3300006871 Ga0075434_101207075 Ga0075434_1012070752 130
307 3300006881 Ga0068865_100050587 Ga0068865_1000505874 130
308 3300006881 Ga0068865_100063078 Ga0068865_1000630782 130
309 3300006931 Ga0097620_100001651 Ga0097620_10000165112 130
310 3300006931 Ga0097620_100120225 Ga0097620_1001202252 130
311 3300006931 Ga0097620_103074566 Ga0097620_1030745661 130
312 3300009011 Ga0105251_10119064 Ga0105251_101190642 130
313 3300009092 Ga0105250_10460122 Ga0105250_104601222 130
314 3300009098 Ga0105245_10051087 Ga0105245_100510872 130
315 3300009098 Ga0105245_10761590 Ga0105245_107615902 130
316 3300009101 Ga0105247_10000082 Ga0105247_1000008246 130
317 3300009101 Ga0105247_10138777 Ga0105247_101387772 130
318 3300009101 Ga0105247_10171891 Ga0105247_101718912 130
319 3300009101 Ga0105247_10188098 Ga0105247_101880982 130
320 3300009101 Ga0105247_10383025 Ga0105247_103830252 130
321 3300009148 Ga0105243_10124009 Ga0105243_101240092 130
322 3300009148 Ga0105243_10193596 Ga0105243_101935962 130
323 3300009148 Ga0105243_10491911 Ga0105243_104919112 130
324 3300009148 Ga0105243_10836171 Ga0105243_108361712 130
325 3300009174 Ga0105241_10187101 Ga0105241_101871012 130
326 3300009174 Ga0105241_10592499 Ga0105241_105924993 130
327 3300009174 Ga0105241_10889712 Ga0105241_108897122 130
328 3300009176 Ga0105242_10212148 Ga0105242_102121482 130
329 3300009176 Ga0105242_10636241 Ga0105242_106362413 130
330 3300009177 Ga0105248_10000084 Ga0105248_1000008489 130
331 3300009177 Ga0105248_10045541 Ga0105248_100455413 130
332 3300009177 Ga0105248_10079301 Ga0105248_100793013 130
333 3300009177 Ga0105248_10384927 Ga0105248_103849272 130
334 3300009177 Ga0105248_10425874 Ga0105248_104258742 130
335 3300009177 Ga0105248_10648813 Ga0105248_106488132 130
336 3300009545 Ga0105237_10001322 Ga0105237_100013228 130
337 3300009545 Ga0105237_10323336 Ga0105237_103233362 130
338 3300009545 Ga0105237_10579900 Ga0105237_105799002 130
339 3300009551 Ga0105238_10071422 Ga0105238_100714222 130
340 3300009551 Ga0105238_10411270 Ga0105238_104112702 130
341 3300009551 Ga0105238_10627594 Ga0105238_106275942 130
342 3300009551 Ga0105238_12447126 Ga0105238_124471262 130
343 3300009553 Ga0105249_10000285 Ga0105249_1000028521 130
344 3300009553 Ga0105249_10255109 Ga0105249_102551092 130
345 3300009553 Ga0105249_10604345 Ga0105249_106043452 130
346 3300009553 Ga0105249_11287530 Ga0105249_112875302 130
347 3300009553 Ga0105249_11768580 Ga0105249_117685801 130
348 3300009553 Ga0105249_11826317 Ga0105249_118263172 130
349 3300010375 Ga0105239_10011658 Ga0105239_100116583 130
350 3300010375 Ga0105239_10024619 Ga0105239_100246194 130
351 3300010375 Ga0105239_10752324 Ga0105239_107523242 130
352 3300010375 Ga0105239_11865801 Ga0105239_118658012 130
353 3300010375 Ga0105239_12052310 Ga0105239_120523101 130
354 3300011119 Ga0105246_10164337 Ga0105246_101643372 130
355 3300011119 Ga0105246_10184996 Ga0105246_101849962 130
356 3300011119 Ga0105246_10531246 Ga0105246_105312462 130
357 3300013102 Ga0157371_10367199 Ga0157371_103671991 130
358 3300013102 Ga0157371_10859013 Ga0157371_108590132 130
359 3300013105 Ga0157369_11766139 Ga0157369_117661392 130
360 3300013296 Ga0157374_10511398 Ga0157374_105113981 130
361 3300013296 Ga0157374_12693069 Ga0157374_126930692 130
362 3300013297 Ga0157378_10178812 Ga0157378_101788122 130
363 3300013297 Ga0157378_10264821 Ga0157378_102648213 130
364 3300013297 Ga0157378_10449534 Ga0157378_104495342 130
365 3300013306 Ga0163162_10028509 Ga0163162_100285096 130
366 3300013306 Ga0163162_10681207 Ga0163162_106812072 130
