F478841

General Info

Members Datasets Scaffolds Average Seq Length
746 438 642 377

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100292187|Ga0070680_1002921871
Length 382
Sequence MTLSRRRFSAAVSAAVALPGFISRANAQGSTIKIGMCAPITGPAAEQGRYAQTGARLALDAVNKAGGVLGKKVELIIEDDQTTNPGVVLAFSKLSSQPDMVAFIGSIRSTQVHAMAPDVLKVGKPVMIGGTDPALTHMGNQWLFRFRPNDSYSGSVIADYGVNTLGKKKWAIVHSTDAFGTAGGNALATALKKLPGATVALDQGYANQSQDFTPVVLAIKQSGADVLGSYFTFENDLGVFARQLRQLGVNIPWVGSPSVVNVSALKLAGPALYGTFGVADYAEDSSPASKAYGKLYRDATKIAPDNQSSWTYDAMTILCMAINKAGKTDPAAIRAAILAVKGYAGAEGEYNFDANGDGLHGYNIVRNEKGNIVFDKHVESRS

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2643221651 Afipia sp. Root123D2 Isolate Unclassified
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2818991467 Bosea vestrisii 3192 Isolate Unclassified
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
21 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
22 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
23 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
24 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
25 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
26 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
27 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
28 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
29 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
30 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
31 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
32 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
33 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
34 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
35 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
36 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
37 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
38 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
39 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
40 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
41 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
42 2904699407
43 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
44 2906610324
45 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
46 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
47 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
48 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
49 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
50 2922425934
51 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
52 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
53 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
54 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
55 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
56 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
57 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
58 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
59 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
60 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
61 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
62 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
63 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
64 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
65 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
66 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
67 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
68 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
69 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
70 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
71 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
72 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
73 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
74 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
75 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
76 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
77 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
78 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
79 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
80 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
81 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
82 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
83 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
84 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
85 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
86 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
87 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
88 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
89 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
90 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
91 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
92 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
93 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
108 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
111 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
112 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
116 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
117 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
122 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
131 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
132 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
133 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
137 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
140 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
141 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
142 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
143 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
146 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
147 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
148 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
149 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
150 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
151 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
152 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
153 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
154 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
155 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
156 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
159 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
160 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
161 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
162 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
164 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
165 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
166 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
167 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
168 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
169 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
170 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
175 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
176 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
177 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
178 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
179 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
180 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
181 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
185 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
186 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
187 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
188 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
189 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
190 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
191 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
192 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
193 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
196 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
197 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
198 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
199 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
200 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
203 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
261 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
262 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
263 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
269 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
270 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
271 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
272 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
273 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
274 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
275 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
276 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
279 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
280 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
281 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
286 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
287 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
307 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
308 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
321 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
322 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
323 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
324 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
368 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
371 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
372 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
373 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
374 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
375 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
376 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
379 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
394 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
406 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
407 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
408 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
409 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
410 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
412 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
413 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
418 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
419 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
420 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
421 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
422 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
423 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
424 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
425 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
426 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
427 641522639 Methylobacterium sp. 4-46 Isolate Nodule
428 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
429 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
430 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
431 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
432 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
433 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
434 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
435 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
436 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
437 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
438 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.54
Metatranscriptomes 0
Isolates 13.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 10.46
Rhizoplane 4.69
Rhizosphere 64.08
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003880 3300000549 Bacteria 1979
2 JGI25151J46595_10000038 3300003187 Bacteria 180430
3 JGI25151J46595_10000044 3300003187 Bacteria 170418
4 JGI25153J46596_10011922 3300003215 Bacteria 3803
5 Ga0055526_1000390 3300003771 Bacteria 35464
6 Ga0055526_1004359 3300003771 Bacteria 8546
7 Ga0055524_1000035 3300003775 Bacteria 174636
8 Ga0065165_1002220 3300005262 Bacteria 17337
9 Ga0070683_100022143 3300005329 Bacteria 5677
10 Ga0070690_100000207 3300005330 Bacteria 30496
11 Ga0068869_100051041 3300005334 Bacteria 3000
