F478841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 438 | 642 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100292187|Ga0070680_1002921871 |
| Length | 382 |
| Sequence | MTLSRRRFSAAVSAAVALPGFISRANAQGSTIKIGMCAPITGPAAEQGRYAQTGARLALDAVNKAGGVLGKKVELIIEDDQTTNPGVVLAFSKLSSQPDMVAFIGSIRSTQVHAMAPDVLKVGKPVMIGGTDPALTHMGNQWLFRFRPNDSYSGSVIADYGVNTLGKKKWAIVHSTDAFGTAGGNALATALKKLPGATVALDQGYANQSQDFTPVVLAIKQSGADVLGSYFTFENDLGVFARQLRQLGVNIPWVGSPSVVNVSALKLAGPALYGTFGVADYAEDSSPASKAYGKLYRDATKIAPDNQSSWTYDAMTILCMAINKAGKTDPAAIRAAILAVKGYAGAEGEYNFDANGDGLHGYNIVRNEKGNIVFDKHVESRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 12 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 13 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 17 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 18 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 19 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 20 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 21 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 22 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 23 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 24 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 25 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 26 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 27 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 28 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 29 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 30 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 31 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 32 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 33 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 34 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 35 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 36 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 37 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 38 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 39 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 40 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 41 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 42 | 2904699407 | |||
| 43 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 44 | 2906610324 | |||
| 45 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 46 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 47 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 48 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 49 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 50 | 2922425934 | |||
| 51 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 52 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 53 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 54 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 55 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 56 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 57 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 58 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 59 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 60 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 61 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 62 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 63 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 64 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 65 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 66 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 67 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 68 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 69 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 70 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 71 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 72 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 73 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 74 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 75 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 76 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 77 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 78 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 79 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 80 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 81 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 82 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 83 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 84 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 85 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 86 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 87 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 88 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 89 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 90 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 91 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 92 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 93 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 94 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 97 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 100 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 106 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 135 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 141 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 143 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 144 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 145 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 147 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 148 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 149 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 150 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 151 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 152 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 153 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 154 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 155 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 156 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 158 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 159 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 164 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 165 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 166 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 168 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 169 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 170 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 171 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 182 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 196 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 197 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 198 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 199 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 200 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 269 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 270 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 271 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 272 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 273 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 274 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 275 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 276 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 278 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 279 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 280 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 281 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 282 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 304 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 305 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 306 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 307 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 308 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 370 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 371 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 372 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 373 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 374 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 375 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 379 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 387 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 388 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 389 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 390 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 408 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 409 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 411 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 412 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 422 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 423 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 425 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 426 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 427 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 428 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 429 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 430 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 431 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 432 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 433 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 434 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 435 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 436 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 437 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 438 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.54 |
| Metatranscriptomes | 0 |
| Isolates | 13.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.79 |
| Nodule | 10.46 |
| Rhizoplane | 4.69 |
| Rhizosphere | 64.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003880 | 3300000549 | Bacteria | 1979 |
| 2 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 3 | JGI25151J46595_10000044 | 3300003187 | Bacteria | 170418 |
| 4 | JGI25153J46596_10011922 | 3300003215 | Bacteria | 3803 |
| 5 | Ga0055526_1000390 | 3300003771 | Bacteria | 35464 |
| 6 | Ga0055526_1004359 | 3300003771 | Bacteria | 8546 |
| 7 | Ga0055524_1000035 | 3300003775 | Bacteria | 174636 |
| 8 | Ga0065165_1002220 | 3300005262 | Bacteria | 17337 |
| 9 | Ga0070683_100022143 | 3300005329 | Bacteria | 5677 |
| 10 | Ga0070690_100000207 | 3300005330 | Bacteria | 30496 |
| 11 | Ga0068869_100051041 | 3300005334 | Bacteria | 3000 |
| 12 | Ga0070666_10225926 | 3300005335 | Bacteria | 1321 |
| 13 | Ga0070680_100095809 | 3300005336 | Bacteria | 2461 |
| 14 | Ga0070680_100101358 | 3300005336 | Bacteria | 2390 |
| 15 | Ga0070680_100173194 | 3300005336 | Bacteria | 1817 |
| 16 | Ga0070680_100292187 | 3300005336 | Bacteria | 1381 |
| 17 | Ga0070682_100039753 | 3300005337 | Bacteria | 2891 |
| 18 | Ga0068868_100034182 | 3300005338 | Bacteria | 3924 |
| 19 | Ga0070660_100019918 | 3300005339 | Bacteria | 4923 |
| 20 | Ga0070660_100051646 | 3300005339 | Bacteria | 3167 |
| 21 | Ga0070660_100182949 | 3300005339 | Bacteria | 1696 |
| 22 | Ga0070689_100005554 | 3300005340 | Bacteria | 8625 |
| 23 | Ga0070661_100178530 | 3300005344 | Bacteria | 1615 |
| 24 | Ga0070692_10009000 | 3300005345 | Bacteria | 4480 |
| 25 | Ga0070675_100251073 | 3300005354 | Bacteria | 1548 |
| 26 | Ga0070671_100166109 | 3300005355 | Bacteria | 1866 |
| 27 | Ga0070674_100011306 | 3300005356 | Bacteria | 5430 |
| 28 | Ga0070674_100129017 | 3300005356 | Bacteria | 1883 |
| 29 | Ga0070673_100065918 | 3300005364 | Bacteria | 2891 |
| 30 | Ga0070688_100048409 | 3300005365 | Bacteria | 2641 |
| 31 | Ga0070659_100138531 | 3300005366 | Bacteria | 1980 |
| 32 | Ga0070667_100225055 | 3300005367 | Unclassified | 1671 |
| 33 | Ga0070709_10000203 | 3300005434 | Bacteria | 38151 |
| 34 | Ga0070709_10109435 | 3300005434 | Bacteria | 1855 |
| 35 | Ga0070714_100021335 | 3300005435 | Bacteria | 5301 |
| 36 | Ga0070714_100118970 | 3300005435 | Bacteria | 2347 |
| 37 | Ga0070713_100036700 | 3300005436 | Bacteria | 3957 |
| 38 | Ga0070713_100099861 | 3300005436 | Bacteria | 2511 |
| 39 | Ga0070710_10002700 | 3300005437 | Bacteria | 8432 |
| 40 | Ga0070710_10007564 | 3300005437 | Bacteria | 5262 |
| 41 | Ga0070710_10013736 | 3300005437 | Bacteria | 4063 |
| 42 | Ga0070710_10197423 | 3300005437 | Unclassified | 1268 |
| 43 | Ga0070701_10000361 | 3300005438 | Bacteria | 15132 |
| 44 | Ga0070711_100001730 | 3300005439 | Bacteria | 12117 |
| 45 | Ga0070711_100011047 | 3300005439 | Bacteria | 5601 |
| 46 | Ga0070711_100030771 | 3300005439 | Bacteria | 3557 |
| 47 | Ga0070705_100004891 | 3300005440 | Bacteria | 6526 |