367 3300013306 Ga0163162_12092277 Ga0163162_120922771 130
368 3300013307 Ga0157372_10392164 Ga0157372_103921642 130
369 3300013307 Ga0157372_10444451 Ga0157372_104444512 130
370 3300013307 Ga0157372_10871701 Ga0157372_108717012 130
371 3300013308 Ga0157375_10896535 Ga0157375_108965352 130
372 3300013308 Ga0157375_11086150 Ga0157375_110861502 130
373 3300013308 Ga0157375_11675328 Ga0157375_116753282 130
374 3300014325 Ga0163163_10206354 Ga0163163_102063542 130
375 3300014325 Ga0163163_10294424 Ga0163163_102944242 130
376 3300014325 Ga0163163_10748389 Ga0163163_107483892 130
377 3300014326 Ga0157380_10061839 Ga0157380_100618392 130
378 3300014326 Ga0157380_10417625 Ga0157380_104176253 130
379 3300014745 Ga0157377_10923607 Ga0157377_109236072 130
380 3300014968 Ga0157379_10052581 Ga0157379_100525812 130
381 3300014968 Ga0157379_10360750 Ga0157379_103607503 130
382 3300014968 Ga0157379_10910640 Ga0157379_109106401 130
383 3300014969 Ga0157376_10200898 Ga0157376_102008982 130
384 3300014969 Ga0157376_10479904 Ga0157376_104799041 130
385 3300014969 Ga0157376_10713778 Ga0157376_107137782 130
386 3300014969 Ga0157376_11641378 Ga0157376_116413781 130
387 3300017792 Ga0163161_10096797 Ga0163161_100967972 130
388 3300017792 Ga0163161_10426864 Ga0163161_104268642 130
389 3300017792 Ga0163161_10616422 Ga0163161_106164223 130
390 3300017792 Ga0163161_10853020 Ga0163161_108530202 130
391 3300025885 Ga0207653_10034056 Ga0207653_100340562 130
392 3300025898 Ga0207692_10099142 Ga0207692_100991422 130
393 3300025898 Ga0207692_10317478 Ga0207692_103174782 130
394 3300025899 Ga0207642_10068498 Ga0207642_100684982 130
395 3300025899 Ga0207642_10344377 Ga0207642_103443772 130
396 3300025900 Ga0207710_10000263 Ga0207710_1000026342 130
397 3300025900 Ga0207710_10079942 Ga0207710_100799422 130
398 3300025900 Ga0207710_10196341 Ga0207710_101963412 130
399 3300025900 Ga0207710_10340513 Ga0207710_103405132 130
400 3300025901 Ga0207688_10019300 Ga0207688_100193002 130
401 3300025901 Ga0207688_10506750 Ga0207688_105067502 130
402 3300025903 Ga0207680_10035392 Ga0207680_100353923 130
403 3300025903 Ga0207680_11099990 Ga0207680_110999901 130
404 3300025904 Ga0207647_10034828 Ga0207647_100348284 130
405 3300025905 Ga0207685_10143931 Ga0207685_101439312 130
406 3300025905 Ga0207685_10184472 Ga0207685_101844722 130
407 3300025906 Ga0207699_10069074 Ga0207699_100690742 130
408 3300025906 Ga0207699_10427800 Ga0207699_104278001 130
409 3300025906 Ga0207699_10679700 Ga0207699_106797002 130
410 3300025907 Ga0207645_10010653 Ga0207645_100106535 130
411 3300025908 Ga0207643_10260856 Ga0207643_102608562 130
412 3300025909 Ga0207705_10163937 Ga0207705_101639372 130
413 3300025911 Ga0207654_10160709 Ga0207654_101607092 130
414 3300025914 Ga0207671_10020933 Ga0207671_100209335 130
415 3300025914 Ga0207671_10672702 Ga0207671_106727022 130
416 3300025915 Ga0207693_10015796 Ga0207693_100157967 130
417 3300025915 Ga0207693_10129064 Ga0207693_101290642 130
418 3300025916 Ga0207663_10050302 Ga0207663_100503022 130
419 3300025916 Ga0207663_10286176 Ga0207663_102861762 130
420 3300025918 Ga0207662_10091817 Ga0207662_100918172 130
421 3300025920 Ga0207649_11133589 Ga0207649_111335892 130
422 3300025923 Ga0207681_10004263 Ga0207681_100042635 130
423 3300025923 Ga0207681_10862482 Ga0207681_108624822 130
424 3300025924 Ga0207694_10400410 Ga0207694_104004102 130
425 3300025924 Ga0207694_10461393 Ga0207694_104613931 130
426 3300025924 Ga0207694_10621533 Ga0207694_106215332 130
427 3300025925 Ga0207650_11008347 Ga0207650_110083472 130
428 3300025927 Ga0207687_10080878 Ga0207687_100808782 130