12 Ga0070666_10225926 3300005335 Bacteria 1321
13 Ga0070680_100095809 3300005336 Bacteria 2461
14 Ga0070680_100101358 3300005336 Bacteria 2390
15 Ga0070680_100173194 3300005336 Bacteria 1817
16 Ga0070680_100292187 3300005336 Bacteria 1381
17 Ga0070682_100039753 3300005337 Bacteria 2891
18 Ga0068868_100034182 3300005338 Bacteria 3924
19 Ga0070660_100019918 3300005339 Bacteria 4923
20 Ga0070660_100051646 3300005339 Bacteria 3167
21 Ga0070660_100182949 3300005339 Bacteria 1696
22 Ga0070689_100005554 3300005340 Bacteria 8625
23 Ga0070661_100178530 3300005344 Bacteria 1615
24 Ga0070692_10009000 3300005345 Bacteria 4480
25 Ga0070675_100251073 3300005354 Bacteria 1548
26 Ga0070671_100166109 3300005355 Bacteria 1866
27 Ga0070674_100011306 3300005356 Bacteria 5430
28 Ga0070674_100129017 3300005356 Bacteria 1883
29 Ga0070673_100065918 3300005364 Bacteria 2891
30 Ga0070688_100048409 3300005365 Bacteria 2641
31 Ga0070659_100138531 3300005366 Bacteria 1980
32 Ga0070667_100225055 3300005367 Unclassified 1671
33 Ga0070709_10000203 3300005434 Bacteria 38151
34 Ga0070709_10109435 3300005434 Bacteria 1855
35 Ga0070714_100021335 3300005435 Bacteria 5301
36 Ga0070714_100118970 3300005435 Bacteria 2347
37 Ga0070713_100036700 3300005436 Bacteria 3957
38 Ga0070713_100099861 3300005436 Bacteria 2511
39 Ga0070710_10002700 3300005437 Bacteria 8432
40 Ga0070710_10007564 3300005437 Bacteria 5262
41 Ga0070710_10013736 3300005437 Bacteria 4063
42 Ga0070710_10197423 3300005437 Unclassified 1268
43 Ga0070701_10000361 3300005438 Bacteria 15132
44 Ga0070711_100001730 3300005439 Bacteria 12117
45 Ga0070711_100011047 3300005439 Bacteria 5601
46 Ga0070711_100030771 3300005439 Bacteria 3557
47 Ga0070705_100004891 3300005440 Bacteria 6526
48 Ga0070700_100000469 3300005441 Bacteria 20211
49 Ga0070663_100010941 3300005455 Bacteria 5672
50 Ga0070663_100034586 3300005455 Bacteria 3501
51 Ga0070678_100012495 3300005456 Bacteria 5282
52 Ga0070662_100052429 3300005457 Bacteria 2949
53 Ga0070681_10018290 3300005458 Bacteria 7005
54 Ga0070681_10056849 3300005458 Bacteria 3893
55 Ga0068867_100034336 3300005459 Bacteria 3676
56 Ga0068867_100104229 3300005459 Unclassified 2170
57 Ga0068867_100199671 3300005459 Bacteria 1600
58 Ga0070706_100139385 3300005467 Bacteria 2264
59 Ga0070707_100385593 3300005468 Bacteria 1361
60 Ga0070699_100025383 3300005518 Bacteria 5109
61 Ga0070679_100009864 3300005530 Bacteria 9035
62 Ga0070679_100017715 3300005530 Bacteria 6896
63 Ga0070679_100056049 3300005530 Bacteria 3926
64 Ga0070684_100135289 3300005535 Bacteria 2226
65 Ga0070684_100183679 3300005535 Bacteria 1902
66 Ga0070697_100040370 3300005536 Bacteria 3775
67 Ga0068853_100005226 3300005539 Bacteria 10155
68 Ga0068853_100040363 3300005539 Bacteria 3982
69 Ga0068853_100043705 3300005539 Bacteria 3833
70 Ga0068853_100297183 3300005539 Bacteria 1492
71 Ga0070686_100001838 3300005544 Bacteria 11840
72 Ga0070695_100130261 3300005545 Bacteria 1733
73 Ga0070696_100121088 3300005546 Bacteria 1894
74 Ga0070696_100150471 3300005546 Bacteria 1708
75 Ga0070665_100016962 3300005548 Bacteria 7302
76 Ga0070665_100108533 3300005548 Bacteria 2778
77 Ga0070665_100321397 3300005548 Bacteria 1552
78 Ga0070704_100021333 3300005549 Bacteria 4198
79 Ga0070704_100106637 3300005549 Bacteria 2123
80 Ga0068855_100010865 3300005563 Bacteria 10993
81 Ga0068855_100059992 3300005563 Bacteria 4450
82 Ga0068855_100067952 3300005563 Bacteria 4150
83 Ga0070664_100019919 3300005564 Bacteria 5522
84 Ga0068857_100014683 3300005577 Bacteria 6833
85 Ga0068857_100016047 3300005577 Bacteria 6562
86 Ga0068857_100067452 3300005577 Bacteria 3184
87 Ga0068854_100022014 3300005578 Bacteria 4334
88 Ga0068856_100003347 3300005614 Bacteria 16276
89 Ga0068856_100062929 3300005614 Bacteria 3665
90 Ga0070702_100007752 3300005615 Bacteria 5158
91 Ga0068859_100018883 3300005617 Bacteria 6927
92 Ga0068864_100262416 3300005618 Bacteria 1607
93 Ga0068866_10000298 3300005718 Bacteria 23676
94 Ga0068866_10005233 3300005718 Bacteria 5345
95 Ga0068861_100000393 3300005719 Bacteria 25233
96 Ga0068851_10004825 3300005834 Bacteria 6103
97 Ga0068870_10003281 3300005840 Bacteria 6834
98 Ga0068863_100081423 3300005841 Bacteria 3067
99 Ga0068858_100004345 3300005842 Bacteria 13913
100 Ga0068858_100006733 3300005842 Bacteria 11181
101 Ga0068860_100166205 3300005843 Bacteria 2130
102 Ga0068860_100223015 3300005843 Bacteria 1831
103 Ga0081540_1009663 3300005983 Bacteria 6629
104 Ga0081540_1020917 3300005983 Bacteria 3918
105 Ga0070717_10070357 3300006028 Bacteria 2916
106 Ga0075365_10009687 3300006038 Bacteria 5559
107 Ga0075365_10053068 3300006038 Bacteria 2684
108 Ga0075363_100087469 3300006048 Bacteria 1712
109 Ga0070715_10007578 3300006163 Bacteria 3742
110 Ga0070715_10036971 3300006163 Bacteria 2018
111 Ga0070716_100002283 3300006173 Bacteria 8826
112 Ga0070716_100008237 3300006173 Bacteria 5166
113 Ga0070712_100008500 3300006175 Bacteria 6456
114 Ga0070712_100018815 3300006175 Bacteria 4493
115 Ga0070712_100231788 3300006175 Bacteria 1467
116 Ga0097621_100004050 3300006237 Bacteria 10168
117 Ga0097621_100010946 3300006237 Bacteria 6660
118 Ga0068871_100000782 3300006358 Bacteria 21411
119 Ga0068871_100005345 3300006358 Bacteria 9003
120 Ga0068871_100345905 3300006358 Bacteria 1314
121 Ga0075431_100142152 3300006847 Bacteria 2474
122 Ga0068865_100000084 3300006881 Bacteria 50482
123 Ga0068865_100130527 3300006881 Bacteria 1882
124 Ga0068865_100143700 3300006881 Bacteria 1802
125 Ga0068865_100174103 3300006881 Bacteria 1652
126 Ga0097620_100018883 3300006931 Bacteria 6927
127 Ga0099824_1007408 3300006942 Bacteria 14551
128 Ga0099822_1006547 3300006943 Bacteria 15161
129 Ga0099794_10013294 3300007265 Bacteria 3579
130 Ga0099794_10026075 3300007265 Bacteria 2698
131 Ga0099794_10030124 3300007265 Bacteria 2532
132 Ga0099794_10037632 3300007265 Unclassified 2291
133 Ga0099795_10026375 3300007788 Bacteria 1957
134 Ga0105240_10006298 3300009093 Bacteria 17466
135 Ga0105240_10006694 3300009093 Bacteria 16895
136 Ga0105240_10027880 3300009093 Bacteria 7389
137 Ga0105240_10034221 3300009093 Bacteria 6557
138 Ga0105240_10250952 3300009093 Bacteria 2046
139 Ga0105245_10000063 3300009098 Bacteria 113377
140 Ga0105245_10028645 3300009098 Bacteria 4915
141 Ga0105245_10251088 3300009098 Bacteria 1718
142 Ga0105247_10014337 3300009101 Bacteria 4759
143 Ga0105247_10100082 3300009101 Bacteria 1852
144 Ga0105243_10001155 3300009148 Bacteria 23948
145 Ga0105241_10083123 3300009174 Bacteria 2511
146 Ga0105242_10003979 3300009176 Bacteria 11486
147 Ga0105242_10015686 3300009176 Bacteria 5886
148 Ga0105248_10029925 3300009177 Bacteria 6076
149 Ga0105248_10039177 3300009177 Bacteria 5307
150 Ga0105248_10107540 3300009177 Bacteria 3145
151 Ga0105248_10228922 3300009177 Bacteria 2092
152 Ga0105237_10040903 3300009545 Bacteria 4675
153 Ga0105237_10047694 3300009545 Bacteria 4306
154 Ga0105237_10058418 3300009545 Bacteria 3860
155 Ga0105237_10058572 3300009545 Bacteria 3855
156 Ga0105237_10175266 3300009545 Bacteria 2145
157 Ga0105238_10006294 3300009551 Bacteria 11798
158 Ga0105238_10017402 3300009551 Bacteria 7303
159 Ga0105238_10035145 3300009551 Bacteria 5096
160 Ga0105238_10164063 3300009551 Bacteria 2197
161 Ga0105238_10270458 3300009551 Bacteria 1680
162 Ga0105249_10022766 3300009553 Bacteria 5616
163 Ga0105249_10067760 3300009553 Bacteria 3289
164 Ga0099796_10011104 3300010159 Bacteria 2501
165 Ga0099796_10011436 3300010159 Bacteria 2477
166 Ga0105239_10001588 3300010375 Bacteria 30008
167 Ga0105239_10031510 3300010375 Bacteria 5830
168 Ga0105239_10049046 3300010375 Bacteria 4630
169 Ga0105239_10074287 3300010375 Bacteria 3738
170 Ga0105246_10006885 3300011119 Bacteria 6955
171 Ga0105246_10094733 3300011119 Bacteria 2160
172 Ga0157370_10014947 3300013104 Bacteria 7918
173 Ga0157370_10025078 3300013104 Bacteria 5903
174 Ga0157369_10021190 3300013105 Bacteria 7267
175 Ga0157369_10041431 3300013105 Bacteria 5027
176 Ga0157369_10416234 3300013105 Bacteria 1393
177 Ga0157374_10023179 3300013296 Bacteria 5547
178 Ga0157374_10033305 3300013296 Bacteria 4701
179 Ga0157374_10386324 3300013296 Bacteria 1395
180 Ga0157378_10001267 3300013297 Bacteria 22738
181 Ga0157378_10047944 3300013297 Bacteria 3799
182 Ga0157378_10071640 3300013297 Bacteria 3113
183 Ga0157378_10202534 3300013297 Bacteria 1878
184 Ga0163162_10000526 3300013306 Bacteria 35521
185 Ga0163162_10017979 3300013306 Bacteria 6918
186 Ga0163162_10031442 3300013306 Bacteria 5265
187 Ga0163162_10080658 3300013306 Bacteria 3322
188 Ga0163162_10101697 3300013306 Bacteria 2966
189 Ga0163162_10317323 3300013306 Bacteria 1691
190 Ga0157375_10009689 3300013308 Bacteria 8470
191 Ga0157375_10029609 3300013308 Bacteria 5152
192 Ga0157375_10058259 3300013308 Bacteria 3821
193 Ga0157375_10185725 3300013308 Bacteria 2232
194 Ga0163163_10011315 3300014325 Bacteria 8088
195 Ga0163163_10192425 3300014325 Bacteria 2088
196 Ga0157380_10010857 3300014326 Bacteria 6567
197 Ga0157379_10077884 3300014968 Bacteria 2969
198 Ga0157379_10313650 3300014968 Bacteria 1431
199 Ga0157376_10027760 3300014969 Bacteria 4491
200 Ga0157376_10055672 3300014969 Bacteria 3301
201 Ga0163161_10013681 3300017792 Bacteria 5650
202 Ga0163161_10206783 3300017792 Bacteria 1515
203 Ga0213873_10008935 3300021358 Bacteria 2064
204 Ga0213873_10013089 3300021358 Bacteria 1813
205 Ga0213874_10015102 3300021377 Bacteria 2031
206 Ga0213876_10000749 3300021384 Bacteria 22477
207 Ga0213876_10004947 3300021384 Bacteria 7370
208 Ga0213876_10007051 3300021384 Bacteria 6126
209 Ga0213876_10015648 3300021384 Bacteria 4015
210 Ga0213875_10007684 3300021388 Bacteria 5554
211 Ga0213875_10011228 3300021388 Bacteria 4462
212 Ga0213875_10113003 3300021388 Bacteria 1268
213 Ga0213871_10000276 3300021441 Bacteria 6352
214 Ga0209563_103620 3300025230 Bacteria 3147
215 Ga0209677_100141 3300025253 Bacteria 66656
216 Ga0209677_102457 3300025253 Bacteria 6950
217 Ga0209233_1002351 3300025261 Bacteria 7040
218 Ga0209233_1002384 3300025261 Bacteria 6957
219 Ga0209455_1007127 3300025272 Bacteria 3198
220 Ga0209673_1023393 3300025273 Bacteria 2105
221 Ga0209675_1000905 3300025291 Bacteria 18956
222 Ga0209025_1000014 3300025294 Bacteria 865448
223 Ga0209564_1000044 3300025295 Bacteria 381017
224 Ga0209564_1000049 3300025295 Bacteria 362075
225 Ga0209758_1015744 3300025297 Bacteria 3893
226 Ga0209256_1000014 3300025299 Bacteria 687409
227 Ga0209256_1000181 3300025299 Bacteria 123624
228 Ga0207426_1010388 3300025302 Bacteria 3614
229 Ga0207692_10001651 3300025898 Bacteria 8435
230 Ga0207642_10006430 3300025899 Bacteria 3905
231 Ga0207710_10071136 3300025900 Bacteria 1595
232 Ga0207680_10026036 3300025903 Bacteria 3236
233 Ga0207680_10212242 3300025903 Bacteria 1324
234 Ga0207699_10002275 3300025906 Bacteria 9062
235 Ga0207699_10066770 3300025906 Bacteria 2185
236 Ga0207643_10003705 3300025908 Bacteria 8218
237 Ga0207684_10035847 3300025910 Bacteria 4211
238 Ga0207654_10013541 3300025911 Bacteria 4197
239 Ga0207707_10000419 3300025912 Bacteria 44410
240 Ga0207707_10002705 3300025912 Bacteria 15850
241 Ga0207707_10002868 3300025912 Bacteria 15401
242 Ga0207707_10027445 3300025912 Bacteria 4979
243 Ga0207695_10022984 3300025913 Bacteria 7061
244 Ga0207695_10048124 3300025913 Bacteria 4506
245 Ga0207695_10060686 3300025913 Bacteria 3913
246 Ga0207671_10006837 3300025914 Bacteria 10068
247 Ga0207671_10029342 3300025914 Bacteria 4107
248 Ga0207671_10116185 3300025914 Bacteria 2041
249 Ga0207693_10017378 3300025915 Bacteria 5738
250 Ga0207693_10058489 3300025915 Bacteria 3020
251 Ga0207693_10099089 3300025915 Bacteria 2285
252 Ga0207693_10123079 3300025915 Bacteria 2037
253 Ga0207663_10003400 3300025916 Bacteria 7780
254 Ga0207663_10045041 3300025916 Bacteria 2711
255 Ga0207660_10012377 3300025917 Bacteria 5581
256 Ga0207660_10094449 3300025917 Bacteria 2223
257 Ga0207657_10011308 3300025919 Bacteria 8865
258 Ga0207657_10046183 3300025919 Bacteria 3816
259 Ga0207652_10001690 3300025921 Bacteria 19300
260 Ga0207652_10009155 3300025921 Bacteria 7969
261 Ga0207652_10011695 3300025921 Bacteria 7082
262 Ga0207681_10132220 3300025923 Bacteria 1847
263 Ga0207694_10004974 3300025924 Bacteria 10290
264 Ga0207687_10008928 3300025927 Bacteria 6555
265 Ga0207687_10084376 3300025927 Bacteria 2302
266 Ga0207700_10083561 3300025928 Bacteria 2500
267 Ga0207700_10095119 3300025928 Bacteria 2362
268 Ga0207664_10019520 3300025929 Bacteria 5011