| 48 | Ga0070700_100000469 | 3300005441 | Bacteria | 20211 |
| 49 | Ga0070663_100010941 | 3300005455 | Bacteria | 5672 |
| 50 | Ga0070663_100034586 | 3300005455 | Bacteria | 3501 |
| 51 | Ga0070678_100012495 | 3300005456 | Bacteria | 5282 |
| 52 | Ga0070662_100052429 | 3300005457 | Bacteria | 2949 |
| 53 | Ga0070681_10018290 | 3300005458 | Bacteria | 7005 |
| 54 | Ga0070681_10056849 | 3300005458 | Bacteria | 3893 |
| 55 | Ga0068867_100034336 | 3300005459 | Bacteria | 3676 |
| 56 | Ga0068867_100104229 | 3300005459 | Unclassified | 2170 |
| 57 | Ga0068867_100199671 | 3300005459 | Bacteria | 1600 |
| 58 | Ga0070706_100139385 | 3300005467 | Bacteria | 2264 |
| 59 | Ga0070707_100385593 | 3300005468 | Bacteria | 1361 |
| 60 | Ga0070699_100025383 | 3300005518 | Bacteria | 5109 |
| 61 | Ga0070679_100009864 | 3300005530 | Bacteria | 9035 |
| 62 | Ga0070679_100017715 | 3300005530 | Bacteria | 6896 |
| 63 | Ga0070679_100056049 | 3300005530 | Bacteria | 3926 |
| 64 | Ga0070684_100135289 | 3300005535 | Bacteria | 2226 |
| 65 | Ga0070684_100183679 | 3300005535 | Bacteria | 1902 |
| 66 | Ga0070697_100040370 | 3300005536 | Bacteria | 3775 |
| 67 | Ga0068853_100005226 | 3300005539 | Bacteria | 10155 |
| 68 | Ga0068853_100040363 | 3300005539 | Bacteria | 3982 |
| 69 | Ga0068853_100043705 | 3300005539 | Bacteria | 3833 |
| 70 | Ga0068853_100297183 | 3300005539 | Bacteria | 1492 |
| 71 | Ga0070686_100001838 | 3300005544 | Bacteria | 11840 |
| 72 | Ga0070695_100130261 | 3300005545 | Bacteria | 1733 |
| 73 | Ga0070696_100121088 | 3300005546 | Bacteria | 1894 |
| 74 | Ga0070696_100150471 | 3300005546 | Bacteria | 1708 |
| 75 | Ga0070665_100016962 | 3300005548 | Bacteria | 7302 |
| 76 | Ga0070665_100108533 | 3300005548 | Bacteria | 2778 |
| 77 | Ga0070665_100321397 | 3300005548 | Bacteria | 1552 |
| 78 | Ga0070704_100021333 | 3300005549 | Bacteria | 4198 |
| 79 | Ga0070704_100106637 | 3300005549 | Bacteria | 2123 |
| 80 | Ga0068855_100010865 | 3300005563 | Bacteria | 10993 |
| 81 | Ga0068855_100059992 | 3300005563 | Bacteria | 4450 |
| 82 | Ga0068855_100067952 | 3300005563 | Bacteria | 4150 |
| 83 | Ga0070664_100019919 | 3300005564 | Bacteria | 5522 |
| 84 | Ga0068857_100014683 | 3300005577 | Bacteria | 6833 |
| 85 | Ga0068857_100016047 | 3300005577 | Bacteria | 6562 |
| 86 | Ga0068857_100067452 | 3300005577 | Bacteria | 3184 |
| 87 | Ga0068854_100022014 | 3300005578 | Bacteria | 4334 |
| 88 | Ga0068856_100003347 | 3300005614 | Bacteria | 16276 |
| 89 | Ga0068856_100062929 | 3300005614 | Bacteria | 3665 |
| 90 | Ga0070702_100007752 | 3300005615 | Bacteria | 5158 |
| 91 | Ga0068859_100018883 | 3300005617 | Bacteria | 6927 |
| 92 | Ga0068864_100262416 | 3300005618 | Bacteria | 1607 |
| 93 | Ga0068866_10000298 | 3300005718 | Bacteria | 23676 |
| 94 | Ga0068866_10005233 | 3300005718 | Bacteria | 5345 |
| 95 | Ga0068861_100000393 | 3300005719 | Bacteria | 25233 |
| 96 | Ga0068851_10004825 | 3300005834 | Bacteria | 6103 |
| 97 | Ga0068870_10003281 | 3300005840 | Bacteria | 6834 |
| 98 | Ga0068863_100081423 | 3300005841 | Bacteria | 3067 |
| 99 | Ga0068858_100004345 | 3300005842 | Bacteria | 13913 |
| 100 | Ga0068858_100006733 | 3300005842 | Bacteria | 11181 |
| 101 | Ga0068860_100166205 | 3300005843 | Bacteria | 2130 |
| 102 | Ga0068860_100223015 | 3300005843 | Bacteria | 1831 |
| 103 | Ga0081540_1009663 | 3300005983 | Bacteria | 6629 |
| 104 | Ga0081540_1020917 | 3300005983 | Bacteria | 3918 |
| 105 | Ga0070717_10070357 | 3300006028 | Bacteria | 2916 |
| 106 | Ga0075365_10009687 | 3300006038 | Bacteria | 5559 |
| 107 | Ga0075365_10053068 | 3300006038 | Bacteria | 2684 |
| 108 | Ga0075363_100087469 | 3300006048 | Bacteria | 1712 |
| 109 | Ga0070715_10007578 | 3300006163 | Bacteria | 3742 |
| 110 | Ga0070715_10036971 | 3300006163 | Bacteria | 2018 |
| 111 | Ga0070716_100002283 | 3300006173 | Bacteria | 8826 |
| 112 | Ga0070716_100008237 | 3300006173 | Bacteria | 5166 |
| 113 | Ga0070712_100008500 | 3300006175 | Bacteria | 6456 |
| 114 | Ga0070712_100018815 | 3300006175 | Bacteria | 4493 |
| 115 | Ga0070712_100231788 | 3300006175 | Bacteria | 1467 |
| 116 | Ga0097621_100004050 | 3300006237 | Bacteria | 10168 |
| 117 | Ga0097621_100010946 | 3300006237 | Bacteria | 6660 |
| 118 | Ga0068871_100000782 | 3300006358 | Bacteria | 21411 |
| 119 | Ga0068871_100005345 | 3300006358 | Bacteria | 9003 |
| 120 | Ga0068871_100345905 | 3300006358 | Bacteria | 1314 |
| 121 | Ga0075431_100142152 | 3300006847 | Bacteria | 2474 |
| 122 | Ga0068865_100000084 | 3300006881 | Bacteria | 50482 |
| 123 | Ga0068865_100130527 | 3300006881 | Bacteria | 1882 |
| 124 | Ga0068865_100143700 | 3300006881 | Bacteria | 1802 |
| 125 | Ga0068865_100174103 | 3300006881 | Bacteria | 1652 |
| 126 | Ga0097620_100018883 | 3300006931 | Bacteria | 6927 |
| 127 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 128 | Ga0099822_1006547 | 3300006943 | Bacteria | 15161 |
| 129 | Ga0099794_10013294 | 3300007265 | Bacteria | 3579 |
| 130 | Ga0099794_10026075 | 3300007265 | Bacteria | 2698 |
| 131 | Ga0099794_10030124 | 3300007265 | Bacteria | 2532 |
| 132 | Ga0099794_10037632 | 3300007265 | Unclassified | 2291 |
| 133 | Ga0099795_10026375 | 3300007788 | Bacteria | 1957 |
| 134 | Ga0105240_10006298 | 3300009093 | Bacteria | 17466 |
| 135 | Ga0105240_10006694 | 3300009093 | Bacteria | 16895 |
| 136 | Ga0105240_10027880 | 3300009093 | Bacteria | 7389 |
| 137 | Ga0105240_10034221 | 3300009093 | Bacteria | 6557 |
| 138 | Ga0105240_10250952 | 3300009093 | Bacteria | 2046 |
| 139 | Ga0105245_10000063 | 3300009098 | Bacteria | 113377 |
| 140 | Ga0105245_10028645 | 3300009098 | Bacteria | 4915 |
| 141 | Ga0105245_10251088 | 3300009098 | Bacteria | 1718 |
| 142 | Ga0105247_10014337 | 3300009101 | Bacteria | 4759 |
| 143 | Ga0105247_10100082 | 3300009101 | Bacteria | 1852 |
| 144 | Ga0105243_10001155 | 3300009148 | Bacteria | 23948 |
| 145 | Ga0105241_10083123 | 3300009174 | Bacteria | 2511 |
| 146 | Ga0105242_10003979 | 3300009176 | Bacteria | 11486 |
| 147 | Ga0105242_10015686 | 3300009176 | Bacteria | 5886 |
| 148 | Ga0105248_10029925 | 3300009177 | Bacteria | 6076 |
| 149 | Ga0105248_10039177 | 3300009177 | Bacteria | 5307 |
| 150 | Ga0105248_10107540 | 3300009177 | Bacteria | 3145 |
| 151 | Ga0105248_10228922 | 3300009177 | Bacteria | 2092 |
| 152 | Ga0105237_10040903 | 3300009545 | Bacteria | 4675 |
| 153 | Ga0105237_10047694 | 3300009545 | Bacteria | 4306 |
| 154 | Ga0105237_10058418 | 3300009545 | Bacteria | 3860 |
| 155 | Ga0105237_10058572 | 3300009545 | Bacteria | 3855 |
| 156 | Ga0105237_10175266 | 3300009545 | Bacteria | 2145 |
| 157 | Ga0105238_10006294 | 3300009551 | Bacteria | 11798 |
| 158 | Ga0105238_10017402 | 3300009551 | Bacteria | 7303 |
| 159 | Ga0105238_10035145 | 3300009551 | Bacteria | 5096 |
| 160 | Ga0105238_10164063 | 3300009551 | Bacteria | 2197 |
| 161 | Ga0105238_10270458 | 3300009551 | Bacteria | 1680 |
| 162 | Ga0105249_10022766 | 3300009553 | Bacteria | 5616 |
| 163 | Ga0105249_10067760 | 3300009553 | Bacteria | 3289 |
| 164 | Ga0099796_10011104 | 3300010159 | Bacteria | 2501 |
| 165 | Ga0099796_10011436 | 3300010159 | Bacteria | 2477 |
| 166 | Ga0105239_10001588 | 3300010375 | Bacteria | 30008 |
| 167 | Ga0105239_10031510 | 3300010375 | Bacteria | 5830 |
| 168 | Ga0105239_10049046 | 3300010375 | Bacteria | 4630 |
| 169 | Ga0105239_10074287 | 3300010375 | Bacteria | 3738 |
| 170 | Ga0105246_10006885 | 3300011119 | Bacteria | 6955 |
| 171 | Ga0105246_10094733 | 3300011119 | Bacteria | 2160 |
| 172 | Ga0157370_10014947 | 3300013104 | Bacteria | 7918 |
| 173 | Ga0157370_10025078 | 3300013104 | Bacteria | 5903 |
| 174 | Ga0157369_10021190 | 3300013105 | Bacteria | 7267 |
| 175 | Ga0157369_10041431 | 3300013105 | Bacteria | 5027 |
| 176 | Ga0157369_10416234 | 3300013105 | Bacteria | 1393 |
| 177 | Ga0157374_10023179 | 3300013296 | Bacteria | 5547 |
| 178 | Ga0157374_10033305 | 3300013296 | Bacteria | 4701 |
| 179 | Ga0157374_10386324 | 3300013296 | Bacteria | 1395 |
| 180 | Ga0157378_10001267 | 3300013297 | Bacteria | 22738 |
| 181 | Ga0157378_10047944 | 3300013297 | Bacteria | 3799 |
| 182 | Ga0157378_10071640 | 3300013297 | Bacteria | 3113 |
| 183 | Ga0157378_10202534 | 3300013297 | Bacteria | 1878 |
| 184 | Ga0163162_10000526 | 3300013306 | Bacteria | 35521 |
| 185 | Ga0163162_10017979 | 3300013306 | Bacteria | 6918 |
| 186 | Ga0163162_10031442 | 3300013306 | Bacteria | 5265 |
| 187 | Ga0163162_10080658 | 3300013306 | Bacteria | 3322 |
| 188 | Ga0163162_10101697 | 3300013306 | Bacteria | 2966 |
| 189 | Ga0163162_10317323 | 3300013306 | Bacteria | 1691 |
| 190 | Ga0157375_10009689 | 3300013308 | Bacteria | 8470 |
| 191 | Ga0157375_10029609 | 3300013308 | Bacteria | 5152 |
| 192 | Ga0157375_10058259 | 3300013308 | Bacteria | 3821 |
| 193 | Ga0157375_10185725 | 3300013308 | Bacteria | 2232 |
| 194 | Ga0163163_10011315 | 3300014325 | Bacteria | 8088 |
| 195 | Ga0163163_10192425 | 3300014325 | Bacteria | 2088 |
| 196 | Ga0157380_10010857 | 3300014326 | Bacteria | 6567 |
| 197 | Ga0157379_10077884 | 3300014968 | Bacteria | 2969 |
| 198 | Ga0157379_10313650 | 3300014968 | Bacteria | 1431 |
| 199 | Ga0157376_10027760 | 3300014969 | Bacteria | 4491 |
| 200 | Ga0157376_10055672 | 3300014969 | Bacteria | 3301 |
| 201 | Ga0163161_10013681 | 3300017792 | Bacteria | 5650 |
| 202 | Ga0163161_10206783 | 3300017792 | Bacteria | 1515 |
| 203 | Ga0213873_10008935 | 3300021358 | Bacteria | 2064 |
| 204 | Ga0213873_10013089 | 3300021358 | Bacteria | 1813 |
| 205 | Ga0213874_10015102 | 3300021377 | Bacteria | 2031 |
| 206 | Ga0213876_10000749 | 3300021384 | Bacteria | 22477 |
| 207 | Ga0213876_10004947 | 3300021384 | Bacteria | 7370 |
| 208 | Ga0213876_10007051 | 3300021384 | Bacteria | 6126 |
| 209 | Ga0213876_10015648 | 3300021384 | Bacteria | 4015 |
| 210 | Ga0213875_10007684 | 3300021388 | Bacteria | 5554 |
| 211 | Ga0213875_10011228 | 3300021388 | Bacteria | 4462 |
| 212 | Ga0213875_10113003 | 3300021388 | Bacteria | 1268 |
| 213 | Ga0213871_10000276 | 3300021441 | Bacteria | 6352 |
| 214 | Ga0209563_103620 | 3300025230 | Bacteria | 3147 |
| 215 | Ga0209677_100141 | 3300025253 | Bacteria | 66656 |
| 216 | Ga0209677_102457 | 3300025253 | Bacteria | 6950 |
| 217 | Ga0209233_1002351 | 3300025261 | Bacteria | 7040 |
| 218 | Ga0209233_1002384 | 3300025261 | Bacteria | 6957 |
| 219 | Ga0209455_1007127 | 3300025272 | Bacteria | 3198 |
| 220 | Ga0209673_1023393 | 3300025273 | Bacteria | 2105 |
| 221 | Ga0209675_1000905 | 3300025291 | Bacteria | 18956 |
| 222 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 223 | Ga0209564_1000044 | 3300025295 | Bacteria | 381017 |
| 224 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 225 | Ga0209758_1015744 | 3300025297 | Bacteria | 3893 |
| 226 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 227 | Ga0209256_1000181 | 3300025299 | Bacteria | 123624 |
| 228 | Ga0207426_1010388 | 3300025302 | Bacteria | 3614 |
| 229 | Ga0207692_10001651 | 3300025898 | Bacteria | 8435 |
| 230 | Ga0207642_10006430 | 3300025899 | Bacteria | 3905 |
| 231 | Ga0207710_10071136 | 3300025900 | Bacteria | 1595 |
| 232 | Ga0207680_10026036 | 3300025903 | Bacteria | 3236 |
| 233 | Ga0207680_10212242 | 3300025903 | Bacteria | 1324 |
| 234 | Ga0207699_10002275 | 3300025906 | Bacteria | 9062 |
| 235 | Ga0207699_10066770 | 3300025906 | Bacteria | 2185 |
| 236 | Ga0207643_10003705 | 3300025908 | Bacteria | 8218 |
| 237 | Ga0207684_10035847 | 3300025910 | Bacteria | 4211 |
| 238 | Ga0207654_10013541 | 3300025911 | Bacteria | 4197 |
| 239 | Ga0207707_10000419 | 3300025912 | Bacteria | 44410 |
| 240 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 241 | Ga0207707_10002868 | 3300025912 | Bacteria | 15401 |
| 242 | Ga0207707_10027445 | 3300025912 | Bacteria | 4979 |
| 243 | Ga0207695_10022984 | 3300025913 | Bacteria | 7061 |
| 244 | Ga0207695_10048124 | 3300025913 | Bacteria | 4506 |
| 245 | Ga0207695_10060686 | 3300025913 | Bacteria | 3913 |
| 246 | Ga0207671_10006837 | 3300025914 | Bacteria | 10068 |
| 247 | Ga0207671_10029342 | 3300025914 | Bacteria | 4107 |
| 248 | Ga0207671_10116185 | 3300025914 | Bacteria | 2041 |
| 249 | Ga0207693_10017378 | 3300025915 | Bacteria | 5738 |
| 250 | Ga0207693_10058489 | 3300025915 | Bacteria | 3020 |
| 251 | Ga0207693_10099089 | 3300025915 | Bacteria | 2285 |
| 252 | Ga0207693_10123079 | 3300025915 | Bacteria | 2037 |
| 253 | Ga0207663_10003400 | 3300025916 | Bacteria | 7780 |
| 254 | Ga0207663_10045041 | 3300025916 | Bacteria | 2711 |
| 255 | Ga0207660_10012377 | 3300025917 | Bacteria | 5581 |
| 256 | Ga0207660_10094449 | 3300025917 | Bacteria | 2223 |
| 257 | Ga0207657_10011308 | 3300025919 | Bacteria | 8865 |
| 258 | Ga0207657_10046183 | 3300025919 | Bacteria | 3816 |
| 259 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 260 | Ga0207652_10009155 | 3300025921 | Bacteria | 7969 |
| 261 | Ga0207652_10011695 | 3300025921 | Bacteria | 7082 |