429 3300025927 Ga0207687_10789280 Ga0207687_107892802 130
430 3300025927 Ga0207687_10815187 Ga0207687_108151872 130
431 3300025928 Ga0207700_10364492 Ga0207700_103644922 130
432 3300025928 Ga0207700_10532690 Ga0207700_105326902 130
433 3300025931 Ga0207644_10023915 Ga0207644_100239154 130
434 3300025931 Ga0207644_10224507 Ga0207644_102245072 130
435 3300025932 Ga0207690_10282556 Ga0207690_102825561 130
436 3300025932 Ga0207690_10525368 Ga0207690_105253682 130
437 3300025933 Ga0207706_10011311 Ga0207706_100113114 130
438 3300025933 Ga0207706_10471147 Ga0207706_104711472 130
439 3300025933 Ga0207706_11264658 Ga0207706_112646582 130
440 3300025934 Ga0207686_10062265 Ga0207686_100622652 130
441 3300025935 Ga0207709_10100118 Ga0207709_101001182 130
442 3300025935 Ga0207709_10121588 Ga0207709_101215882 130
443 3300025935 Ga0207709_10800589 Ga0207709_108005892 130
444 3300025936 Ga0207670_10257882 Ga0207670_102578822 130
445 3300025936 Ga0207670_10531148 Ga0207670_105311482 130
446 3300025937 Ga0207669_10069211 Ga0207669_100692113 130
447 3300025937 Ga0207669_10088478 Ga0207669_100884782 130
448 3300025938 Ga0207704_10050726 Ga0207704_100507262 130
449 3300025938 Ga0207704_10080189 Ga0207704_100801892 130
450 3300025938 Ga0207704_10093216 Ga0207704_100932162 130
451 3300025939 Ga0207665_10013432 Ga0207665_100134325 130
452 3300025939 Ga0207665_10021303 Ga0207665_100213034 130
453 3300025939 Ga0207665_10458465 Ga0207665_104584652 130
454 3300025939 Ga0207665_10607145 Ga0207665_106071452 130
455 3300025940 Ga0207691_10121641 Ga0207691_101216412 130
456 3300025940 Ga0207691_10145610 Ga0207691_101456103 130
457 3300025941 Ga0207711_10002374 Ga0207711_100023744 130
458 3300025941 Ga0207711_10133249 Ga0207711_101332492 130
459 3300025941 Ga0207711_10327481 Ga0207711_103274812 130
460 3300025941 Ga0207711_10874221 Ga0207711_108742212 130
461 3300025942 Ga0207689_10018584 Ga0207689_100185843 130
462 3300025949 Ga0207667_10138782 Ga0207667_101387822 130
463 3300025949 Ga0207667_10259210 Ga0207667_102592101 130
464 3300025960 Ga0207651_10763336 Ga0207651_107633362 130
465 3300025961 Ga0207712_10000011 Ga0207712_10000011338 130
466 3300025961 Ga0207712_10177806 Ga0207712_101778062 130
467 3300025961 Ga0207712_10695480 Ga0207712_106954802 130
468 3300025972 Ga0207668_10000743 Ga0207668_100007435 130
469 3300025972 Ga0207668_10121415 Ga0207668_101214152 130
470 3300025972 Ga0207668_10130203 Ga0207668_101302033 130
471 3300025972 Ga0207668_10172034 Ga0207668_101720342 130
472 3300025972 Ga0207668_10607086 Ga0207668_106070862 130
473 3300025981 Ga0207640_10258523 Ga0207640_102585232 130
474 3300025981 Ga0207640_10354149 Ga0207640_103541492 130
475 3300025981 Ga0207640_10528075 Ga0207640_105280752 130
476 3300025986 Ga0207658_10000220 Ga0207658_100002208 130
477 3300025986 Ga0207658_10020156 Ga0207658_100201563 130
478 3300025986 Ga0207658_10023013 Ga0207658_100230135 130
479 3300025986 Ga0207658_10029355 Ga0207658_100293551 130
480 3300025986 Ga0207658_10053838 Ga0207658_100538383 130
481 3300026023 Ga0207677_10488769 Ga0207677_104887692 130
482 3300026023 Ga0207677_10536583 Ga0207677_105365832 130
483 3300026023 Ga0207677_10988370 Ga0207677_109883702 130
484 3300026035 Ga0207703_10049187 Ga0207703_100491874 130
485 3300026035 Ga0207703_10261012 Ga0207703_102610122 130
486 3300026035 Ga0207703_10416162 Ga0207703_104161623 130
487 3300026035 Ga0207703_10423477 Ga0207703_104234772 130
488 3300026035 Ga0207703_10591277 Ga0207703_105912772 130
489 3300026041 Ga0207639_10092003 Ga0207639_100920032 130