269 Ga0207664_10055261 3300025929 Bacteria 3150
270 Ga0207664_10173003 3300025929 Bacteria 1849
271 Ga0207664_10215110 3300025929 Unclassified 1665
272 Ga0207690_10085073 3300025932 Bacteria 2219
273 Ga0207706_10324269 3300025933 Bacteria 1340
274 Ga0207686_10004474 3300025934 Bacteria 7489
275 Ga0207686_10008261 3300025934 Bacteria 5614
276 Ga0207709_10002360 3300025935 Bacteria 11919
277 Ga0207670_10010596 3300025936 Bacteria 5318
278 Ga0207669_10019350 3300025937 Bacteria 3543
279 Ga0207669_10063791 3300025937 Unclassified 2276
280 Ga0207704_10063904 3300025938 Bacteria 2297
281 Ga0207665_10005897 3300025939 Bacteria 8151
282 Ga0207665_10084398 3300025939 Bacteria 2192
283 Ga0207711_10005401 3300025941 Bacteria 10804
284 Ga0207711_10027328 3300025941 Bacteria 4792
285 Ga0207711_10049952 3300025941 Bacteria 3581
286 Ga0207711_10201143 3300025941 Bacteria 1818
287 Ga0207689_10000152 3300025942 Bacteria 59757
288 Ga0207689_10036749 3300025942 Bacteria 4065
289 Ga0207661_10008213 3300025944 Bacteria 7451
290 Ga0207661_10218935 3300025944 Bacteria 1682
291 Ga0207679_10063502 3300025945 Bacteria 2757
292 Ga0207679_10113969 3300025945 Bacteria 2140
293 Ga0207667_10002017 3300025949 Bacteria 25487
294 Ga0207667_10034874 3300025949 Bacteria 5400
295 Ga0207667_10153242 3300025949 Bacteria 2372
296 Ga0207668_10025027 3300025972 Bacteria 3858
297 Ga0207668_10255363 3300025972 Bacteria 1426
298 Ga0207640_10052890 3300025981 Bacteria 2648
299 Ga0207677_10005891 3300026023 Bacteria 6669
300 Ga0207703_10098778 3300026035 Bacteria 2469
301 Ga0207639_10014520 3300026041 Bacteria 5543
302 Ga0207639_10066716 3300026041 Bacteria 2798
303 Ga0207639_10119314 3300026041 Bacteria 2164
304 Ga0207678_10006479 3300026067 Bacteria 10385
305 Ga0207678_10031213 3300026067 Bacteria 4648
306 Ga0207678_10036065 3300026067 Bacteria 4304
307 Ga0207678_10082315 3300026067 Bacteria 2754
308 Ga0207708_10000166 3300026075 Bacteria 51921
309 Ga0207708_10010991 3300026075 Bacteria 6733
310 Ga0207702_10000548 3300026078 Bacteria 41978
311 Ga0207641_10111254 3300026088 Bacteria 2428
312 Ga0207648_10000131 3300026089 Bacteria 73949
313 Ga0207648_10012752 3300026089 Bacteria 7854
314 Ga0207676_10123343 3300026095 Bacteria 2189
315 Ga0207676_10386425 3300026095 Bacteria 1304
316 Ga0207674_10010575 3300026116 Bacteria 10440
317 Ga0207674_10013781 3300026116 Bacteria 8946
318 Ga0207674_10070422 3300026116 Bacteria 3516
319 Ga0207674_10151454 3300026116 Bacteria 2276
320 Ga0207675_100001354 3300026118 Bacteria 24525
321 Ga0207675_100050443 3300026118 Bacteria 3883
322 Ga0207675_100082798 3300026118 Bacteria 3009
323 Ga0207683_10006827 3300026121 Bacteria 9772
324 Ga0207683_10015560 3300026121 Bacteria 6476
325 Ga0207683_10016803 3300026121 Bacteria 6228
326 Ga0207698_10196905 3300026142 Bacteria 1801
327 Ga0207698_10221318 3300026142 Bacteria 1711
328 Ga0207698_10232731 3300026142 Bacteria 1674
329 Ga0209589_1000014 3300027357 Bacteria 227996
330 Ga0209489_100014 3300027361 Bacteria 227996
331 Ga0209700_100024 3300027363 Bacteria 227996
332 Ga0209179_1005504 3300027512 Bacteria 1986
333 Ga0209588_1002539 3300027671 Bacteria 4953
334 Ga0209588_1039098 3300027671 Bacteria 1530
335 Ga0268266_10009249 3300028379 Bacteria 8692
336 Ga0268266_10275747 3300028379 Bacteria 1562
337 Ga0268265_10055636 3300028380 Bacteria 3007
338 Ga0268265_10134138 3300028380 Bacteria 2063
339 Ga0268264_10206852 3300028381 Bacteria 1799
340 Ga0307511_10024264 3300030521 Bacteria 5626
341 Ga0265330_10022974 3300031235 Bacteria 2834
342 Ga0265330_10067773 3300031235 Bacteria 1546
343 Ga0265328_10030289 3300031239 Bacteria 2016
344 Ga0265325_10027647 3300031241 Bacteria 3064
345 Ga0265340_10001085 3300031247 Bacteria 15485
346 Ga0265339_10116574 3300031249 Bacteria 1377
347 Ga0265331_10041625 3300031250 Bacteria 2232
348 Ga0265331_10042854 3300031250 Bacteria 2194
349 Ga0265327_10000236 3300031251 Bacteria 110434
350 Ga0265314_10004266 3300031711 Bacteria 13380
351 Ga0265314_10146683 3300031711 Bacteria 1452
352 Ga0265342_10030008 3300031712 Bacteria 3374
353 Ga0265342_10070700 3300031712 Bacteria 2035
354 Ga0307507_10083911 3300033179 Bacteria 2781
355 Ga0307510_10061882 3300033180 Bacteria 3831
356 Ga0315911_1000002 3300033442 Bacteria 926833
357 Ga0373926_0007554 3300035083 Bacteria 3620
358 Ga0373934_0033359 3300035086 Bacteria 2020
359 Ga0373923_0009940 3300035111 Bacteria 3446
360 Ga0373923_0083424 3300035111 Bacteria 1389
361 Ga0373936_0013841 3300035113 Bacteria 3080
362 Ga0373936_0017960 3300035113 Bacteria 2728
363 Ga0373953_0058080 3300035117 Bacteria 1576
364 Ga0373954_0000645 3300035118 Bacteria 13339
365 Ga0373957_0069054 3300035120 Bacteria 1379
366 Ga0373943_0040178 3300035170 Bacteria 2258
367 Ga0373943_0081606 3300035170 Bacteria 1659
368 Ga0373924_0022355 3300035410 Bacteria 2472
369 Ga0373935_0012897 3300035692 Bacteria 5035
370 Ga0373935_0060625 3300035692 Bacteria 2420
371 Ga0373927_0014717 3300035695 Bacteria 5172
372 Ga0373927_0045076 3300035695 Bacteria 2853
373 Ga0373927_0049560 3300035695 Bacteria 2715
374 Ga0373927_0111542 3300035695 Bacteria 1782
375 Ga0373933_0003690 3300035724 Bacteria 8470
376 Ga0373933_0175570 3300035724 Bacteria 1365
377 Ga0373933_0207156 3300035724 Bacteria 1256
378 Ga0373937_0027665 3300036401 Bacteria 5130
379 Ga0373937_0041387 3300036401 Bacteria 4202
380 Ga0373937_0084598 3300036401 Bacteria 2935
381 Ga0373937_0283900 3300036401 Bacteria 1563
382 Ga0373925_0025108 3300037068 Bacteria 4351
383 Ga0373925_0031128 3300037068 Bacteria 3919
384 Ga0373925_0101482 3300037068 Bacteria 2212
385 Ga0395899_0063956 3300037312 Bacteria 2706
386 Ga0395900_0082779 3300037418 Bacteria 3297
387 Ga0395900_0259525 3300037418 Bacteria 1736
388 Ga0395900_0330718 3300037418 Bacteria 1502
389 Ga0395898_0034204 3300037466 Bacteria 5067
390 Ga0395898_0071593 3300037466 Bacteria 3350
391 Ga0395905_0048596 3300037471 Bacteria 3976
392 Ga0395905_0131323 3300037471 Bacteria 2355
393 Ga0436364_1009808 3300037853 Bacteria 10125
394 Ga0436364_1470735 3300037853 Bacteria 11217
395 Ga0436365_0002039 3300039437 Bacteria 28011
396 Ga0436365_0266146 3300039437 Bacteria 1743
397 Ga0436365_0693504 3300039437 Bacteria 82758
398 Ga0436365_0839901 3300039437 Bacteria 10218
399 Ga0436360_0411669 3300039438 Bacteria 1406
400 Ga0436361_0194339 3300039447 Bacteria 4635
401 Ga0436361_0711176 3300039447 Bacteria 18026
402 Ga0436363_0322567 3300039450 Bacteria 9751
403 Ga0436363_0555717 3300039450 Bacteria 1190
404 Ga0436363_1048610 3300039450 Bacteria 16451
405 Ga0436362_0305717 3300039453 Bacteria 3347
406 Ga0436362_0442809 3300039453 Bacteria 5601
407 Ga0466964_0038046 3300044706 Bacteria 1934
408 Ga0466968_0007831 3300044735 Bacteria 4076
409 Ga0466970_0178105 3300044765 Bacteria 1179
410 Ga0466957_0028471 3300044842 Bacteria 3327
411 Ga0466959_0098882 3300045049 Bacteria 2090
412 Ga0466967_0205162 3300045976 Bacteria 1868
413 Ga0495592_0012242 3300046454 Bacteria 6511
414 Ga0495592_0022948 3300046454 Bacteria 4748
415 Ga0495592_0068940 3300046454 Bacteria 2580
416 Ga0495603_0003836 3300046455 Bacteria 8949
417 Ga0495603_0008150 3300046455 Bacteria 6331
418 Ga0495603_0042416 3300046455 Bacteria 2720
419 Ga0495603_0067385 3300046455 Bacteria 2107
420 Ga0495603_0118371 3300046455 Bacteria 1544
421 Ga0495629_0000373 3300046459 Bacteria 37733
422 Ga0495629_0000862 3300046459 Bacteria 24478
423 Ga0495629_0018940 3300046459 Bacteria 4923
424 Ga0495629_0055657 3300046459 Bacteria 2766
425 Ga0495629_0071868 3300046459 Bacteria 2415
426 Ga0495638_0000356 3300046460 Bacteria 57145
427 Ga0495641_0021456 3300046461 Bacteria 3249
428 Ga0495651_0007091 3300046462 Bacteria 8568
429 Ga0495653_0022804 3300046463 Bacteria 5063
430 Ga0495653_0036975 3300046463 Bacteria 3841
431 Ga0495650_0075469 3300046471 Bacteria 1312
432 Ga0495580_0010268 3300046472 Bacteria 7303
433 Ga0495580_0086463 3300046472 Bacteria 2184
434 Ga0495580_0087209 3300046472 Bacteria 2174
435 Ga0495582_0006572 3300046473 Bacteria 6452
436 Ga0495582_0036637 3300046473 Bacteria 2698
437 Ga0495605_0003407 3300046474 Bacteria 9471
438 Ga0495639_0000544 3300046475 Bacteria 17562
439 Ga0495639_0023871 3300046475 Bacteria 2689
440 Ga0495662_0004072 3300046476 Bacteria 7358
441 Ga0495662_0099452 3300046476 Bacteria 1422
442 Ga0495664_0025650 3300046477 Bacteria 3432
443 Ga0495585_0017177 3300046492 Bacteria 4185
444 Ga0495594_0083608 3300046499 Bacteria 1784
445 Ga0495596_0037025 3300046500 Bacteria 1931
446 Ga0495607_0030694 3300046501 Bacteria 3297
447 Ga0495606_0001386 3300046507 Bacteria 32763
448 Ga0495606_0019788 3300046507 Bacteria 4988
449 Ga0495606_0102246 3300046507 Bacteria 1743
450 Ga0495608_0018583 3300046511 Bacteria 4791
451 Ga0495618_0027852 3300046514 Bacteria 3519
452 Ga0495628_0009755 3300046516 Bacteria 8185
453 Ga0495628_0042488 3300046516 Bacteria 3626
454 Ga0495630_0011058 3300046517 Bacteria 6529
455 Ga0495630_0029536 3300046517 Bacteria 4075
456 Ga0495630_0044051 3300046517 Bacteria 3335
457 Ga0495648_0000936 3300046524 Bacteria 30292
458 Ga0495648_0019888 3300046524 Bacteria 4701
459 Ga0495652_0023315 3300046529 Bacteria 5487
460 Ga0495652_0149199 3300046529 Bacteria 1829
461 Ga0495654_0046864 3300046530 Bacteria 2127
462 Ga0495665_0005176 3300046531 Bacteria 7031
463 Ga0495665_0007397 3300046531 Bacteria 5938
464 Ga0495640_0003929 3300046533 Bacteria 11908
465 Ga0495640_0008396 3300046533 Bacteria 8101
466 Ga0495640_0037252 3300046533 Bacteria 3432
467 Ga0495640_0070999 3300046533 Bacteria 2337
468 Ga0495587_0068567 3300046536 Bacteria 2066
469 Ga0495609_0046400 3300046538 Bacteria 1946
470 Ga0495597_0053875 3300046542 Bacteria 1768
471 Ga0495645_0015499 3300046543 Bacteria 5421
472 Ga0495645_0083930 3300046543 Bacteria 2282
473 Ga0495622_0006092 3300046557 Bacteria 5603
474 Ga0495622_0086201 3300046557 Bacteria 1444
475 Ga0495668_0136411 3300046616 Bacteria 1343
476 Ga0495634_0024114 3300046642 Bacteria 4272
477 Ga0495634_0035525 3300046642 Bacteria 3412
478 Ga0495625_0140248 3300046660 Bacteria 1631
479 Ga0495635_0007185 3300046663 Bacteria 7777
480 Ga0495588_0046261 3300046674 Bacteria 2232
481 Ga0495588_0052369 3300046674 Bacteria 2104
482 Ga0495657_0051454 3300046675 Bacteria 2765
483 Ga0495623_0131031 3300046679 Bacteria 1501
484 Ga0495646_0051528 3300046680 Bacteria 2491
485 Ga0495646_0072488 3300046680 Bacteria 2025
486 Ga0495658_0005818 3300046683 Bacteria 6053
487 Ga0495613_0007707 3300046689 Bacteria 8008
488 Ga0495613_0013842 3300046689 Bacteria 5984
489 Ga0495624_0075840 3300046690 Bacteria 2087
490 Ga0495624_0193246 3300046690 Bacteria 1238
491 Ga0495670_0007712 3300046691 Bacteria 5293
492 Ga0495589_0002533 3300046794 Bacteria 10169
493 Ga0495600_0026321 3300046809 Bacteria 3754
494 Ga0495600_0054621 3300046809 Bacteria 2609
495 Ga0495600_0157126 3300046809 Bacteria 1471
496 Ga0495581_0011818 3300047315 Bacteria 5054
497 Ga0495581_0026865 3300047315 Bacteria 3337
498 Ga0495581_0064141 3300047315 Bacteria 2122
499 Ga0495604_0013854 3300047317 Bacteria 6433
500 Ga0495604_0078254 3300047317 Bacteria 2482
501 Ga0495604_0114136 3300047317 Bacteria 1965
502 Ga0495604_0116832 3300047317 Bacteria 1936
503 Ga0495674_0004525 3300047319 Bacteria 13376
504 Ga0495674_0008459 3300047319 Bacteria 9804
505 Ga0495674_0056952 3300047319 Bacteria 3422
506 Ga0495672_0027522 3300047320 Bacteria 3611
507 Ga0495685_013142 3300047447 Bacteria 2808
508 Ga0495684_0015794 3300047471 Bacteria 5811
509 Ga0495684_0028441 3300047471 Bacteria 4292
510 Ga0495686_0001093 3300047472 Bacteria 32230
511 Ga0495686_0092699 3300047472 Bacteria 1832
512 Ga0495686_0105256 3300047472 Bacteria 1698
513 Ga0495686_0172363 3300047472 Bacteria 1258
514 Ga0495593_0008449 3300047673 Bacteria 5987
515 Ga0495593_0038320 3300047673 Bacteria 2589
516 Ga0495593_0094788 3300047673 Bacteria 1535
517 Ga0495602_0023629 3300048088 Bacteria 5985
518 Ga0495602_0128040 3300048088 Bacteria 2030
519 Ga0496100_0010201 3300048903 Bacteria 5312
520 Ga0496100_0027311 3300048903 Bacteria 3510
521 Ga0496100_0113077 3300048903 Bacteria 1889
522 Ga0496101_0002052 3300048904 Bacteria 12255
523 Ga0496102_0001771 3300048905 Bacteria 18745
524 Ga0496102_0015129 3300048905 Bacteria 6717
525 Ga0496102_0276628 3300048905 Bacteria 1582
526 Ga0496103_0005699 3300048906 Bacteria 7445
527 Ga0496103_0020532 3300048906 Bacteria 3969
528 Ga0496104_0037726 3300048907 Bacteria 4518