| 262 | Ga0207681_10132220 | 3300025923 | Bacteria | 1847 |
| 263 | Ga0207694_10004974 | 3300025924 | Bacteria | 10290 |
| 264 | Ga0207687_10008928 | 3300025927 | Bacteria | 6555 |
| 265 | Ga0207687_10084376 | 3300025927 | Bacteria | 2302 |
| 266 | Ga0207700_10083561 | 3300025928 | Bacteria | 2500 |
| 267 | Ga0207700_10095119 | 3300025928 | Bacteria | 2362 |
| 268 | Ga0207664_10019520 | 3300025929 | Bacteria | 5011 |
| 269 | Ga0207664_10055261 | 3300025929 | Bacteria | 3150 |
| 270 | Ga0207664_10173003 | 3300025929 | Bacteria | 1849 |
| 271 | Ga0207664_10215110 | 3300025929 | Unclassified | 1665 |
| 272 | Ga0207690_10085073 | 3300025932 | Bacteria | 2219 |
| 273 | Ga0207706_10324269 | 3300025933 | Bacteria | 1340 |
| 274 | Ga0207686_10004474 | 3300025934 | Bacteria | 7489 |
| 275 | Ga0207686_10008261 | 3300025934 | Bacteria | 5614 |
| 276 | Ga0207709_10002360 | 3300025935 | Bacteria | 11919 |
| 277 | Ga0207670_10010596 | 3300025936 | Bacteria | 5318 |
| 278 | Ga0207669_10019350 | 3300025937 | Bacteria | 3543 |
| 279 | Ga0207669_10063791 | 3300025937 | Unclassified | 2276 |
| 280 | Ga0207704_10063904 | 3300025938 | Bacteria | 2297 |
| 281 | Ga0207665_10005897 | 3300025939 | Bacteria | 8151 |
| 282 | Ga0207665_10084398 | 3300025939 | Bacteria | 2192 |
| 283 | Ga0207711_10005401 | 3300025941 | Bacteria | 10804 |
| 284 | Ga0207711_10027328 | 3300025941 | Bacteria | 4792 |
| 285 | Ga0207711_10049952 | 3300025941 | Bacteria | 3581 |
| 286 | Ga0207711_10201143 | 3300025941 | Bacteria | 1818 |
| 287 | Ga0207689_10000152 | 3300025942 | Bacteria | 59757 |
| 288 | Ga0207689_10036749 | 3300025942 | Bacteria | 4065 |
| 289 | Ga0207661_10008213 | 3300025944 | Bacteria | 7451 |
| 290 | Ga0207661_10218935 | 3300025944 | Bacteria | 1682 |
| 291 | Ga0207679_10063502 | 3300025945 | Bacteria | 2757 |
| 292 | Ga0207679_10113969 | 3300025945 | Bacteria | 2140 |
| 293 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 294 | Ga0207667_10034874 | 3300025949 | Bacteria | 5400 |
| 295 | Ga0207667_10153242 | 3300025949 | Bacteria | 2372 |
| 296 | Ga0207668_10025027 | 3300025972 | Bacteria | 3858 |
| 297 | Ga0207668_10255363 | 3300025972 | Bacteria | 1426 |
| 298 | Ga0207640_10052890 | 3300025981 | Bacteria | 2648 |
| 299 | Ga0207677_10005891 | 3300026023 | Bacteria | 6669 |
| 300 | Ga0207703_10098778 | 3300026035 | Bacteria | 2469 |
| 301 | Ga0207639_10014520 | 3300026041 | Bacteria | 5543 |
| 302 | Ga0207639_10066716 | 3300026041 | Bacteria | 2798 |
| 303 | Ga0207639_10119314 | 3300026041 | Bacteria | 2164 |
| 304 | Ga0207678_10006479 | 3300026067 | Bacteria | 10385 |
| 305 | Ga0207678_10031213 | 3300026067 | Bacteria | 4648 |
| 306 | Ga0207678_10036065 | 3300026067 | Bacteria | 4304 |
| 307 | Ga0207678_10082315 | 3300026067 | Bacteria | 2754 |
| 308 | Ga0207708_10000166 | 3300026075 | Bacteria | 51921 |
| 309 | Ga0207708_10010991 | 3300026075 | Bacteria | 6733 |
| 310 | Ga0207702_10000548 | 3300026078 | Bacteria | 41978 |
| 311 | Ga0207641_10111254 | 3300026088 | Bacteria | 2428 |
| 312 | Ga0207648_10000131 | 3300026089 | Bacteria | 73949 |
| 313 | Ga0207648_10012752 | 3300026089 | Bacteria | 7854 |
| 314 | Ga0207676_10123343 | 3300026095 | Bacteria | 2189 |
| 315 | Ga0207676_10386425 | 3300026095 | Bacteria | 1304 |
| 316 | Ga0207674_10010575 | 3300026116 | Bacteria | 10440 |
| 317 | Ga0207674_10013781 | 3300026116 | Bacteria | 8946 |
| 318 | Ga0207674_10070422 | 3300026116 | Bacteria | 3516 |
| 319 | Ga0207674_10151454 | 3300026116 | Bacteria | 2276 |
| 320 | Ga0207675_100001354 | 3300026118 | Bacteria | 24525 |
| 321 | Ga0207675_100050443 | 3300026118 | Bacteria | 3883 |
| 322 | Ga0207675_100082798 | 3300026118 | Bacteria | 3009 |
| 323 | Ga0207683_10006827 | 3300026121 | Bacteria | 9772 |
| 324 | Ga0207683_10015560 | 3300026121 | Bacteria | 6476 |
| 325 | Ga0207683_10016803 | 3300026121 | Bacteria | 6228 |
| 326 | Ga0207698_10196905 | 3300026142 | Bacteria | 1801 |
| 327 | Ga0207698_10221318 | 3300026142 | Bacteria | 1711 |
| 328 | Ga0207698_10232731 | 3300026142 | Bacteria | 1674 |
| 329 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 330 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 331 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 332 | Ga0209179_1005504 | 3300027512 | Bacteria | 1986 |
| 333 | Ga0209588_1002539 | 3300027671 | Bacteria | 4953 |
| 334 | Ga0209588_1039098 | 3300027671 | Bacteria | 1530 |
| 335 | Ga0268266_10009249 | 3300028379 | Bacteria | 8692 |
| 336 | Ga0268266_10275747 | 3300028379 | Bacteria | 1562 |
| 337 | Ga0268265_10055636 | 3300028380 | Bacteria | 3007 |
| 338 | Ga0268265_10134138 | 3300028380 | Bacteria | 2063 |
| 339 | Ga0268264_10206852 | 3300028381 | Bacteria | 1799 |
| 340 | Ga0307511_10024264 | 3300030521 | Bacteria | 5626 |
| 341 | Ga0265330_10022974 | 3300031235 | Bacteria | 2834 |
| 342 | Ga0265330_10067773 | 3300031235 | Bacteria | 1546 |
| 343 | Ga0265328_10030289 | 3300031239 | Bacteria | 2016 |
| 344 | Ga0265325_10027647 | 3300031241 | Bacteria | 3064 |
| 345 | Ga0265340_10001085 | 3300031247 | Bacteria | 15485 |
| 346 | Ga0265339_10116574 | 3300031249 | Bacteria | 1377 |
| 347 | Ga0265331_10041625 | 3300031250 | Bacteria | 2232 |
| 348 | Ga0265331_10042854 | 3300031250 | Bacteria | 2194 |
| 349 | Ga0265327_10000236 | 3300031251 | Bacteria | 110434 |
| 350 | Ga0265314_10004266 | 3300031711 | Bacteria | 13380 |
| 351 | Ga0265314_10146683 | 3300031711 | Bacteria | 1452 |
| 352 | Ga0265342_10030008 | 3300031712 | Bacteria | 3374 |
| 353 | Ga0265342_10070700 | 3300031712 | Bacteria | 2035 |
| 354 | Ga0307507_10083911 | 3300033179 | Bacteria | 2781 |
| 355 | Ga0307510_10061882 | 3300033180 | Bacteria | 3831 |
| 356 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 357 | Ga0373926_0007554 | 3300035083 | Bacteria | 3620 |
| 358 | Ga0373934_0033359 | 3300035086 | Bacteria | 2020 |
| 359 | Ga0373923_0009940 | 3300035111 | Bacteria | 3446 |
| 360 | Ga0373923_0083424 | 3300035111 | Bacteria | 1389 |
| 361 | Ga0373936_0013841 | 3300035113 | Bacteria | 3080 |
| 362 | Ga0373936_0017960 | 3300035113 | Bacteria | 2728 |
| 363 | Ga0373953_0058080 | 3300035117 | Bacteria | 1576 |
| 364 | Ga0373954_0000645 | 3300035118 | Bacteria | 13339 |
| 365 | Ga0373957_0069054 | 3300035120 | Bacteria | 1379 |
| 366 | Ga0373943_0040178 | 3300035170 | Bacteria | 2258 |
| 367 | Ga0373943_0081606 | 3300035170 | Bacteria | 1659 |
| 368 | Ga0373924_0022355 | 3300035410 | Bacteria | 2472 |
| 369 | Ga0373935_0012897 | 3300035692 | Bacteria | 5035 |
| 370 | Ga0373935_0060625 | 3300035692 | Bacteria | 2420 |
| 371 | Ga0373927_0014717 | 3300035695 | Bacteria | 5172 |
| 372 | Ga0373927_0045076 | 3300035695 | Bacteria | 2853 |
| 373 | Ga0373927_0049560 | 3300035695 | Bacteria | 2715 |
| 374 | Ga0373927_0111542 | 3300035695 | Bacteria | 1782 |
| 375 | Ga0373933_0003690 | 3300035724 | Bacteria | 8470 |
| 376 | Ga0373933_0175570 | 3300035724 | Bacteria | 1365 |
| 377 | Ga0373933_0207156 | 3300035724 | Bacteria | 1256 |
| 378 | Ga0373937_0027665 | 3300036401 | Bacteria | 5130 |
| 379 | Ga0373937_0041387 | 3300036401 | Bacteria | 4202 |
| 380 | Ga0373937_0084598 | 3300036401 | Bacteria | 2935 |
| 381 | Ga0373937_0283900 | 3300036401 | Bacteria | 1563 |
| 382 | Ga0373925_0025108 | 3300037068 | Bacteria | 4351 |
| 383 | Ga0373925_0031128 | 3300037068 | Bacteria | 3919 |
| 384 | Ga0373925_0101482 | 3300037068 | Bacteria | 2212 |
| 385 | Ga0395899_0063956 | 3300037312 | Bacteria | 2706 |
| 386 | Ga0395900_0082779 | 3300037418 | Bacteria | 3297 |
| 387 | Ga0395900_0259525 | 3300037418 | Bacteria | 1736 |
| 388 | Ga0395900_0330718 | 3300037418 | Bacteria | 1502 |
| 389 | Ga0395898_0034204 | 3300037466 | Bacteria | 5067 |
| 390 | Ga0395898_0071593 | 3300037466 | Bacteria | 3350 |
| 391 | Ga0395905_0048596 | 3300037471 | Bacteria | 3976 |
| 392 | Ga0395905_0131323 | 3300037471 | Bacteria | 2355 |
| 393 | Ga0436364_1009808 | 3300037853 | Bacteria | 10125 |
| 394 | Ga0436364_1470735 | 3300037853 | Bacteria | 11217 |
| 395 | Ga0436365_0002039 | 3300039437 | Bacteria | 28011 |
| 396 | Ga0436365_0266146 | 3300039437 | Bacteria | 1743 |
| 397 | Ga0436365_0693504 | 3300039437 | Bacteria | 82758 |
| 398 | Ga0436365_0839901 | 3300039437 | Bacteria | 10218 |
| 399 | Ga0436360_0411669 | 3300039438 | Bacteria | 1406 |
| 400 | Ga0436361_0194339 | 3300039447 | Bacteria | 4635 |
| 401 | Ga0436361_0711176 | 3300039447 | Bacteria | 18026 |
| 402 | Ga0436363_0322567 | 3300039450 | Bacteria | 9751 |
| 403 | Ga0436363_0555717 | 3300039450 | Bacteria | 1190 |
| 404 | Ga0436363_1048610 | 3300039450 | Bacteria | 16451 |
| 405 | Ga0436362_0305717 | 3300039453 | Bacteria | 3347 |
| 406 | Ga0436362_0442809 | 3300039453 | Bacteria | 5601 |
| 407 | Ga0466964_0038046 | 3300044706 | Bacteria | 1934 |
| 408 | Ga0466968_0007831 | 3300044735 | Bacteria | 4076 |
| 409 | Ga0466970_0178105 | 3300044765 | Bacteria | 1179 |
| 410 | Ga0466957_0028471 | 3300044842 | Bacteria | 3327 |
| 411 | Ga0466959_0098882 | 3300045049 | Bacteria | 2090 |
| 412 | Ga0466967_0205162 | 3300045976 | Bacteria | 1868 |
| 413 | Ga0495592_0012242 | 3300046454 | Bacteria | 6511 |
| 414 | Ga0495592_0022948 | 3300046454 | Bacteria | 4748 |
| 415 | Ga0495592_0068940 | 3300046454 | Bacteria | 2580 |
| 416 | Ga0495603_0003836 | 3300046455 | Bacteria | 8949 |
| 417 | Ga0495603_0008150 | 3300046455 | Bacteria | 6331 |
| 418 | Ga0495603_0042416 | 3300046455 | Bacteria | 2720 |
| 419 | Ga0495603_0067385 | 3300046455 | Bacteria | 2107 |
| 420 | Ga0495603_0118371 | 3300046455 | Bacteria | 1544 |
| 421 | Ga0495629_0000373 | 3300046459 | Bacteria | 37733 |
| 422 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 423 | Ga0495629_0018940 | 3300046459 | Bacteria | 4923 |
| 424 | Ga0495629_0055657 | 3300046459 | Bacteria | 2766 |
| 425 | Ga0495629_0071868 | 3300046459 | Bacteria | 2415 |
| 426 | Ga0495638_0000356 | 3300046460 | Bacteria | 57145 |
| 427 | Ga0495641_0021456 | 3300046461 | Bacteria | 3249 |
| 428 | Ga0495651_0007091 | 3300046462 | Bacteria | 8568 |
| 429 | Ga0495653_0022804 | 3300046463 | Bacteria | 5063 |
| 430 | Ga0495653_0036975 | 3300046463 | Bacteria | 3841 |
| 431 | Ga0495650_0075469 | 3300046471 | Bacteria | 1312 |
| 432 | Ga0495580_0010268 | 3300046472 | Bacteria | 7303 |
| 433 | Ga0495580_0086463 | 3300046472 | Bacteria | 2184 |
| 434 | Ga0495580_0087209 | 3300046472 | Bacteria | 2174 |
| 435 | Ga0495582_0006572 | 3300046473 | Bacteria | 6452 |
| 436 | Ga0495582_0036637 | 3300046473 | Bacteria | 2698 |
| 437 | Ga0495605_0003407 | 3300046474 | Bacteria | 9471 |
| 438 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 439 | Ga0495639_0023871 | 3300046475 | Bacteria | 2689 |
| 440 | Ga0495662_0004072 | 3300046476 | Bacteria | 7358 |
| 441 | Ga0495662_0099452 | 3300046476 | Bacteria | 1422 |
| 442 | Ga0495664_0025650 | 3300046477 | Bacteria | 3432 |
| 443 | Ga0495585_0017177 | 3300046492 | Bacteria | 4185 |
| 444 | Ga0495594_0083608 | 3300046499 | Bacteria | 1784 |
| 445 | Ga0495596_0037025 | 3300046500 | Bacteria | 1931 |
| 446 | Ga0495607_0030694 | 3300046501 | Bacteria | 3297 |
| 447 | Ga0495606_0001386 | 3300046507 | Bacteria | 32763 |
| 448 | Ga0495606_0019788 | 3300046507 | Bacteria | 4988 |
| 449 | Ga0495606_0102246 | 3300046507 | Bacteria | 1743 |
| 450 | Ga0495608_0018583 | 3300046511 | Bacteria | 4791 |
| 451 | Ga0495618_0027852 | 3300046514 | Bacteria | 3519 |
| 452 | Ga0495628_0009755 | 3300046516 | Bacteria | 8185 |
| 453 | Ga0495628_0042488 | 3300046516 | Bacteria | 3626 |
| 454 | Ga0495630_0011058 | 3300046517 | Bacteria | 6529 |
| 455 | Ga0495630_0029536 | 3300046517 | Bacteria | 4075 |
| 456 | Ga0495630_0044051 | 3300046517 | Bacteria | 3335 |
| 457 | Ga0495648_0000936 | 3300046524 | Bacteria | 30292 |
| 458 | Ga0495648_0019888 | 3300046524 | Bacteria | 4701 |
| 459 | Ga0495652_0023315 | 3300046529 | Bacteria | 5487 |
| 460 | Ga0495652_0149199 | 3300046529 | Bacteria | 1829 |
| 461 | Ga0495654_0046864 | 3300046530 | Bacteria | 2127 |
| 462 | Ga0495665_0005176 | 3300046531 | Bacteria | 7031 |
| 463 | Ga0495665_0007397 | 3300046531 | Bacteria | 5938 |
| 464 | Ga0495640_0003929 | 3300046533 | Bacteria | 11908 |
| 465 | Ga0495640_0008396 | 3300046533 | Bacteria | 8101 |
| 466 | Ga0495640_0037252 | 3300046533 | Bacteria | 3432 |
| 467 | Ga0495640_0070999 | 3300046533 | Bacteria | 2337 |
| 468 | Ga0495587_0068567 | 3300046536 | Bacteria | 2066 |
| 469 | Ga0495609_0046400 | 3300046538 | Bacteria | 1946 |
| 470 | Ga0495597_0053875 | 3300046542 | Bacteria | 1768 |
| 471 | Ga0495645_0015499 | 3300046543 | Bacteria | 5421 |
| 472 | Ga0495645_0083930 | 3300046543 | Bacteria | 2282 |
| 473 | Ga0495622_0006092 | 3300046557 | Bacteria | 5603 |
| 474 | Ga0495622_0086201 | 3300046557 | Bacteria | 1444 |
| 475 | Ga0495668_0136411 | 3300046616 | Bacteria | 1343 |
| 476 | Ga0495634_0024114 | 3300046642 | Bacteria | 4272 |
| 477 | Ga0495634_0035525 | 3300046642 | Bacteria | 3412 |