490 3300026041 Ga0207639_10283850 Ga0207639_102838502 130
491 3300026067 Ga0207678_10033813 Ga0207678_100338132 130
492 3300026067 Ga0207678_10053695 Ga0207678_100536954 130
493 3300026075 Ga0207708_10600069 Ga0207708_106000692 130
494 3300026075 Ga0207708_11051813 Ga0207708_110518132 130
495 3300026078 Ga0207702_10977708 Ga0207702_109777082 130
496 3300026088 Ga0207641_10000437 Ga0207641_1000043740 130
497 3300026088 Ga0207641_10232408 Ga0207641_102324082 130
498 3300026088 Ga0207641_10453114 Ga0207641_104531143 130
499 3300026088 Ga0207641_10659261 Ga0207641_106592612 130
500 3300026089 Ga0207648_10023411 Ga0207648_100234116 130
501 3300026089 Ga0207648_10754176 Ga0207648_107541762 130
502 3300026095 Ga0207676_10289069 Ga0207676_102890693 130
503 3300026095 Ga0207676_10539344 Ga0207676_105393442 130
504 3300026095 Ga0207676_10670217 Ga0207676_106702171 130
505 3300026118 Ga0207675_100246115 Ga0207675_1002461152 130
506 3300026118 Ga0207675_100340011 Ga0207675_1003400112 130
507 3300026118 Ga0207675_100966983 Ga0207675_1009669831 130
508 3300026121 Ga0207683_10039013 Ga0207683_100390136 130
509 3300026121 Ga0207683_10154333 Ga0207683_101543332 130
510 3300026121 Ga0207683_10297146 Ga0207683_102971462 130
511 3300026121 Ga0207683_10728277 Ga0207683_107282772 130
512 3300026142 Ga0207698_10588684 Ga0207698_105886842 130
513 3300026142 Ga0207698_10614838 Ga0207698_106148382 130
514 3300026142 Ga0207698_11341409 Ga0207698_113414092 130
515 3300027866 Ga0209813_10041151 Ga0209813_100411512 130
516 3300027866 Ga0209813_10155261 Ga0209813_101552612 130
517 3300028379 Ga0268266_10001362 Ga0268266_1000136230 130
518 3300028379 Ga0268266_10012103 Ga0268266_100121036 130
519 3300028379 Ga0268266_10319251 Ga0268266_103192512 130
520 3300028379 Ga0268266_11060641 Ga0268266_110606412 130
521 3300028379 Ga0268266_11256195 Ga0268266_112561952 130
522 3300028379 Ga0268266_11464426 Ga0268266_114644262 130
523 3300028380 Ga0268265_10000007 Ga0268265_10000007298 130
524 3300028380 Ga0268265_10115130 Ga0268265_101151302 130
525 3300028380 Ga0268265_10625650 Ga0268265_106256502 130
526 3300028380 Ga0268265_10921125 Ga0268265_109211252 130
527 3300028380 Ga0268265_11040140 Ga0268265_110401402 130
528 3300028381 Ga0268264_10000007 Ga0268264_10000007429 130
529 3300028381 Ga0268264_10133110 Ga0268264_101331102 130
530 3300028381 Ga0268264_11112020 Ga0268264_111120201 130
531 3300031824 Ga0307413_11603130 Ga0307413_116031301 130
532 3300031852 Ga0307410_10034512 Ga0307410_100345123 130
533 3300031852 Ga0307410_11804209 Ga0307410_118042091 130
534 3300031903 Ga0307407_10024784 Ga0307407_100247843 130
535 3300031903 Ga0307407_10164583 Ga0307407_101645832 130
536 3300031911 Ga0307412_10061732 Ga0307412_100617323 130
537 3300031911 Ga0307412_11485122 Ga0307412_114851222 130
538 3300031995 Ga0307409_100243326 Ga0307409_1002433262 130
539 3300032004 Ga0307414_10204497 Ga0307414_102044972 130
540 3300032004 Ga0307414_10934793 Ga0307414_109347932 130
541 3300032005 Ga0307411_10322502 Ga0307411_103225022 130
542 3300032126 Ga0307415_100120642 Ga0307415_1001206422 130
543 3300032126 Ga0307415_100650165 Ga0307415_1006501651 130
544 3300034819 Ga0373958_0201070 Ga0373958_0201070_49_441 130
545 3300035092 Ga0373952_0086123 Ga0373952_0086123_72_464 130
546 3300035112 Ga0373932_0101457 Ga0373932_0101457_406_798 130
547 3300035241 Ga0373961_0124879 Ga0373961_0124879_149_541 130
548 3300035691 Ga0373931_0085985 Ga0373931_0085985_1087_1479 130
549 3300035691 Ga0373931_0234393 Ga0373931_0234393_294_686 130
550 3300041404 Ga0439436_0098676 Ga0439436_0098676_233_625 130