529 Ga0496104_0048391 3300048907 Bacteria 4009
530 Ga0496104_0066770 3300048907 Bacteria 3415
531 Ga0496105_0011039 3300048908 Bacteria 7120
532 Ga0496105_0042795 3300048908 Bacteria 3734
533 Ga0496106_0002858 3300048909 Bacteria 12824
534 Ga0496106_0037996 3300048909 Bacteria 3602
535 Ga0496106_0069924 3300048909 Bacteria 2680
536 Ga0496107_0002387 3300048910 Bacteria 12152
537 Ga0496107_0034319 3300048910 Bacteria 3634
538 Ga0496107_0145214 3300048910 Bacteria 1754
539 Ga0496107_0213740 3300048910 Bacteria 1434
540 Ga0496108_0016020 3300048911 Bacteria 6111
541 Ga0496109_0007060 3300048912 Bacteria 9476
542 Ga0496110_0015025 3300048913 Bacteria 6438
543 Ga0496110_0111226 3300048913 Bacteria 2462
544 Ga0496111_0035529 3300048914 Bacteria 3562
545 Ga0496112_0042097 3300048915 Bacteria 4469
546 Ga0496113_0206442 3300048916 Bacteria 1563
547 Ga0496114_0111205 3300048917 Bacteria 2347
548 Ga0496114_0253233 3300048917 Bacteria 1549
549 Ga0496115_0000535 3300048918 Bacteria 29580
550 Ga0496115_0011938 3300048918 Bacteria 6524
551 Ga0496115_0018795 3300048918 Bacteria 5312
552 Ga0496116_0043047 3300048919 Bacteria 3080
553 Ga0496117_0081608 3300048920 Bacteria 2121
554 Ga0496117_0130469 3300048920 Bacteria 1524
555 Ga0496118_0020073 3300048921 Bacteria 5942
556 Ga0496118_0043574 3300048921 Bacteria 3525
557 Ga0496119_0007752 3300048922 Bacteria 9586
558 Ga0496119_0068576 3300048922 Bacteria 2088
559 Ga0496121_0000230 3300048924 Bacteria 120616
560 Ga0496121_0007034 3300048924 Bacteria 13662
561 Ga0496121_0013403 3300048924 Bacteria 8814
562 Ga0496121_0016583 3300048924 Bacteria 7595
563 Ga0496121_0025042 3300048924 Bacteria 5681
564 Ga0496121_0064434 3300048924 Bacteria 2988
565 Ga0496121_0066215 3300048924 Bacteria 2935
566 Ga0496121_0068552 3300048924 Bacteria 2869
567 Ga0496121_0133432 3300048924 Bacteria 1854
568 Ga0496122_0037590 3300048925 Bacteria 3894
569 Ga0496122_0178105 3300048925 Bacteria 1272
570 Ga0496123_0016263 3300048926 Bacteria 6051
571 Ga0496124_0095175 3300048927 Bacteria 2421
572 Ga0496125_0000040 3300048928 Bacteria 314478
573 Ga0496125_0004755 3300048928 Bacteria 15477
574 Ga0496125_0047371 3300048928 Bacteria 3596
575 Ga0496126_0002483 3300048929 Bacteria 24817
576 Ga0496126_0005712 3300048929 Bacteria 14100
577 Ga0496126_0006690 3300048929 Bacteria 12809
578 Ga0496126_0015906 3300048929 Bacteria 7553
579 Ga0496126_0019903 3300048929 Bacteria 6598
580 Ga0496126_0043030 3300048929 Bacteria 4169
581 Ga0496126_0060499 3300048929 Bacteria 3405
582 Ga0496126_0064515 3300048929 Bacteria 3280
583 Ga0496126_0084206 3300048929 Bacteria 2805
584 Ga0496126_0216878 3300048929 Bacteria 1609
585 Ga0496126_0341011 3300048929 Bacteria 1227
586 Ga0495682_0026810 3300049460 Bacteria 2138
587 Ga0501034_0000533 3300049571 Bacteria 60463
588 Ga0501034_0040217 3300049571 Bacteria 4734
589 Ga0501072_0004798 3300049588 Bacteria 10299
590 Ga0501083_0024160 3300049744 Bacteria 4213
591 Ga0501035_0152223 3300049822 Bacteria 2007
592 nmdc:mga0yw44_15006_c1 3300050492 Bacteria 4135
593 nmdc:mga0yw44_35778_c1 3300050492 Bacteria 2921
594 nmdc:mga0k408_77126_c1 3300050493 Bacteria 1948
595 nmdc:mga06z11_136648_c1 3300050494 Bacteria 1381
596 nmdc:mga06z11_4857_c1 3300050494 Bacteria 5325
597 nmdc:mga07m45_745_c1 3300050496 Bacteria 13914
598 Ga0500635_0004481 3300053080 Bacteria 3603
599 Ga0495595_0102635 3300053084 Bacteria 1381
600 Ga0495619_0009769 3300053085 Bacteria 6050
601 Ga0495619_0018295 3300053085 Bacteria 4446
602 Ga0500566_0000158 3300053094 Bacteria 34495
603 Ga0500566_0013617 3300053094 Bacteria 4783
604 Ga0500640_000568 3300053095 Bacteria 9480
605 Ga0500554_000804 3300053102 Bacteria 6184
606 Ga0500554_001364 3300053102 Bacteria 4725
607 Ga0500562_013148 3300053108 Bacteria 2110
608 Ga0500572_000024 3300053111 Bacteria 47391
609 Ga0500572_000858 3300053111 Bacteria 9461
610 Ga0500591_027635 3300053115 Bacteria 2747
611 Ga0500595_000010 3300053119 Bacteria 275806
612 Ga0500595_000537 3300053119 Bacteria 22809
613 Ga0500595_001188 3300053119 Bacteria 14372
614 Ga0500595_003127 3300053119 Bacteria 7841
615 Ga0500595_005685 3300053119 Bacteria 5413
616 Ga0500595_014349 3300053119 Bacteria 3007
617 Ga0500608_001300 3300053122 Bacteria 8888
618 Ga0500608_033147 3300053122 Bacteria 2457
619 Ga0500642_0007066 3300053130 Bacteria 3748
620 Ga0500559_0001379 3300053136 Bacteria 13865
621 Ga0500559_0003877 3300053136 Bacteria 7232
622 Ga0500603_000465 3300053150 Bacteria 10412
623 Ga0500603_000902 3300053150 Bacteria 7046
624 Ga0500603_007453 3300053150 Bacteria 2403
625 Ga0500616_0000028 3300053153 Bacteria 435722
626 Ga0500616_0043984 3300053153 Bacteria 2385
627 Ga0500630_000112 3300053159 Bacteria 26672
628 Ga0500638_001161 3300053162 Bacteria 7913
629 Ga0500639_000040 3300053163 Bacteria 63516
630 Ga0500639_021288 3300053163 Bacteria 3426
631 Ga0500636_0000365 3300053177 Bacteria 24884
632 Ga0500636_0012352 3300053177 Bacteria 5005
633 Ga0500636_0113358 3300053177 Bacteria 1529
634 Ga0500636_0121323 3300053177 Bacteria 1466
635 Ga0500637_0000042 3300053178 Bacteria 46215
636 Ga0500637_0008272 3300053178 Bacteria 5236
637 Ga0500637_0063515 3300053178 Bacteria 2117
638 Ga0500625_078487 3300053729 Bacteria 1448
639 Ga0500645_006583 3300053730 Bacteria 4126
640 Ga0500552_002567 3300053733 Bacteria 1782
641 Ga0500601_000203 3300053737 Bacteria 12048
642 Ga0500661_000056 3300055283 Bacteria 17736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10071640 Ga0157378_100716403 337
2 3300047673 Ga0495593_0094788 Ga0495593_0094788_12_1124 339
3 3300025913 Ga0207695_10060686 Ga0207695_100606862 340
4 3300048922 Ga0496119_0068576 Ga0496119_0068576_26_1138 340
5 3300005563 Ga0068855_100010865 Ga0068855_1000108656 341
6 3300013104 Ga0157370_10014947 Ga0157370_100149473 341
7 3300025921 Ga0207652_10011695 Ga0207652_100116958 341
8 3300039438 Ga0436360_0411669 Ga0436360_0411669_275_1360 341
9 3300039447 Ga0436361_0194339 Ga0436361_0194339_1643_2728 341
10 3300039453 Ga0436362_0305717 Ga0436362_0305717_314_1399 341
11 3300048928 Ga0496125_0000040 Ga0496125_0000040_21076_22221 341
12 3300044765 Ga0466970_0178105 Ga0466970_0178105_74_1168 343
13 3300025261 Ga0209233_1002384 Ga0209233_10023842 344
14 3300033442 Ga0315911_1000002 Ga0315911_1000002157 344
15 3300048910 Ga0496107_0213740 Ga0496107_0213740_274_1419 344
16 iso_pu_bacteria 2842333319 2842333970 344
17 3300021388 Ga0213875_10007684 Ga0213875_100076843 346
18 3300046809 Ga0495600_0157126 Ga0495600_0157126_308_1408 346
19 3300048924 Ga0496121_0066215 Ga0496121_0066215_1078_2223 346
20 3300048929 Ga0496126_0084206 Ga0496126_0084206_794_1894 348
21 3300049571 Ga0501034_0000533 Ga0501034_0000533_33706_34821 349
22 3300049588 Ga0501072_0004798 Ga0501072_0004798_4801_5916 349
23 3300053119 Ga0500595_000010 Ga0500595_000010_157054_158190 349
24 3300007265 Ga0099794_10026075 Ga0099794_100260752 350
25 3300007265 Ga0099794_10037632 Ga0099794_100376322 350
26 3300027671 Ga0209588_1002539 Ga0209588_10025395 350
27 3300046455 Ga0495603_0067385 Ga0495603_0067385_286_1434 350
28 3300046473 Ga0495582_0036637 Ga0495582_0036637_118_1266 350
29 3300046475 Ga0495639_0000544 Ga0495639_0000544_16330_17478 350
30 3300046557 Ga0495622_0086201 Ga0495622_0086201_88_1236 350
31 3300047315 Ga0495581_0064141 Ga0495581_0064141_566_1714 350
32 3300007265 Ga0099794_10030124 Ga0099794_100301242 351
33 3300025915 Ga0207693_10123079 Ga0207693_101230791 351
34 3300039450 Ga0436363_0555717 Ga0436363_0555717_32_1144 351
35 3300046524 Ga0495648_0019888 Ga0495648_0019888_2364_3509 351
36 3300048920 Ga0496117_0130469 Ga0496117_0130469_87_1232 351
37 3300048924 Ga0496121_0007034 Ga0496121_0007034_992_2137 351
38 3300048924 Ga0496121_0068552 Ga0496121_0068552_580_1728 351
39 3300048928 Ga0496125_0004755 Ga0496125_0004755_14192_15340 351
40 3300048929 Ga0496126_0341011 Ga0496126_0341011_52_1200 351
41 3300050494 nmdc:mga06z11_136648_c1 nmdc:mga06z11_136648_c1_42_1190 351
42 3300053119 Ga0500595_003127 Ga0500595_003127_3688_4833 351
43 3300053119 Ga0500595_005685 Ga0500595_005685_1521_2666 351
44 3300053130 Ga0500642_0007066 Ga0500642_0007066_916_2061 351
45 3300005437 Ga0070710_10197423 Ga0070710_101974231 352
46 3300005536 Ga0070697_100040370 Ga0070697_1000403702 352
47 3300009101 Ga0105247_10014337 Ga0105247_100143373 352
48 3300009177 Ga0105248_10029925 Ga0105248_100299253 352
49 3300011119 Ga0105246_10094733 Ga0105246_100947332 352
50 3300013296 Ga0157374_10386324 Ga0157374_103863242 352
51 3300013306 Ga0163162_10080658 Ga0163162_100806583 352
52 3300013308 Ga0157375_10029609 Ga0157375_100296093 352
53 3300014969 Ga0157376_10027760 Ga0157376_100277604 352
54 3300025928 Ga0207700_10095119 Ga0207700_100951192 352
55 3300025929 Ga0207664_10215110 Ga0207664_102151102 352
56 3300026095 Ga0207676_10386425 Ga0207676_103864252 352
57 3300046507 Ga0495606_0001386 Ga0495606_0001386_29305_30417 352
58 3300048929 Ga0496126_0019903 Ga0496126_0019903_4987_6099 352
59 3300049822 Ga0501035_0152223 Ga0501035_0152223_429_1583 352
60 3300053085 Ga0495619_0018295 Ga0495619_0018295_2144_3256 352
61 3300005334 Ga0068869_100051041 Ga0068869_1000510412 353
62 3300005339 Ga0070660_100182949 Ga0070660_1001829492 353
63 3300005366 Ga0070659_100138531 Ga0070659_1001385312 353
64 3300005518 Ga0070699_100025383 Ga0070699_1000253835 353
65 3300005539 Ga0068853_100043705 Ga0068853_1000437052 353
66 3300005563 Ga0068855_100059992 Ga0068855_1000599924 353
67 3300005614 Ga0068856_100062929 Ga0068856_1000629292 353
68 3300009098 Ga0105245_10251088 Ga0105245_102510881 353
69 3300013105 Ga0157369_10416234 Ga0157369_104162341 353
70 3300025906 Ga0207699_10066770 Ga0207699_100667702 353
71 3300025911 Ga0207654_10013541 Ga0207654_100135414 353
72 3300025917 Ga0207660_10094449 Ga0207660_100944492 353
73 3300025923 Ga0207681_10132220 Ga0207681_101322202 353
74 3300025932 Ga0207690_10085073 Ga0207690_100850732 353
75 3300025945 Ga0207679_10113969 Ga0207679_101139692 353
76 3300026116 Ga0207674_10070422 Ga0207674_100704222 353
77 3300028380 Ga0268265_10134138 Ga0268265_101341381 353
78 3300005354 Ga0070675_100251073 Ga0070675_1002510731 354
79 3300005356 Ga0070674_100129017 Ga0070674_1001290172 354
80 3300005367 Ga0070667_100225055 Ga0070667_1002250552 354
81 3300005459 Ga0068867_100104229 Ga0068867_1001042291 354
82 3300005548 Ga0070665_100321397 Ga0070665_1003213972 354
83 3300005617 Ga0068859_100018883 Ga0068859_1000188835 354
84 3300005841 Ga0068863_100081423 Ga0068863_1000814232 354
85 3300005842 Ga0068858_100006733 Ga0068858_1000067337 354
86 3300005843 Ga0068860_100166205 Ga0068860_1001662052 354
87 3300006237 Ga0097621_100010946 Ga0097621_1000109462 354
88 3300006358 Ga0068871_100005345 Ga0068871_1000053454 354
89 3300006847 Ga0075431_100142152 Ga0075431_1001421521 354
90 3300006881 Ga0068865_100174103 Ga0068865_1001741032 354
91 3300006931 Ga0097620_100018883 Ga0097620_1000188835 354
92 3300013308 Ga0157375_10058259 Ga0157375_100582592 354
93 3300021384 Ga0213876_10007051 Ga0213876_100070511 354
94 3300025937 Ga0207669_10063791 Ga0207669_100637912 354
95 3300025941 Ga0207711_10049952 Ga0207711_100499523 354
96 3300025942 Ga0207689_10036749 Ga0207689_100367493 354
97 3300025972 Ga0207668_10255363 Ga0207668_102553632 354
98 3300026035 Ga0207703_10098778 Ga0207703_100987782 354
99 3300026088 Ga0207641_10111254 Ga0207641_101112542 354
100 3300026118 Ga0207675_100050443 Ga0207675_1000504432 354
101 3300028379 Ga0268266_10275747 Ga0268266_102757472 354
102 3300028380 Ga0268265_10055636 Ga0268265_100556362 354
103 3300039437 Ga0436365_0839901 Ga0436365_0839901_884_2020 354
104 3300039447 Ga0436361_0194339 Ga0436361_0194339_3355_4491 354
105 3300048925 Ga0496122_0178105 Ga0496122_0178105_93_1247 354
106 3300049744 Ga0501083_0024160 Ga0501083_0024160_388_1515 354
107 3300005330 Ga0070690_100000207 Ga0070690_1000002077 355
108 3300005336 Ga0070680_100173194 Ga0070680_1001731942 355
109 3300005340 Ga0070689_100005554 Ga0070689_1000055545 355
110 3300005345 Ga0070692_10009000 Ga0070692_100090002 355
111 3300005365 Ga0070688_100048409 Ga0070688_1000484092 355
112 3300005438 Ga0070701_10000361 Ga0070701_1000036114 355
113 3300005440 Ga0070705_100004891 Ga0070705_1000048912 355
114 3300005441 Ga0070700_100000469 Ga0070700_10000046917 355
115 3300005456 Ga0070678_100012495 Ga0070678_1000124952 355
116 3300005459 Ga0068867_100199671 Ga0068867_1001996712 355
117 3300005544 Ga0070686_100001838 Ga0070686_1000018388 355