| 478 | Ga0495625_0140248 | 3300046660 | Bacteria | 1631 |
| 479 | Ga0495635_0007185 | 3300046663 | Bacteria | 7777 |
| 480 | Ga0495588_0046261 | 3300046674 | Bacteria | 2232 |
| 481 | Ga0495588_0052369 | 3300046674 | Bacteria | 2104 |
| 482 | Ga0495657_0051454 | 3300046675 | Bacteria | 2765 |
| 483 | Ga0495623_0131031 | 3300046679 | Bacteria | 1501 |
| 484 | Ga0495646_0051528 | 3300046680 | Bacteria | 2491 |
| 485 | Ga0495646_0072488 | 3300046680 | Bacteria | 2025 |
| 486 | Ga0495658_0005818 | 3300046683 | Bacteria | 6053 |
| 487 | Ga0495613_0007707 | 3300046689 | Bacteria | 8008 |
| 488 | Ga0495613_0013842 | 3300046689 | Bacteria | 5984 |
| 489 | Ga0495624_0075840 | 3300046690 | Bacteria | 2087 |
| 490 | Ga0495624_0193246 | 3300046690 | Bacteria | 1238 |
| 491 | Ga0495670_0007712 | 3300046691 | Bacteria | 5293 |
| 492 | Ga0495589_0002533 | 3300046794 | Bacteria | 10169 |
| 493 | Ga0495600_0026321 | 3300046809 | Bacteria | 3754 |
| 494 | Ga0495600_0054621 | 3300046809 | Bacteria | 2609 |
| 495 | Ga0495600_0157126 | 3300046809 | Bacteria | 1471 |
| 496 | Ga0495581_0011818 | 3300047315 | Bacteria | 5054 |
| 497 | Ga0495581_0026865 | 3300047315 | Bacteria | 3337 |
| 498 | Ga0495581_0064141 | 3300047315 | Bacteria | 2122 |
| 499 | Ga0495604_0013854 | 3300047317 | Bacteria | 6433 |
| 500 | Ga0495604_0078254 | 3300047317 | Bacteria | 2482 |
| 501 | Ga0495604_0114136 | 3300047317 | Bacteria | 1965 |
| 502 | Ga0495604_0116832 | 3300047317 | Bacteria | 1936 |
| 503 | Ga0495674_0004525 | 3300047319 | Bacteria | 13376 |
| 504 | Ga0495674_0008459 | 3300047319 | Bacteria | 9804 |
| 505 | Ga0495674_0056952 | 3300047319 | Bacteria | 3422 |
| 506 | Ga0495672_0027522 | 3300047320 | Bacteria | 3611 |
| 507 | Ga0495685_013142 | 3300047447 | Bacteria | 2808 |
| 508 | Ga0495684_0015794 | 3300047471 | Bacteria | 5811 |
| 509 | Ga0495684_0028441 | 3300047471 | Bacteria | 4292 |
| 510 | Ga0495686_0001093 | 3300047472 | Bacteria | 32230 |
| 511 | Ga0495686_0092699 | 3300047472 | Bacteria | 1832 |
| 512 | Ga0495686_0105256 | 3300047472 | Bacteria | 1698 |
| 513 | Ga0495686_0172363 | 3300047472 | Bacteria | 1258 |
| 514 | Ga0495593_0008449 | 3300047673 | Bacteria | 5987 |
| 515 | Ga0495593_0038320 | 3300047673 | Bacteria | 2589 |
| 516 | Ga0495593_0094788 | 3300047673 | Bacteria | 1535 |
| 517 | Ga0495602_0023629 | 3300048088 | Bacteria | 5985 |
| 518 | Ga0495602_0128040 | 3300048088 | Bacteria | 2030 |
| 519 | Ga0496100_0010201 | 3300048903 | Bacteria | 5312 |
| 520 | Ga0496100_0027311 | 3300048903 | Bacteria | 3510 |
| 521 | Ga0496100_0113077 | 3300048903 | Bacteria | 1889 |
| 522 | Ga0496101_0002052 | 3300048904 | Bacteria | 12255 |
| 523 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 524 | Ga0496102_0015129 | 3300048905 | Bacteria | 6717 |
| 525 | Ga0496102_0276628 | 3300048905 | Bacteria | 1582 |
| 526 | Ga0496103_0005699 | 3300048906 | Bacteria | 7445 |
| 527 | Ga0496103_0020532 | 3300048906 | Bacteria | 3969 |
| 528 | Ga0496104_0037726 | 3300048907 | Bacteria | 4518 |
| 529 | Ga0496104_0048391 | 3300048907 | Bacteria | 4009 |
| 530 | Ga0496104_0066770 | 3300048907 | Bacteria | 3415 |
| 531 | Ga0496105_0011039 | 3300048908 | Bacteria | 7120 |
| 532 | Ga0496105_0042795 | 3300048908 | Bacteria | 3734 |
| 533 | Ga0496106_0002858 | 3300048909 | Bacteria | 12824 |
| 534 | Ga0496106_0037996 | 3300048909 | Bacteria | 3602 |
| 535 | Ga0496106_0069924 | 3300048909 | Bacteria | 2680 |
| 536 | Ga0496107_0002387 | 3300048910 | Bacteria | 12152 |
| 537 | Ga0496107_0034319 | 3300048910 | Bacteria | 3634 |
| 538 | Ga0496107_0145214 | 3300048910 | Bacteria | 1754 |
| 539 | Ga0496107_0213740 | 3300048910 | Bacteria | 1434 |
| 540 | Ga0496108_0016020 | 3300048911 | Bacteria | 6111 |
| 541 | Ga0496109_0007060 | 3300048912 | Bacteria | 9476 |
| 542 | Ga0496110_0015025 | 3300048913 | Bacteria | 6438 |
| 543 | Ga0496110_0111226 | 3300048913 | Bacteria | 2462 |
| 544 | Ga0496111_0035529 | 3300048914 | Bacteria | 3562 |
| 545 | Ga0496112_0042097 | 3300048915 | Bacteria | 4469 |
| 546 | Ga0496113_0206442 | 3300048916 | Bacteria | 1563 |
| 547 | Ga0496114_0111205 | 3300048917 | Bacteria | 2347 |
| 548 | Ga0496114_0253233 | 3300048917 | Bacteria | 1549 |
| 549 | Ga0496115_0000535 | 3300048918 | Bacteria | 29580 |
| 550 | Ga0496115_0011938 | 3300048918 | Bacteria | 6524 |
| 551 | Ga0496115_0018795 | 3300048918 | Bacteria | 5312 |
| 552 | Ga0496116_0043047 | 3300048919 | Bacteria | 3080 |
| 553 | Ga0496117_0081608 | 3300048920 | Bacteria | 2121 |
| 554 | Ga0496117_0130469 | 3300048920 | Bacteria | 1524 |
| 555 | Ga0496118_0020073 | 3300048921 | Bacteria | 5942 |
| 556 | Ga0496118_0043574 | 3300048921 | Bacteria | 3525 |
| 557 | Ga0496119_0007752 | 3300048922 | Bacteria | 9586 |
| 558 | Ga0496119_0068576 | 3300048922 | Bacteria | 2088 |
| 559 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 560 | Ga0496121_0007034 | 3300048924 | Bacteria | 13662 |
| 561 | Ga0496121_0013403 | 3300048924 | Bacteria | 8814 |
| 562 | Ga0496121_0016583 | 3300048924 | Bacteria | 7595 |
| 563 | Ga0496121_0025042 | 3300048924 | Bacteria | 5681 |
| 564 | Ga0496121_0064434 | 3300048924 | Bacteria | 2988 |
| 565 | Ga0496121_0066215 | 3300048924 | Bacteria | 2935 |
| 566 | Ga0496121_0068552 | 3300048924 | Bacteria | 2869 |
| 567 | Ga0496121_0133432 | 3300048924 | Bacteria | 1854 |
| 568 | Ga0496122_0037590 | 3300048925 | Bacteria | 3894 |
| 569 | Ga0496122_0178105 | 3300048925 | Bacteria | 1272 |
| 570 | Ga0496123_0016263 | 3300048926 | Bacteria | 6051 |
| 571 | Ga0496124_0095175 | 3300048927 | Bacteria | 2421 |
| 572 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 573 | Ga0496125_0004755 | 3300048928 | Bacteria | 15477 |
| 574 | Ga0496125_0047371 | 3300048928 | Bacteria | 3596 |
| 575 | Ga0496126_0002483 | 3300048929 | Bacteria | 24817 |
| 576 | Ga0496126_0005712 | 3300048929 | Bacteria | 14100 |
| 577 | Ga0496126_0006690 | 3300048929 | Bacteria | 12809 |
| 578 | Ga0496126_0015906 | 3300048929 | Bacteria | 7553 |
| 579 | Ga0496126_0019903 | 3300048929 | Bacteria | 6598 |
| 580 | Ga0496126_0043030 | 3300048929 | Bacteria | 4169 |
| 581 | Ga0496126_0060499 | 3300048929 | Bacteria | 3405 |
| 582 | Ga0496126_0064515 | 3300048929 | Bacteria | 3280 |
| 583 | Ga0496126_0084206 | 3300048929 | Bacteria | 2805 |
| 584 | Ga0496126_0216878 | 3300048929 | Bacteria | 1609 |
| 585 | Ga0496126_0341011 | 3300048929 | Bacteria | 1227 |
| 586 | Ga0495682_0026810 | 3300049460 | Bacteria | 2138 |
| 587 | Ga0501034_0000533 | 3300049571 | Bacteria | 60463 |
| 588 | Ga0501034_0040217 | 3300049571 | Bacteria | 4734 |
| 589 | Ga0501072_0004798 | 3300049588 | Bacteria | 10299 |
| 590 | Ga0501083_0024160 | 3300049744 | Bacteria | 4213 |
| 591 | Ga0501035_0152223 | 3300049822 | Bacteria | 2007 |
| 592 | nmdc:mga0yw44_15006_c1 | 3300050492 | Bacteria | 4135 |
| 593 | nmdc:mga0yw44_35778_c1 | 3300050492 | Bacteria | 2921 |
| 594 | nmdc:mga0k408_77126_c1 | 3300050493 | Bacteria | 1948 |
| 595 | nmdc:mga06z11_136648_c1 | 3300050494 | Bacteria | 1381 |
| 596 | nmdc:mga06z11_4857_c1 | 3300050494 | Bacteria | 5325 |
| 597 | nmdc:mga07m45_745_c1 | 3300050496 | Bacteria | 13914 |
| 598 | Ga0500635_0004481 | 3300053080 | Bacteria | 3603 |
| 599 | Ga0495595_0102635 | 3300053084 | Bacteria | 1381 |
| 600 | Ga0495619_0009769 | 3300053085 | Bacteria | 6050 |
| 601 | Ga0495619_0018295 | 3300053085 | Bacteria | 4446 |
| 602 | Ga0500566_0000158 | 3300053094 | Bacteria | 34495 |
| 603 | Ga0500566_0013617 | 3300053094 | Bacteria | 4783 |
| 604 | Ga0500640_000568 | 3300053095 | Bacteria | 9480 |
| 605 | Ga0500554_000804 | 3300053102 | Bacteria | 6184 |
| 606 | Ga0500554_001364 | 3300053102 | Bacteria | 4725 |
| 607 | Ga0500562_013148 | 3300053108 | Bacteria | 2110 |
| 608 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 609 | Ga0500572_000858 | 3300053111 | Bacteria | 9461 |
| 610 | Ga0500591_027635 | 3300053115 | Bacteria | 2747 |
| 611 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 612 | Ga0500595_000537 | 3300053119 | Bacteria | 22809 |
| 613 | Ga0500595_001188 | 3300053119 | Bacteria | 14372 |
| 614 | Ga0500595_003127 | 3300053119 | Bacteria | 7841 |
| 615 | Ga0500595_005685 | 3300053119 | Bacteria | 5413 |
| 616 | Ga0500595_014349 | 3300053119 | Bacteria | 3007 |
| 617 | Ga0500608_001300 | 3300053122 | Bacteria | 8888 |
| 618 | Ga0500608_033147 | 3300053122 | Bacteria | 2457 |
| 619 | Ga0500642_0007066 | 3300053130 | Bacteria | 3748 |
| 620 | Ga0500559_0001379 | 3300053136 | Bacteria | 13865 |
| 621 | Ga0500559_0003877 | 3300053136 | Bacteria | 7232 |
| 622 | Ga0500603_000465 | 3300053150 | Bacteria | 10412 |
| 623 | Ga0500603_000902 | 3300053150 | Bacteria | 7046 |
| 624 | Ga0500603_007453 | 3300053150 | Bacteria | 2403 |
| 625 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 626 | Ga0500616_0043984 | 3300053153 | Bacteria | 2385 |
| 627 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 628 | Ga0500638_001161 | 3300053162 | Bacteria | 7913 |
| 629 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 630 | Ga0500639_021288 | 3300053163 | Bacteria | 3426 |
| 631 | Ga0500636_0000365 | 3300053177 | Bacteria | 24884 |
| 632 | Ga0500636_0012352 | 3300053177 | Bacteria | 5005 |
| 633 | Ga0500636_0113358 | 3300053177 | Bacteria | 1529 |
| 634 | Ga0500636_0121323 | 3300053177 | Bacteria | 1466 |
| 635 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 636 | Ga0500637_0008272 | 3300053178 | Bacteria | 5236 |
| 637 | Ga0500637_0063515 | 3300053178 | Bacteria | 2117 |
| 638 | Ga0500625_078487 | 3300053729 | Bacteria | 1448 |
| 639 | Ga0500645_006583 | 3300053730 | Bacteria | 4126 |
| 640 | Ga0500552_002567 | 3300053733 | Bacteria | 1782 |
| 641 | Ga0500601_000203 | 3300053737 | Bacteria | 12048 |
| 642 | Ga0500661_000056 | 3300055283 | Bacteria | 17736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10071640 | Ga0157378_100716403 | 337 |
| 2 | 3300047673 | Ga0495593_0094788 | Ga0495593_0094788_12_1124 | 339 |
| 3 | 3300025913 | Ga0207695_10060686 | Ga0207695_100606862 | 340 |
| 4 | 3300048922 | Ga0496119_0068576 | Ga0496119_0068576_26_1138 | 340 |
| 5 | 3300005563 | Ga0068855_100010865 | Ga0068855_1000108656 | 341 |
| 6 | 3300013104 | Ga0157370_10014947 | Ga0157370_100149473 | 341 |
| 7 | 3300025921 | Ga0207652_10011695 | Ga0207652_100116958 | 341 |
| 8 | 3300039438 | Ga0436360_0411669 | Ga0436360_0411669_275_1360 | 341 |
| 9 | 3300039447 | Ga0436361_0194339 | Ga0436361_0194339_1643_2728 | 341 |
| 10 | 3300039453 | Ga0436362_0305717 | Ga0436362_0305717_314_1399 | 341 |
| 11 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_21076_22221 | 341 |
| 12 | 3300044765 | Ga0466970_0178105 | Ga0466970_0178105_74_1168 | 343 |
| 13 | 3300025261 | Ga0209233_1002384 | Ga0209233_10023842 | 344 |
| 14 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002157 | 344 |
| 15 | 3300048910 | Ga0496107_0213740 | Ga0496107_0213740_274_1419 | 344 |
| 16 | iso_pu_bacteria | 2842333319 | 2842333970 | 344 |
| 17 | 3300021388 | Ga0213875_10007684 | Ga0213875_100076843 | 346 |
| 18 | 3300046809 | Ga0495600_0157126 | Ga0495600_0157126_308_1408 | 346 |
| 19 | 3300048924 | Ga0496121_0066215 | Ga0496121_0066215_1078_2223 | 346 |
| 20 | 3300048929 | Ga0496126_0084206 | Ga0496126_0084206_794_1894 | 348 |
| 21 | 3300049571 | Ga0501034_0000533 | Ga0501034_0000533_33706_34821 | 349 |
| 22 | 3300049588 | Ga0501072_0004798 | Ga0501072_0004798_4801_5916 | 349 |
| 23 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_157054_158190 | 349 |
| 24 | 3300007265 | Ga0099794_10026075 | Ga0099794_100260752 | 350 |
| 25 | 3300007265 | Ga0099794_10037632 | Ga0099794_100376322 | 350 |
| 26 | 3300027671 | Ga0209588_1002539 | Ga0209588_10025395 | 350 |
| 27 | 3300046455 | Ga0495603_0067385 | Ga0495603_0067385_286_1434 | 350 |
| 28 | 3300046473 | Ga0495582_0036637 | Ga0495582_0036637_118_1266 | 350 |
| 29 | 3300046475 | Ga0495639_0000544 | Ga0495639_0000544_16330_17478 | 350 |
| 30 | 3300046557 | Ga0495622_0086201 | Ga0495622_0086201_88_1236 | 350 |
| 31 | 3300047315 | Ga0495581_0064141 | Ga0495581_0064141_566_1714 | 350 |
| 32 | 3300007265 | Ga0099794_10030124 | Ga0099794_100301242 | 351 |
| 33 | 3300025915 | Ga0207693_10123079 | Ga0207693_101230791 | 351 |
| 34 | 3300039450 | Ga0436363_0555717 | Ga0436363_0555717_32_1144 | 351 |
| 35 | 3300046524 | Ga0495648_0019888 | Ga0495648_0019888_2364_3509 | 351 |
| 36 | 3300048920 | Ga0496117_0130469 | Ga0496117_0130469_87_1232 | 351 |
| 37 | 3300048924 | Ga0496121_0007034 | Ga0496121_0007034_992_2137 | 351 |
| 38 | 3300048924 | Ga0496121_0068552 | Ga0496121_0068552_580_1728 | 351 |
| 39 | 3300048928 | Ga0496125_0004755 | Ga0496125_0004755_14192_15340 | 351 |
| 40 | 3300048929 | Ga0496126_0341011 | Ga0496126_0341011_52_1200 | 351 |
| 41 | 3300050494 | nmdc:mga06z11_136648_c1 | nmdc:mga06z11_136648_c1_42_1190 | 351 |
| 42 | 3300053119 | Ga0500595_003127 | Ga0500595_003127_3688_4833 | 351 |
| 43 | 3300053119 | Ga0500595_005685 | Ga0500595_005685_1521_2666 | 351 |