551 3300041410 Ga0439461_0050756 Ga0439461_0050756_390_782 130
552 3300041410 Ga0439461_0056440 Ga0439461_0056440_140_535 130
553 3300041411 Ga0439466_0006222 Ga0439466_0006222_212_604 130
554 3300041411 Ga0439466_0015440 Ga0439466_0015440_1589_1984 130
555 3300041413 Ga0439465_0008521 Ga0439465_0008521_143_538 130
556 3300041413 Ga0439465_0030042 Ga0439465_0030042_1319_1711 130
557 3300041413 Ga0439465_0309382 Ga0439465_0309382_46_438 130
558 3300041997 Ga0439431_0004898 Ga0439431_0004898_601_993 130
559 3300042002 Ga0439442_011258 Ga0439442_011258_862_1257 130
560 3300042004 Ga0439445_0004645 Ga0439445_0004645_55_447 130
561 3300042004 Ga0439445_0010971 Ga0439445_0010971_325_720 130
562 3300042008 Ga0439450_022713 Ga0439450_022713_880_1272 130
563 3300042435 Ga0439434_0021846 Ga0439434_0021846_1040_1435 130
564 3300044658 Ga0466972_0008913 Ga0466972_0008913_1977_2372 130
565 3300044658 Ga0466972_0015341 Ga0466972_0015341_248_640 130
566 3300044658 Ga0466972_0030250 Ga0466972_0030250_836_1231 130
567 3300044658 Ga0466972_0071967 Ga0466972_0071967_108_503 130
568 3300044658 Ga0466972_0099630 Ga0466972_0099630_531_926 130
569 3300044658 Ga0466972_0319248 Ga0466972_0319248_254_646 130
570 3300044683 Ga0466965_0002694 Ga0466965_0002694_5978_6370 130
571 3300044683 Ga0466965_0073984 Ga0466965_0073984_199_594 130
572 3300044693 Ga0466961_0049062 Ga0466961_0049062_641_1036 130
573 3300044706 Ga0466964_0696466 Ga0466964_0696466_21_416 130
574 3300044735 Ga0466968_0050691 Ga0466968_0050691_1346_1741 130
575 3300044765 Ga0466970_0054459 Ga0466970_0054459_414_806 130
576 3300044765 Ga0466970_0173730 Ga0466970_0173730_416_811 130
577 3300044765 Ga0466970_0701835 Ga0466970_0701835_112_504 130
578 3300044842 Ga0466957_0009124 Ga0466957_0009124_3523_3918 130
579 3300044842 Ga0466957_0565758 Ga0466957_0565758_223_615 130
580 3300044901 Ga0466960_0050259 Ga0466960_0050259_476_871 130
581 3300045049 Ga0466959_0046300 Ga0466959_0046300_160_555 130
582 3300045836 Ga0466958_0085205 Ga0466958_0085205_1473_1868 130
583 3300045976 Ga0466967_0263044 Ga0466967_0263044_1224_1619 130
584 3300045976 Ga0466967_0355692 Ga0466967_0355692_162_554 130
585 3300046459 Ga0495629_0234133 Ga0495629_0234133_182_574 130
586 3300046460 Ga0495638_0005530 Ga0495638_0005530_811_1203 130
587 3300046473 Ga0495582_0299622 Ga0495582_0299622_480_872 130
588 3300046476 Ga0495662_0072499 Ga0495662_0072499_448_840 130
589 3300046499 Ga0495594_0052719 Ga0495594_0052719_37_429 130
590 3300046506 Ga0495583_0126820 Ga0495583_0126820_197_589 130
591 3300046507 Ga0495606_0110052 Ga0495606_0110052_974_1366 130
592 3300046514 Ga0495618_0162594 Ga0495618_0162594_729_1121 130
593 3300046522 Ga0495643_0481491 Ga0495643_0481491_111_503 130
594 3300046524 Ga0495648_0011454 Ga0495648_0011454_5596_5988 130
595 3300046528 Ga0495642_0263579 Ga0495642_0263579_231_623 130
596 3300046533 Ga0495640_0037508 Ga0495640_0037508_581_973 130
597 3300046616 Ga0495668_0034340 Ga0495668_0034340_542_934 130
598 3300046683 Ga0495658_0191758 Ga0495658_0191758_867_1259 130
599 3300046690 Ga0495624_0655252 Ga0495624_0655252_91_483 130
600 3300046694 Ga0495649_0392751 Ga0495649_0392751_61_456 130
601 3300047315 Ga0495581_0215188 Ga0495581_0215188_76_468 130
602 3300047317 Ga0495604_0089758 Ga0495604_0089758_869_1261 130
603 3300047319 Ga0495674_0495613 Ga0495674_0495613_344_736 130
604 3300047320 Ga0495672_0069647 Ga0495672_0069647_1506_1898 130
605 3300047321 Ga0495676_0101381 Ga0495676_0101381_1431_1823 130
606 3300047469 Ga0495673_0002084 Ga0495673_0002084_6906_7298 130