118 3300005546 Ga0070696_100121088 Ga0070696_1001210881 355
119 3300005549 Ga0070704_100021333 Ga0070704_1000213332 355
120 3300005615 Ga0070702_100007752 Ga0070702_1000077524 355
121 3300005718 Ga0068866_10000298 Ga0068866_1000029822 355
122 3300005719 Ga0068861_100000393 Ga0068861_1000003934 355
123 3300005840 Ga0068870_10003281 Ga0068870_100032815 355
124 3300005842 Ga0068858_100004345 Ga0068858_1000043454 355
125 3300006237 Ga0097621_100004050 Ga0097621_1000040505 355
126 3300006358 Ga0068871_100000782 Ga0068871_10000078219 355
127 3300006881 Ga0068865_100000084 Ga0068865_10000008448 355
128 3300009098 Ga0105245_10000063 Ga0105245_10000063101 355
129 3300009148 Ga0105243_10001155 Ga0105243_100011554 355
130 3300009176 Ga0105242_10003979 Ga0105242_100039798 355
131 3300009177 Ga0105248_10039177 Ga0105248_100391774 355
132 3300009177 Ga0105248_10107540 Ga0105248_101075402 355
133 3300009553 Ga0105249_10067760 Ga0105249_100677604 355
134 3300013297 Ga0157378_10001267 Ga0157378_100012674 355
135 3300013297 Ga0157378_10047944 Ga0157378_100479443 355
136 3300013306 Ga0163162_10000526 Ga0163162_100005267 355
137 3300013306 Ga0163162_10101697 Ga0163162_101016972 355
138 3300014326 Ga0157380_10010857 Ga0157380_100108573 355
139 3300025899 Ga0207642_10006430 Ga0207642_100064302 355
140 3300025908 Ga0207643_10003705 Ga0207643_100037053 355
141 3300025927 Ga0207687_10008928 Ga0207687_100089282 355
142 3300025934 Ga0207686_10004474 Ga0207686_100044745 355
143 3300025935 Ga0207709_10002360 Ga0207709_100023606 355
144 3300025936 Ga0207670_10010596 Ga0207670_100105962 355
145 3300025941 Ga0207711_10027328 Ga0207711_100273282 355
146 3300025942 Ga0207689_10000152 Ga0207689_1000015254 355
147 3300026075 Ga0207708_10000166 Ga0207708_1000016647 355
148 3300026089 Ga0207648_10000131 Ga0207648_100001313 355
149 3300026118 Ga0207675_100001354 Ga0207675_10000135423 355
150 3300026121 Ga0207683_10006827 Ga0207683_100068278 355
151 3300026142 Ga0207698_10196905 Ga0207698_101969052 355
152 3300039437 Ga0436365_0266146 Ga0436365_0266146_137_1282 355
153 3300046455 Ga0495603_0042416 Ga0495603_0042416_1464_2594 355
154 3300046460 Ga0495638_0000356 Ga0495638_0000356_26249_27379 355
155 3300046474 Ga0495605_0003407 Ga0495605_0003407_7045_8175 355
156 3300046492 Ga0495585_0017177 Ga0495585_0017177_662_1792 355
157 3300046500 Ga0495596_0037025 Ga0495596_0037025_482_1612 355
158 3300046501 Ga0495607_0030694 Ga0495607_0030694_831_1961 355
159 3300046530 Ga0495654_0046864 Ga0495654_0046864_245_1375 355
160 3300046691 Ga0495670_0007712 Ga0495670_0007712_3952_5082 355
161 3300046794 Ga0495589_0002533 Ga0495589_0002533_8722_9852 355
162 3300047447 Ga0495685_013142 Ga0495685_013142_72_1202 355
163 3300047472 Ga0495686_0172363 Ga0495686_0172363_18_1148 355
164 3300048903 Ga0496100_0113077 Ga0496100_0113077_415_1545 355
165 3300048905 Ga0496102_0015129 Ga0496102_0015129_3522_4652 355
166 3300048909 Ga0496106_0037996 Ga0496106_0037996_433_1563 355
167 3300048918 Ga0496115_0011938 Ga0496115_0011938_1737_2867 355
168 3300048921 Ga0496118_0043574 Ga0496118_0043574_2355_3485 355
169 3300005336 Ga0070680_100101358 Ga0070680_1001013582 356
170 3300005458 Ga0070681_10018290 Ga0070681_100182905 356
171 3300005459 Ga0068867_100034336 Ga0068867_1000343363 356
172 3300005535 Ga0070684_100183679 Ga0070684_1001836791 356
173 3300005539 Ga0068853_100005226 Ga0068853_1000052262 356
174 3300005549 Ga0070704_100106637 Ga0070704_1001066372 356
175 3300005577 Ga0068857_100014683 Ga0068857_1000146834 356
176 3300006358 Ga0068871_100345905 Ga0068871_1003459051 356
177 3300010375 Ga0105239_10049046 Ga0105239_100490463 356
178 3300021388 Ga0213875_10113003 Ga0213875_101130031 356
179 3300025912 Ga0207707_10027445 Ga0207707_100274453 356
180 3300026041 Ga0207639_10014520 Ga0207639_100145202 356
181 3300026075 Ga0207708_10010991 Ga0207708_100109914 356
182 3300026089 Ga0207648_10012752 Ga0207648_100127523 356
183 3300026116 Ga0207674_10013781 Ga0207674_100137814 356
184 3300039447 Ga0436361_0711176 Ga0436361_0711176_16353_17483 356
185 3300009545 Ga0105237_10040903 Ga0105237_100409032 357
186 3300010375 Ga0105239_10031510 Ga0105239_100315103 357
187 3300025903 Ga0207680_10026036 Ga0207680_100260362 357
188 3300025941 Ga0207711_10005401 Ga0207711_100054014 357
189 3300031249 Ga0265339_10116574 Ga0265339_101165741 357
190 3300049571 Ga0501034_0040217 Ga0501034_0040217_2144_3283 357
191 iso_pu_bacteria 3003665799 3003672581 357
192 iso_pu_bacteria 2545555834 2545676621 358
193 iso_pu_bacteria 2545555834 2545678861 358
194 iso_pu_bacteria 2889306138 2889309714 358
195 iso_pu_bacteria 2902405164 2902406588 358
196 iso_pu_bacteria 641522639 641646578 358
197 iso_pu_bacteria 2508501128 2509149322 359
198 iso_pu_bacteria 2513237096 2513654066 359
199 iso_pu_bacteria 2513237098 2513679249 359
200 iso_pu_bacteria 2513237137 2513856818 359
201 iso_pu_bacteria 2513237141 2513891274 359
202 iso_pu_bacteria 2513237145 2513918406 359
203 iso_pu_bacteria 2517572143 2517891360 359
204 iso_pu_bacteria 2524023210 2524468459 359
205 iso_pu_bacteria 2524023228 2524538454 359
206 iso_pu_bacteria 2528768022 2528849003 359
207 iso_pu_bacteria 2602042107 2603860920 359
208 iso_pu_bacteria 2643221651 2644291335 359
209 iso_pu_bacteria 2667528175 2671118860 359
210 iso_pu_bacteria 2728368998 2728750072 359
211 iso_pu_bacteria 2791355197 2793066728 359
212 iso_pu_bacteria 2818991467 2819721080 359
213 iso_pu_bacteria 2824600985 2824606556 359
214 iso_pu_bacteria 2824609381 2824613027 359
215 iso_pu_bacteria 2824653114 2824658520 359
216 iso_pu_bacteria 2824661429 2824666465 359
217 iso_pu_bacteria 2824704595 2824710252 359
218 iso_pu_bacteria 2824753945 2824755960 359
219 iso_pu_bacteria 2824763712 2824767498 359
220 iso_pu_bacteria 2841911363 2841914929 359
221 iso_pu_bacteria 2841917233 2841920454 359
222 iso_pu_bacteria 2857524615 2857524628 359
223 iso_pu_bacteria 2874628541 2874635028 359
224 iso_pu_bacteria 2879099564 2879107110 359
225 iso_pu_bacteria 2885374607 2885374985 359
226 iso_pu_bacteria 2885383462 2885384040 359
227 iso_pu_bacteria 2885409591 2885410285 359
228 iso_pu_bacteria 2888388044 2888392804 359
229 iso_pu_bacteria 2888419890 2888425562 359
230 iso_pu_bacteria 2893066018 2893069149 359
231 iso_pu_bacteria 2903748898 2903755321 359
232 iso_pu_bacteria 2903768456 2903769708 359
233 iso_pu_bacteria 2904690495 2904691228 359
234 iso_pu_bacteria 2904699407 2904701314 359
235 iso_pu_bacteria 2904711408 2904711995 359
236 iso_pu_bacteria 2906610324 2906616546 359
237 iso_pu_bacteria 2906635258 2906635319 359
238 iso_pu_bacteria 2906660503 2906666864 359
239 iso_pu_bacteria 2908739725 2908741714 359
240 iso_pu_bacteria 2908756301 2908759131 359
241 iso_pu_bacteria 2919073203 2919078510 359
242 iso_pu_bacteria 2922425934 2922431434 359
243 iso_pu_bacteria 2929615660 2929621001 359
244 iso_pu_bacteria 2929624759 2929626168 359
245 iso_pu_bacteria 2932784394 2932784953 359
246 iso_pu_bacteria 2932809354 2932809985 359
247 iso_pu_bacteria 2932818245 2932818272 359
248 iso_pu_bacteria 2932828146 2932828790 359
249 iso_pu_bacteria 2933577622 2933583129 359
250 iso_pu_bacteria 2935616580 2935619790 359
251 iso_pu_bacteria 2935630451 2935634030 359
252 iso_pu_bacteria 2935638405 2935638771 359
253 iso_pu_bacteria 2935665750 2935666378 359
254 iso_pu_bacteria 2935675223 2935676576 359
255 iso_pu_bacteria 2935684952 2935684959 359
256 iso_pu_bacteria 2935694250 2935694656 359
257 iso_pu_bacteria 2935703347 2935703777 359
258 iso_pu_bacteria 2935713505 2935713512 359
259 iso_pu_bacteria 2935722832 2935724132 359
260 iso_pu_bacteria 2935732158 2935733510 359
261 iso_pu_bacteria 2935741537 2935742889 359
262 iso_pu_bacteria 2935750917 2935750924 359
263 iso_pu_bacteria 2935760218 2935760545 359
264 iso_pu_bacteria 2935801545 2935801914 359
265 iso_pu_bacteria 2935810662 2935810685 359
266 iso_pu_bacteria 2935827899 2935828265 359
267 iso_pu_bacteria 2935837841 2935842469 359
268 iso_pu_bacteria 2935855204 2935857895 359
269 iso_pu_bacteria 2935864058 2935868763 359
270 iso_pu_bacteria 2935873716 2935874178 359
271 iso_pu_bacteria 2935959822 2935966604 359
272 iso_pu_bacteria 2935992306 2935992897 359
273 iso_pu_bacteria 2936002035 2936002810 359
274 iso_pu_bacteria 2936037263 2936037895 359
275 iso_pu_bacteria 2940556831 2940558273 359
276 iso_pu_bacteria 2941507105 2941510667 359
277 iso_pu_bacteria 2941515067 2941518051 359
278 iso_pu_bacteria 2941523033 2941527078 359
279 iso_pu_bacteria 2941531003 2941531185 359
280 iso_pu_bacteria 2941538514 2941542518 359
281 iso_pu_bacteria 3005474847 3005481227 359
282 iso_pu_bacteria 643348564 643604158 359
283 iso_pu_bacteria 8006933436 8006939482 359
284 iso_pu_bacteria 8006973647 8006979232 359
285 iso_pu_bacteria 8016511872 8016520684 359
286 iso_pu_bacteria 8017057580 8017064899 359
287 iso_pu_bacteria 8019565922 8019575460 359
288 iso_pu_bacteria 8019576017 8019584275 359
289 iso_pu_bacteria 8019586578 8019592043 359
290 iso_pu_bacteria 8055742211 8055745136 359
291 iso_pu_bacteria 8056681323 8056684831 359
292 iso_pu_bacteria 8056689827 8056693086 359
293 3300021384 Ga0213876_10015648 Ga0213876_100156483 360
294 3300005355 Ga0070671_100166109 Ga0070671_1001661091 361
295 3300005356 Ga0070674_100011306 Ga0070674_1000113061 361
296 3300005434 Ga0070709_10109435 Ga0070709_101094351 361
297 3300005435 Ga0070714_100118970 Ga0070714_1001189702 361
298 3300005437 Ga0070710_10007564 Ga0070710_100075643 361
299 3300005439 Ga0070711_100030771 Ga0070711_1000307713 361
300 3300005457 Ga0070662_100052429 Ga0070662_1000524293 361
301 3300005545 Ga0070695_100130261 Ga0070695_1001302612 361
302 3300005546 Ga0070696_100150471 Ga0070696_1001504712 361
303 3300005718 Ga0068866_10005233 Ga0068866_100052335 361
304 3300005843 Ga0068860_100223015 Ga0068860_1002230151 361
305 3300006163 Ga0070715_10007578 Ga0070715_100075782 361
306 3300006173 Ga0070716_100008237 Ga0070716_1000082373 361
307 3300006175 Ga0070712_100018815 Ga0070712_1000188153 361
308 3300006881 Ga0068865_100143700 Ga0068865_1001437001 361
309 3300007265 Ga0099794_10013294 Ga0099794_100132943 361
310 3300009176 Ga0105242_10015686 Ga0105242_100156865 361
311 3300009553 Ga0105249_10022766 Ga0105249_100227662 361
312 3300013297 Ga0157378_10202534 Ga0157378_102025342 361
313 3300013306 Ga0163162_10017979 Ga0163162_100179793 361
314 3300017792 Ga0163161_10013681 Ga0163161_100136816 361
315 3300025915 Ga0207693_10017378 Ga0207693_100173783 361
316 3300025929 Ga0207664_10173003 Ga0207664_101730032 361
317 3300025934 Ga0207686_10008261 Ga0207686_100082616 361
318 3300025937 Ga0207669_10019350 Ga0207669_100193501 361
319 3300025939 Ga0207665_10084398 Ga0207665_100843982 361
320 3300025972 Ga0207668_10025027 Ga0207668_100250272 361
321 3300028381 Ga0268264_10206852 Ga0268264_102068521 361
322 3300046459 Ga0495629_0055657 Ga0495629_0055657_1582_2724 361
323 3300046516 Ga0495628_0009755 Ga0495628_0009755_4455_5597 361
324 3300046517 Ga0495630_0044051 Ga0495630_0044051_605_1747 361
325 3300046524 Ga0495648_0000936 Ga0495648_0000936_29057_30202 361
326 3300046533 Ga0495640_0070999 Ga0495640_0070999_959_2101 361
327 3300046536 Ga0495587_0068567 Ga0495587_0068567_597_1739 361
328 3300046543 Ga0495645_0015499 Ga0495645_0015499_3978_5120 361
329 3300047317 Ga0495604_0078254 Ga0495604_0078254_973_2115 361
330 3300048903 Ga0496100_0010201 Ga0496100_0010201_416_1567 361
331 3300048910 Ga0496107_0145214 Ga0496107_0145214_183_1334 361
332 3300048917 Ga0496114_0253233 Ga0496114_0253233_94_1245 361
333 3300048918 Ga0496115_0018795 Ga0496115_0018795_4101_5252 361
334 3300048929 Ga0496126_0216878 Ga0496126_0216878_419_1561 361
335 3300053150 Ga0500603_007453 Ga0500603_007453_299_1444 361
336 3300005336 Ga0070680_100095809 Ga0070680_1000958091 362
337 3300005337 Ga0070682_100039753 Ga0070682_1000397532 362
338 3300005436 Ga0070713_100036700 Ga0070713_1000367003 362
339 3300005436 Ga0070713_100099861 Ga0070713_1000998612 362
340 3300005437 Ga0070710_10013736 Ga0070710_100137361 362
341 3300005458 Ga0070681_10056849 Ga0070681_100568492 362
342 3300005530 Ga0070679_100009864 Ga0070679_1000098645 362
343 3300005530 Ga0070679_100017715 Ga0070679_1000177153 362
344 3300005577 Ga0068857_100067452 Ga0068857_1000674523 362
345 3300006175 Ga0070712_100008500 Ga0070712_1000085003 362
346 3300009093 Ga0105240_10250952 Ga0105240_102509522 362