| 44 | 3300053130 | Ga0500642_0007066 | Ga0500642_0007066_916_2061 | 351 |
| 45 | 3300005437 | Ga0070710_10197423 | Ga0070710_101974231 | 352 |
| 46 | 3300005536 | Ga0070697_100040370 | Ga0070697_1000403702 | 352 |
| 47 | 3300009101 | Ga0105247_10014337 | Ga0105247_100143373 | 352 |
| 48 | 3300009177 | Ga0105248_10029925 | Ga0105248_100299253 | 352 |
| 49 | 3300011119 | Ga0105246_10094733 | Ga0105246_100947332 | 352 |
| 50 | 3300013296 | Ga0157374_10386324 | Ga0157374_103863242 | 352 |
| 51 | 3300013306 | Ga0163162_10080658 | Ga0163162_100806583 | 352 |
| 52 | 3300013308 | Ga0157375_10029609 | Ga0157375_100296093 | 352 |
| 53 | 3300014969 | Ga0157376_10027760 | Ga0157376_100277604 | 352 |
| 54 | 3300025928 | Ga0207700_10095119 | Ga0207700_100951192 | 352 |
| 55 | 3300025929 | Ga0207664_10215110 | Ga0207664_102151102 | 352 |
| 56 | 3300026095 | Ga0207676_10386425 | Ga0207676_103864252 | 352 |
| 57 | 3300046507 | Ga0495606_0001386 | Ga0495606_0001386_29305_30417 | 352 |
| 58 | 3300048929 | Ga0496126_0019903 | Ga0496126_0019903_4987_6099 | 352 |
| 59 | 3300049822 | Ga0501035_0152223 | Ga0501035_0152223_429_1583 | 352 |
| 60 | 3300053085 | Ga0495619_0018295 | Ga0495619_0018295_2144_3256 | 352 |
| 61 | 3300005334 | Ga0068869_100051041 | Ga0068869_1000510412 | 353 |
| 62 | 3300005339 | Ga0070660_100182949 | Ga0070660_1001829492 | 353 |
| 63 | 3300005366 | Ga0070659_100138531 | Ga0070659_1001385312 | 353 |
| 64 | 3300005518 | Ga0070699_100025383 | Ga0070699_1000253835 | 353 |
| 65 | 3300005539 | Ga0068853_100043705 | Ga0068853_1000437052 | 353 |
| 66 | 3300005563 | Ga0068855_100059992 | Ga0068855_1000599924 | 353 |
| 67 | 3300005614 | Ga0068856_100062929 | Ga0068856_1000629292 | 353 |
| 68 | 3300009098 | Ga0105245_10251088 | Ga0105245_102510881 | 353 |
| 69 | 3300013105 | Ga0157369_10416234 | Ga0157369_104162341 | 353 |
| 70 | 3300025906 | Ga0207699_10066770 | Ga0207699_100667702 | 353 |
| 71 | 3300025911 | Ga0207654_10013541 | Ga0207654_100135414 | 353 |
| 72 | 3300025917 | Ga0207660_10094449 | Ga0207660_100944492 | 353 |
| 73 | 3300025923 | Ga0207681_10132220 | Ga0207681_101322202 | 353 |
| 74 | 3300025932 | Ga0207690_10085073 | Ga0207690_100850732 | 353 |
| 75 | 3300025945 | Ga0207679_10113969 | Ga0207679_101139692 | 353 |
| 76 | 3300026116 | Ga0207674_10070422 | Ga0207674_100704222 | 353 |
| 77 | 3300028380 | Ga0268265_10134138 | Ga0268265_101341381 | 353 |
| 78 | 3300005354 | Ga0070675_100251073 | Ga0070675_1002510731 | 354 |
| 79 | 3300005356 | Ga0070674_100129017 | Ga0070674_1001290172 | 354 |
| 80 | 3300005367 | Ga0070667_100225055 | Ga0070667_1002250552 | 354 |
| 81 | 3300005459 | Ga0068867_100104229 | Ga0068867_1001042291 | 354 |
| 82 | 3300005548 | Ga0070665_100321397 | Ga0070665_1003213972 | 354 |
| 83 | 3300005617 | Ga0068859_100018883 | Ga0068859_1000188835 | 354 |
| 84 | 3300005841 | Ga0068863_100081423 | Ga0068863_1000814232 | 354 |
| 85 | 3300005842 | Ga0068858_100006733 | Ga0068858_1000067337 | 354 |
| 86 | 3300005843 | Ga0068860_100166205 | Ga0068860_1001662052 | 354 |
| 87 | 3300006237 | Ga0097621_100010946 | Ga0097621_1000109462 | 354 |
| 88 | 3300006358 | Ga0068871_100005345 | Ga0068871_1000053454 | 354 |
| 89 | 3300006847 | Ga0075431_100142152 | Ga0075431_1001421521 | 354 |
| 90 | 3300006881 | Ga0068865_100174103 | Ga0068865_1001741032 | 354 |
| 91 | 3300006931 | Ga0097620_100018883 | Ga0097620_1000188835 | 354 |
| 92 | 3300013308 | Ga0157375_10058259 | Ga0157375_100582592 | 354 |
| 93 | 3300021384 | Ga0213876_10007051 | Ga0213876_100070511 | 354 |
| 94 | 3300025937 | Ga0207669_10063791 | Ga0207669_100637912 | 354 |
| 95 | 3300025941 | Ga0207711_10049952 | Ga0207711_100499523 | 354 |
| 96 | 3300025942 | Ga0207689_10036749 | Ga0207689_100367493 | 354 |
| 97 | 3300025972 | Ga0207668_10255363 | Ga0207668_102553632 | 354 |
| 98 | 3300026035 | Ga0207703_10098778 | Ga0207703_100987782 | 354 |
| 99 | 3300026088 | Ga0207641_10111254 | Ga0207641_101112542 | 354 |
| 100 | 3300026118 | Ga0207675_100050443 | Ga0207675_1000504432 | 354 |
| 101 | 3300028379 | Ga0268266_10275747 | Ga0268266_102757472 | 354 |
| 102 | 3300028380 | Ga0268265_10055636 | Ga0268265_100556362 | 354 |
| 103 | 3300039437 | Ga0436365_0839901 | Ga0436365_0839901_884_2020 | 354 |
| 104 | 3300039447 | Ga0436361_0194339 | Ga0436361_0194339_3355_4491 | 354 |
| 105 | 3300048925 | Ga0496122_0178105 | Ga0496122_0178105_93_1247 | 354 |
| 106 | 3300049744 | Ga0501083_0024160 | Ga0501083_0024160_388_1515 | 354 |
| 107 | 3300005330 | Ga0070690_100000207 | Ga0070690_1000002077 | 355 |
| 108 | 3300005336 | Ga0070680_100173194 | Ga0070680_1001731942 | 355 |
| 109 | 3300005340 | Ga0070689_100005554 | Ga0070689_1000055545 | 355 |
| 110 | 3300005345 | Ga0070692_10009000 | Ga0070692_100090002 | 355 |
| 111 | 3300005365 | Ga0070688_100048409 | Ga0070688_1000484092 | 355 |
| 112 | 3300005438 | Ga0070701_10000361 | Ga0070701_1000036114 | 355 |
| 113 | 3300005440 | Ga0070705_100004891 | Ga0070705_1000048912 | 355 |
| 114 | 3300005441 | Ga0070700_100000469 | Ga0070700_10000046917 | 355 |
| 115 | 3300005456 | Ga0070678_100012495 | Ga0070678_1000124952 | 355 |
| 116 | 3300005459 | Ga0068867_100199671 | Ga0068867_1001996712 | 355 |
| 117 | 3300005544 | Ga0070686_100001838 | Ga0070686_1000018388 | 355 |
| 118 | 3300005546 | Ga0070696_100121088 | Ga0070696_1001210881 | 355 |
| 119 | 3300005549 | Ga0070704_100021333 | Ga0070704_1000213332 | 355 |
| 120 | 3300005615 | Ga0070702_100007752 | Ga0070702_1000077524 | 355 |
| 121 | 3300005718 | Ga0068866_10000298 | Ga0068866_1000029822 | 355 |
| 122 | 3300005719 | Ga0068861_100000393 | Ga0068861_1000003934 | 355 |
| 123 | 3300005840 | Ga0068870_10003281 | Ga0068870_100032815 | 355 |
| 124 | 3300005842 | Ga0068858_100004345 | Ga0068858_1000043454 | 355 |
| 125 | 3300006237 | Ga0097621_100004050 | Ga0097621_1000040505 | 355 |
| 126 | 3300006358 | Ga0068871_100000782 | Ga0068871_10000078219 | 355 |
| 127 | 3300006881 | Ga0068865_100000084 | Ga0068865_10000008448 | 355 |
| 128 | 3300009098 | Ga0105245_10000063 | Ga0105245_10000063101 | 355 |
| 129 | 3300009148 | Ga0105243_10001155 | Ga0105243_100011554 | 355 |
| 130 | 3300009176 | Ga0105242_10003979 | Ga0105242_100039798 | 355 |
| 131 | 3300009177 | Ga0105248_10039177 | Ga0105248_100391774 | 355 |
| 132 | 3300009177 | Ga0105248_10107540 | Ga0105248_101075402 | 355 |
| 133 | 3300009553 | Ga0105249_10067760 | Ga0105249_100677604 | 355 |
| 134 | 3300013297 | Ga0157378_10001267 | Ga0157378_100012674 | 355 |
| 135 | 3300013297 | Ga0157378_10047944 | Ga0157378_100479443 | 355 |
| 136 | 3300013306 | Ga0163162_10000526 | Ga0163162_100005267 | 355 |
| 137 | 3300013306 | Ga0163162_10101697 | Ga0163162_101016972 | 355 |
| 138 | 3300014326 | Ga0157380_10010857 | Ga0157380_100108573 | 355 |
| 139 | 3300025899 | Ga0207642_10006430 | Ga0207642_100064302 | 355 |
| 140 | 3300025908 | Ga0207643_10003705 | Ga0207643_100037053 | 355 |
| 141 | 3300025927 | Ga0207687_10008928 | Ga0207687_100089282 | 355 |
| 142 | 3300025934 | Ga0207686_10004474 | Ga0207686_100044745 | 355 |
| 143 | 3300025935 | Ga0207709_10002360 | Ga0207709_100023606 | 355 |
| 144 | 3300025936 | Ga0207670_10010596 | Ga0207670_100105962 | 355 |
| 145 | 3300025941 | Ga0207711_10027328 | Ga0207711_100273282 | 355 |
| 146 | 3300025942 | Ga0207689_10000152 | Ga0207689_1000015254 | 355 |
| 147 | 3300026075 | Ga0207708_10000166 | Ga0207708_1000016647 | 355 |
| 148 | 3300026089 | Ga0207648_10000131 | Ga0207648_100001313 | 355 |
| 149 | 3300026118 | Ga0207675_100001354 | Ga0207675_10000135423 | 355 |
| 150 | 3300026121 | Ga0207683_10006827 | Ga0207683_100068278 | 355 |
| 151 | 3300026142 | Ga0207698_10196905 | Ga0207698_101969052 | 355 |
| 152 | 3300039437 | Ga0436365_0266146 | Ga0436365_0266146_137_1282 | 355 |
| 153 | 3300046455 | Ga0495603_0042416 | Ga0495603_0042416_1464_2594 | 355 |
| 154 | 3300046460 | Ga0495638_0000356 | Ga0495638_0000356_26249_27379 | 355 |
| 155 | 3300046474 | Ga0495605_0003407 | Ga0495605_0003407_7045_8175 | 355 |
| 156 | 3300046492 | Ga0495585_0017177 | Ga0495585_0017177_662_1792 | 355 |
| 157 | 3300046500 | Ga0495596_0037025 | Ga0495596_0037025_482_1612 | 355 |
| 158 | 3300046501 | Ga0495607_0030694 | Ga0495607_0030694_831_1961 | 355 |
| 159 | 3300046530 | Ga0495654_0046864 | Ga0495654_0046864_245_1375 | 355 |
| 160 | 3300046691 | Ga0495670_0007712 | Ga0495670_0007712_3952_5082 | 355 |
| 161 | 3300046794 | Ga0495589_0002533 | Ga0495589_0002533_8722_9852 | 355 |
| 162 | 3300047447 | Ga0495685_013142 | Ga0495685_013142_72_1202 | 355 |
| 163 | 3300047472 | Ga0495686_0172363 | Ga0495686_0172363_18_1148 | 355 |
| 164 | 3300048903 | Ga0496100_0113077 | Ga0496100_0113077_415_1545 | 355 |
| 165 | 3300048905 | Ga0496102_0015129 | Ga0496102_0015129_3522_4652 | 355 |
| 166 | 3300048909 | Ga0496106_0037996 | Ga0496106_0037996_433_1563 | 355 |
| 167 | 3300048918 | Ga0496115_0011938 | Ga0496115_0011938_1737_2867 | 355 |
| 168 | 3300048921 | Ga0496118_0043574 | Ga0496118_0043574_2355_3485 | 355 |
| 169 | 3300005336 | Ga0070680_100101358 | Ga0070680_1001013582 | 356 |
| 170 | 3300005458 | Ga0070681_10018290 | Ga0070681_100182905 | 356 |
| 171 | 3300005459 | Ga0068867_100034336 | Ga0068867_1000343363 | 356 |
| 172 | 3300005535 | Ga0070684_100183679 | Ga0070684_1001836791 | 356 |
| 173 | 3300005539 | Ga0068853_100005226 | Ga0068853_1000052262 | 356 |
| 174 | 3300005549 | Ga0070704_100106637 | Ga0070704_1001066372 | 356 |
| 175 | 3300005577 | Ga0068857_100014683 | Ga0068857_1000146834 | 356 |
| 176 | 3300006358 | Ga0068871_100345905 | Ga0068871_1003459051 | 356 |
| 177 | 3300010375 | Ga0105239_10049046 | Ga0105239_100490463 | 356 |
| 178 | 3300021388 | Ga0213875_10113003 | Ga0213875_101130031 | 356 |
| 179 | 3300025912 | Ga0207707_10027445 | Ga0207707_100274453 | 356 |
| 180 | 3300026041 | Ga0207639_10014520 | Ga0207639_100145202 | 356 |
| 181 | 3300026075 | Ga0207708_10010991 | Ga0207708_100109914 | 356 |
| 182 | 3300026089 | Ga0207648_10012752 | Ga0207648_100127523 | 356 |
| 183 | 3300026116 | Ga0207674_10013781 | Ga0207674_100137814 | 356 |
| 184 | 3300039447 | Ga0436361_0711176 | Ga0436361_0711176_16353_17483 | 356 |
| 185 | 3300009545 | Ga0105237_10040903 | Ga0105237_100409032 | 357 |
| 186 | 3300010375 | Ga0105239_10031510 | Ga0105239_100315103 | 357 |
| 187 | 3300025903 | Ga0207680_10026036 | Ga0207680_100260362 | 357 |
| 188 | 3300025941 | Ga0207711_10005401 | Ga0207711_100054014 | 357 |
| 189 | 3300031249 | Ga0265339_10116574 | Ga0265339_101165741 | 357 |
| 190 | 3300049571 | Ga0501034_0040217 | Ga0501034_0040217_2144_3283 | 357 |
| 191 | iso_pu_bacteria | 3003665799 | 3003672581 | 357 |
| 192 | iso_pu_bacteria | 2545555834 | 2545676621 | 358 |
| 193 | iso_pu_bacteria | 2545555834 | 2545678861 | 358 |
| 194 | iso_pu_bacteria | 2889306138 | 2889309714 | 358 |
| 195 | iso_pu_bacteria | 2902405164 | 2902406588 | 358 |
| 196 | iso_pu_bacteria | 641522639 | 641646578 | 358 |
| 197 | iso_pu_bacteria | 2508501128 | 2509149322 | 359 |
| 198 | iso_pu_bacteria | 2513237096 | 2513654066 | 359 |
| 199 | iso_pu_bacteria | 2513237098 | 2513679249 | 359 |
| 200 | iso_pu_bacteria | 2513237137 | 2513856818 | 359 |
| 201 | iso_pu_bacteria | 2513237141 | 2513891274 | 359 |
| 202 | iso_pu_bacteria | 2513237145 | 2513918406 | 359 |
| 203 | iso_pu_bacteria | 2517572143 | 2517891360 | 359 |
| 204 | iso_pu_bacteria | 2524023210 | 2524468459 | 359 |
| 205 | iso_pu_bacteria | 2524023228 | 2524538454 | 359 |
| 206 | iso_pu_bacteria | 2528768022 | 2528849003 | 359 |
| 207 | iso_pu_bacteria | 2602042107 | 2603860920 | 359 |
| 208 | iso_pu_bacteria | 2643221651 | 2644291335 | 359 |
| 209 | iso_pu_bacteria | 2667528175 | 2671118860 | 359 |
| 210 | iso_pu_bacteria | 2728368998 | 2728750072 | 359 |
| 211 | iso_pu_bacteria | 2791355197 | 2793066728 | 359 |
| 212 | iso_pu_bacteria | 2818991467 | 2819721080 | 359 |
| 213 | iso_pu_bacteria | 2824600985 | 2824606556 | 359 |
| 214 | iso_pu_bacteria | 2824609381 | 2824613027 | 359 |
| 215 | iso_pu_bacteria | 2824653114 | 2824658520 | 359 |
| 216 | iso_pu_bacteria | 2824661429 | 2824666465 | 359 |
| 217 | iso_pu_bacteria | 2824704595 | 2824710252 | 359 |
| 218 | iso_pu_bacteria | 2824753945 | 2824755960 | 359 |
| 219 | iso_pu_bacteria | 2824763712 | 2824767498 | 359 |
| 220 | iso_pu_bacteria | 2841911363 | 2841914929 | 359 |
| 221 | iso_pu_bacteria | 2841917233 | 2841920454 | 359 |
| 222 | iso_pu_bacteria | 2857524615 | 2857524628 | 359 |
| 223 | iso_pu_bacteria | 2874628541 | 2874635028 | 359 |
| 224 | iso_pu_bacteria | 2879099564 | 2879107110 | 359 |
| 225 | iso_pu_bacteria | 2885374607 | 2885374985 | 359 |
| 226 | iso_pu_bacteria | 2885383462 | 2885384040 | 359 |
| 227 | iso_pu_bacteria | 2885409591 | 2885410285 | 359 |
| 228 | iso_pu_bacteria | 2888388044 | 2888392804 | 359 |
| 229 | iso_pu_bacteria | 2888419890 | 2888425562 | 359 |
| 230 | iso_pu_bacteria | 2893066018 | 2893069149 | 359 |