607 3300048091 Ga0495626_0052874 Ga0495626_0052874_1369_1761 130
608 3300048903 Ga0496100_0008578 Ga0496100_0008578_4567_4968 130
609 3300048903 Ga0496100_0011790 Ga0496100_0011790_1887_2282 130
610 3300048903 Ga0496100_0033241 Ga0496100_0033241_1748_2140 130
611 3300048903 Ga0496100_0052355 Ga0496100_0052355_570_962 130
612 3300048903 Ga0496100_0130670 Ga0496100_0130670_677_1069 130
613 3300048903 Ga0496100_0364298 Ga0496100_0364298_75_467 130
614 3300048904 Ga0496101_0000926 Ga0496101_0000926_5718_6110 130
615 3300048904 Ga0496101_0001429 Ga0496101_0001429_8785_9186 130
616 3300048904 Ga0496101_0006786 Ga0496101_0006786_156_551 130
617 3300048904 Ga0496101_0136105 Ga0496101_0136105_26_418 130
618 3300048904 Ga0496101_0641075 Ga0496101_0641075_254_646 130
619 3300048904 Ga0496101_0963587 Ga0496101_0963587_73_468 130
620 3300048904 Ga0496101_1147797 Ga0496101_1147797_83_475 130
621 3300048905 Ga0496102_0000007 Ga0496102_0000007_405287_405679 130
622 3300048905 Ga0496102_0000249 Ga0496102_0000249_47882_48277 130
623 3300048905 Ga0496102_0066057 Ga0496102_0066057_2397_2789 130
624 3300048905 Ga0496102_0076689 Ga0496102_0076689_561_953 130
625 3300048905 Ga0496102_0150467 Ga0496102_0150467_934_1329 130
626 3300048905 Ga0496102_0967732 Ga0496102_0967732_18_410 130
627 3300048906 Ga0496103_0000013 Ga0496103_0000013_286144_286536 130
628 3300048906 Ga0496103_0023577 Ga0496103_0023577_2138_2533 130
629 3300048906 Ga0496103_0067902 Ga0496103_0067902_268_660 130
630 3300048906 Ga0496103_0069420 Ga0496103_0069420_961_1356 130
631 3300048906 Ga0496103_0085586 Ga0496103_0085586_1195_1587 130
632 3300048906 Ga0496103_0142453 Ga0496103_0142453_966_1361 130
633 3300048906 Ga0496103_0534225 Ga0496103_0534225_213_605 130
634 3300048907 Ga0496104_0039487 Ga0496104_0039487_3113_3514 130
635 3300048907 Ga0496104_0608122 Ga0496104_0608122_375_767 130
636 3300048908 Ga0496105_0009048 Ga0496105_0009048_6511_6912 130
637 3300048908 Ga0496105_0193940 Ga0496105_0193940_645_1037 130
638 3300048908 Ga0496105_0283327 Ga0496105_0283327_627_1022 130
639 3300048908 Ga0496105_1324089 Ga0496105_1324089_36_431 130
640 3300048909 Ga0496106_0031315 Ga0496106_0031315_3277_3672 130
641 3300048909 Ga0496106_0032115 Ga0496106_0032115_1165_1566 130
642 3300048909 Ga0496106_0056434 Ga0496106_0056434_2182_2574 130
643 3300048909 Ga0496106_0082400 Ga0496106_0082400_1907_2299 130
644 3300048909 Ga0496106_0216233 Ga0496106_0216233_640_1032 130
645 3300048909 Ga0496106_0970471 Ga0496106_0970471_45_437 130
646 3300048910 Ga0496107_0003186 Ga0496107_0003186_6354_6755 130
647 3300048910 Ga0496107_0024700 Ga0496107_0024700_2269_2661 130
648 3300048910 Ga0496107_0027942 Ga0496107_0027942_2698_3090 130
649 3300048910 Ga0496107_0481503 Ga0496107_0481503_254_646 130
650 3300048911 Ga0496108_0012071 Ga0496108_0012071_1621_2013 130
651 3300048911 Ga0496108_0135640 Ga0496108_0135640_1177_1569 130
652 3300048911 Ga0496108_0189202 Ga0496108_0189202_848_1240 130
653 3300048911 Ga0496108_0463692 Ga0496108_0463692_111_506 130
654 3300048912 Ga0496109_0077885 Ga0496109_0077885_2148_2540 130
655 3300048912 Ga0496109_0167489 Ga0496109_0167489_523_915 130
656 3300048912 Ga0496109_1098843 Ga0496109_1098843_178_573 130
657 3300048913 Ga0496110_0790590 Ga0496110_0790590_276_671 130
658 3300048913 Ga0496110_0852603 Ga0496110_0852603_388_783 130
659 3300048914 Ga0496111_0167722 Ga0496111_0167722_49_441 130
660 3300048915 Ga0496112_0021987 Ga0496112_0021987_1388_1780 130
661 3300048915 Ga0496112_0146419 Ga0496112_0146419_1920_2315 130
662 3300048915 Ga0496112_0498561 Ga0496112_0498561_419_811 130