347 3300009174 Ga0105241_10083123 Ga0105241_100831232 362
348 3300009551 Ga0105238_10035145 Ga0105238_100351453 362
349 3300009551 Ga0105238_10270458 Ga0105238_102704582 362
350 3300013105 Ga0157369_10041431 Ga0157369_100414315 362
351 3300013296 Ga0157374_10023179 Ga0157374_100231793 362
352 3300025912 Ga0207707_10002868 Ga0207707_100028687 362
353 3300025915 Ga0207693_10099089 Ga0207693_100990892 362
354 3300025916 Ga0207663_10003400 Ga0207663_100034007 362
355 3300025921 Ga0207652_10009155 Ga0207652_100091553 362
356 3300025928 Ga0207700_10083561 Ga0207700_100835612 362
357 3300025949 Ga0207667_10034874 Ga0207667_100348744 362
358 3300025949 Ga0207667_10153242 Ga0207667_101532422 362
359 3300026116 Ga0207674_10151454 Ga0207674_101514542 362
360 3300031235 Ga0265330_10067773 Ga0265330_100677732 362
361 3300031241 Ga0265325_10027647 Ga0265325_100276472 362
362 3300031250 Ga0265331_10042854 Ga0265331_100428541 362
363 3300035083 Ga0373926_0007554 Ga0373926_0007554_417_1562 362
364 3300035120 Ga0373957_0069054 Ga0373957_0069054_51_1196 362
365 3300035170 Ga0373943_0040178 Ga0373943_0040178_315_1460 362
366 3300035410 Ga0373924_0022355 Ga0373924_0022355_600_1745 362
367 3300035692 Ga0373935_0060625 Ga0373935_0060625_420_1565 362
368 3300035695 Ga0373927_0014717 Ga0373927_0014717_1089_2234 362
369 3300035695 Ga0373927_0049560 Ga0373927_0049560_949_2094 362
370 3300036401 Ga0373937_0027665 Ga0373937_0027665_2832_3977 362
371 3300036401 Ga0373937_0041387 Ga0373937_0041387_1305_2450 362
372 3300037068 Ga0373925_0025108 Ga0373925_0025108_1781_2926 362
373 3300044735 Ga0466968_0007831 Ga0466968_0007831_2813_3976 362
374 3300046454 Ga0495592_0068940 Ga0495592_0068940_264_1409 362
375 3300046455 Ga0495603_0008150 Ga0495603_0008150_309_1454 362
376 3300046459 Ga0495629_0071868 Ga0495629_0071868_851_1996 362
377 3300046472 Ga0495580_0010268 Ga0495580_0010268_1452_2597 362
378 3300046476 Ga0495662_0099452 Ga0495662_0099452_257_1402 362
379 3300046517 Ga0495630_0029536 Ga0495630_0029536_2655_3800 362
380 3300046531 Ga0495665_0005176 Ga0495665_0005176_5121_6266 362
381 3300046533 Ga0495640_0003929 Ga0495640_0003929_645_1790 362
382 3300046674 Ga0495588_0052369 Ga0495588_0052369_534_1679 362
383 3300046680 Ga0495646_0072488 Ga0495646_0072488_254_1399 362
384 3300046690 Ga0495624_0075840 Ga0495624_0075840_487_1632 362
385 3300047315 Ga0495581_0011818 Ga0495581_0011818_950_2095 362
386 3300047319 Ga0495674_0004525 Ga0495674_0004525_10871_12016 362
387 3300047320 Ga0495672_0027522 Ga0495672_0027522_112_1257 362
388 3300047471 Ga0495684_0028441 Ga0495684_0028441_3069_4214 362
389 3300047673 Ga0495593_0038320 Ga0495593_0038320_1187_2332 362
390 3300048916 Ga0496113_0206442 Ga0496113_0206442_190_1335 362
391 3300048929 Ga0496126_0015906 Ga0496126_0015906_4691_5836 362
392 3300053080 Ga0500635_0004481 Ga0500635_0004481_480_1625 362
393 3300053102 Ga0500554_000804 Ga0500554_000804_3961_5106 362
394 3300053150 Ga0500603_000465 Ga0500603_000465_3834_4979 362
395 3300053178 Ga0500637_0008272 Ga0500637_0008272_1338_2483 362
396 3300000549 LJQas_1003880 LJQas_10038802 363
397 3300003187 JGI25151J46595_10000038 JGI25151J46595_10000038196 363
398 3300003187 JGI25151J46595_10000044 JGI25151J46595_10000044165 363
399 3300003215 JGI25153J46596_10011922 JGI25153J46596_100119221 363
400 3300003771 Ga0055526_1000390 Ga0055526_100039025 363
401 3300003771 Ga0055526_1004359 Ga0055526_10043597 363
402 3300003775 Ga0055524_1000035 Ga0055524_100003572 363
403 3300005262 Ga0065165_1002220 Ga0065165_10022205 363
404 3300005329 Ga0070683_100022143 Ga0070683_1000221432 363
405 3300005335 Ga0070666_10225926 Ga0070666_102259261 363
406 3300005336 Ga0070680_100292187 Ga0070680_1002921871 363
407 3300005338 Ga0068868_100034182 Ga0068868_1000341825 363
408 3300005339 Ga0070660_100019918 Ga0070660_1000199183 363
409 3300005339 Ga0070660_100051646 Ga0070660_1000516464 363
410 3300005344 Ga0070661_100178530 Ga0070661_1001785302 363
411 3300005364 Ga0070673_100065918 Ga0070673_1000659183 363
412 3300005434 Ga0070709_10000203 Ga0070709_1000020319 363
413 3300005435 Ga0070714_100021335 Ga0070714_1000213354 363
414 3300005437 Ga0070710_10002700 Ga0070710_100027002 363
415 3300005439 Ga0070711_100001730 Ga0070711_1000017309 363
416 3300005439 Ga0070711_100011047 Ga0070711_1000110475 363
417 3300005455 Ga0070663_100010941 Ga0070663_1000109414 363
418 3300005455 Ga0070663_100034586 Ga0070663_1000345864 363
419 3300005467 Ga0070706_100139385 Ga0070706_1001393852 363
420 3300005468 Ga0070707_100385593 Ga0070707_1003855931 363
421 3300005530 Ga0070679_100056049 Ga0070679_1000560492 363
422 3300005535 Ga0070684_100135289 Ga0070684_1001352892 363
423 3300005539 Ga0068853_100040363 Ga0068853_1000403635 363
424 3300005539 Ga0068853_100297183 Ga0068853_1002971831 363
425 3300005548 Ga0070665_100016962 Ga0070665_1000169623 363
426 3300005548 Ga0070665_100108533 Ga0070665_1001085332 363
427 3300005563 Ga0068855_100067952 Ga0068855_1000679522 363
428 3300005564 Ga0070664_100019919 Ga0070664_1000199193 363
429 3300005577 Ga0068857_100016047 Ga0068857_1000160473 363
430 3300005578 Ga0068854_100022014 Ga0068854_1000220143 363
431 3300005614 Ga0068856_100003347 Ga0068856_1000033479 363
432 3300005618 Ga0068864_100262416 Ga0068864_1002624162 363
433 3300005834 Ga0068851_10004825 Ga0068851_100048252 363
434 3300005983 Ga0081540_1009663 Ga0081540_10096635 363
435 3300005983 Ga0081540_1020917 Ga0081540_10209174 363
436 3300006028 Ga0070717_10070357 Ga0070717_100703572 363
437 3300006038 Ga0075365_10009687 Ga0075365_100096873 363
438 3300006038 Ga0075365_10053068 Ga0075365_100530682 363
439 3300006048 Ga0075363_100087469 Ga0075363_1000874692 363
440 3300006163 Ga0070715_10036971 Ga0070715_100369712 363
441 3300006173 Ga0070716_100002283 Ga0070716_1000022836 363
442 3300006175 Ga0070712_100231788 Ga0070712_1002317881 363
443 3300006881 Ga0068865_100130527 Ga0068865_1001305272 363
444 3300006942 Ga0099824_1007408 Ga0099824_10074083 363
445 3300006943 Ga0099822_1006547 Ga0099822_100654710 363
446 3300007788 Ga0099795_10026375 Ga0099795_100263752 363
447 3300009093 Ga0105240_10006298 Ga0105240_1000629819 363
448 3300009093 Ga0105240_10006694 Ga0105240_100066943 363
449 3300009093 Ga0105240_10027880 Ga0105240_100278802 363
450 3300009093 Ga0105240_10034221 Ga0105240_100342211 363
451 3300009098 Ga0105245_10028645 Ga0105245_100286453 363
452 3300009101 Ga0105247_10100082 Ga0105247_101000822 363
453 3300009177 Ga0105248_10228922 Ga0105248_102289222 363
454 3300009545 Ga0105237_10047694 Ga0105237_100476943 363
455 3300009545 Ga0105237_10058418 Ga0105237_100584183 363
456 3300009545 Ga0105237_10058572 Ga0105237_100585722 363
457 3300009545 Ga0105237_10175266 Ga0105237_101752662 363
458 3300009551 Ga0105238_10006294 Ga0105238_100062942 363
459 3300009551 Ga0105238_10017402 Ga0105238_100174022 363
460 3300009551 Ga0105238_10164063 Ga0105238_101640632 363
461 3300010159 Ga0099796_10011104 Ga0099796_100111042 363
462 3300010159 Ga0099796_10011436 Ga0099796_100114362 363
463 3300010375 Ga0105239_10001588 Ga0105239_100015882 363
464 3300010375 Ga0105239_10074287 Ga0105239_100742872 363
465 3300011119 Ga0105246_10006885 Ga0105246_100068852 363
466 3300013104 Ga0157370_10025078 Ga0157370_100250783 363
467 3300013105 Ga0157369_10021190 Ga0157369_100211906 363
468 3300013296 Ga0157374_10033305 Ga0157374_100333055 363
469 3300013306 Ga0163162_10031442 Ga0163162_100314422 363
470 3300013306 Ga0163162_10317323 Ga0163162_103173232 363
471 3300013308 Ga0157375_10009689 Ga0157375_100096894 363
472 3300013308 Ga0157375_10185725 Ga0157375_101857252 363
473 3300014325 Ga0163163_10011315 Ga0163163_100113155 363
474 3300014325 Ga0163163_10192425 Ga0163163_101924251 363
475 3300014968 Ga0157379_10077884 Ga0157379_100778843 363
476 3300014968 Ga0157379_10313650 Ga0157379_103136501 363
477 3300014969 Ga0157376_10055672 Ga0157376_100556722 363
478 3300017792 Ga0163161_10206783 Ga0163161_102067831 363
479 3300021358 Ga0213873_10008935 Ga0213873_100089351 363
480 3300021358 Ga0213873_10013089 Ga0213873_100130892 363
481 3300021377 Ga0213874_10015102 Ga0213874_100151021 363
482 3300021384 Ga0213876_10000749 Ga0213876_1000074910 363
483 3300021384 Ga0213876_10004947 Ga0213876_100049476 363
484 3300021388 Ga0213875_10011228 Ga0213875_100112281 363
485 3300021441 Ga0213871_10000276 Ga0213871_100002765 363
486 3300025230 Ga0209563_103620 Ga0209563_1036203 363
487 3300025253 Ga0209677_100141 Ga0209677_1001413 363
488 3300025253 Ga0209677_102457 Ga0209677_1024572 363
489 3300025261 Ga0209233_1002351 Ga0209233_10023515 363
490 3300025272 Ga0209455_1007127 Ga0209455_10071273 363
491 3300025273 Ga0209673_1023393 Ga0209673_10233932 363
492 3300025291 Ga0209675_1000905 Ga0209675_100090517 363
493 3300025294 Ga0209025_1000014 Ga0209025_1000014190 363
494 3300025295 Ga0209564_1000044 Ga0209564_1000044256 363
495 3300025295 Ga0209564_1000049 Ga0209564_100004916 363
496 3300025297 Ga0209758_1015744 Ga0209758_10157441 363
497 3300025299 Ga0209256_1000014 Ga0209256_1000014623 363
498 3300025299 Ga0209256_1000181 Ga0209256_1000181109 363
499 3300025302 Ga0207426_1010388 Ga0207426_10103882 363
500 3300025898 Ga0207692_10001651 Ga0207692_100016517 363
501 3300025900 Ga0207710_10071136 Ga0207710_100711361 363
502 3300025903 Ga0207680_10212242 Ga0207680_102122421 363
503 3300025906 Ga0207699_10002275 Ga0207699_100022753 363
504 3300025910 Ga0207684_10035847 Ga0207684_100358473 363
505 3300025912 Ga0207707_10000419 Ga0207707_1000041936 363
506 3300025912 Ga0207707_10002705 Ga0207707_100027053 363
507 3300025913 Ga0207695_10022984 Ga0207695_100229849 363
508 3300025913 Ga0207695_10048124 Ga0207695_100481243 363
509 3300025914 Ga0207671_10006837 Ga0207671_100068375 363
510 3300025914 Ga0207671_10029342 Ga0207671_100293423 363
511 3300025914 Ga0207671_10116185 Ga0207671_101161852 363
512 3300025915 Ga0207693_10058489 Ga0207693_100584892 363
513 3300025916 Ga0207663_10045041 Ga0207663_100450412 363
514 3300025917 Ga0207660_10012377 Ga0207660_100123773 363
515 3300025919 Ga0207657_10011308 Ga0207657_100113083 363
516 3300025919 Ga0207657_10046183 Ga0207657_100461832 363
517 3300025921 Ga0207652_10001690 Ga0207652_1000169016 363
518 3300025924 Ga0207694_10004974 Ga0207694_100049742 363
519 3300025927 Ga0207687_10084376 Ga0207687_100843762 363
520 3300025929 Ga0207664_10019520 Ga0207664_100195202 363
521 3300025929 Ga0207664_10055261 Ga0207664_100552612 363
522 3300025933 Ga0207706_10324269 Ga0207706_103242691 363
523 3300025938 Ga0207704_10063904 Ga0207704_100639043 363
524 3300025939 Ga0207665_10005897 Ga0207665_100058974 363
525 3300025941 Ga0207711_10201143 Ga0207711_102011432 363
526 3300025944 Ga0207661_10008213 Ga0207661_100082134 363
527 3300025944 Ga0207661_10218935 Ga0207661_102189352 363
528 3300025945 Ga0207679_10063502 Ga0207679_100635023 363
529 3300025949 Ga0207667_10002017 Ga0207667_100020179 363
530 3300025981 Ga0207640_10052890 Ga0207640_100528903 363
531 3300026023 Ga0207677_10005891 Ga0207677_100058915 363
532 3300026041 Ga0207639_10066716 Ga0207639_100667162 363
533 3300026041 Ga0207639_10119314 Ga0207639_101193141 363
534 3300026067 Ga0207678_10006479 Ga0207678_100064797 363
535 3300026067 Ga0207678_10031213 Ga0207678_100312132 363
536 3300026067 Ga0207678_10036065 Ga0207678_100360654 363
537 3300026067 Ga0207678_10082315 Ga0207678_100823152 363
538 3300026078 Ga0207702_10000548 Ga0207702_1000054826 363
539 3300026095 Ga0207676_10123343 Ga0207676_101233432 363
540 3300026116 Ga0207674_10010575 Ga0207674_100105754 363
541 3300026118 Ga0207675_100082798 Ga0207675_1000827982 363
542 3300026121 Ga0207683_10015560 Ga0207683_100155605 363
543 3300026121 Ga0207683_10016803 Ga0207683_100168034 363
544 3300026142 Ga0207698_10221318 Ga0207698_102213181 363
545 3300026142 Ga0207698_10232731 Ga0207698_102327311 363
546 3300027357 Ga0209589_1000014 Ga0209589_1000014163 363
547 3300027361 Ga0209489_100014 Ga0209489_100014163 363
548 3300027363 Ga0209700_100024 Ga0209700_100024163 363
549 3300027512 Ga0209179_1005504 Ga0209179_10055042 363
550 3300027671 Ga0209588_1039098 Ga0209588_10390981 363
551 3300028379 Ga0268266_10009249 Ga0268266_100092494 363
552 3300030521 Ga0307511_10024264 Ga0307511_100242645 363
553 3300031235 Ga0265330_10022974 Ga0265330_100229742 363
554 3300031239 Ga0265328_10030289 Ga0265328_100302891 363
555 3300031247 Ga0265340_10001085 Ga0265340_100010853 363