| 231 | iso_pu_bacteria | 2903748898 | 2903755321 | 359 |
| 232 | iso_pu_bacteria | 2903768456 | 2903769708 | 359 |
| 233 | iso_pu_bacteria | 2904690495 | 2904691228 | 359 |
| 234 | iso_pu_bacteria | 2904699407 | 2904701314 | 359 |
| 235 | iso_pu_bacteria | 2904711408 | 2904711995 | 359 |
| 236 | iso_pu_bacteria | 2906610324 | 2906616546 | 359 |
| 237 | iso_pu_bacteria | 2906635258 | 2906635319 | 359 |
| 238 | iso_pu_bacteria | 2906660503 | 2906666864 | 359 |
| 239 | iso_pu_bacteria | 2908739725 | 2908741714 | 359 |
| 240 | iso_pu_bacteria | 2908756301 | 2908759131 | 359 |
| 241 | iso_pu_bacteria | 2919073203 | 2919078510 | 359 |
| 242 | iso_pu_bacteria | 2922425934 | 2922431434 | 359 |
| 243 | iso_pu_bacteria | 2929615660 | 2929621001 | 359 |
| 244 | iso_pu_bacteria | 2929624759 | 2929626168 | 359 |
| 245 | iso_pu_bacteria | 2932784394 | 2932784953 | 359 |
| 246 | iso_pu_bacteria | 2932809354 | 2932809985 | 359 |
| 247 | iso_pu_bacteria | 2932818245 | 2932818272 | 359 |
| 248 | iso_pu_bacteria | 2932828146 | 2932828790 | 359 |
| 249 | iso_pu_bacteria | 2933577622 | 2933583129 | 359 |
| 250 | iso_pu_bacteria | 2935616580 | 2935619790 | 359 |
| 251 | iso_pu_bacteria | 2935630451 | 2935634030 | 359 |
| 252 | iso_pu_bacteria | 2935638405 | 2935638771 | 359 |
| 253 | iso_pu_bacteria | 2935665750 | 2935666378 | 359 |
| 254 | iso_pu_bacteria | 2935675223 | 2935676576 | 359 |
| 255 | iso_pu_bacteria | 2935684952 | 2935684959 | 359 |
| 256 | iso_pu_bacteria | 2935694250 | 2935694656 | 359 |
| 257 | iso_pu_bacteria | 2935703347 | 2935703777 | 359 |
| 258 | iso_pu_bacteria | 2935713505 | 2935713512 | 359 |
| 259 | iso_pu_bacteria | 2935722832 | 2935724132 | 359 |
| 260 | iso_pu_bacteria | 2935732158 | 2935733510 | 359 |
| 261 | iso_pu_bacteria | 2935741537 | 2935742889 | 359 |
| 262 | iso_pu_bacteria | 2935750917 | 2935750924 | 359 |
| 263 | iso_pu_bacteria | 2935760218 | 2935760545 | 359 |
| 264 | iso_pu_bacteria | 2935801545 | 2935801914 | 359 |
| 265 | iso_pu_bacteria | 2935810662 | 2935810685 | 359 |
| 266 | iso_pu_bacteria | 2935827899 | 2935828265 | 359 |
| 267 | iso_pu_bacteria | 2935837841 | 2935842469 | 359 |
| 268 | iso_pu_bacteria | 2935855204 | 2935857895 | 359 |
| 269 | iso_pu_bacteria | 2935864058 | 2935868763 | 359 |
| 270 | iso_pu_bacteria | 2935873716 | 2935874178 | 359 |
| 271 | iso_pu_bacteria | 2935959822 | 2935966604 | 359 |
| 272 | iso_pu_bacteria | 2935992306 | 2935992897 | 359 |
| 273 | iso_pu_bacteria | 2936002035 | 2936002810 | 359 |
| 274 | iso_pu_bacteria | 2936037263 | 2936037895 | 359 |
| 275 | iso_pu_bacteria | 2940556831 | 2940558273 | 359 |
| 276 | iso_pu_bacteria | 2941507105 | 2941510667 | 359 |
| 277 | iso_pu_bacteria | 2941515067 | 2941518051 | 359 |
| 278 | iso_pu_bacteria | 2941523033 | 2941527078 | 359 |
| 279 | iso_pu_bacteria | 2941531003 | 2941531185 | 359 |
| 280 | iso_pu_bacteria | 2941538514 | 2941542518 | 359 |
| 281 | iso_pu_bacteria | 3005474847 | 3005481227 | 359 |
| 282 | iso_pu_bacteria | 643348564 | 643604158 | 359 |
| 283 | iso_pu_bacteria | 8006933436 | 8006939482 | 359 |
| 284 | iso_pu_bacteria | 8006973647 | 8006979232 | 359 |
| 285 | iso_pu_bacteria | 8016511872 | 8016520684 | 359 |
| 286 | iso_pu_bacteria | 8017057580 | 8017064899 | 359 |
| 287 | iso_pu_bacteria | 8019565922 | 8019575460 | 359 |
| 288 | iso_pu_bacteria | 8019576017 | 8019584275 | 359 |
| 289 | iso_pu_bacteria | 8019586578 | 8019592043 | 359 |
| 290 | iso_pu_bacteria | 8055742211 | 8055745136 | 359 |
| 291 | iso_pu_bacteria | 8056681323 | 8056684831 | 359 |
| 292 | iso_pu_bacteria | 8056689827 | 8056693086 | 359 |
| 293 | 3300021384 | Ga0213876_10015648 | Ga0213876_100156483 | 360 |
| 294 | 3300005355 | Ga0070671_100166109 | Ga0070671_1001661091 | 361 |
| 295 | 3300005356 | Ga0070674_100011306 | Ga0070674_1000113061 | 361 |
| 296 | 3300005434 | Ga0070709_10109435 | Ga0070709_101094351 | 361 |
| 297 | 3300005435 | Ga0070714_100118970 | Ga0070714_1001189702 | 361 |
| 298 | 3300005437 | Ga0070710_10007564 | Ga0070710_100075643 | 361 |
| 299 | 3300005439 | Ga0070711_100030771 | Ga0070711_1000307713 | 361 |
| 300 | 3300005457 | Ga0070662_100052429 | Ga0070662_1000524293 | 361 |
| 301 | 3300005545 | Ga0070695_100130261 | Ga0070695_1001302612 | 361 |
| 302 | 3300005546 | Ga0070696_100150471 | Ga0070696_1001504712 | 361 |
| 303 | 3300005718 | Ga0068866_10005233 | Ga0068866_100052335 | 361 |
| 304 | 3300005843 | Ga0068860_100223015 | Ga0068860_1002230151 | 361 |
| 305 | 3300006163 | Ga0070715_10007578 | Ga0070715_100075782 | 361 |
| 306 | 3300006173 | Ga0070716_100008237 | Ga0070716_1000082373 | 361 |
| 307 | 3300006175 | Ga0070712_100018815 | Ga0070712_1000188153 | 361 |
| 308 | 3300006881 | Ga0068865_100143700 | Ga0068865_1001437001 | 361 |
| 309 | 3300007265 | Ga0099794_10013294 | Ga0099794_100132943 | 361 |
| 310 | 3300009176 | Ga0105242_10015686 | Ga0105242_100156865 | 361 |
| 311 | 3300009553 | Ga0105249_10022766 | Ga0105249_100227662 | 361 |
| 312 | 3300013297 | Ga0157378_10202534 | Ga0157378_102025342 | 361 |
| 313 | 3300013306 | Ga0163162_10017979 | Ga0163162_100179793 | 361 |
| 314 | 3300017792 | Ga0163161_10013681 | Ga0163161_100136816 | 361 |
| 315 | 3300025915 | Ga0207693_10017378 | Ga0207693_100173783 | 361 |
| 316 | 3300025929 | Ga0207664_10173003 | Ga0207664_101730032 | 361 |
| 317 | 3300025934 | Ga0207686_10008261 | Ga0207686_100082616 | 361 |
| 318 | 3300025937 | Ga0207669_10019350 | Ga0207669_100193501 | 361 |
| 319 | 3300025939 | Ga0207665_10084398 | Ga0207665_100843982 | 361 |
| 320 | 3300025972 | Ga0207668_10025027 | Ga0207668_100250272 | 361 |
| 321 | 3300028381 | Ga0268264_10206852 | Ga0268264_102068521 | 361 |
| 322 | 3300046459 | Ga0495629_0055657 | Ga0495629_0055657_1582_2724 | 361 |
| 323 | 3300046516 | Ga0495628_0009755 | Ga0495628_0009755_4455_5597 | 361 |
| 324 | 3300046517 | Ga0495630_0044051 | Ga0495630_0044051_605_1747 | 361 |
| 325 | 3300046524 | Ga0495648_0000936 | Ga0495648_0000936_29057_30202 | 361 |
| 326 | 3300046533 | Ga0495640_0070999 | Ga0495640_0070999_959_2101 | 361 |
| 327 | 3300046536 | Ga0495587_0068567 | Ga0495587_0068567_597_1739 | 361 |
| 328 | 3300046543 | Ga0495645_0015499 | Ga0495645_0015499_3978_5120 | 361 |
| 329 | 3300047317 | Ga0495604_0078254 | Ga0495604_0078254_973_2115 | 361 |
| 330 | 3300048903 | Ga0496100_0010201 | Ga0496100_0010201_416_1567 | 361 |
| 331 | 3300048910 | Ga0496107_0145214 | Ga0496107_0145214_183_1334 | 361 |
| 332 | 3300048917 | Ga0496114_0253233 | Ga0496114_0253233_94_1245 | 361 |
| 333 | 3300048918 | Ga0496115_0018795 | Ga0496115_0018795_4101_5252 | 361 |
| 334 | 3300048929 | Ga0496126_0216878 | Ga0496126_0216878_419_1561 | 361 |
| 335 | 3300053150 | Ga0500603_007453 | Ga0500603_007453_299_1444 | 361 |
| 336 | 3300005336 | Ga0070680_100095809 | Ga0070680_1000958091 | 362 |
| 337 | 3300005337 | Ga0070682_100039753 | Ga0070682_1000397532 | 362 |
| 338 | 3300005436 | Ga0070713_100036700 | Ga0070713_1000367003 | 362 |
| 339 | 3300005436 | Ga0070713_100099861 | Ga0070713_1000998612 | 362 |
| 340 | 3300005437 | Ga0070710_10013736 | Ga0070710_100137361 | 362 |
| 341 | 3300005458 | Ga0070681_10056849 | Ga0070681_100568492 | 362 |
| 342 | 3300005530 | Ga0070679_100009864 | Ga0070679_1000098645 | 362 |
| 343 | 3300005530 | Ga0070679_100017715 | Ga0070679_1000177153 | 362 |
| 344 | 3300005577 | Ga0068857_100067452 | Ga0068857_1000674523 | 362 |
| 345 | 3300006175 | Ga0070712_100008500 | Ga0070712_1000085003 | 362 |
| 346 | 3300009093 | Ga0105240_10250952 | Ga0105240_102509522 | 362 |
| 347 | 3300009174 | Ga0105241_10083123 | Ga0105241_100831232 | 362 |
| 348 | 3300009551 | Ga0105238_10035145 | Ga0105238_100351453 | 362 |
| 349 | 3300009551 | Ga0105238_10270458 | Ga0105238_102704582 | 362 |
| 350 | 3300013105 | Ga0157369_10041431 | Ga0157369_100414315 | 362 |
| 351 | 3300013296 | Ga0157374_10023179 | Ga0157374_100231793 | 362 |
| 352 | 3300025912 | Ga0207707_10002868 | Ga0207707_100028687 | 362 |
| 353 | 3300025915 | Ga0207693_10099089 | Ga0207693_100990892 | 362 |
| 354 | 3300025916 | Ga0207663_10003400 | Ga0207663_100034007 | 362 |
| 355 | 3300025921 | Ga0207652_10009155 | Ga0207652_100091553 | 362 |
| 356 | 3300025928 | Ga0207700_10083561 | Ga0207700_100835612 | 362 |
| 357 | 3300025949 | Ga0207667_10034874 | Ga0207667_100348744 | 362 |
| 358 | 3300025949 | Ga0207667_10153242 | Ga0207667_101532422 | 362 |
| 359 | 3300026116 | Ga0207674_10151454 | Ga0207674_101514542 | 362 |
| 360 | 3300031235 | Ga0265330_10067773 | Ga0265330_100677732 | 362 |
| 361 | 3300031241 | Ga0265325_10027647 | Ga0265325_100276472 | 362 |
| 362 | 3300031250 | Ga0265331_10042854 | Ga0265331_100428541 | 362 |
| 363 | 3300035083 | Ga0373926_0007554 | Ga0373926_0007554_417_1562 | 362 |
| 364 | 3300035120 | Ga0373957_0069054 | Ga0373957_0069054_51_1196 | 362 |
| 365 | 3300035170 | Ga0373943_0040178 | Ga0373943_0040178_315_1460 | 362 |
| 366 | 3300035410 | Ga0373924_0022355 | Ga0373924_0022355_600_1745 | 362 |
| 367 | 3300035692 | Ga0373935_0060625 | Ga0373935_0060625_420_1565 | 362 |
| 368 | 3300035695 | Ga0373927_0014717 | Ga0373927_0014717_1089_2234 | 362 |
| 369 | 3300035695 | Ga0373927_0049560 | Ga0373927_0049560_949_2094 | 362 |
| 370 | 3300036401 | Ga0373937_0027665 | Ga0373937_0027665_2832_3977 | 362 |
| 371 | 3300036401 | Ga0373937_0041387 | Ga0373937_0041387_1305_2450 | 362 |
| 372 | 3300037068 | Ga0373925_0025108 | Ga0373925_0025108_1781_2926 | 362 |
| 373 | 3300044735 | Ga0466968_0007831 | Ga0466968_0007831_2813_3976 | 362 |
| 374 | 3300046454 | Ga0495592_0068940 | Ga0495592_0068940_264_1409 | 362 |
| 375 | 3300046455 | Ga0495603_0008150 | Ga0495603_0008150_309_1454 | 362 |
| 376 | 3300046459 | Ga0495629_0071868 | Ga0495629_0071868_851_1996 | 362 |
| 377 | 3300046472 | Ga0495580_0010268 | Ga0495580_0010268_1452_2597 | 362 |
| 378 | 3300046476 | Ga0495662_0099452 | Ga0495662_0099452_257_1402 | 362 |
| 379 | 3300046517 | Ga0495630_0029536 | Ga0495630_0029536_2655_3800 | 362 |
| 380 | 3300046531 | Ga0495665_0005176 | Ga0495665_0005176_5121_6266 | 362 |
| 381 | 3300046533 | Ga0495640_0003929 | Ga0495640_0003929_645_1790 | 362 |
| 382 | 3300046674 | Ga0495588_0052369 | Ga0495588_0052369_534_1679 | 362 |
| 383 | 3300046680 | Ga0495646_0072488 | Ga0495646_0072488_254_1399 | 362 |
| 384 | 3300046690 | Ga0495624_0075840 | Ga0495624_0075840_487_1632 | 362 |
| 385 | 3300047315 | Ga0495581_0011818 | Ga0495581_0011818_950_2095 | 362 |
| 386 | 3300047319 | Ga0495674_0004525 | Ga0495674_0004525_10871_12016 | 362 |
| 387 | 3300047320 | Ga0495672_0027522 | Ga0495672_0027522_112_1257 | 362 |
| 388 | 3300047471 | Ga0495684_0028441 | Ga0495684_0028441_3069_4214 | 362 |
| 389 | 3300047673 | Ga0495593_0038320 | Ga0495593_0038320_1187_2332 | 362 |
| 390 | 3300048916 | Ga0496113_0206442 | Ga0496113_0206442_190_1335 | 362 |
| 391 | 3300048929 | Ga0496126_0015906 | Ga0496126_0015906_4691_5836 | 362 |
| 392 | 3300053080 | Ga0500635_0004481 | Ga0500635_0004481_480_1625 | 362 |
| 393 | 3300053102 | Ga0500554_000804 | Ga0500554_000804_3961_5106 | 362 |
| 394 | 3300053150 | Ga0500603_000465 | Ga0500603_000465_3834_4979 | 362 |
| 395 | 3300053178 | Ga0500637_0008272 | Ga0500637_0008272_1338_2483 | 362 |
| 396 | 3300000549 | LJQas_1003880 | LJQas_10038802 | 363 |
| 397 | 3300003187 | JGI25151J46595_10000038 | JGI25151J46595_10000038196 | 363 |
| 398 | 3300003187 | JGI25151J46595_10000044 | JGI25151J46595_10000044165 | 363 |
| 399 | 3300003215 | JGI25153J46596_10011922 | JGI25153J46596_100119221 | 363 |
| 400 | 3300003771 | Ga0055526_1000390 | Ga0055526_100039025 | 363 |
| 401 | 3300003771 | Ga0055526_1004359 | Ga0055526_10043597 | 363 |
| 402 | 3300003775 | Ga0055524_1000035 | Ga0055524_100003572 | 363 |
| 403 | 3300005262 | Ga0065165_1002220 | Ga0065165_10022205 | 363 |
| 404 | 3300005329 | Ga0070683_100022143 | Ga0070683_1000221432 | 363 |
| 405 | 3300005335 | Ga0070666_10225926 | Ga0070666_102259261 | 363 |
| 406 | 3300005336 | Ga0070680_100292187 | Ga0070680_1002921871 | 363 |
| 407 | 3300005338 | Ga0068868_100034182 | Ga0068868_1000341825 | 363 |
| 408 | 3300005339 | Ga0070660_100019918 | Ga0070660_1000199183 | 363 |
| 409 | 3300005339 | Ga0070660_100051646 | Ga0070660_1000516464 | 363 |
| 410 | 3300005344 | Ga0070661_100178530 | Ga0070661_1001785302 | 363 |
| 411 | 3300005364 | Ga0070673_100065918 | Ga0070673_1000659183 | 363 |
| 412 | 3300005434 | Ga0070709_10000203 | Ga0070709_1000020319 | 363 |
| 413 | 3300005435 | Ga0070714_100021335 | Ga0070714_1000213354 | 363 |
| 414 | 3300005437 | Ga0070710_10002700 | Ga0070710_100027002 | 363 |
| 415 | 3300005439 | Ga0070711_100001730 | Ga0070711_1000017309 | 363 |
| 416 | 3300005439 | Ga0070711_100011047 | Ga0070711_1000110475 | 363 |
| 417 | 3300005455 | Ga0070663_100010941 | Ga0070663_1000109414 | 363 |
| 418 | 3300005455 | Ga0070663_100034586 | Ga0070663_1000345864 | 363 |
| 419 | 3300005467 | Ga0070706_100139385 | Ga0070706_1001393852 | 363 |