663 3300048915 Ga0496112_0810557 Ga0496112_0810557_10_402 130
664 3300048916 Ga0496113_0087906 Ga0496113_0087906_103_498 130
665 3300048916 Ga0496113_0159075 Ga0496113_0159075_77_469 130
666 3300048917 Ga0496114_0002582 Ga0496114_0002582_13095_13487 130
667 3300048917 Ga0496114_0004034 Ga0496114_0004034_4809_5210 130
668 3300048917 Ga0496114_0586778 Ga0496114_0586778_127_519 130
669 3300048918 Ga0496115_0008694 Ga0496115_0008694_6484_6885 130
670 3300048918 Ga0496115_0088000 Ga0496115_0088000_259_654 130
671 3300048918 Ga0496115_0566752 Ga0496115_0566752_254_646 130
672 3300048918 Ga0496115_0584670 Ga0496115_0584670_222_614 130
673 3300048918 Ga0496115_1307168 Ga0496115_1307168_85_477 130
674 3300048919 Ga0496116_0000033 Ga0496116_0000033_12492_12884 130
675 3300048919 Ga0496116_0034457 Ga0496116_0034457_583_978 130
676 3300048920 Ga0496117_0000025 Ga0496117_0000025_12422_12814 130
677 3300048920 Ga0496117_0006852 Ga0496117_0006852_746_1141 130
678 3300048921 Ga0496118_0000023 Ga0496118_0000023_405293_405685 130
679 3300048921 Ga0496118_0069537 Ga0496118_0069537_245_640 130
680 3300048922 Ga0496119_0001166 Ga0496119_0001166_5775_6167 130
681 3300048922 Ga0496119_0011509 Ga0496119_0011509_57_452 130
682 3300048922 Ga0496119_0573306 Ga0496119_0573306_93_485 130
683 3300048923 Ga0496120_0007290 Ga0496120_0007290_674_1066 130
684 3300048923 Ga0496120_0011731 Ga0496120_0011731_103_498 130
685 3300048924 Ga0496121_0000039 Ga0496121_0000039_241065_241457 130
686 3300048924 Ga0496121_0005272 Ga0496121_0005272_4779_5174 130
687 3300048925 Ga0496122_0019511 Ga0496122_0019511_4404_4796 130
688 3300048926 Ga0496123_0038368 Ga0496123_0038368_1320_1712 130
689 3300048927 Ga0496124_0196177 Ga0496124_0196177_151_543 130
690 3300048927 Ga0496124_0264191 Ga0496124_0264191_442_837 130
691 3300048928 Ga0496125_0028720 Ga0496125_0028720_529_924 130
692 3300048929 Ga0496126_0000968 Ga0496126_0000968_33332_33724 130
693 3300048929 Ga0496126_0073297 Ga0496126_0073297_437_829 130
694 3300048929 Ga0496126_0116218 Ga0496126_0116218_746_1141 130
695 3300048929 Ga0496126_0331723 Ga0496126_0331723_782_1174 130
696 3300049571 Ga0501034_0218530 Ga0501034_0218530_87_482 130
697 3300049579 Ga0501043_0443588 Ga0501043_0443588_458_850 130
698 3300049583 Ga0501067_0213017 Ga0501067_0213017_73_465 130
699 3300050489 nmdc:mga03683_141464_c1 nmdc:mga03683_141464_c1_211_603 130
700 3300050489 nmdc:mga03683_171812_c1 nmdc:mga03683_171812_c1_75_467 130
701 3300050489 nmdc:mga03683_85083_c1 nmdc:mga03683_85083_c1_457_849 130
702 3300050490 nmdc:mga03n38_150708_c1 nmdc:mga03n38_150708_c1_422_814 130
703 3300050490 nmdc:mga03n38_19058_c1 nmdc:mga03n38_19058_c1_617_1009 130
704 3300050490 nmdc:mga03n38_298764_c1 nmdc:mga03n38_298764_c1_278_673 130
705 3300050490 nmdc:mga03n38_331717_c1 nmdc:mga03n38_331717_c1_194_586 130
706 3300050490 nmdc:mga03n38_481962_c1 nmdc:mga03n38_481962_c1_26_421 130
707 3300050490 nmdc:mga03n38_57144_c1 nmdc:mga03n38_57144_c1_1066_1458 130
708 3300050490 nmdc:mga03n38_610_c1 nmdc:mga03n38_610_c1_7303_7695 130
709 3300050490 nmdc:mga03n38_76983_c1 nmdc:mga03n38_76983_c1_423_815 130
710 3300050490 nmdc:mga03n38_9017_c1 nmdc:mga03n38_9017_c1_2673_3065 130
711 3300050491 nmdc:mga00v17_15989_c1 nmdc:mga00v17_15989_c1_148_540 130
712 3300050491 nmdc:mga00v17_3800_c1 nmdc:mga00v17_3800_c1_569_961 130
713 3300050491 nmdc:mga00v17_383905_c1 nmdc:mga00v17_383905_c1_481_873 130
714 3300050491 nmdc:mga00v17_84857_c1 nmdc:mga00v17_84857_c1_900_1292 130
715 3300050491 nmdc:mga00v17_857210_c1 nmdc:mga00v17_857210_c1_148_540 130