556 3300031250 Ga0265331_10041625 Ga0265331_100416252 363
557 3300031251 Ga0265327_10000236 Ga0265327_1000023673 363
558 3300031711 Ga0265314_10004266 Ga0265314_100042669 363
559 3300031711 Ga0265314_10146683 Ga0265314_101466832 363
560 3300031712 Ga0265342_10030008 Ga0265342_100300082 363
561 3300031712 Ga0265342_10070700 Ga0265342_100707002 363
562 3300033179 Ga0307507_10083911 Ga0307507_100839111 363
563 3300033180 Ga0307510_10061882 Ga0307510_100618822 363
564 3300035086 Ga0373934_0033359 Ga0373934_0033359_775_1920 363
565 3300035111 Ga0373923_0009940 Ga0373923_0009940_1213_2358 363
566 3300035111 Ga0373923_0083424 Ga0373923_0083424_202_1347 363
567 3300035113 Ga0373936_0013841 Ga0373936_0013841_748_1893 363
568 3300035113 Ga0373936_0017960 Ga0373936_0017960_893_2038 363
569 3300035117 Ga0373953_0058080 Ga0373953_0058080_153_1298 363
570 3300035118 Ga0373954_0000645 Ga0373954_0000645_6830_7975 363
571 3300035170 Ga0373943_0081606 Ga0373943_0081606_478_1623 363
572 3300035692 Ga0373935_0012897 Ga0373935_0012897_3033_4178 363
573 3300035695 Ga0373927_0045076 Ga0373927_0045076_311_1456 363
574 3300035695 Ga0373927_0111542 Ga0373927_0111542_201_1346 363
575 3300035724 Ga0373933_0003690 Ga0373933_0003690_5111_6256 363
576 3300035724 Ga0373933_0175570 Ga0373933_0175570_124_1269 363
577 3300035724 Ga0373933_0207156 Ga0373933_0207156_35_1180 363
578 3300036401 Ga0373937_0084598 Ga0373937_0084598_1168_2313 363
579 3300036401 Ga0373937_0283900 Ga0373937_0283900_280_1425 363
580 3300037068 Ga0373925_0031128 Ga0373925_0031128_1923_3068 363
581 3300037068 Ga0373925_0101482 Ga0373925_0101482_579_1727 363
582 3300037312 Ga0395899_0063956 Ga0395899_0063956_1551_2696 363
583 3300037418 Ga0395900_0082779 Ga0395900_0082779_1397_2542 363
584 3300037418 Ga0395900_0259525 Ga0395900_0259525_14_1159 363
585 3300037418 Ga0395900_0330718 Ga0395900_0330718_98_1243 363
586 3300037466 Ga0395898_0034204 Ga0395898_0034204_100_1245 363
587 3300037466 Ga0395898_0071593 Ga0395898_0071593_860_2005 363
588 3300037471 Ga0395905_0048596 Ga0395905_0048596_2741_3886 363
589 3300037471 Ga0395905_0131323 Ga0395905_0131323_43_1188 363
590 3300037853 Ga0436364_1009808 Ga0436364_1009808_7691_8836 363
591 3300037853 Ga0436364_1470735 Ga0436364_1470735_2287_3432 363
592 3300039437 Ga0436365_0002039 Ga0436365_0002039_17723_18868 363
593 3300039437 Ga0436365_0693504 Ga0436365_0693504_71137_72282 363
594 3300039450 Ga0436363_0322567 Ga0436363_0322567_7317_8657 363
595 3300039450 Ga0436363_1048610 Ga0436363_1048610_5605_6750 363
596 3300039453 Ga0436362_0442809 Ga0436362_0442809_3159_4304 363
597 3300044706 Ga0466964_0038046 Ga0466964_0038046_519_1664 363
598 3300044842 Ga0466957_0028471 Ga0466957_0028471_1915_3060 363
599 3300045049 Ga0466959_0098882 Ga0466959_0098882_139_1287 363
600 3300045976 Ga0466967_0205162 Ga0466967_0205162_196_1344 363
601 3300046454 Ga0495592_0012242 Ga0495592_0012242_953_2098 363
602 3300046454 Ga0495592_0022948 Ga0495592_0022948_2742_3887 363
603 3300046455 Ga0495603_0003836 Ga0495603_0003836_5013_6158 363
604 3300046455 Ga0495603_0118371 Ga0495603_0118371_321_1466 363
605 3300046459 Ga0495629_0000373 Ga0495629_0000373_7335_8480 363
606 3300046459 Ga0495629_0000862 Ga0495629_0000862_5732_6877 363
607 3300046459 Ga0495629_0018940 Ga0495629_0018940_3031_4176 363
608 3300046461 Ga0495641_0021456 Ga0495641_0021456_123_1268 363
609 3300046462 Ga0495651_0007091 Ga0495651_0007091_4932_6077 363
610 3300046463 Ga0495653_0022804 Ga0495653_0022804_3170_4315 363
611 3300046463 Ga0495653_0036975 Ga0495653_0036975_211_1356 363
612 3300046471 Ga0495650_0075469 Ga0495650_0075469_38_1183 363
613 3300046472 Ga0495580_0086463 Ga0495580_0086463_753_1898 363
614 3300046472 Ga0495580_0087209 Ga0495580_0087209_280_1425 363
615 3300046473 Ga0495582_0006572 Ga0495582_0006572_402_1547 363
616 3300046475 Ga0495639_0023871 Ga0495639_0023871_1125_2270 363
617 3300046476 Ga0495662_0004072 Ga0495662_0004072_706_1851 363
618 3300046477 Ga0495664_0025650 Ga0495664_0025650_294_1439 363
619 3300046499 Ga0495594_0083608 Ga0495594_0083608_614_1759 363
620 3300046507 Ga0495606_0019788 Ga0495606_0019788_2819_3964 363
621 3300046507 Ga0495606_0102246 Ga0495606_0102246_97_1242 363
622 3300046511 Ga0495608_0018583 Ga0495608_0018583_3627_4772 363
623 3300046514 Ga0495618_0027852 Ga0495618_0027852_2306_3451 363
624 3300046516 Ga0495628_0042488 Ga0495628_0042488_1749_2894 363
625 3300046517 Ga0495630_0011058 Ga0495630_0011058_4766_5911 363
626 3300046529 Ga0495652_0023315 Ga0495652_0023315_3966_5111 363
627 3300046529 Ga0495652_0149199 Ga0495652_0149199_480_1625 363
628 3300046531 Ga0495665_0007397 Ga0495665_0007397_2049_3194 363
629 3300046533 Ga0495640_0008396 Ga0495640_0008396_4710_5855 363
630 3300046533 Ga0495640_0037252 Ga0495640_0037252_619_1764 363
631 3300046538 Ga0495609_0046400 Ga0495609_0046400_604_1752 363
632 3300046542 Ga0495597_0053875 Ga0495597_0053875_584_1729 363
633 3300046543 Ga0495645_0083930 Ga0495645_0083930_616_1761 363
634 3300046557 Ga0495622_0006092 Ga0495622_0006092_2089_3234 363
635 3300046616 Ga0495668_0136411 Ga0495668_0136411_175_1320 363
636 3300046642 Ga0495634_0024114 Ga0495634_0024114_1768_2913 363
637 3300046642 Ga0495634_0035525 Ga0495634_0035525_1930_3075 363
638 3300046660 Ga0495625_0140248 Ga0495625_0140248_270_1415 363
639 3300046663 Ga0495635_0007185 Ga0495635_0007185_2614_3759 363
640 3300046674 Ga0495588_0046261 Ga0495588_0046261_26_1171 363
641 3300046675 Ga0495657_0051454 Ga0495657_0051454_1468_2613 363
642 3300046679 Ga0495623_0131031 Ga0495623_0131031_303_1448 363
643 3300046680 Ga0495646_0051528 Ga0495646_0051528_43_1188 363
644 3300046683 Ga0495658_0005818 Ga0495658_0005818_2811_3956 363
645 3300046689 Ga0495613_0007707 Ga0495613_0007707_1991_3136 363
646 3300046689 Ga0495613_0013842 Ga0495613_0013842_3606_4751 363
647 3300046690 Ga0495624_0193246 Ga0495624_0193246_22_1167 363
648 3300046809 Ga0495600_0026321 Ga0495600_0026321_2091_3236 363
649 3300046809 Ga0495600_0054621 Ga0495600_0054621_367_1512 363
650 3300047315 Ga0495581_0026865 Ga0495581_0026865_1188_2333 363
651 3300047317 Ga0495604_0013854 Ga0495604_0013854_4661_5806 363
652 3300047317 Ga0495604_0114136 Ga0495604_0114136_106_1251 363
653 3300047317 Ga0495604_0116832 Ga0495604_0116832_136_1281 363
654 3300047319 Ga0495674_0008459 Ga0495674_0008459_5749_6894 363
655 3300047319 Ga0495674_0056952 Ga0495674_0056952_1884_3029 363
656 3300047471 Ga0495684_0015794 Ga0495684_0015794_115_1260 363
657 3300047472 Ga0495686_0001093 Ga0495686_0001093_10507_11655 363
658 3300047472 Ga0495686_0092699 Ga0495686_0092699_364_1509 363
659 3300047472 Ga0495686_0105256 Ga0495686_0105256_258_1406 363
660 3300047673 Ga0495593_0008449 Ga0495593_0008449_4404_5549 363
661 3300048088 Ga0495602_0023629 Ga0495602_0023629_3792_4937 363
662 3300048088 Ga0495602_0128040 Ga0495602_0128040_73_1218 363
663 3300048903 Ga0496100_0027311 Ga0496100_0027311_679_1836 363
664 3300048904 Ga0496101_0002052 Ga0496101_0002052_3181_4338 363
665 3300048905 Ga0496102_0001771 Ga0496102_0001771_12277_13434 363
666 3300048905 Ga0496102_0276628 Ga0496102_0276628_230_1375 363
667 3300048906 Ga0496103_0005699 Ga0496103_0005699_3816_4973 363
668 3300048906 Ga0496103_0020532 Ga0496103_0020532_2392_3540 363
669 3300048907 Ga0496104_0037726 Ga0496104_0037726_444_1589 363
670 3300048907 Ga0496104_0048391 Ga0496104_0048391_1848_2996 363
671 3300048907 Ga0496104_0066770 Ga0496104_0066770_266_1411 363
672 3300048908 Ga0496105_0011039 Ga0496105_0011039_5705_6850 363
673 3300048908 Ga0496105_0042795 Ga0496105_0042795_845_1990 363
674 3300048909 Ga0496106_0002858 Ga0496106_0002858_7954_9111 363
675 3300048909 Ga0496106_0069924 Ga0496106_0069924_255_1400 363
676 3300048910 Ga0496107_0002387 Ga0496107_0002387_7957_9114 363
677 3300048910 Ga0496107_0034319 Ga0496107_0034319_966_2111 363
678 3300048911 Ga0496108_0016020 Ga0496108_0016020_3181_4338 363
679 3300048912 Ga0496109_0007060 Ga0496109_0007060_2546_3703 363
680 3300048913 Ga0496110_0015025 Ga0496110_0015025_1610_2767 363
681 3300048913 Ga0496110_0111226 Ga0496110_0111226_1088_2236 363
682 3300048914 Ga0496111_0035529 Ga0496111_0035529_1087_2244 363
683 3300048915 Ga0496112_0042097 Ga0496112_0042097_1088_2233 363
684 3300048917 Ga0496114_0111205 Ga0496114_0111205_943_2088 363
685 3300048918 Ga0496115_0000535 Ga0496115_0000535_21501_22658 363
686 3300048919 Ga0496116_0043047 Ga0496116_0043047_1316_2461 363
687 3300048920 Ga0496117_0081608 Ga0496117_0081608_579_1724 363
688 3300048921 Ga0496118_0020073 Ga0496118_0020073_2341_3486 363
689 3300048922 Ga0496119_0007752 Ga0496119_0007752_5788_6933 363
690 3300048924 Ga0496121_0000230 Ga0496121_0000230_74435_75580 363
691 3300048924 Ga0496121_0013403 Ga0496121_0013403_4808_5953 363
692 3300048924 Ga0496121_0016583 Ga0496121_0016583_4760_5908 363
693 3300048924 Ga0496121_0025042 Ga0496121_0025042_238_1383 363
694 3300048924 Ga0496121_0064434 Ga0496121_0064434_826_1971 363
695 3300048924 Ga0496121_0133432 Ga0496121_0133432_244_1389 363
696 3300048925 Ga0496122_0037590 Ga0496122_0037590_1798_2952 363
697 3300048926 Ga0496123_0016263 Ga0496123_0016263_3716_4870 363
698 3300048927 Ga0496124_0095175 Ga0496124_0095175_612_1757 363
699 3300048928 Ga0496125_0047371 Ga0496125_0047371_1021_2166 363
700 3300048929 Ga0496126_0002483 Ga0496126_0002483_8380_9528 363
701 3300048929 Ga0496126_0005712 Ga0496126_0005712_4197_5342 363
702 3300048929 Ga0496126_0006690 Ga0496126_0006690_5113_6276 363
703 3300048929 Ga0496126_0043030 Ga0496126_0043030_2139_3284 363
704 3300048929 Ga0496126_0060499 Ga0496126_0060499_126_1271 363
705 3300048929 Ga0496126_0064515 Ga0496126_0064515_1999_3144 363
706 3300049460 Ga0495682_0026810 Ga0495682_0026810_386_1531 363
707 3300050492 nmdc:mga0yw44_15006_c1 nmdc:mga0yw44_15006_c1_2667_3812 363
708 3300050492 nmdc:mga0yw44_35778_c1 nmdc:mga0yw44_35778_c1_1412_2557 363
709 3300050493 nmdc:mga0k408_77126_c1 nmdc:mga0k408_77126_c1_331_1476 363
710 3300050494 nmdc:mga06z11_4857_c1 nmdc:mga06z11_4857_c1_2076_3221 363
711 3300050496 nmdc:mga07m45_745_c1 nmdc:mga07m45_745_c1_2267_3412 363
712 3300053084 Ga0495595_0102635 Ga0495595_0102635_183_1328 363
713 3300053085 Ga0495619_0009769 Ga0495619_0009769_4767_5912 363
714 3300053094 Ga0500566_0000158 Ga0500566_0000158_3609_4754 363
715 3300053094 Ga0500566_0013617 Ga0500566_0013617_1157_2302 363
716 3300053095 Ga0500640_000568 Ga0500640_000568_6621_7766 363
717 3300053102 Ga0500554_001364 Ga0500554_001364_1345_2490 363
718 3300053108 Ga0500562_013148 Ga0500562_013148_82_1230 363
719 3300053111 Ga0500572_000024 Ga0500572_000024_2669_3814 363
720 3300053111 Ga0500572_000858 Ga0500572_000858_2777_3922 363
721 3300053115 Ga0500591_027635 Ga0500591_027635_908_2053 363
722 3300053119 Ga0500595_000537 Ga0500595_000537_6040_7185 363
723 3300053119 Ga0500595_001188 Ga0500595_001188_3011_4159 363
724 3300053119 Ga0500595_014349 Ga0500595_014349_45_1190 363
725 3300053122 Ga0500608_001300 Ga0500608_001300_28_1173 363
726 3300053122 Ga0500608_033147 Ga0500608_033147_721_1866 363
727 3300053136 Ga0500559_0001379 Ga0500559_0001379_2620_3765 363
728 3300053136 Ga0500559_0003877 Ga0500559_0003877_4863_6008 363
729 3300053150 Ga0500603_000902 Ga0500603_000902_177_1322 363
730 3300053153 Ga0500616_0000028 Ga0500616_0000028_73361_74509 363
731 3300053153 Ga0500616_0043984 Ga0500616_0043984_358_1503 363
732 3300053159 Ga0500630_000112 Ga0500630_000112_19512_20657 363
733 3300053162 Ga0500638_001161 Ga0500638_001161_2698_3843 363
734 3300053163 Ga0500639_000040 Ga0500639_000040_25834_26979 363
735 3300053163 Ga0500639_021288 Ga0500639_021288_748_1893 363
736 3300053177 Ga0500636_0000365 Ga0500636_0000365_14779_15924 363
737 3300053177 Ga0500636_0012352 Ga0500636_0012352_3539_4693 363
738 3300053177 Ga0500636_0113358 Ga0500636_0113358_146_1291 363
739 3300053177 Ga0500636_0121323 Ga0500636_0121323_10_1155 363
740 3300053178 Ga0500637_0000042 Ga0500637_0000042_6434_7579 363
741 3300053178 Ga0500637_0063515 Ga0500637_0063515_745_1893 363
742 3300053729 Ga0500625_078487 Ga0500625_078487_256_1401 363
743 3300053730 Ga0500645_006583 Ga0500645_006583_2661_3806 363
744 3300053733 Ga0500552_002567 Ga0500552_002567_370_1518 363
745 3300053737 Ga0500601_000203 Ga0500601_000203_10667_11812 363
746 3300055283 Ga0500661_000056 Ga0500661_000056_10368_11513 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13433