| 420 | 3300005468 | Ga0070707_100385593 | Ga0070707_1003855931 | 363 |
| 421 | 3300005530 | Ga0070679_100056049 | Ga0070679_1000560492 | 363 |
| 422 | 3300005535 | Ga0070684_100135289 | Ga0070684_1001352892 | 363 |
| 423 | 3300005539 | Ga0068853_100040363 | Ga0068853_1000403635 | 363 |
| 424 | 3300005539 | Ga0068853_100297183 | Ga0068853_1002971831 | 363 |
| 425 | 3300005548 | Ga0070665_100016962 | Ga0070665_1000169623 | 363 |
| 426 | 3300005548 | Ga0070665_100108533 | Ga0070665_1001085332 | 363 |
| 427 | 3300005563 | Ga0068855_100067952 | Ga0068855_1000679522 | 363 |
| 428 | 3300005564 | Ga0070664_100019919 | Ga0070664_1000199193 | 363 |
| 429 | 3300005577 | Ga0068857_100016047 | Ga0068857_1000160473 | 363 |
| 430 | 3300005578 | Ga0068854_100022014 | Ga0068854_1000220143 | 363 |
| 431 | 3300005614 | Ga0068856_100003347 | Ga0068856_1000033479 | 363 |
| 432 | 3300005618 | Ga0068864_100262416 | Ga0068864_1002624162 | 363 |
| 433 | 3300005834 | Ga0068851_10004825 | Ga0068851_100048252 | 363 |
| 434 | 3300005983 | Ga0081540_1009663 | Ga0081540_10096635 | 363 |
| 435 | 3300005983 | Ga0081540_1020917 | Ga0081540_10209174 | 363 |
| 436 | 3300006028 | Ga0070717_10070357 | Ga0070717_100703572 | 363 |
| 437 | 3300006038 | Ga0075365_10009687 | Ga0075365_100096873 | 363 |
| 438 | 3300006038 | Ga0075365_10053068 | Ga0075365_100530682 | 363 |
| 439 | 3300006048 | Ga0075363_100087469 | Ga0075363_1000874692 | 363 |
| 440 | 3300006163 | Ga0070715_10036971 | Ga0070715_100369712 | 363 |
| 441 | 3300006173 | Ga0070716_100002283 | Ga0070716_1000022836 | 363 |
| 442 | 3300006175 | Ga0070712_100231788 | Ga0070712_1002317881 | 363 |
| 443 | 3300006881 | Ga0068865_100130527 | Ga0068865_1001305272 | 363 |
| 444 | 3300006942 | Ga0099824_1007408 | Ga0099824_10074083 | 363 |
| 445 | 3300006943 | Ga0099822_1006547 | Ga0099822_100654710 | 363 |
| 446 | 3300007788 | Ga0099795_10026375 | Ga0099795_100263752 | 363 |
| 447 | 3300009093 | Ga0105240_10006298 | Ga0105240_1000629819 | 363 |
| 448 | 3300009093 | Ga0105240_10006694 | Ga0105240_100066943 | 363 |
| 449 | 3300009093 | Ga0105240_10027880 | Ga0105240_100278802 | 363 |
| 450 | 3300009093 | Ga0105240_10034221 | Ga0105240_100342211 | 363 |
| 451 | 3300009098 | Ga0105245_10028645 | Ga0105245_100286453 | 363 |
| 452 | 3300009101 | Ga0105247_10100082 | Ga0105247_101000822 | 363 |
| 453 | 3300009177 | Ga0105248_10228922 | Ga0105248_102289222 | 363 |
| 454 | 3300009545 | Ga0105237_10047694 | Ga0105237_100476943 | 363 |
| 455 | 3300009545 | Ga0105237_10058418 | Ga0105237_100584183 | 363 |
| 456 | 3300009545 | Ga0105237_10058572 | Ga0105237_100585722 | 363 |
| 457 | 3300009545 | Ga0105237_10175266 | Ga0105237_101752662 | 363 |
| 458 | 3300009551 | Ga0105238_10006294 | Ga0105238_100062942 | 363 |
| 459 | 3300009551 | Ga0105238_10017402 | Ga0105238_100174022 | 363 |
| 460 | 3300009551 | Ga0105238_10164063 | Ga0105238_101640632 | 363 |
| 461 | 3300010159 | Ga0099796_10011104 | Ga0099796_100111042 | 363 |
| 462 | 3300010159 | Ga0099796_10011436 | Ga0099796_100114362 | 363 |
| 463 | 3300010375 | Ga0105239_10001588 | Ga0105239_100015882 | 363 |
| 464 | 3300010375 | Ga0105239_10074287 | Ga0105239_100742872 | 363 |
| 465 | 3300011119 | Ga0105246_10006885 | Ga0105246_100068852 | 363 |
| 466 | 3300013104 | Ga0157370_10025078 | Ga0157370_100250783 | 363 |
| 467 | 3300013105 | Ga0157369_10021190 | Ga0157369_100211906 | 363 |
| 468 | 3300013296 | Ga0157374_10033305 | Ga0157374_100333055 | 363 |
| 469 | 3300013306 | Ga0163162_10031442 | Ga0163162_100314422 | 363 |
| 470 | 3300013306 | Ga0163162_10317323 | Ga0163162_103173232 | 363 |
| 471 | 3300013308 | Ga0157375_10009689 | Ga0157375_100096894 | 363 |
| 472 | 3300013308 | Ga0157375_10185725 | Ga0157375_101857252 | 363 |
| 473 | 3300014325 | Ga0163163_10011315 | Ga0163163_100113155 | 363 |
| 474 | 3300014325 | Ga0163163_10192425 | Ga0163163_101924251 | 363 |
| 475 | 3300014968 | Ga0157379_10077884 | Ga0157379_100778843 | 363 |
| 476 | 3300014968 | Ga0157379_10313650 | Ga0157379_103136501 | 363 |
| 477 | 3300014969 | Ga0157376_10055672 | Ga0157376_100556722 | 363 |
| 478 | 3300017792 | Ga0163161_10206783 | Ga0163161_102067831 | 363 |
| 479 | 3300021358 | Ga0213873_10008935 | Ga0213873_100089351 | 363 |
| 480 | 3300021358 | Ga0213873_10013089 | Ga0213873_100130892 | 363 |
| 481 | 3300021377 | Ga0213874_10015102 | Ga0213874_100151021 | 363 |
| 482 | 3300021384 | Ga0213876_10000749 | Ga0213876_1000074910 | 363 |
| 483 | 3300021384 | Ga0213876_10004947 | Ga0213876_100049476 | 363 |
| 484 | 3300021388 | Ga0213875_10011228 | Ga0213875_100112281 | 363 |
| 485 | 3300021441 | Ga0213871_10000276 | Ga0213871_100002765 | 363 |
| 486 | 3300025230 | Ga0209563_103620 | Ga0209563_1036203 | 363 |
| 487 | 3300025253 | Ga0209677_100141 | Ga0209677_1001413 | 363 |
| 488 | 3300025253 | Ga0209677_102457 | Ga0209677_1024572 | 363 |
| 489 | 3300025261 | Ga0209233_1002351 | Ga0209233_10023515 | 363 |
| 490 | 3300025272 | Ga0209455_1007127 | Ga0209455_10071273 | 363 |
| 491 | 3300025273 | Ga0209673_1023393 | Ga0209673_10233932 | 363 |
| 492 | 3300025291 | Ga0209675_1000905 | Ga0209675_100090517 | 363 |
| 493 | 3300025294 | Ga0209025_1000014 | Ga0209025_1000014190 | 363 |
| 494 | 3300025295 | Ga0209564_1000044 | Ga0209564_1000044256 | 363 |
| 495 | 3300025295 | Ga0209564_1000049 | Ga0209564_100004916 | 363 |
| 496 | 3300025297 | Ga0209758_1015744 | Ga0209758_10157441 | 363 |
| 497 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014623 | 363 |
| 498 | 3300025299 | Ga0209256_1000181 | Ga0209256_1000181109 | 363 |
| 499 | 3300025302 | Ga0207426_1010388 | Ga0207426_10103882 | 363 |
| 500 | 3300025898 | Ga0207692_10001651 | Ga0207692_100016517 | 363 |
| 501 | 3300025900 | Ga0207710_10071136 | Ga0207710_100711361 | 363 |
| 502 | 3300025903 | Ga0207680_10212242 | Ga0207680_102122421 | 363 |
| 503 | 3300025906 | Ga0207699_10002275 | Ga0207699_100022753 | 363 |
| 504 | 3300025910 | Ga0207684_10035847 | Ga0207684_100358473 | 363 |
| 505 | 3300025912 | Ga0207707_10000419 | Ga0207707_1000041936 | 363 |
| 506 | 3300025912 | Ga0207707_10002705 | Ga0207707_100027053 | 363 |
| 507 | 3300025913 | Ga0207695_10022984 | Ga0207695_100229849 | 363 |
| 508 | 3300025913 | Ga0207695_10048124 | Ga0207695_100481243 | 363 |
| 509 | 3300025914 | Ga0207671_10006837 | Ga0207671_100068375 | 363 |
| 510 | 3300025914 | Ga0207671_10029342 | Ga0207671_100293423 | 363 |
| 511 | 3300025914 | Ga0207671_10116185 | Ga0207671_101161852 | 363 |
| 512 | 3300025915 | Ga0207693_10058489 | Ga0207693_100584892 | 363 |
| 513 | 3300025916 | Ga0207663_10045041 | Ga0207663_100450412 | 363 |
| 514 | 3300025917 | Ga0207660_10012377 | Ga0207660_100123773 | 363 |
| 515 | 3300025919 | Ga0207657_10011308 | Ga0207657_100113083 | 363 |
| 516 | 3300025919 | Ga0207657_10046183 | Ga0207657_100461832 | 363 |
| 517 | 3300025921 | Ga0207652_10001690 | Ga0207652_1000169016 | 363 |
| 518 | 3300025924 | Ga0207694_10004974 | Ga0207694_100049742 | 363 |
| 519 | 3300025927 | Ga0207687_10084376 | Ga0207687_100843762 | 363 |
| 520 | 3300025929 | Ga0207664_10019520 | Ga0207664_100195202 | 363 |
| 521 | 3300025929 | Ga0207664_10055261 | Ga0207664_100552612 | 363 |
| 522 | 3300025933 | Ga0207706_10324269 | Ga0207706_103242691 | 363 |
| 523 | 3300025938 | Ga0207704_10063904 | Ga0207704_100639043 | 363 |
| 524 | 3300025939 | Ga0207665_10005897 | Ga0207665_100058974 | 363 |
| 525 | 3300025941 | Ga0207711_10201143 | Ga0207711_102011432 | 363 |
| 526 | 3300025944 | Ga0207661_10008213 | Ga0207661_100082134 | 363 |
| 527 | 3300025944 | Ga0207661_10218935 | Ga0207661_102189352 | 363 |
| 528 | 3300025945 | Ga0207679_10063502 | Ga0207679_100635023 | 363 |
| 529 | 3300025949 | Ga0207667_10002017 | Ga0207667_100020179 | 363 |
| 530 | 3300025981 | Ga0207640_10052890 | Ga0207640_100528903 | 363 |
| 531 | 3300026023 | Ga0207677_10005891 | Ga0207677_100058915 | 363 |
| 532 | 3300026041 | Ga0207639_10066716 | Ga0207639_100667162 | 363 |
| 533 | 3300026041 | Ga0207639_10119314 | Ga0207639_101193141 | 363 |
| 534 | 3300026067 | Ga0207678_10006479 | Ga0207678_100064797 | 363 |
| 535 | 3300026067 | Ga0207678_10031213 | Ga0207678_100312132 | 363 |
| 536 | 3300026067 | Ga0207678_10036065 | Ga0207678_100360654 | 363 |
| 537 | 3300026067 | Ga0207678_10082315 | Ga0207678_100823152 | 363 |
| 538 | 3300026078 | Ga0207702_10000548 | Ga0207702_1000054826 | 363 |
| 539 | 3300026095 | Ga0207676_10123343 | Ga0207676_101233432 | 363 |
| 540 | 3300026116 | Ga0207674_10010575 | Ga0207674_100105754 | 363 |
| 541 | 3300026118 | Ga0207675_100082798 | Ga0207675_1000827982 | 363 |
| 542 | 3300026121 | Ga0207683_10015560 | Ga0207683_100155605 | 363 |
| 543 | 3300026121 | Ga0207683_10016803 | Ga0207683_100168034 | 363 |
| 544 | 3300026142 | Ga0207698_10221318 | Ga0207698_102213181 | 363 |
| 545 | 3300026142 | Ga0207698_10232731 | Ga0207698_102327311 | 363 |
| 546 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014163 | 363 |
| 547 | 3300027361 | Ga0209489_100014 | Ga0209489_100014163 | 363 |
| 548 | 3300027363 | Ga0209700_100024 | Ga0209700_100024163 | 363 |
| 549 | 3300027512 | Ga0209179_1005504 | Ga0209179_10055042 | 363 |
| 550 | 3300027671 | Ga0209588_1039098 | Ga0209588_10390981 | 363 |
| 551 | 3300028379 | Ga0268266_10009249 | Ga0268266_100092494 | 363 |
| 552 | 3300030521 | Ga0307511_10024264 | Ga0307511_100242645 | 363 |
| 553 | 3300031235 | Ga0265330_10022974 | Ga0265330_100229742 | 363 |
| 554 | 3300031239 | Ga0265328_10030289 | Ga0265328_100302891 | 363 |
| 555 | 3300031247 | Ga0265340_10001085 | Ga0265340_100010853 | 363 |
| 556 | 3300031250 | Ga0265331_10041625 | Ga0265331_100416252 | 363 |
| 557 | 3300031251 | Ga0265327_10000236 | Ga0265327_1000023673 | 363 |
| 558 | 3300031711 | Ga0265314_10004266 | Ga0265314_100042669 | 363 |
| 559 | 3300031711 | Ga0265314_10146683 | Ga0265314_101466832 | 363 |
| 560 | 3300031712 | Ga0265342_10030008 | Ga0265342_100300082 | 363 |
| 561 | 3300031712 | Ga0265342_10070700 | Ga0265342_100707002 | 363 |
| 562 | 3300033179 | Ga0307507_10083911 | Ga0307507_100839111 | 363 |
| 563 | 3300033180 | Ga0307510_10061882 | Ga0307510_100618822 | 363 |
| 564 | 3300035086 | Ga0373934_0033359 | Ga0373934_0033359_775_1920 | 363 |
| 565 | 3300035111 | Ga0373923_0009940 | Ga0373923_0009940_1213_2358 | 363 |
| 566 | 3300035111 | Ga0373923_0083424 | Ga0373923_0083424_202_1347 | 363 |
| 567 | 3300035113 | Ga0373936_0013841 | Ga0373936_0013841_748_1893 | 363 |
| 568 | 3300035113 | Ga0373936_0017960 | Ga0373936_0017960_893_2038 | 363 |
| 569 | 3300035117 | Ga0373953_0058080 | Ga0373953_0058080_153_1298 | 363 |
| 570 | 3300035118 | Ga0373954_0000645 | Ga0373954_0000645_6830_7975 | 363 |
| 571 | 3300035170 | Ga0373943_0081606 | Ga0373943_0081606_478_1623 | 363 |
| 572 | 3300035692 | Ga0373935_0012897 | Ga0373935_0012897_3033_4178 | 363 |
| 573 | 3300035695 | Ga0373927_0045076 | Ga0373927_0045076_311_1456 | 363 |
| 574 | 3300035695 | Ga0373927_0111542 | Ga0373927_0111542_201_1346 | 363 |
| 575 | 3300035724 | Ga0373933_0003690 | Ga0373933_0003690_5111_6256 | 363 |
| 576 | 3300035724 | Ga0373933_0175570 | Ga0373933_0175570_124_1269 | 363 |
| 577 | 3300035724 | Ga0373933_0207156 | Ga0373933_0207156_35_1180 | 363 |
| 578 | 3300036401 | Ga0373937_0084598 | Ga0373937_0084598_1168_2313 | 363 |
| 579 | 3300036401 | Ga0373937_0283900 | Ga0373937_0283900_280_1425 | 363 |
| 580 | 3300037068 | Ga0373925_0031128 | Ga0373925_0031128_1923_3068 | 363 |
| 581 | 3300037068 | Ga0373925_0101482 | Ga0373925_0101482_579_1727 | 363 |
| 582 | 3300037312 | Ga0395899_0063956 | Ga0395899_0063956_1551_2696 | 363 |
| 583 | 3300037418 | Ga0395900_0082779 | Ga0395900_0082779_1397_2542 | 363 |
| 584 | 3300037418 | Ga0395900_0259525 | Ga0395900_0259525_14_1159 | 363 |
| 585 | 3300037418 | Ga0395900_0330718 | Ga0395900_0330718_98_1243 | 363 |
| 586 | 3300037466 | Ga0395898_0034204 | Ga0395898_0034204_100_1245 | 363 |
| 587 | 3300037466 | Ga0395898_0071593 | Ga0395898_0071593_860_2005 | 363 |
| 588 | 3300037471 | Ga0395905_0048596 | Ga0395905_0048596_2741_3886 | 363 |
| 589 | 3300037471 | Ga0395905_0131323 | Ga0395905_0131323_43_1188 | 363 |
| 590 | 3300037853 | Ga0436364_1009808 | Ga0436364_1009808_7691_8836 | 363 |
| 591 | 3300037853 | Ga0436364_1470735 | Ga0436364_1470735_2287_3432 | 363 |
| 592 | 3300039437 | Ga0436365_0002039 | Ga0436365_0002039_17723_18868 | 363 |
| 593 | 3300039437 | Ga0436365_0693504 | Ga0436365_0693504_71137_72282 | 363 |
| 594 | 3300039450 | Ga0436363_0322567 | Ga0436363_0322567_7317_8657 | 363 |
| 595 | 3300039450 | Ga0436363_1048610 | Ga0436363_1048610_5605_6750 | 363 |
| 596 | 3300039453 | Ga0436362_0442809 | Ga0436362_0442809_3159_4304 | 363 |
| 597 | 3300044706 | Ga0466964_0038046 | Ga0466964_0038046_519_1664 | 363 |
| 598 | 3300044842 | Ga0466957_0028471 | Ga0466957_0028471_1915_3060 | 363 |
| 599 | 3300045049 | Ga0466959_0098882 | Ga0466959_0098882_139_1287 | 363 |