716 3300050492 nmdc:mga0yw44_571134_c1 nmdc:mga0yw44_571134_c1_345_737 130
717 3300050492 nmdc:mga0yw44_77624_c1 nmdc:mga0yw44_77624_c1_621_1013 130
718 3300050492 nmdc:mga0yw44_777334_c1 nmdc:mga0yw44_777334_c1_74_466 130
719 3300050492 nmdc:mga0yw44_883689_c1 nmdc:mga0yw44_883689_c1_33_425 130
720 3300050494 nmdc:mga06z11_30276_c1 nmdc:mga06z11_30276_c1_2015_2407 130
721 3300050494 nmdc:mga06z11_324424_c1 nmdc:mga06z11_324424_c1_174_566 130
722 3300050494 nmdc:mga06z11_374274_c1 nmdc:mga06z11_374274_c1_184_576 130
723 3300050494 nmdc:mga06z11_874971_c1 nmdc:mga06z11_874971_c1_104_496 130
724 3300050495 nmdc:mga04h51_49218_c1 nmdc:mga04h51_49218_c1_703_1095 130
725 3300050495 nmdc:mga04h51_88445_c1 nmdc:mga04h51_88445_c1_508_900 130
726 3300050496 nmdc:mga07m45_24331_c1 nmdc:mga07m45_24331_c1_272_664 130
727 3300050496 nmdc:mga07m45_274345_c1 nmdc:mga07m45_274345_c1_62_457 130
728 3300050496 nmdc:mga07m45_323692_c1 nmdc:mga07m45_323692_c1_361_753 130
729 3300050512 nmdc:mga0n895_1051935_c1 nmdc:mga0n895_1051935_c1_133_525 130
730 3300050515 nmdc:mga0a205_567464_c1 nmdc:mga0a205_567464_c1_501_893 130
731 3300050516 nmdc:mga0sz30_113875_c1 nmdc:mga0sz30_113875_c1_119_511 130
732 3300050516 nmdc:mga0sz30_192740_c1 nmdc:mga0sz30_192740_c1_100_495 130
733 3300050516 nmdc:mga0sz30_63539_c1 nmdc:mga0sz30_63539_c1_610_1002 130
734 3300050516 nmdc:mga0sz30_688_c1 nmdc:mga0sz30_688_c1_5748_6140 130
735 3300053077 Ga0495601_0264247 Ga0495601_0264247_346_738 130
736 3300053080 Ga0500635_0002835 Ga0500635_0002835_2314_2706 130
737 3300053085 Ga0495619_0205580 Ga0495619_0205580_643_1035 130
738 3300053087 Ga0500643_001472 Ga0500643_001472_8606_8998 130
739 3300053104 Ga0500556_0056120 Ga0500556_0056120_117_509 130
740 3300053108 Ga0500562_014800 Ga0500562_014800_1482_1874 130
741 3300053109 Ga0500569_239856 Ga0500569_239856_165_557 130
742 3300053131 Ga0500652_002611 Ga0500652_002611_518_910 130
743 3300053139 Ga0500568_0093889 Ga0500568_0093889_606_998 130
744 3300053151 Ga0500604_0108397 Ga0500604_0108397_103_495 130
745 3300053160 Ga0500633_0053075 Ga0500633_0053075_27_419 130
746 3300061719 Ga0466962_0023406 Ga0466962_0023406_2483_2878 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

1

137

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3loq-assembly2.cif.gz_B the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8565 2 127
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8418 2 125
3loq-assembly1.cif.gz_A the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8355 2 127
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8207 2 125
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8166 2 125
ID Description Score Start End Superfamily
3loqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8205 2 126 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8096 2 128 3.40.50.620
af_P9WGL3_237_367_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7957 2 117 3.40.50.620
af_Q84JS5_13_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.793 2 130 3.40.50.620
3ab8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7926 2 125 3.40.50.12370
ID Description Score Start End GO Terms
AF-A0A563DUN2-F1-model_v4 Universal stress protein 0.9637 2 127
AF-A0A1H0T9J0-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.958 2 129
AF-A0A0T1WAK1-F1-model_v4 Universal stress protein UspA 0.9557 1 129
AF-A0A0A0IU55-F1-model_v4 deleted 0.9486 1 129
AF-A0A0T1WAK1-F1-model_v4 Universal stress protein UspA 0.9486 1 129

Feature Viewer

pLDDT pTM Quality
86.8 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map