Peripla_BP_5

Periplasmic binding protein domain

32

127

0.94

PF13458

Peripla_BP_6

Periplasmic binding protein

31

371

0.93

PF01094

ANF_receptor

Receptor family ligand binding region

50

368

0.83

PF13433

Peripla_BP_5

Periplasmic binding protein domain

146

368

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.9355 32 360
4q6w-assembly1.cif.gz_A crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid 0.9205 31 356
4obb-assembly2.cif.gz_B the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. 0.914 31 357
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9107 31 357
3sg0-assembly1.cif.gz_A the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.9084 32 356
ID Description Score Start End Superfamily
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9312 151 276 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9198 151 276 3.40.50.2300
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9191 151 277 3.40.50.2300
3hutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9167 149 281 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9148 32 345 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A847NCB7-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9717 29 205
AF-A0A7C7DJU6-F1-model_v4 ABC transporter substrate-binding protein 0.9541 31 361 GO:0006865
AF-A9WLT8-F1-model_v4 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein 0.9452 52 270
AF-A0A523TX78-F1-model_v4 Leucine-binding protein domain-containing protein 0.9447 30 357 GO:0006865
GO:0016020
AF-A0A2G9ZTJ8-F1-model_v4 Leucine-binding protein domain-containing protein 0.9437 115 276

Feature Viewer

pLDDT pTM Quality
91.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map