| 600 | 3300045976 | Ga0466967_0205162 | Ga0466967_0205162_196_1344 | 363 |
| 601 | 3300046454 | Ga0495592_0012242 | Ga0495592_0012242_953_2098 | 363 |
| 602 | 3300046454 | Ga0495592_0022948 | Ga0495592_0022948_2742_3887 | 363 |
| 603 | 3300046455 | Ga0495603_0003836 | Ga0495603_0003836_5013_6158 | 363 |
| 604 | 3300046455 | Ga0495603_0118371 | Ga0495603_0118371_321_1466 | 363 |
| 605 | 3300046459 | Ga0495629_0000373 | Ga0495629_0000373_7335_8480 | 363 |
| 606 | 3300046459 | Ga0495629_0000862 | Ga0495629_0000862_5732_6877 | 363 |
| 607 | 3300046459 | Ga0495629_0018940 | Ga0495629_0018940_3031_4176 | 363 |
| 608 | 3300046461 | Ga0495641_0021456 | Ga0495641_0021456_123_1268 | 363 |
| 609 | 3300046462 | Ga0495651_0007091 | Ga0495651_0007091_4932_6077 | 363 |
| 610 | 3300046463 | Ga0495653_0022804 | Ga0495653_0022804_3170_4315 | 363 |
| 611 | 3300046463 | Ga0495653_0036975 | Ga0495653_0036975_211_1356 | 363 |
| 612 | 3300046471 | Ga0495650_0075469 | Ga0495650_0075469_38_1183 | 363 |
| 613 | 3300046472 | Ga0495580_0086463 | Ga0495580_0086463_753_1898 | 363 |
| 614 | 3300046472 | Ga0495580_0087209 | Ga0495580_0087209_280_1425 | 363 |
| 615 | 3300046473 | Ga0495582_0006572 | Ga0495582_0006572_402_1547 | 363 |
| 616 | 3300046475 | Ga0495639_0023871 | Ga0495639_0023871_1125_2270 | 363 |
| 617 | 3300046476 | Ga0495662_0004072 | Ga0495662_0004072_706_1851 | 363 |
| 618 | 3300046477 | Ga0495664_0025650 | Ga0495664_0025650_294_1439 | 363 |
| 619 | 3300046499 | Ga0495594_0083608 | Ga0495594_0083608_614_1759 | 363 |
| 620 | 3300046507 | Ga0495606_0019788 | Ga0495606_0019788_2819_3964 | 363 |
| 621 | 3300046507 | Ga0495606_0102246 | Ga0495606_0102246_97_1242 | 363 |
| 622 | 3300046511 | Ga0495608_0018583 | Ga0495608_0018583_3627_4772 | 363 |
| 623 | 3300046514 | Ga0495618_0027852 | Ga0495618_0027852_2306_3451 | 363 |
| 624 | 3300046516 | Ga0495628_0042488 | Ga0495628_0042488_1749_2894 | 363 |
| 625 | 3300046517 | Ga0495630_0011058 | Ga0495630_0011058_4766_5911 | 363 |
| 626 | 3300046529 | Ga0495652_0023315 | Ga0495652_0023315_3966_5111 | 363 |
| 627 | 3300046529 | Ga0495652_0149199 | Ga0495652_0149199_480_1625 | 363 |
| 628 | 3300046531 | Ga0495665_0007397 | Ga0495665_0007397_2049_3194 | 363 |
| 629 | 3300046533 | Ga0495640_0008396 | Ga0495640_0008396_4710_5855 | 363 |
| 630 | 3300046533 | Ga0495640_0037252 | Ga0495640_0037252_619_1764 | 363 |
| 631 | 3300046538 | Ga0495609_0046400 | Ga0495609_0046400_604_1752 | 363 |
| 632 | 3300046542 | Ga0495597_0053875 | Ga0495597_0053875_584_1729 | 363 |
| 633 | 3300046543 | Ga0495645_0083930 | Ga0495645_0083930_616_1761 | 363 |
| 634 | 3300046557 | Ga0495622_0006092 | Ga0495622_0006092_2089_3234 | 363 |
| 635 | 3300046616 | Ga0495668_0136411 | Ga0495668_0136411_175_1320 | 363 |
| 636 | 3300046642 | Ga0495634_0024114 | Ga0495634_0024114_1768_2913 | 363 |
| 637 | 3300046642 | Ga0495634_0035525 | Ga0495634_0035525_1930_3075 | 363 |
| 638 | 3300046660 | Ga0495625_0140248 | Ga0495625_0140248_270_1415 | 363 |
| 639 | 3300046663 | Ga0495635_0007185 | Ga0495635_0007185_2614_3759 | 363 |
| 640 | 3300046674 | Ga0495588_0046261 | Ga0495588_0046261_26_1171 | 363 |
| 641 | 3300046675 | Ga0495657_0051454 | Ga0495657_0051454_1468_2613 | 363 |
| 642 | 3300046679 | Ga0495623_0131031 | Ga0495623_0131031_303_1448 | 363 |
| 643 | 3300046680 | Ga0495646_0051528 | Ga0495646_0051528_43_1188 | 363 |
| 644 | 3300046683 | Ga0495658_0005818 | Ga0495658_0005818_2811_3956 | 363 |
| 645 | 3300046689 | Ga0495613_0007707 | Ga0495613_0007707_1991_3136 | 363 |
| 646 | 3300046689 | Ga0495613_0013842 | Ga0495613_0013842_3606_4751 | 363 |
| 647 | 3300046690 | Ga0495624_0193246 | Ga0495624_0193246_22_1167 | 363 |
| 648 | 3300046809 | Ga0495600_0026321 | Ga0495600_0026321_2091_3236 | 363 |
| 649 | 3300046809 | Ga0495600_0054621 | Ga0495600_0054621_367_1512 | 363 |
| 650 | 3300047315 | Ga0495581_0026865 | Ga0495581_0026865_1188_2333 | 363 |
| 651 | 3300047317 | Ga0495604_0013854 | Ga0495604_0013854_4661_5806 | 363 |
| 652 | 3300047317 | Ga0495604_0114136 | Ga0495604_0114136_106_1251 | 363 |
| 653 | 3300047317 | Ga0495604_0116832 | Ga0495604_0116832_136_1281 | 363 |
| 654 | 3300047319 | Ga0495674_0008459 | Ga0495674_0008459_5749_6894 | 363 |
| 655 | 3300047319 | Ga0495674_0056952 | Ga0495674_0056952_1884_3029 | 363 |
| 656 | 3300047471 | Ga0495684_0015794 | Ga0495684_0015794_115_1260 | 363 |
| 657 | 3300047472 | Ga0495686_0001093 | Ga0495686_0001093_10507_11655 | 363 |
| 658 | 3300047472 | Ga0495686_0092699 | Ga0495686_0092699_364_1509 | 363 |
| 659 | 3300047472 | Ga0495686_0105256 | Ga0495686_0105256_258_1406 | 363 |
| 660 | 3300047673 | Ga0495593_0008449 | Ga0495593_0008449_4404_5549 | 363 |
| 661 | 3300048088 | Ga0495602_0023629 | Ga0495602_0023629_3792_4937 | 363 |
| 662 | 3300048088 | Ga0495602_0128040 | Ga0495602_0128040_73_1218 | 363 |
| 663 | 3300048903 | Ga0496100_0027311 | Ga0496100_0027311_679_1836 | 363 |
| 664 | 3300048904 | Ga0496101_0002052 | Ga0496101_0002052_3181_4338 | 363 |
| 665 | 3300048905 | Ga0496102_0001771 | Ga0496102_0001771_12277_13434 | 363 |
| 666 | 3300048905 | Ga0496102_0276628 | Ga0496102_0276628_230_1375 | 363 |
| 667 | 3300048906 | Ga0496103_0005699 | Ga0496103_0005699_3816_4973 | 363 |
| 668 | 3300048906 | Ga0496103_0020532 | Ga0496103_0020532_2392_3540 | 363 |
| 669 | 3300048907 | Ga0496104_0037726 | Ga0496104_0037726_444_1589 | 363 |
| 670 | 3300048907 | Ga0496104_0048391 | Ga0496104_0048391_1848_2996 | 363 |
| 671 | 3300048907 | Ga0496104_0066770 | Ga0496104_0066770_266_1411 | 363 |
| 672 | 3300048908 | Ga0496105_0011039 | Ga0496105_0011039_5705_6850 | 363 |
| 673 | 3300048908 | Ga0496105_0042795 | Ga0496105_0042795_845_1990 | 363 |
| 674 | 3300048909 | Ga0496106_0002858 | Ga0496106_0002858_7954_9111 | 363 |
| 675 | 3300048909 | Ga0496106_0069924 | Ga0496106_0069924_255_1400 | 363 |
| 676 | 3300048910 | Ga0496107_0002387 | Ga0496107_0002387_7957_9114 | 363 |
| 677 | 3300048910 | Ga0496107_0034319 | Ga0496107_0034319_966_2111 | 363 |
| 678 | 3300048911 | Ga0496108_0016020 | Ga0496108_0016020_3181_4338 | 363 |
| 679 | 3300048912 | Ga0496109_0007060 | Ga0496109_0007060_2546_3703 | 363 |
| 680 | 3300048913 | Ga0496110_0015025 | Ga0496110_0015025_1610_2767 | 363 |
| 681 | 3300048913 | Ga0496110_0111226 | Ga0496110_0111226_1088_2236 | 363 |
| 682 | 3300048914 | Ga0496111_0035529 | Ga0496111_0035529_1087_2244 | 363 |
| 683 | 3300048915 | Ga0496112_0042097 | Ga0496112_0042097_1088_2233 | 363 |
| 684 | 3300048917 | Ga0496114_0111205 | Ga0496114_0111205_943_2088 | 363 |
| 685 | 3300048918 | Ga0496115_0000535 | Ga0496115_0000535_21501_22658 | 363 |
| 686 | 3300048919 | Ga0496116_0043047 | Ga0496116_0043047_1316_2461 | 363 |
| 687 | 3300048920 | Ga0496117_0081608 | Ga0496117_0081608_579_1724 | 363 |
| 688 | 3300048921 | Ga0496118_0020073 | Ga0496118_0020073_2341_3486 | 363 |
| 689 | 3300048922 | Ga0496119_0007752 | Ga0496119_0007752_5788_6933 | 363 |
| 690 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_74435_75580 | 363 |
| 691 | 3300048924 | Ga0496121_0013403 | Ga0496121_0013403_4808_5953 | 363 |
| 692 | 3300048924 | Ga0496121_0016583 | Ga0496121_0016583_4760_5908 | 363 |
| 693 | 3300048924 | Ga0496121_0025042 | Ga0496121_0025042_238_1383 | 363 |
| 694 | 3300048924 | Ga0496121_0064434 | Ga0496121_0064434_826_1971 | 363 |
| 695 | 3300048924 | Ga0496121_0133432 | Ga0496121_0133432_244_1389 | 363 |
| 696 | 3300048925 | Ga0496122_0037590 | Ga0496122_0037590_1798_2952 | 363 |
| 697 | 3300048926 | Ga0496123_0016263 | Ga0496123_0016263_3716_4870 | 363 |
| 698 | 3300048927 | Ga0496124_0095175 | Ga0496124_0095175_612_1757 | 363 |
| 699 | 3300048928 | Ga0496125_0047371 | Ga0496125_0047371_1021_2166 | 363 |
| 700 | 3300048929 | Ga0496126_0002483 | Ga0496126_0002483_8380_9528 | 363 |
| 701 | 3300048929 | Ga0496126_0005712 | Ga0496126_0005712_4197_5342 | 363 |
| 702 | 3300048929 | Ga0496126_0006690 | Ga0496126_0006690_5113_6276 | 363 |
| 703 | 3300048929 | Ga0496126_0043030 | Ga0496126_0043030_2139_3284 | 363 |
| 704 | 3300048929 | Ga0496126_0060499 | Ga0496126_0060499_126_1271 | 363 |
| 705 | 3300048929 | Ga0496126_0064515 | Ga0496126_0064515_1999_3144 | 363 |
| 706 | 3300049460 | Ga0495682_0026810 | Ga0495682_0026810_386_1531 | 363 |
| 707 | 3300050492 | nmdc:mga0yw44_15006_c1 | nmdc:mga0yw44_15006_c1_2667_3812 | 363 |
| 708 | 3300050492 | nmdc:mga0yw44_35778_c1 | nmdc:mga0yw44_35778_c1_1412_2557 | 363 |
| 709 | 3300050493 | nmdc:mga0k408_77126_c1 | nmdc:mga0k408_77126_c1_331_1476 | 363 |
| 710 | 3300050494 | nmdc:mga06z11_4857_c1 | nmdc:mga06z11_4857_c1_2076_3221 | 363 |
| 711 | 3300050496 | nmdc:mga07m45_745_c1 | nmdc:mga07m45_745_c1_2267_3412 | 363 |
| 712 | 3300053084 | Ga0495595_0102635 | Ga0495595_0102635_183_1328 | 363 |
| 713 | 3300053085 | Ga0495619_0009769 | Ga0495619_0009769_4767_5912 | 363 |
| 714 | 3300053094 | Ga0500566_0000158 | Ga0500566_0000158_3609_4754 | 363 |
| 715 | 3300053094 | Ga0500566_0013617 | Ga0500566_0013617_1157_2302 | 363 |
| 716 | 3300053095 | Ga0500640_000568 | Ga0500640_000568_6621_7766 | 363 |
| 717 | 3300053102 | Ga0500554_001364 | Ga0500554_001364_1345_2490 | 363 |
| 718 | 3300053108 | Ga0500562_013148 | Ga0500562_013148_82_1230 | 363 |
| 719 | 3300053111 | Ga0500572_000024 | Ga0500572_000024_2669_3814 | 363 |
| 720 | 3300053111 | Ga0500572_000858 | Ga0500572_000858_2777_3922 | 363 |
| 721 | 3300053115 | Ga0500591_027635 | Ga0500591_027635_908_2053 | 363 |
| 722 | 3300053119 | Ga0500595_000537 | Ga0500595_000537_6040_7185 | 363 |
| 723 | 3300053119 | Ga0500595_001188 | Ga0500595_001188_3011_4159 | 363 |
| 724 | 3300053119 | Ga0500595_014349 | Ga0500595_014349_45_1190 | 363 |
| 725 | 3300053122 | Ga0500608_001300 | Ga0500608_001300_28_1173 | 363 |
| 726 | 3300053122 | Ga0500608_033147 | Ga0500608_033147_721_1866 | 363 |
| 727 | 3300053136 | Ga0500559_0001379 | Ga0500559_0001379_2620_3765 | 363 |
| 728 | 3300053136 | Ga0500559_0003877 | Ga0500559_0003877_4863_6008 | 363 |
| 729 | 3300053150 | Ga0500603_000902 | Ga0500603_000902_177_1322 | 363 |
| 730 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_73361_74509 | 363 |
| 731 | 3300053153 | Ga0500616_0043984 | Ga0500616_0043984_358_1503 | 363 |
| 732 | 3300053159 | Ga0500630_000112 | Ga0500630_000112_19512_20657 | 363 |
| 733 | 3300053162 | Ga0500638_001161 | Ga0500638_001161_2698_3843 | 363 |
| 734 | 3300053163 | Ga0500639_000040 | Ga0500639_000040_25834_26979 | 363 |
| 735 | 3300053163 | Ga0500639_021288 | Ga0500639_021288_748_1893 | 363 |
| 736 | 3300053177 | Ga0500636_0000365 | Ga0500636_0000365_14779_15924 | 363 |
| 737 | 3300053177 | Ga0500636_0012352 | Ga0500636_0012352_3539_4693 | 363 |
| 738 | 3300053177 | Ga0500636_0113358 | Ga0500636_0113358_146_1291 | 363 |
| 739 | 3300053177 | Ga0500636_0121323 | Ga0500636_0121323_10_1155 | 363 |
| 740 | 3300053178 | Ga0500637_0000042 | Ga0500637_0000042_6434_7579 | 363 |
| 741 | 3300053178 | Ga0500637_0063515 | Ga0500637_0063515_745_1893 | 363 |
| 742 | 3300053729 | Ga0500625_078487 | Ga0500625_078487_256_1401 | 363 |
| 743 | 3300053730 | Ga0500645_006583 | Ga0500645_006583_2661_3806 | 363 |
| 744 | 3300053733 | Ga0500552_002567 | Ga0500552_002567_370_1518 | 363 |
| 745 | 3300053737 | Ga0500601_000203 | Ga0500601_000203_10667_11812 | 363 |
| 746 | 3300055283 | Ga0500661_000056 | Ga0500661_000056_10368_11513 | 363 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3td9-assembly1.cif.gz_A-2 | crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution | 0.9355 | 32 | 360 |
| 4q6w-assembly1.cif.gz_A | crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid | 0.9205 | 31 | 356 |
| 4obb-assembly2.cif.gz_B | the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. | 0.914 | 31 | 357 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9107 | 31 | 357 |
| 3sg0-assembly1.cif.gz_A | the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 | 0.9084 | 32 | 356 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3td9A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9312 | 151 | 276 | 3.40.50.2300 |
| 1usiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9198 | 151 | 276 | 3.40.50.2300 |
| 4jb2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9191 | 151 | 277 | 3.40.50.2300 |
| 3hutA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9167 | 149 | 281 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9148 | 32 | 345 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847NCB7-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9717 | 29 | 205 |
|
| AF-A0A7C7DJU6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9541 | 31 | 361 |
GO:0006865
|
| AF-A9WLT8-F1-model_v4 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein | 0.9452 | 52 | 270 |
|
| AF-A0A523TX78-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9447 | 30 | 357 |
GO:0006865
GO:0016020 |
| AF-A0A2G9ZTJ8-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9437 | 115 | 276 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar