F478839

General Info

Members Datasets Scaffolds Average Seq Length
746 220 742 151

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10019611|Ga0070658_100196114
Length 181
Sequence VKRLHVHVGVTDLDQSIRFYSTLFAAEPSVIKKDYAKWMLDDPRVNFAISVGQRTAKGIEHLGIQAENLDELGEVYGRLKVADRQVLEEGATTCCYAKSEKSWIADPDGIVWEAFFTNGEATVYGDSPTLSVISDNAADDACCTPAMPSAEPAPVAAATKRHERAFHAADKYEGVSDRVRT

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
3 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
4 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
208 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
211 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
212 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 0.8
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003050 3300001904 Bacteria 2927
2 JGI24736J21556_1006376 3300001904 Bacteria 1985
3 JGI24740J21852_10001530 3300001979 Bacteria 10629
4 JGI24739J22299_10000816 3300001989 Bacteria 11417
5 JGI24737J22298_10000296 3300001990 Bacteria 16530
6 JGI24737J22298_10001986 3300001990 Bacteria 7310
7 JGI24743J22301_10043019 3300001991 Bacteria 910
8 JGI24735J21928_10010173 3300002067 Bacteria 3005
9 JGI24738J21930_10000065 3300002075 Bacteria 21949
10 JGI24034J26672_10001309 3300002239 Bacteria 3281
11 JGI24742J22300_10022430 3300002244 Bacteria 1082
12 JGI24751J29686_10069004 3300002459 Bacteria 728
13 Ga0055536_1011948 3300003781 Bacteria 3270
14 Ga0065715_10105120 3300005293 Bacteria 2913
15 Ga0065715_10155685 3300005293 Bacteria 1680
16 Ga0070658_10019611 3300005327 Bacteria 5414
17 Ga0070658_10184707 3300005327 Bacteria 1755
18 Ga0070658_10686357 3300005327 Bacteria 889
19 Ga0070676_10004904 3300005328 Bacteria 7089
20 Ga0070683_100428677 3300005329 Bacteria 1262
21 Ga0070683_101895692 3300005329 Bacteria 573
22 Ga0070690_100004600 3300005330 Bacteria 7674
23 Ga0070690_100560041 3300005330 Bacteria 863
24 Ga0070670_100008638 3300005331 Bacteria 8695
25 Ga0070670_100107489 3300005331 Bacteria 2404
26 Ga0070670_100146356 3300005331 Bacteria 2044
27 Ga0070677_10000855 3300005333 Bacteria 10030
28 Ga0070677_10013352 3300005333 Bacteria 2871
29 Ga0068869_100000215 3300005334 Bacteria 30140
30 Ga0068869_100010224 3300005334 Bacteria 6111
31 Ga0070666_10083844 3300005335 Bacteria 2181
32 Ga0070666_10103898 3300005335 Bacteria 1960
33 Ga0070666_10115718 3300005335 Bacteria 1857
34 Ga0070666_10150119 3300005335 Bacteria 1626
35 Ga0070666_11056361 3300005335 Bacteria 603
36 Ga0070682_100041381 3300005337 Bacteria 2840
37 Ga0068868_100000041 3300005338 Bacteria 69601
38 Ga0068868_101596486 3300005338 Bacteria 613
39 Ga0070660_100003237 3300005339 Bacteria 11177
40 Ga0070660_100006747 3300005339 Bacteria 7963
41 Ga0070660_100088940 3300005339 Bacteria 2433
42 Ga0070660_101012651 3300005339 Bacteria 702
43 Ga0070661_100000202 3300005344 Bacteria 49212
44 Ga0070661_100025208 3300005344 Bacteria 4273
45 Ga0070661_100057413 3300005344 Bacteria 2852
46 Ga0070661_100226765 3300005344 Bacteria 1435
47 Ga0070661_100229083 3300005344 Bacteria 1428
48 Ga0070661_100472726 3300005344 Bacteria 1000
49 Ga0070692_10014846 3300005345 Bacteria 3669
50 Ga0070668_100000058 3300005347 Bacteria 69744
51 Ga0070668_100003957 3300005347 Bacteria 10951
52 Ga0070668_100017983 3300005347 Bacteria 5303
53 Ga0070668_100018834 3300005347 Bacteria 5186
54 Ga0070668_100045744 3300005347 Bacteria 3358
55 Ga0070668_100049227 3300005347 Bacteria 3242
56 Ga0070668_100065165 3300005347 Bacteria 2826
57 Ga0070668_100175136 3300005347 Bacteria 1749
58 Ga0070668_100991526 3300005347 Bacteria 755
59 Ga0070669_100009536 3300005353 Bacteria 6912
60 Ga0070669_100023162 3300005353 Bacteria 4445
61 Ga0070669_100090685 3300005353 Bacteria 2291
62 Ga0070669_100117319 3300005353 Bacteria 2026
63 Ga0070669_100181647 3300005353 Bacteria 1646
64 Ga0070669_100358535 3300005353 Bacteria 1185
65 Ga0070669_100518748 3300005353 Bacteria 990
66 Ga0070669_100653636 3300005353 Bacteria 885
67 Ga0070669_101018920 3300005353 Bacteria 711
68 Ga0070675_100003261 3300005354 Bacteria 12301
69 Ga0070675_100630226 3300005354 Bacteria 974
70 Ga0070675_100785581 3300005354 Bacteria 870
71 Ga0070675_100794401 3300005354 Bacteria 865
72 Ga0070671_100000259 3300005355 Bacteria 35442
73 Ga0070671_100000790 3300005355 Bacteria 22794
74 Ga0070671_100072558 3300005355 Bacteria 2875
75 Ga0070671_100361572 3300005355 Bacteria 1239
76 Ga0070671_100975342 3300005355 Bacteria 742
77 Ga0070674_100003988 3300005356 Bacteria 8365
78 Ga0070674_100087427 3300005356 Bacteria 2241
79 Ga0070674_100139342 3300005356 Bacteria 1819
80 Ga0070674_100247126 3300005356 Bacteria 1399
81 Ga0070674_100995691 3300005356 Bacteria 735
82 Ga0070673_100000242 3300005364 Bacteria 27415
83 Ga0070673_100008168 3300005364 Bacteria 6946
84 Ga0070673_100025546 3300005364 Bacteria 4350
85 Ga0070673_100045669 3300005364 Bacteria 3398
86 Ga0070673_100278983 3300005364 Bacteria 1465
87 Ga0070659_100001924 3300005366 Bacteria 14833
88 Ga0070659_100020999 3300005366 Bacteria 4966
89 Ga0070659_100039606 3300005366 Bacteria 3680
90 Ga0070659_100199020 3300005366 Bacteria 1648
91 Ga0070659_100509981 3300005366 Bacteria 1026
92 Ga0070659_100590648 3300005366 Bacteria 953
93 Ga0070667_100001538 3300005367 Bacteria 20662
94 Ga0070667_100005653 3300005367 Bacteria 10440
95 Ga0070667_100013153 3300005367 Bacteria 6841
96 Ga0070667_100026415 3300005367 Bacteria 4829
97 Ga0070667_100046109 3300005367 Bacteria 3666
98 Ga0070667_100154767 3300005367 Bacteria 2016
99 Ga0070694_100015173 3300005444 Bacteria 4832
100 Ga0070663_100005330 3300005455 Bacteria 7630
101 Ga0070663_100020557 3300005455 Bacteria 4372
102 Ga0070663_100192644 3300005455 Bacteria 1587
103 Ga0070663_101116013 3300005455 Bacteria 690
104 Ga0070678_100028880 3300005456 Bacteria 3789
105 Ga0070662_100002998 3300005457 Bacteria 10500
106 Ga0070662_100016475 3300005457 Bacteria 4965
107 Ga0070662_100021755 3300005457 Bacteria 4382
108 Ga0070662_100059615 3300005457 Bacteria 2781
109 Ga0070662_100064544 3300005457 Bacteria 2682
110 Ga0070662_100209834 3300005457 Bacteria 1549
111 Ga0070662_100524527 3300005457 Bacteria 990
112 Ga0070662_100902558 3300005457 Bacteria 754
113 Ga0070662_101198024 3300005457 Bacteria 653
114 Ga0068867_100022803 3300005459 Bacteria 4479
115 Ga0068867_100041281 3300005459 Bacteria 3371
116 Ga0068853_100000281 3300005539 Bacteria 35996
117 Ga0068853_100299481 3300005539 Bacteria 1486
118 Ga0068853_100372696 3300005539 Bacteria 1332
119 Ga0070672_100004276 3300005543 Bacteria 9334
120 Ga0070672_100020270 3300005543 Bacteria 4846
121 Ga0070672_100068141 3300005543 Bacteria 2822
122 Ga0070672_100539107 3300005543 Bacteria 1012
123 Ga0070686_100220581 3300005544 Bacteria 1370
124 Ga0070686_100534044 3300005544 Bacteria 915
125 Ga0070686_100811378 3300005544 Bacteria 755
126 Ga0070695_100368081 3300005545 Bacteria 1081
127 Ga0070693_100111115 3300005547 Bacteria 1686
128 Ga0070693_100158561 3300005547 Bacteria 1439
129 Ga0070665_100000080 3300005548 Bacteria 185165
130 Ga0070665_100012762 3300005548 Bacteria 8463
131 Ga0070665_100019598 3300005548 Bacteria 6791
132 Ga0070665_100049897 3300005548 Bacteria 4199
133 Ga0070665_100379149 3300005548 Bacteria 1421
134 Ga0068855_100005738 3300005563 Bacteria 15155
135 Ga0068855_100108004 3300005563 Bacteria 3197
136 Ga0068855_100175206 3300005563 Bacteria 2427
137 Ga0070664_100023876 3300005564 Bacteria 5051
138 Ga0070664_100099669 3300005564 Bacteria 2525
139 Ga0070664_100313076 3300005564 Bacteria 1421
140 Ga0070664_101135041 3300005564 Bacteria 737
141 Ga0068857_100000686 3300005577 Bacteria 25194
142 Ga0068857_100004703 3300005577 Bacteria 11572
143 Ga0068857_100047076 3300005577 Bacteria 3828
144 Ga0068854_100001510 3300005578 Bacteria 14092
145 Ga0070702_100050228 3300005615 Bacteria 2381
146 Ga0070702_100289458 3300005615 Bacteria 1128
147 Ga0068852_100018863 3300005616 Bacteria 5445
148 Ga0068852_100037585 3300005616 Bacteria 4061
149 Ga0068852_100673695 3300005616 Bacteria 1043
150 Ga0068859_100000281 3300005617 Bacteria 50775
151 Ga0068859_100002867 3300005617 Bacteria 17497
152 Ga0068859_100064511 3300005617 Bacteria 3695
153 Ga0068859_100092689 3300005617 Bacteria 3072
154 Ga0068859_100154149 3300005617 Bacteria 2374
155 Ga0068864_100000261 3300005618 Bacteria 47015
156 Ga0068864_100000564 3300005618 Bacteria 31589
157 Ga0068864_100012776 3300005618 Bacteria 6941
158 Ga0068864_100257374 3300005618 Bacteria 1623
159 Ga0068864_101797130 3300005618 Bacteria 618
160 Ga0068866_10011347 3300005718 Bacteria 3852
161 Ga0068861_100018385 3300005719 Bacteria 4980
162 Ga0068861_100142586 3300005719 Bacteria 1957
163 Ga0068861_100831243 3300005719 Bacteria 869
164 Ga0068870_10108690 3300005840 Bacteria 1579
165 Ga0068863_100000012 3300005841 Bacteria 229774
166 Ga0068863_100000554 3300005841 Bacteria 38065
167 Ga0068863_100000807 3300005841 Bacteria 31405
168 Ga0068863_100054664 3300005841 Bacteria 3782
169 Ga0068863_100136054 3300005841 Bacteria 2347
170 Ga0068863_101044389 3300005841 Bacteria 821
171 Ga0068863_101970210 3300005841 Bacteria 594
172 Ga0068858_100001974 3300005842 Bacteria 20959
173 Ga0068858_100002051 3300005842 Bacteria 20516
174 Ga0068858_100007088 3300005842 Bacteria 10883
175 Ga0068858_100717600 3300005842 Bacteria 973
176 Ga0068860_100000007 3300005843 Bacteria 429329
177 Ga0068860_100000867 3300005843 Bacteria 33656
178 Ga0068860_100021722 3300005843 Bacteria 6211
179 Ga0068860_100024963 3300005843 Bacteria 5770
180 Ga0068860_100029454 3300005843 Bacteria 5281
181 Ga0068860_100115857 3300005843 Bacteria 2563
182 Ga0068860_100217063 3300005843 Bacteria 1856
183 Ga0068860_100373712 3300005843 Bacteria 1406
184 Ga0068862_100007953 3300005844 Bacteria 8771
185 Ga0068862_100012194 3300005844 Bacteria 7104
186 Ga0068862_100035671 3300005844 Bacteria 4214
187 Ga0068862_100054627 3300005844 Bacteria 3419
188 Ga0068862_100079950 3300005844 Bacteria 2834
189 Ga0068862_100100081 3300005844 Bacteria 2535
190 Ga0068862_100114981 3300005844 Bacteria 2366
191 Ga0068862_100161212 3300005844 Bacteria 2002
192 Ga0068862_100179790 3300005844 Bacteria 1898
193 Ga0068862_100379468 3300005844 Bacteria 1318
194 Ga0068862_100744130 3300005844 Bacteria 953
195 Ga0081538_10204941 3300005981 Bacteria 804
196 Ga0075432_10286721 3300006058 Unclassified 679
197 Ga0097621_100139323 3300006237 Bacteria 2072
198 Ga0097621_100141616 3300006237 Bacteria 2055
199 Ga0097621_101219077 3300006237 Bacteria 709
200 Ga0068871_100034420 3300006358 Bacteria 4020
201 Ga0075434_100340015 3300006871 Bacteria 1522
202 Ga0068865_100000790 3300006881 Bacteria 17803
203 Ga0068865_100014327 3300006881 Bacteria 5037
204 Ga0068865_100460882 3300006881 Bacteria 1053
205 Ga0068865_101102814 3300006881 Bacteria 699
206 Ga0097620_100000281 3300006931 Bacteria 50775
207 Ga0097620_100002867 3300006931 Bacteria 17497
208 Ga0097620_100064511 3300006931 Bacteria 3695
209 Ga0097620_100092684 3300006931 Bacteria 3072
210 Ga0097620_100154153 3300006931 Bacteria 2374
211 Ga0105240_10004806 3300009093 Bacteria 20361
212 Ga0105240_10385779 3300009093 Bacteria 1581
213 Ga0105245_10000433 3300009098 Bacteria 38731
214 Ga0105245_10257276 3300009098 Bacteria 1698
215 Ga0105245_10271296 3300009098 Bacteria 1655
216 Ga0105247_10875263 3300009101 Bacteria 692
217 Ga0105243_10297982 3300009148 Bacteria 1460
218 Ga0105243_10918802 3300009148 Bacteria 872
219 Ga0105243_10954273 3300009148 Bacteria 857
220 Ga0105241_10005737 3300009174 Bacteria 9168
221 Ga0105242_10819435 3300009176 Bacteria 923
222 Ga0105248_10000070 3300009177 Bacteria 119985
223 Ga0105248_10000313 3300009177 Bacteria 57777
224 Ga0105248_10364035 3300009177 Bacteria 1628
225 Ga0105248_11006495 3300009177 Bacteria 941
226 Ga0105238_10049340 3300009551 Bacteria 4240
227 Ga0105238_10409481 3300009551 Bacteria 1350
228 Ga0105249_10013031 3300009553 Bacteria 7338
229 Ga0105249_10106551 3300009553 Bacteria 2645
230 Ga0105249_10135702 3300009553 Bacteria 2354
231 Ga0105249_10381311 3300009553 Bacteria 1436
232 Ga0105249_12447354 3300009553 Bacteria 595
233 Ga0105249_12585786 3300009553 Bacteria 580
234 Ga0105239_10083996 3300010375 Bacteria 3507
235 Ga0105246_10002636 3300011119 Bacteria 10863
236 Ga0105246_10081653 3300011119 Bacteria 2305
237 Ga0105246_10342842 3300011119 Bacteria 1222
238 Ga0105246_10513106 3300011119 Bacteria 1020
239 Ga0105246_10582765 3300011119 Bacteria 964
240 Ga0157373_10001179 3300013100 Bacteria 19984
241 Ga0157373_10173693 3300013100 Bacteria 1516
242 Ga0157371_10001574 3300013102 Bacteria 23422
243 Ga0157371_10062082 3300013102 Bacteria 2649
244 Ga0157371_10078664 3300013102 Bacteria 2336
245 Ga0157370_10443807 3300013104 Bacteria 1193
246 Ga0157370_10705715 3300013104 Bacteria 921
247 Ga0157369_10021165 3300013105 Bacteria 7271
248 Ga0157374_11661484 3300013296 Bacteria 663
249 Ga0157378_10004425 3300013297 Bacteria 12364
250 Ga0157378_10389203 3300013297 Bacteria 1371
251 Ga0157378_10954625 3300013297 Bacteria 890
252 Ga0163162_10008879 3300013306 Bacteria 9774
253 Ga0163162_10020341 3300013306 Bacteria 6520
254 Ga0163162_10543359 3300013306 Bacteria 1290
255 Ga0157372_10009526 3300013307 Bacteria 10325
256 Ga0157372_10168279 3300013307 Bacteria 2535
257 Ga0157372_10618378 3300013307 Bacteria 1262
258 Ga0157375_10008102 3300013308 Bacteria 9194
259 Ga0157375_10039115 3300013308 Bacteria 4561
260 Ga0157375_10312088 3300013308 Bacteria 1737
261 Ga0157375_10371419 3300013308 Bacteria 1597
262 Ga0163163_10000135 3300014325 Bacteria 75904
263 Ga0163163_11248474 3300014325 Bacteria 805
264 Ga0157380_11451355 3300014326 Bacteria 738
265 Ga0157377_10508560 3300014745 Bacteria 843
266 Ga0157379_10080896 3300014968 Bacteria 2910
267 Ga0163161_11553238 3300017792 Bacteria 582
268 Ga0213873_10048744 3300021358 Bacteria 1115
269 Ga0213876_10337688 3300021384 Unclassified 801
270 Ga0209676_1003019 3300025292 Bacteria 10938
271 Ga0209025_1087630 3300025294 Bacteria 1030
272 Ga0207697_10000157 3300025315 Bacteria 33854
273 Ga0207697_10058040 3300025315 Bacteria 1607
274 Ga0207682_10000868 3300025893 Bacteria 14041
275 Ga0207682_10028209 3300025893 Bacteria 2240
276 Ga0207682_10064337 3300025893 Bacteria 1541
277 Ga0207642_10034332 3300025899 Bacteria 2156
278 Ga0207688_10000953 3300025901 Bacteria 14689
279 Ga0207688_10005358 3300025901 Bacteria 6964
280 Ga0207680_10009968 3300025903 Bacteria 4734
281 Ga0207680_10046147 3300025903 Bacteria 2574
282 Ga0207647_10000047 3300025904 Bacteria 89112
283 Ga0207647_10005300 3300025904 Bacteria 9478
284 Ga0207647_10047918 3300025904 Bacteria 2655
285 Ga0207647_10055973 3300025904 Bacteria 2421
286 Ga0207647_10124675 3300025904 Bacteria 1517
287 Ga0207645_10008285 3300025907 Bacteria 7264
288 Ga0207645_10015768 3300025907 Bacteria 5011
289 Ga0207645_10025419 3300025907 Bacteria 3831
290 Ga0207643_10013980 3300025908 Bacteria 4354
291 Ga0207705_10013983 3300025909 Bacteria 5787
292 Ga0207705_10124324 3300025909 Bacteria 1916
293 Ga0207705_10150945 3300025909 Bacteria 1741
294 Ga0207654_10550226 3300025911 Bacteria 820
295 Ga0207695_10008169 3300025913 Bacteria 13150
296 Ga0207660_10024638 3300025917 Bacteria 4075
297 Ga0207657_10000826 3300025919 Bacteria 32744
298 Ga0207657_10010150 3300025919 Bacteria 9412
299 Ga0207657_10053736 3300025919 Bacteria 3488
300 Ga0207657_10707347 3300025919 Bacteria 782
301 Ga0207657_10870207 3300025919 Bacteria 695
302 Ga0207649_10000106 3300025920 Bacteria 69452
303 Ga0207649_10039805 3300025920 Bacteria 2852
304 Ga0207649_10048199 3300025920 Bacteria 2627
305 Ga0207649_10309338 3300025920 Bacteria 1158
306 Ga0207681_10010855 3300025923 Bacteria 5596
307 Ga0207681_10046258 3300025923 Bacteria 2926
308 Ga0207681_10056807 3300025923 Bacteria 2671
309 Ga0207681_10168989 3300025923 Bacteria 1656
310 Ga0207681_10250954 3300025923 Bacteria 1381
311 Ga0207681_10375853 3300025923 Bacteria 1143
312 Ga0207681_10402283 3300025923 Bacteria 1106
313 Ga0207694_10038889 3300025924 Bacteria 3659
314 Ga0207650_10008191 3300025925 Bacteria 7131
315 Ga0207650_10116027 3300025925 Bacteria 2079
316 Ga0207650_10262490 3300025925 Bacteria 1401
317 Ga0207650_10293142 3300025925 Bacteria 1327
318 Ga0207659_10005106 3300025926 Bacteria 7955
319 Ga0207659_10224819 3300025926 Bacteria 1511
320 Ga0207687_10001801 3300025927 Bacteria 14760
321 Ga0207687_10084471 3300025927 Bacteria 2301
322 Ga0207687_10114868 3300025927 Bacteria 2005
323 Ga0207664_10164585 3300025929 Bacteria 1894
324 Ga0207644_10000070 3300025931 Bacteria 74994
325 Ga0207644_10000430 3300025931 Bacteria 27277
326 Ga0207644_10134607 3300025931 Bacteria 1896
327 Ga0207644_10209183 3300025931 Bacteria 1542
328 Ga0207644_10329917 3300025931 Bacteria 1235
329 Ga0207690_10000680 3300025932 Bacteria 21791
330 Ga0207690_10009628 3300025932 Bacteria 5735
331 Ga0207690_10039377 3300025932 Bacteria 3083
332 Ga0207690_10103221 3300025932 Bacteria 2040
333 Ga0207690_10474801 3300025932 Bacteria 1008
334 Ga0207706_10000103 3300025933 Bacteria 89756
335 Ga0207706_10014063 3300025933 Bacteria 7257
336 Ga0207706_10020563 3300025933 Bacteria 5933
337 Ga0207706_10237882 3300025933 Bacteria 1592
338 Ga0207706_10373975 3300025933 Bacteria 1237
339 Ga0207706_10486039 3300025933 Bacteria 1066
340 Ga0207709_10330798 3300025935 Bacteria 1143
341 Ga0207709_10916445 3300025935 Bacteria 713
342 Ga0207670_10014163 3300025936 Bacteria 4725
343 Ga0207669_10062133 3300025937 Bacteria 2299
344 Ga0207669_10111387 3300025937 Bacteria 1835
345 Ga0207669_10183913 3300025937 Bacteria 1501
346 Ga0207669_10209548 3300025937 Bacteria 1421
347 Ga0207704_10005465 3300025938 Bacteria 5859
348 Ga0207704_10022804 3300025938 Bacteria 3362
349 Ga0207704_10156861 3300025938 Bacteria 1614
350 Ga0207691_10000586 3300025940 Bacteria 36317
351 Ga0207691_10025895 3300025940 Bacteria 5505
352 Ga0207691_10034401 3300025940 Bacteria 4711
353 Ga0207691_10153224 3300025940 Bacteria 2026
354 Ga0207691_10176798 3300025940 Bacteria 1867
355 Ga0207691_10640877 3300025940 Bacteria 898
356 Ga0207711_10000051 3300025941 Bacteria 140854
357 Ga0207711_10001081 3300025941 Bacteria 26051
358 Ga0207689_10000242 3300025942 Bacteria 48659
359 Ga0207689_10005615 3300025942 Bacteria 11174
360 Ga0207689_10221637 3300025942 Bacteria 1563
361 Ga0207689_10290166 3300025942 Bacteria 1355
362 Ga0207679_10009996 3300025945 Bacteria 6096
363 Ga0207679_10012970 3300025945 Bacteria 5453
364 Ga0207679_10185932 3300025945 Bacteria 1723
365 Ga0207679_10988307 3300025945 Bacteria 771
366 Ga0207679_10993410 3300025945 Bacteria 769
367 Ga0207679_11632020 3300025945 Bacteria 591
368 Ga0207667_10002726 3300025949 Bacteria 21834
369 Ga0207667_10046246 3300025949 Bacteria 4608
370 Ga0207667_10085821 3300025949 Bacteria 3258
371 Ga0207651_10003302 3300025960 Bacteria 7902
372 Ga0207651_10023724 3300025960 Bacteria 3780
373 Ga0207651_10048471 3300025960 Bacteria 2872
374 Ga0207651_10053312 3300025960 Bacteria 2764
375 Ga0207651_10137881 3300025960 Bacteria 1879
376 Ga0207712_10006473 3300025961 Bacteria 7385
377 Ga0207712_10021473 3300025961 Bacteria 4239
378 Ga0207712_10124175 3300025961 Bacteria 1957
379 Ga0207712_10247325 3300025961 Bacteria 1440
380 Ga0207668_10000061 3300025972 Bacteria 89620
381 Ga0207668_10000129 3300025972 Bacteria 53619
382 Ga0207668_10030404 3300025972 Bacteria 3549
383 Ga0207668_10034881 3300025972 Bacteria 3345
384 Ga0207668_10050910 3300025972 Bacteria 2857
385 Ga0207668_10063344 3300025972 Bacteria 2608
386 Ga0207668_10144647 3300025972 Bacteria 1833
387 Ga0207668_10159244 3300025972 Bacteria 1757
388 Ga0207668_10884229 3300025972 Bacteria 794
389 Ga0207640_10000173 3300025981 Bacteria 46801
390 Ga0207658_10005059 3300025986 Bacteria 9073
391 Ga0207658_10011114 3300025986 Bacteria 6132
392 Ga0207658_10016898 3300025986 Bacteria 5022
393 Ga0207658_10046760 3300025986 Bacteria 3162
394 Ga0207658_10089292 3300025986 Bacteria 2385
395 Ga0207658_10187294 3300025986 Bacteria 1717
396 Ga0207677_10001214 3300026023 Bacteria 13926
397 Ga0207677_12181681 3300026023 Bacteria 515
398 Ga0207703_10003929 3300026035 Bacteria 12332
399 Ga0207703_10033345 3300026035 Bacteria 4081
400 Ga0207639_10000267 3300026041 Bacteria 37378
401 Ga0207639_10255233 3300026041 Bacteria 1531
402 Ga0207639_10279592 3300026041 Bacteria 1467
403 Ga0207639_10320064 3300026041 Bacteria 1377
404 Ga0207678_10012675 3300026067 Bacteria 7408
405 Ga0207678_10200620 3300026067 Bacteria 1706
406 Ga0207678_10883908 3300026067 Bacteria 790
407 Ga0207641_10000024 3300026088 Bacteria 250751
408 Ga0207641_10000190 3300026088 Bacteria 84715
409 Ga0207641_10004167 3300026088 Bacteria 12599
410 Ga0207641_10014286 3300026088 Bacteria 6507
411 Ga0207641_10074998 3300026088 Bacteria 2920
412 Ga0207641_11414122 3300026088 Bacteria 697
413 Ga0207648_10000838 3300026089 Bacteria 34648
414 Ga0207648_10036826 3300026089 Bacteria 4310
415 Ga0207676_10001202 3300026095 Bacteria 19413
416 Ga0207676_10114584 3300026095 Bacteria 2261
417 Ga0207676_10202314 3300026095 Bacteria 1756
418 Ga0207676_11895262 3300026095 Bacteria 595
419 Ga0207674_10000899 3300026116 Bacteria 38882
420 Ga0207674_10024788 3300026116 Bacteria 6403
421 Ga0207674_10340423 3300026116 Bacteria 1450
422 Ga0207674_10688470 3300026116 Bacteria 987
423 Ga0207675_100072458 3300026118 Bacteria 3222
424 Ga0207675_100132872 3300026118 Bacteria 2360
425 Ga0207683_10034323 3300026121 Bacteria 4408
426 Ga0207698_10000760 3300026142 Bacteria 18747
427 Ga0207698_10218291 3300026142 Bacteria 1721
428 Ga0207698_10758957 3300026142 Bacteria 969
429 Ga0209967_1050749 3300027364 Bacteria 637
430 Ga0209982_1013038 3300027552 Bacteria 1250
431 Ga0209974_10001653 3300027876 Bacteria 8065
432 Ga0209974_10005015 3300027876 Bacteria 4681
433 Ga0209974_10105423 3300027876 Bacteria 988
434 Ga0268266_10000055 3300028379 Bacteria 291630
435 Ga0268266_10000315 3300028379 Bacteria 76532
436 Ga0268266_10020218 3300028379 Bacteria 5676
437 Ga0268266_10044185 3300028379 Bacteria 3808
438 Ga0268266_10051783 3300028379 Bacteria 3525
439 Ga0268266_10067429 3300028379 Bacteria 3097
440 Ga0268266_10320390 3300028379 Bacteria 1451
441 Ga0268265_10044197 3300028380 Bacteria 3316
442 Ga0268265_10086022 3300028380 Bacteria 2497
443 Ga0268265_10109706 3300028380 Bacteria 2250
444 Ga0268265_10142184 3300028380 Bacteria 2010
445 Ga0268265_10203505 3300028380 Bacteria 1719
446 Ga0268265_10212933 3300028380 Bacteria 1685
447 Ga0268265_10262799 3300028380 Bacteria 1535
448 Ga0268265_10610924 3300028380 Bacteria 1043
449 Ga0268264_10000134 3300028381 Bacteria 179475
450 Ga0268264_10000778 3300028381 Bacteria 35132
451 Ga0268264_10006123 3300028381 Bacteria 10163
452 Ga0268264_10007677 3300028381 Bacteria 8991
453 Ga0268264_10015771 3300028381 Bacteria 6187
454 Ga0268264_10076258 3300028381 Bacteria 2852
455 Ga0268264_10092182 3300028381 Bacteria 2615
456 Ga0265327_10052086 3300031251 Bacteria 2133
457 Ga0307408_100022268 3300031548 Bacteria 4304
458 Ga0307408_100044383 3300031548 Bacteria 3167
459 Ga0307408_100044872 3300031548 Bacteria 3153
460 Ga0307408_100058588 3300031548 Bacteria 2800
461 Ga0307408_100064767 3300031548 Bacteria 2678
462 Ga0307408_100070037 3300031548 Bacteria 2588
463 Ga0307408_100106372 3300031548 Bacteria 2146
464 Ga0307408_100112957 3300031548 Bacteria 2090
465 Ga0307408_100226306 3300031548 Bacteria 1529
466 Ga0307408_100345597 3300031548 Bacteria 1261
467 Ga0307408_100515299 3300031548 Bacteria 1049
468 Ga0307408_100539982 3300031548 Bacteria 1027
469 Ga0307408_100646529 3300031548 Bacteria 945
470 Ga0307408_100914399 3300031548 Bacteria 804
471 Ga0307408_101382958 3300031548 Bacteria 662
472 Ga0307405_10002056 3300031731 Bacteria 8749
473 Ga0307405_10015446 3300031731 Bacteria 4137
474 Ga0307405_10028963 3300031731 Bacteria 3232
475 Ga0307405_10045652 3300031731 Bacteria 2687
476 Ga0307405_10058800 3300031731 Bacteria 2421
477 Ga0307405_10148813 3300031731 Bacteria 1643
478 Ga0307405_10308258 3300031731 Bacteria 1204
479 Ga0307405_10558624 3300031731 Bacteria 927
480 Ga0307405_10616464 3300031731 Bacteria 888
481 Ga0307405_10636995 3300031731 Bacteria 875
482 Ga0307405_10656199 3300031731 Bacteria 863
483 Ga0307405_10663765 3300031731 Bacteria 859
484 Ga0307413_10004731 3300031824 Bacteria 5976
485 Ga0307413_10030161 3300031824 Bacteria 3043
486 Ga0307413_10034128 3300031824 Bacteria 2905
487 Ga0307413_10045118 3300031824 Bacteria 2610
488 Ga0307413_10052167 3300031824 Bacteria 2468
489 Ga0307413_10068212 3300031824 Bacteria 2227
490 Ga0307413_10080900 3300031824 Bacteria 2081
491 Ga0307413_10197197 3300031824 Bacteria 1451
492 Ga0307413_10217987 3300031824 Bacteria 1391
493 Ga0307413_10243021 3300031824 Bacteria 1330
494 Ga0307413_10271019 3300031824 Bacteria 1271
495 Ga0307413_10303344 3300031824 Bacteria 1212
496 Ga0307413_10406891 3300031824 Bacteria 1068
497 Ga0307413_10469024 3300031824 Bacteria 1003
498 Ga0307413_10537824 3300031824 Bacteria 945
499 Ga0307413_10561409 3300031824 Bacteria 928
500 Ga0307413_10601497 3300031824 Bacteria 900
501 Ga0307413_10832427 3300031824 Bacteria 778
502 Ga0307410_10013593 3300031852 Bacteria 4756
503 Ga0307410_10021686 3300031852 Bacteria 3954
504 Ga0307410_10022287 3300031852 Bacteria 3912
505 Ga0307410_10041309 3300031852 Bacteria 3040
506 Ga0307410_10079951 3300031852 Bacteria 2292
507 Ga0307410_10108246 3300031852 Bacteria 2006
508 Ga0307410_10181995 3300031852 Bacteria 1592
509 Ga0307410_10229792 3300031852 Bacteria 1432
510 Ga0307410_10287135 3300031852 Bacteria 1293
511 Ga0307410_10292913 3300031852 Bacteria 1281
512 Ga0307410_10343456 3300031852 Bacteria 1190
513 Ga0307410_10501836 3300031852 Bacteria 998
514 Ga0307410_10559026 3300031852 Bacteria 949
515 Ga0307410_11198113 3300031852 Bacteria 661
516 Ga0307406_10000566 3300031901 Bacteria 21309
517 Ga0307406_10014750 3300031901 Bacteria 4502
518 Ga0307406_10054163 3300031901 Bacteria 2559
519 Ga0307406_10094196 3300031901 Bacteria 2024
520 Ga0307406_10129365 3300031901 Bacteria 1770
521 Ga0307406_10177004 3300031901 Bacteria 1549
522 Ga0307406_10209725 3300031901 Bacteria 1440
523 Ga0307406_10335117 3300031901 Bacteria 1176
524 Ga0307406_10659384 3300031901 Bacteria 869
525 Ga0307406_11056519 3300031901 Bacteria 699
526 Ga0307407_10004114 3300031903 Bacteria 6122
527 Ga0307407_10004272 3300031903 Bacteria 6031
528 Ga0307407_10009087 3300031903 Bacteria 4609
529 Ga0307407_10023926 3300031903 Bacteria 3194
530 Ga0307407_10042917 3300031903 Bacteria 2539
531 Ga0307407_10060951 3300031903 Bacteria 2203
532 Ga0307407_10066541 3300031903 Bacteria 2126
533 Ga0307407_10192540 3300031903 Bacteria 1360
534 Ga0307407_10241749 3300031903 Bacteria 1232
535 Ga0307407_10446019 3300031903 Bacteria 938
536 Ga0307407_10807631 3300031903 Bacteria 714
537 Ga0307412_10026572 3300031911 Bacteria 3599
538 Ga0307412_10042782 3300031911 Bacteria 2946
539 Ga0307412_10130272 3300031911 Bacteria 1826
540 Ga0307412_10169174 3300031911 Bacteria 1632
541 Ga0307412_10173453 3300031911 Bacteria 1615
542 Ga0307412_10194516 3300031911 Bacteria 1536
543 Ga0307412_10205179 3300031911 Bacteria 1500
544 Ga0307412_10278601 3300031911 Bacteria 1312
545 Ga0307412_10347349 3300031911 Bacteria 1190
546 Ga0307412_10402546 3300031911 Bacteria 1114
547 Ga0307412_10430578 3300031911 Bacteria 1081
548 Ga0307412_10511574 3300031911 Bacteria 1001
549 Ga0307412_10560300 3300031911 Bacteria 961
550 Ga0307412_10588797 3300031911 Bacteria 940
551 Ga0307412_10667394 3300031911 Bacteria 889
552 Ga0307412_11371985 3300031911 Bacteria 639
553 Ga0307409_100003788 3300031995 Bacteria 8326
554 Ga0307409_100008505 3300031995 Bacteria 6235
555 Ga0307409_100011473 3300031995 Bacteria 5591
556 Ga0307409_100020648 3300031995 Bacteria 4494
557 Ga0307409_100026353 3300031995 Bacteria 4098
558 Ga0307409_100038493 3300031995 Bacteria 3538
559 Ga0307409_100046349 3300031995 Bacteria 3290
560 Ga0307409_100050142 3300031995 Bacteria 3187
561 Ga0307409_100055674 3300031995 Bacteria 3055
562 Ga0307409_100214113 3300031995 Bacteria 1734
563 Ga0307409_100399311 3300031995 Bacteria 1312
564 Ga0307409_100697901 3300031995 Bacteria 1014
565 Ga0307409_100741163 3300031995 Bacteria 985
566 Ga0307409_100752999 3300031995 Bacteria 978
567 Ga0307409_100841143 3300031995 Bacteria 928
568 Ga0307409_101881578 3300031995 Bacteria 628
569 Ga0307416_100001154 3300032002 Bacteria 14190
570 Ga0307416_100008529 3300032002 Bacteria 6624
571 Ga0307416_100042481 3300032002 Bacteria 3549
572 Ga0307416_100054472 3300032002 Bacteria 3215
573 Ga0307416_100102541 3300032002 Bacteria 2495
574 Ga0307416_100154356 3300032002 Bacteria 2111
575 Ga0307416_100206651 3300032002 Bacteria 1868
576 Ga0307416_100268813 3300032002 Bacteria 1672
577 Ga0307416_100513640 3300032002 Bacteria 1265
578 Ga0307416_100557471 3300032002 Bacteria 1220
579 Ga0307416_100561671 3300032002 Bacteria 1216
580 Ga0307416_100641660 3300032002 Unclassified 1146
581 Ga0307416_100647574 3300032002 Bacteria 1141
582 Ga0307416_100657230 3300032002 Bacteria 1134
583 Ga0307416_101204091 3300032002 Bacteria 863
584 Ga0307416_101339090 3300032002 Bacteria 822
585 Ga0307416_101493691 3300032002 Bacteria 781
586 Ga0307414_10000897 3300032004 Bacteria 15247
587 Ga0307414_10027386 3300032004 Bacteria 3683
588 Ga0307414_10035280 3300032004 Bacteria 3327
589 Ga0307414_10044109 3300032004 Bacteria 3042
590 Ga0307414_10055807 3300032004 Bacteria 2767
591 Ga0307414_10076888 3300032004 Bacteria 2427
592 Ga0307414_10087421 3300032004 Bacteria 2303
593 Ga0307414_10105812 3300032004 Bacteria 2128
594 Ga0307414_10143239 3300032004 Bacteria 1874
595 Ga0307414_10151242 3300032004 Bacteria 1831
596 Ga0307414_10193677 3300032004 Bacteria 1647
597 Ga0307414_10226893 3300032004 Bacteria 1537
598 Ga0307414_10270967 3300032004 Bacteria 1422
599 Ga0307414_10610428 3300032004 Bacteria 979
600 Ga0307414_10634120 3300032004 Bacteria 962
601 Ga0307414_11124397 3300032004 Bacteria 726
602 Ga0307414_11211234 3300032004 Bacteria 699
603 Ga0307414_11420789 3300032004 Bacteria 645
604 Ga0307414_11496499 3300032004 Bacteria 628
605 Ga0307411_10000291 3300032005 Bacteria 16720
606 Ga0307411_10000460 3300032005 Bacteria 14059
607 Ga0307411_10003039 3300032005 Bacteria 7661
608 Ga0307411_10016408 3300032005 Bacteria 4191
609 Ga0307411_10016864 3300032005 Bacteria 4143
610 Ga0307411_10018843 3300032005 Bacteria 3971
611 Ga0307411_10023579 3300032005 Bacteria 3648
612 Ga0307411_10023919 3300032005 Bacteria 3630
613 Ga0307411_10044420 3300032005 Bacteria 2850
614 Ga0307411_10073141 3300032005 Bacteria 2330
615 Ga0307411_10089472 3300032005 Bacteria 2144
616 Ga0307411_10108001 3300032005 Bacteria 1984
617 Ga0307411_10117224 3300032005 Bacteria 1918
618 Ga0307411_10250340 3300032005 Bacteria 1392
619 Ga0307411_10258019 3300032005 Bacteria 1375
620 Ga0307411_10371099 3300032005 Bacteria 1174
621 Ga0307411_10371407 3300032005 Bacteria 1173
622 Ga0307411_10637083 3300032005 Bacteria 921
623 Ga0307411_11245928 3300032005 Bacteria 676
624 Ga0307415_100005203 3300032126 Bacteria 6873
625 Ga0307415_100033799 3300032126 Bacteria 3321
626 Ga0307415_100039698 3300032126 Bacteria 3113
627 Ga0307415_100142722 3300032126 Bacteria 1831
628 Ga0307415_100156621 3300032126 Bacteria 1760
629 Ga0307415_100173247 3300032126 Bacteria 1685
630 Ga0307415_100376875 3300032126 Bacteria 1203
631 Ga0307415_100384743 3300032126 Bacteria 1192
632 Ga0307415_100415385 3300032126 Bacteria 1153
633 Ga0307415_100462897 3300032126 Bacteria 1099
634 Ga0307415_100524503 3300032126 Bacteria 1040
635 Ga0307415_100538051 3300032126 Bacteria 1028
636 Ga0307415_100626065 3300032126 Bacteria 961
637 Ga0307415_101295064 3300032126 Bacteria 690
638 Ga0307415_101564033 3300032126 Bacteria 632
639 Ga0395899_0042544 3300037312 Bacteria 3391
640 Ga0395899_0126438 3300037312 Bacteria 1828
641 Ga0395899_0324445 3300037312 Bacteria 1036
642 Ga0395899_0325202 3300037312 Bacteria 1035
643 Ga0395900_0011557 3300037418 Bacteria 9034
644 Ga0395900_0016659 3300037418 Bacteria 7496
645 Ga0395900_0017797 3300037418 Bacteria 7255
646 Ga0395900_0022251 3300037418 Bacteria 6486
647 Ga0395900_0045518 3300037418 Bacteria 4519
648 Ga0395900_0048771 3300037418 Bacteria 4362
649 Ga0395900_0084615 3300037418 Bacteria 3259
650 Ga0395900_0116720 3300037418 Bacteria 2739
651 Ga0395900_0142421 3300037418 Bacteria 2454
652 Ga0395900_0383342 3300037418 Bacteria 1373
653 Ga0395900_0405575 3300037418 Bacteria 1326
654 Ga0395898_0004993 3300037466 Bacteria 14389
655 Ga0395898_0005963 3300037466 Bacteria 13081
656 Ga0395898_0056828 3300037466 Bacteria 3813
657 Ga0395898_0489496 3300037466 Bacteria 1170
658 Ga0395898_0619145 3300037466 Bacteria 1025
659 Ga0395905_0002455 3300037471 Bacteria 20530
660 Ga0395905_0005327 3300037471 Bacteria 13147
661 Ga0395905_0013658 3300037471 Bacteria 7778
662 Ga0395905_0017889 3300037471 Bacteria 6734
663 Ga0395905_0023676 3300037471 Bacteria 5798
664 Ga0395905_0091320 3300037471 Bacteria 2855
665 Ga0395905_0139472 3300037471 Bacteria 2281
666 Ga0395905_0164262 3300037471 Bacteria 2086
667 Ga0395905_0279283 3300037471 Bacteria 1556
668 Ga0395905_0313835 3300037471 Bacteria 1456
669 Ga0395905_0548430 3300037471 Bacteria 1057
670 Ga0395905_0731194 3300037471 Bacteria 892
671 Ga0395905_0940552 3300037471 Bacteria 767
672 Ga0395905_1137177 3300037471 Bacteria 684
673 Ga0436364_1241845 3300037853 Bacteria 1378
674 Ga0395901_0005521 3300038443 Bacteria 12805
675 Ga0395901_0024999 3300038443 Bacteria 6129
676 Ga0395901_0040376 3300038443 Bacteria 4832
677 Ga0395901_0059472 3300038443 Bacteria 3976
678 Ga0395901_0060625 3300038443 Bacteria 3937
679 Ga0395901_0068100 3300038443 Bacteria 3708
680 Ga0395901_0075162 3300038443 Bacteria 3524
681 Ga0395901_0208699 3300038443 Bacteria 2045
682 Ga0395901_0399022 3300038443 Bacteria 1413
683 Ga0395901_0416042 3300038443 Bacteria 1379
684 Ga0395901_0475249 3300038443 Bacteria 1276
685 Ga0395901_0507413 3300038443 Bacteria 1227
686 Ga0395901_0609310 3300038443 Bacteria 1100
687 Ga0395901_1046550 3300038443 Bacteria 789
688 Ga0395901_1457294 3300038443 Bacteria 642
689 Ga0395901_1477749 3300038443 Bacteria 636
690 Ga0436365_0031440 3300039437 Bacteria 981
691 Ga0436365_1289842 3300039437 Bacteria 27584
692 Ga0436362_0045296 3300039453 Plasmid 3653
693 Ga0439466_0048783 3300041411 Bacteria 1392
694 Ga0439448_0250599 3300042005 Bacteria 625
695 Ga0439432_050298 3300042006 Bacteria 1301
696 Ga0439432_129763 3300042006 Bacteria 744
697 Ga0450920_106105 3300042122 Bacteria 585
698 Ga0439446_0130129 3300042156 Bacteria 816
699 Ga0439464_0000949 3300042439 Bacteria 6545
700 Ga0451577_0652911 3300042876 Bacteria 954
701 Ga0453684_0505405 3300044712 Bacteria 1338
702 Ga0495641_0248443 3300046461 Bacteria 800
703 Ga0495594_0684747 3300046499 Bacteria 580
704 Ga0495632_0218964 3300046519 Bacteria 861
705 Ga0495642_0073339 3300046528 Bacteria 1434
706 Ga0495640_0270995 3300046533 Bacteria 1059
707 Ga0495667_0311652 3300046559 Bacteria 996
708 Ga0495668_0006091 3300046616 Bacteria 7985
709 Ga0495669_0023160 3300046684 Bacteria 2702
710 Ga0495669_0073840 3300046684 Bacteria 1558
711 Ga0495613_0901363 3300046689 Bacteria 572
712 Ga0495670_0005480 3300046691 Bacteria 6228
713 Ga0495649_0043553 3300046694 Bacteria 2450
714 Ga0496103_0214406 3300048906 Bacteria 1238
715 Ga0496108_0000614 3300048911 Bacteria 27954
716 Ga0496108_0120245 3300048911 Bacteria 2252
717 Ga0496109_0497901 3300048912 Bacteria 1150
718 Ga0496110_0735602 3300048913 Bacteria 889
719 Ga0496111_0396043 3300048914 Bacteria 1021
720 Ga0496117_0050659 3300048920 Bacteria 2943
721 Ga0496121_0002435 3300048924 Bacteria 28455
722 Ga0496126_0129105 3300048929 Bacteria 2186
723 Ga0501033_0160080 3300049570 Bacteria 1621
724 Ga0501034_0117957 3300049571 Bacteria 2641
725 Ga0501074_0096324 3300049590 Bacteria 2119
726 Ga0501202_012006 3300049652 Bacteria 1630
727 Ga0501217_101565 3300049661 Bacteria 818
728 Ga0501242_009267 3300049674 Bacteria 1163
729 Ga0501258_018178 3300049687 Bacteria 808
730 Ga0501080_0096005 3300049742 Bacteria 2752
731 Ga0501262_001377 3300049759 Bacteria 2727
732 Ga0501262_036727 3300049759 Bacteria 721
733 Ga0501272_002595 3300049769 Bacteria 1796
734 Ga0501273_013805 3300049770 Bacteria 1034
735 nmdc:mga0k408_438174_c1 3300050493 Bacteria 776
736 nmdc:mga0n895_522751_c1 3300050512 Bacteria 1194
737 Ga0500658_0000022 3300053134 Bacteria 129341
738 Ga0500568_0000992 3300053139 Bacteria 19446
739 Ga0500616_0000080 3300053153 Bacteria 200381
740 Ga0500587_000543 3300053739 Bacteria 4635
741 Ga0501084_1373829 3300054114 Bacteria 592
742 Ga0590075_166462 3300059424 Bacteria 582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100229083 Ga0070661_1002290832 138
2 3300038443 Ga0395901_0024999 Ga0395901_0024999_332_799 139
3 3300005329 Ga0070683_101895692 Ga0070683_1018956921 140
4 3300032002 Ga0307416_100557471 Ga0307416_1005574712 140
5 3300031824 Ga0307413_10832427 Ga0307413_108324272 141
6 3300032126 Ga0307415_100415385 Ga0307415_1004153852 141
7 3300031731 Ga0307405_10663765 Ga0307405_106637652 142
8 3300032004 Ga0307414_10143239 Ga0307414_101432392 143
9 iso_pu_bacteria 2852653556 2852656978 143
10 3300005337 Ga0070682_100041381 Ga0070682_1000413812 144
11 3300005344 Ga0070661_100226765 Ga0070661_1002267652 144
12 3300005353 Ga0070669_100117319 Ga0070669_1001173192 144
13 3300005354 Ga0070675_100794401 Ga0070675_1007944012 144
14 3300005364 Ga0070673_100278983 Ga0070673_1002789833 144
15 3300005455 Ga0070663_100020557 Ga0070663_1000205576 144
16 3300005457 Ga0070662_100059615 Ga0070662_1000596154 144
17 3300005539 Ga0068853_100372696 Ga0068853_1003726962 144
18 3300005543 Ga0070672_100539107 Ga0070672_1005391071 144
19 3300005564 Ga0070664_100023876 Ga0070664_10002387611 144
20 3300005577 Ga0068857_100004703 Ga0068857_10000470311 144
21 3300005615 Ga0070702_100289458 Ga0070702_1002894581 144
22 3300005618 Ga0068864_100012776 Ga0068864_1000127765 144
23 3300005618 Ga0068864_100257374 Ga0068864_1002573742 144
24 3300005719 Ga0068861_100831243 Ga0068861_1008312432 144
25 3300005841 Ga0068863_100054664 Ga0068863_1000546643 144
26 3300005841 Ga0068863_101044389 Ga0068863_1010443892 144
27 3300005842 Ga0068858_100007088 Ga0068858_1000070888 144
28 3300005842 Ga0068858_100717600 Ga0068858_1007176002 144
29 3300005843 Ga0068860_100024963 Ga0068860_1000249633 144
30 3300005843 Ga0068860_100373712 Ga0068860_1003737122 144
31 3300005844 Ga0068862_100079950 Ga0068862_1000799503 144
32 3300009101 Ga0105247_10875263 Ga0105247_108752632 144
33 3300009148 Ga0105243_10297982 Ga0105243_102979822 144
34 3300009177 Ga0105248_10364035 Ga0105248_103640352 144
35 3300009177 Ga0105248_11006495 Ga0105248_110064952 144
36 3300009553 Ga0105249_10135702 Ga0105249_101357023 144
37 3300011119 Ga0105246_10081653 Ga0105246_100816534 144
38 3300013296 Ga0157374_11661484 Ga0157374_116614841 144
39 3300013308 Ga0157375_10371419 Ga0157375_103714192 144
40 3300026088 Ga0207641_10074998 Ga0207641_100749983 144
41 3300026095 Ga0207676_10202314 Ga0207676_102023143 144
42 3300046461 Ga0495641_0248443 Ga0495641_0248443_11_553 144
43 3300046499 Ga0495594_0684747 Ga0495594_0684747_56_541 144
44 3300046533 Ga0495640_0270995 Ga0495640_0270995_114_656 144
45 3300046559 Ga0495667_0311652 Ga0495667_0311652_115_657 144
46 3300046689 Ga0495613_0901363 Ga0495613_0901363_16_558 144
47 iso_pu_bacteria 2643221588 2643950716 144
48 3300005330 Ga0070690_100560041 Ga0070690_1005600412 145
49 3300005333 Ga0070677_10000855 Ga0070677_100008555 145
50 3300005457 Ga0070662_100209834 Ga0070662_1002098343 145
51 3300005544 Ga0070686_100811378 Ga0070686_1008113781 145
52 3300005719 Ga0068861_100018385 Ga0068861_1000183855 145
53 3300005981 Ga0081538_10204941 Ga0081538_102049411 145
54 3300009098 Ga0105245_10271296 Ga0105245_102712963 145
55 3300011119 Ga0105246_10582765 Ga0105246_105827653 145
56 3300025893 Ga0207682_10000868 Ga0207682_100008685 145
57 3300025927 Ga0207687_10114868 Ga0207687_101148682 145
58 3300025933 Ga0207706_10486039 Ga0207706_104860392 145
59 3300025945 Ga0207679_11632020 Ga0207679_116320201 145
60 3300026118 Ga0207675_100132872 Ga0207675_1001328723 145
61 3300031901 Ga0307406_10659384 Ga0307406_106593841 145
62 3300031911 Ga0307412_10205179 Ga0307412_102051792 145
63 3300032002 Ga0307416_100561671 Ga0307416_1005616712 145
64 3300032005 Ga0307411_10637083 Ga0307411_106370832 145
65 3300032126 Ga0307415_100156621 Ga0307415_1001566211 145
66 3300037312 Ga0395899_0126438 Ga0395899_0126438_802_1275 145
67 3300037312 Ga0395899_0324445 Ga0395899_0324445_132_572 145
68 3300037418 Ga0395900_0048771 Ga0395900_0048771_1547_2020 145
69 3300037418 Ga0395900_0383342 Ga0395900_0383342_226_666 145
70 3300037466 Ga0395898_0619145 Ga0395898_0619145_311_751 145
71 3300037471 Ga0395905_1137177 Ga0395905_1137177_115_555 145
72 3300038443 Ga0395901_0068100 Ga0395901_0068100_1595_2068 145
73 3300038443 Ga0395901_0609310 Ga0395901_0609310_527_967 145
74 3300048911 Ga0496108_0000614 Ga0496108_0000614_5543_5986 145
75 3300048911 Ga0496108_0120245 Ga0496108_0120245_989_1435 145
76 iso_pu_bacteria 2895880812 2895884719 145
77 iso_pu_bacteria 2896429255 2896429970 145
78 3300005347 Ga0070668_100017983 Ga0070668_1000179834 146
79 3300005353 Ga0070669_100358535 Ga0070669_1003585352 146
80 3300005844 Ga0068862_100114981 Ga0068862_1001149812 146
81 3300005844 Ga0068862_100179790 Ga0068862_1001797903 146
82 3300006058 Ga0075432_10286721 Ga0075432_102867211 146
83 3300014326 Ga0157380_11451355 Ga0157380_114513551 146
84 3300021358 Ga0213873_10048744 Ga0213873_100487443 146
85 3300021384 Ga0213876_10337688 Ga0213876_103376881 146
86 3300025907 Ga0207645_10025419 Ga0207645_100254194 146
87 3300025919 Ga0207657_10870207 Ga0207657_108702072 146
88 3300025923 Ga0207681_10250954 Ga0207681_102509542 146
89 3300025929 Ga0207664_10164585 Ga0207664_101645852 146
90 3300025972 Ga0207668_10030404 Ga0207668_100304043 146
91 3300026116 Ga0207674_10688470 Ga0207674_106884702 146
92 3300028380 Ga0268265_10086022 Ga0268265_100860222 146
93 3300028380 Ga0268265_10109706 Ga0268265_101097063 146
94 3300031548 Ga0307408_100058588 Ga0307408_1000585882 146
95 3300031731 Ga0307405_10002056 Ga0307405_1000205610 146
96 3300031731 Ga0307405_10058800 Ga0307405_100588003 146
97 3300031824 Ga0307413_10052167 Ga0307413_100521675 146
98 3300031824 Ga0307413_10243021 Ga0307413_102430213 146
99 3300031824 Ga0307413_10537824 Ga0307413_105378242 146
100 3300031852 Ga0307410_10041309 Ga0307410_100413095 146
101 3300031852 Ga0307410_10559026 Ga0307410_105590262 146
102 3300031901 Ga0307406_10000566 Ga0307406_1000056621 146
103 3300031903 Ga0307407_10009087 Ga0307407_100090875 146
104 3300031903 Ga0307407_10807631 Ga0307407_108076312 146
105 3300031911 Ga0307412_10026572 Ga0307412_100265725 146
106 3300031911 Ga0307412_10278601 Ga0307412_102786013 146
107 3300031995 Ga0307409_100003788 Ga0307409_1000037889 146
108 3300031995 Ga0307409_100026353 Ga0307409_1000263536 146
109 3300031995 Ga0307409_100055674 Ga0307409_1000556744 146
110 3300032002 Ga0307416_100001154 Ga0307416_1000011542 146
111 3300032002 Ga0307416_100268813 Ga0307416_1002688132 146
112 3300032002 Ga0307416_100513640 Ga0307416_1005136403 146
113 3300032004 Ga0307414_10000897 Ga0307414_1000089715 146
114 3300032004 Ga0307414_10044109 Ga0307414_100441094 146
115 3300032004 Ga0307414_10076888 Ga0307414_100768882 146
116 3300032004 Ga0307414_10151242 Ga0307414_101512423 146
117 3300032004 Ga0307414_11420789 Ga0307414_114207892 146
118 3300032005 Ga0307411_10000460 Ga0307411_1000046014 146
119 3300032005 Ga0307411_10089472 Ga0307411_100894723 146
120 3300032005 Ga0307411_10108001 Ga0307411_101080014 146
121 3300032005 Ga0307411_10258019 Ga0307411_102580191 146
122 3300032126 Ga0307415_100142722 Ga0307415_1001427222 146
123 3300032126 Ga0307415_100462897 Ga0307415_1004628973 146
124 3300039437 Ga0436365_0031440 Ga0436365_0031440_110_634 146
125 3300039453 Ga0436362_0045296 Ga0436362_0045296_575_1099 146
126 3300044712 Ga0453684_0505405 Ga0453684_0505405_563_1003 146
127 3300005327 Ga0070658_10686357 Ga0070658_106863572 147
128 3300005347 Ga0070668_100045744 Ga0070668_1000457443 147
129 3300005347 Ga0070668_100065165 Ga0070668_1000651653 147
130 3300005347 Ga0070668_100175136 Ga0070668_1001751362 147
131 3300005347 Ga0070668_100991526 Ga0070668_1009915262 147
132 3300005355 Ga0070671_100072558 Ga0070671_1000725583 147
133 3300005364 Ga0070673_100008168 Ga0070673_1000081686 147
134 3300005367 Ga0070667_100013153 Ga0070667_1000131536 147
135 3300005455 Ga0070663_100192644 Ga0070663_1001926442 147
136 3300005457 Ga0070662_100902558 Ga0070662_1009025582 147
137 3300005548 Ga0070665_100049897 Ga0070665_1000498974 147
138 3300005617 Ga0068859_100002867 Ga0068859_1000028678 147
139 3300005618 Ga0068864_100000564 Ga0068864_10000056430 147
140 3300005841 Ga0068863_100000554 Ga0068863_10000055433 147
141 3300005842 Ga0068858_100001974 Ga0068858_10000197416 147
142 3300005843 Ga0068860_100029454 Ga0068860_1000294546 147
143 3300005843 Ga0068860_100217063 Ga0068860_1002170632 147
144 3300005844 Ga0068862_100012194 Ga0068862_1000121948 147
145 3300005844 Ga0068862_100100081 Ga0068862_1001000814 147
146 3300006931 Ga0097620_100002867 Ga0097620_1000028678 147
147 3300009177 Ga0105248_10000070 Ga0105248_1000007090 147
148 3300009553 Ga0105249_10013031 Ga0105249_100130317 147
149 3300009553 Ga0105249_12585786 Ga0105249_125857862 147
150 3300013306 Ga0163162_10020341 Ga0163162_100203419 147
151 3300014325 Ga0163163_10000135 Ga0163163_1000013510 147
152 3300014968 Ga0157379_10080896 Ga0157379_100808964 147
153 3300025931 Ga0207644_10134607 Ga0207644_101346072 147
154 3300025941 Ga0207711_10000051 Ga0207711_1000005166 147
155 3300025942 Ga0207689_10221637 Ga0207689_102216373 147
156 3300025960 Ga0207651_10137881 Ga0207651_101378812 147
157 3300025961 Ga0207712_10021473 Ga0207712_100214734 147
158 3300025972 Ga0207668_10063344 Ga0207668_100633443 147
159 3300025972 Ga0207668_10144647 Ga0207668_101446473 147
160 3300025972 Ga0207668_10159244 Ga0207668_101592444 147
161 3300025972 Ga0207668_10884229 Ga0207668_108842292 147
162 3300025986 Ga0207658_10005059 Ga0207658_1000505911 147
163 3300026035 Ga0207703_10033345 Ga0207703_100333454 147
164 3300026041 Ga0207639_10320064 Ga0207639_103200642 147
165 3300026088 Ga0207641_10000190 Ga0207641_1000019062 147
166 3300026088 Ga0207641_11414122 Ga0207641_114141221 147
167 3300026095 Ga0207676_10114584 Ga0207676_101145842 147
168 3300027876 Ga0209974_10105423 Ga0209974_101054232 147
169 3300028379 Ga0268266_10044185 Ga0268266_100441855 147
170 3300028380 Ga0268265_10044197 Ga0268265_100441974 147
171 3300028380 Ga0268265_10203505 Ga0268265_102035052 147
172 3300028381 Ga0268264_10000778 Ga0268264_1000077829 147
173 3300028381 Ga0268264_10076258 Ga0268264_100762583 147
174 3300031548 Ga0307408_100044872 Ga0307408_1000448724 147
175 3300031548 Ga0307408_100646529 Ga0307408_1006465292 147
176 3300031548 Ga0307408_100914399 Ga0307408_1009143992 147
177 3300031731 Ga0307405_10045652 Ga0307405_100456523 147
178 3300031824 Ga0307413_10561409 Ga0307413_105614092 147
179 3300031852 Ga0307410_10013593 Ga0307410_100135932 147
180 3300031852 Ga0307410_10501836 Ga0307410_105018362 147
181 3300031901 Ga0307406_10129365 Ga0307406_101293653 147
182 3300031903 Ga0307407_10004114 Ga0307407_100041148 147
183 3300031911 Ga0307412_10588797 Ga0307412_105887972 147
184 3300031911 Ga0307412_10667394 Ga0307412_106673942 147
185 3300031995 Ga0307409_100841143 Ga0307409_1008411432 147
186 3300032002 Ga0307416_100657230 Ga0307416_1006572303 147
187 3300032004 Ga0307414_10087421 Ga0307414_100874212 147
188 3300032004 Ga0307414_11124397 Ga0307414_111243972 147
189 3300032005 Ga0307411_10023579 Ga0307411_100235795 147
190 3300032005 Ga0307411_10044420 Ga0307411_100444204 147
191 3300032126 Ga0307415_100033799 Ga0307415_1000337995 147
192 3300046684 Ga0495669_0073840 Ga0495669_0073840_681_1124 147
193 3300049570 Ga0501033_0160080 Ga0501033_0160080_77_547 147
194 3300002459 JGI24751J29686_10069004 JGI24751J29686_100690041 148
195 3300003781 Ga0055536_1011948 Ga0055536_10119484 148
196 3300005329 Ga0070683_100428677 Ga0070683_1004286774 148
197 3300005335 Ga0070666_10150119 Ga0070666_101501192 148
198 3300005353 Ga0070669_100653636 Ga0070669_1006536362 148
199 3300005367 Ga0070667_100046109 Ga0070667_1000461092 148
200 3300005457 Ga0070662_100524527 Ga0070662_1005245272 148
201 3300006871 Ga0075434_100340015 Ga0075434_1003400152 148
202 3300006881 Ga0068865_101102814 Ga0068865_1011028142 148
203 3300009148 Ga0105243_10918802 Ga0105243_109188022 148
204 3300013100 Ga0157373_10173693 Ga0157373_101736933 148
205 3300017792 Ga0163161_11553238 Ga0163161_115532381 148
206 3300025292 Ga0209676_1003019 Ga0209676_10030195 148
207 3300025294 Ga0209025_1087630 Ga0209025_10876302 148
208 3300025917 Ga0207660_10024638 Ga0207660_100246381 148
209 3300025935 Ga0207709_10916445 Ga0207709_109164452 148
210 3300025945 Ga0207679_10185932 Ga0207679_101859322 148
211 3300025986 Ga0207658_10089292 Ga0207658_100892922 148
212 3300027364 Ga0209967_1050749 Ga0209967_10507491 148
213 3300027552 Ga0209982_1013038 Ga0209982_10130382 148
214 3300027876 Ga0209974_10001653 Ga0209974_100016538 148
215 3300031548 Ga0307408_100022268 Ga0307408_1000222682 148
216 3300031548 Ga0307408_100064767 Ga0307408_1000647675 148
217 3300031548 Ga0307408_100106372 Ga0307408_1001063723 148
218 3300031548 Ga0307408_100112957 Ga0307408_1001129574 148
219 3300031548 Ga0307408_100345597 Ga0307408_1003455972 148
220 3300031548 Ga0307408_101382958 Ga0307408_1013829582 148
221 3300031731 Ga0307405_10015446 Ga0307405_100154464 148
222 3300031731 Ga0307405_10148813 Ga0307405_101488133 148
223 3300031731 Ga0307405_10558624 Ga0307405_105586242 148
224 3300031824 Ga0307413_10030161 Ga0307413_100301614 148
225 3300031824 Ga0307413_10068212 Ga0307413_100682123 148
226 3300031824 Ga0307413_10217987 Ga0307413_102179872 148
227 3300031824 Ga0307413_10406891 Ga0307413_104068912 148
228 3300031852 Ga0307410_10229792 Ga0307410_102297922 148
229 3300031852 Ga0307410_10287135 Ga0307410_102871352 148
230 3300031901 Ga0307406_10014750 Ga0307406_100147507 148
231 3300031901 Ga0307406_10054163 Ga0307406_100541633 148
232 3300031901 Ga0307406_10177004 Ga0307406_101770044 148
233 3300031901 Ga0307406_11056519 Ga0307406_110565191 148
234 3300031903 Ga0307407_10004272 Ga0307407_100042726 148
235 3300031903 Ga0307407_10060951 Ga0307407_100609513 148
236 3300031911 Ga0307412_10042782 Ga0307412_100427821 148
237 3300031911 Ga0307412_10194516 Ga0307412_101945162 148
238 3300031911 Ga0307412_10402546 Ga0307412_104025463 148
239 3300031911 Ga0307412_10430578 Ga0307412_104305782 148
240 3300031911 Ga0307412_10560300 Ga0307412_105603002 148
241 3300031911 Ga0307412_11371985 Ga0307412_113719851 148
242 3300031995 Ga0307409_100011473 Ga0307409_1000114739 148
243 3300031995 Ga0307409_100046349 Ga0307409_1000463493 148
244 3300031995 Ga0307409_100399311 Ga0307409_1003993112 148
245 3300031995 Ga0307409_100697901 Ga0307409_1006979012 148
246 3300032002 Ga0307416_100008529 Ga0307416_1000085299 148
247 3300032002 Ga0307416_100042481 Ga0307416_1000424813 148
248 3300032002 Ga0307416_100206651 Ga0307416_1002066512 148
249 3300032002 Ga0307416_100641660 Ga0307416_1006416602 148
250 3300032004 Ga0307414_10055807 Ga0307414_100558073 148
251 3300032004 Ga0307414_10105812 Ga0307414_101058124 148
252 3300032004 Ga0307414_10226893 Ga0307414_102268933 148
253 3300032004 Ga0307414_10610428 Ga0307414_106104281 148
254 3300032004 Ga0307414_11496499 Ga0307414_114964991 148
255 3300032005 Ga0307411_10023919 Ga0307411_100239195 148
256 3300032005 Ga0307411_10117224 Ga0307411_101172242 148
257 3300032005 Ga0307411_10250340 Ga0307411_102503402 148
258 3300032126 Ga0307415_100005203 Ga0307415_1000052035 148
259 3300032126 Ga0307415_100173247 Ga0307415_1001732472 148
260 3300032126 Ga0307415_100538051 Ga0307415_1005380512 148
261 3300032126 Ga0307415_101564033 Ga0307415_1015640331 148
262 3300037466 Ga0395898_0005963 Ga0395898_0005963_11029_11496 148
263 3300037471 Ga0395905_0731194 Ga0395905_0731194_379_825 148
264 3300038443 Ga0395901_0059472 Ga0395901_0059472_730_1176 148
265 3300039437 Ga0436365_1289842 Ga0436365_1289842_1958_2413 148
266 3300041411 Ga0439466_0048783 Ga0439466_0048783_217_672 148
267 3300042005 Ga0439448_0250599 Ga0439448_0250599_147_602 148
268 3300042006 Ga0439432_129763 Ga0439432_129763_247_702 148
269 3300042122 Ga0450920_106105 Ga0450920_106105_92_538 148
270 3300042156 Ga0439446_0130129 Ga0439446_0130129_180_635 148
271 3300046616 Ga0495668_0006091 Ga0495668_0006091_1747_2202 148
272 3300046694 Ga0495649_0043553 Ga0495649_0043553_1141_1596 148
273 3300048906 Ga0496103_0214406 Ga0496103_0214406_360_812 148
274 3300048912 Ga0496109_0497901 Ga0496109_0497901_350_802 148
275 3300048913 Ga0496110_0735602 Ga0496110_0735602_153_605 148
276 3300048914 Ga0496111_0396043 Ga0496111_0396043_140_592 148
277 3300049590 Ga0501074_0096324 Ga0501074_0096324_1196_1642 148
278 3300049652 Ga0501202_012006 Ga0501202_012006_86_541 148
279 3300049661 Ga0501217_101565 Ga0501217_101565_37_492 148
280 3300049674 Ga0501242_009267 Ga0501242_009267_672_1127 148
281 3300049687 Ga0501258_018178 Ga0501258_018178_125_580 148
282 3300049742 Ga0501080_0096005 Ga0501080_0096005_1607_2053 148
283 3300049759 Ga0501262_001377 Ga0501262_001377_1340_1795 148
284 3300049759 Ga0501262_036727 Ga0501262_036727_106_561 148
285 3300049769 Ga0501272_002595 Ga0501272_002595_103_558 148
286 3300049770 Ga0501273_013805 Ga0501273_013805_285_740 148
287 3300050512 nmdc:mga0n895_522751_c1 nmdc:mga0n895_522751_c1_228_683 148
288 3300053134 Ga0500658_0000022 Ga0500658_0000022_112574_113029 148
289 3300053139 Ga0500568_0000992 Ga0500568_0000992_16641_17114 148
290 3300053153 Ga0500616_0000080 Ga0500616_0000080_116761_117234 148
291 3300001904 JGI24736J21556_1003050 JGI24736J21556_10030502 149
292 3300001904 JGI24736J21556_1006376 JGI24736J21556_10063765 149
293 3300001979 JGI24740J21852_10001530 JGI24740J21852_100015302 149
294 3300001989 JGI24739J22299_10000816 JGI24739J22299_1000081614 149
295 3300001990 JGI24737J22298_10000296 JGI24737J22298_1000029613 149
296 3300001990 JGI24737J22298_10001986 JGI24737J22298_1000198612 149
297 3300001991 JGI24743J22301_10043019 JGI24743J22301_100430192 149
298 3300002067 JGI24735J21928_10010173 JGI24735J21928_100101732 149
299 3300002075 JGI24738J21930_10000065 JGI24738J21930_1000006520 149
300 3300002239 JGI24034J26672_10001309 JGI24034J26672_100013092 149
301 3300002244 JGI24742J22300_10022430 JGI24742J22300_100224303 149
302 3300005293 Ga0065715_10105120 Ga0065715_101051203 149
303 3300005293 Ga0065715_10155685 Ga0065715_101556854 149
304 3300005327 Ga0070658_10019611 Ga0070658_100196114 149
305 3300005327 Ga0070658_10184707 Ga0070658_101847072 149
306 3300005328 Ga0070676_10004904 Ga0070676_100049042 149
307 3300005330 Ga0070690_100004600 Ga0070690_10000460011 149
308 3300005331 Ga0070670_100008638 Ga0070670_1000086388 149
309 3300005331 Ga0070670_100107489 Ga0070670_1001074893 149
310 3300005331 Ga0070670_100146356 Ga0070670_1001463563 149
311 3300005333 Ga0070677_10013352 Ga0070677_100133522 149
312 3300005334 Ga0068869_100000215 Ga0068869_10000021525 149
313 3300005334 Ga0068869_100010224 Ga0068869_1000102245 149
314 3300005335 Ga0070666_10083844 Ga0070666_100838442 149
315 3300005335 Ga0070666_10103898 Ga0070666_101038982 149
316 3300005335 Ga0070666_10115718 Ga0070666_101157183 149
317 3300005335 Ga0070666_11056361 Ga0070666_110563611 149
318 3300005338 Ga0068868_100000041 Ga0068868_10000004138 149
319 3300005338 Ga0068868_101596486 Ga0068868_1015964861 149
320 3300005339 Ga0070660_100003237 Ga0070660_10000323717 149
321 3300005339 Ga0070660_100006747 Ga0070660_10000674713 149
322 3300005339 Ga0070660_100088940 Ga0070660_1000889403 149
323 3300005339 Ga0070660_101012651 Ga0070660_1010126512 149
324 3300005344 Ga0070661_100000202 Ga0070661_1000002029 149
325 3300005344 Ga0070661_100025208 Ga0070661_1000252087 149
326 3300005344 Ga0070661_100057413 Ga0070661_1000574135 149
327 3300005344 Ga0070661_100472726 Ga0070661_1004727261 149
328 3300005345 Ga0070692_10014846 Ga0070692_100148463 149
329 3300005347 Ga0070668_100000058 Ga0070668_10000005830 149
330 3300005347 Ga0070668_100003957 Ga0070668_10000395710 149
331 3300005347 Ga0070668_100018834 Ga0070668_1000188347 149
332 3300005347 Ga0070668_100049227 Ga0070668_1000492277 149
333 3300005353 Ga0070669_100009536 Ga0070669_1000095367 149
334 3300005353 Ga0070669_100023162 Ga0070669_1000231625 149
335 3300005353 Ga0070669_100090685 Ga0070669_1000906852 149
336 3300005353 Ga0070669_100181647 Ga0070669_1001816473 149
337 3300005353 Ga0070669_100518748 Ga0070669_1005187482 149
338 3300005353 Ga0070669_101018920 Ga0070669_1010189201 149
339 3300005354 Ga0070675_100003261 Ga0070675_10000326114 149
340 3300005354 Ga0070675_100630226 Ga0070675_1006302261 149
341 3300005354 Ga0070675_100785581 Ga0070675_1007855812 149
342 3300005355 Ga0070671_100000259 Ga0070671_10000025931 149
343 3300005355 Ga0070671_100000790 Ga0070671_10000079020 149
344 3300005355 Ga0070671_100361572 Ga0070671_1003615722 149
345 3300005355 Ga0070671_100975342 Ga0070671_1009753421 149
346 3300005356 Ga0070674_100003988 Ga0070674_10000398814 149
347 3300005356 Ga0070674_100087427 Ga0070674_1000874274 149
348 3300005356 Ga0070674_100139342 Ga0070674_1001393422 149
349 3300005356 Ga0070674_100247126 Ga0070674_1002471261 149
350 3300005356 Ga0070674_100995691 Ga0070674_1009956912 149
351 3300005364 Ga0070673_100000242 Ga0070673_10000024219 149
352 3300005364 Ga0070673_100025546 Ga0070673_1000255463 149
353 3300005364 Ga0070673_100045669 Ga0070673_1000456693 149
354 3300005366 Ga0070659_100001924 Ga0070659_1000019247 149
355 3300005366 Ga0070659_100020999 Ga0070659_1000209993 149
356 3300005366 Ga0070659_100039606 Ga0070659_1000396062 149
357 3300005366 Ga0070659_100199020 Ga0070659_1001990202 149
358 3300005366 Ga0070659_100509981 Ga0070659_1005099812 149
359 3300005366 Ga0070659_100590648 Ga0070659_1005906481 149
360 3300005367 Ga0070667_100001538 Ga0070667_1000015388 149
361 3300005367 Ga0070667_100005653 Ga0070667_1000056533 149
362 3300005367 Ga0070667_100026415 Ga0070667_1000264155 149
363 3300005367 Ga0070667_100154767 Ga0070667_1001547672 149
364 3300005444 Ga0070694_100015173 Ga0070694_1000151734 149
365 3300005455 Ga0070663_100005330 Ga0070663_1000053305 149
366 3300005455 Ga0070663_101116013 Ga0070663_1011160131 149
367 3300005456 Ga0070678_100028880 Ga0070678_1000288801 149
368 3300005457 Ga0070662_100002998 Ga0070662_1000029988 149
369 3300005457 Ga0070662_100016475 Ga0070662_1000164753 149
370 3300005457 Ga0070662_100021755 Ga0070662_1000217554 149
371 3300005457 Ga0070662_100064544 Ga0070662_1000645443 149
372 3300005457 Ga0070662_101198024 Ga0070662_1011980241 149
373 3300005459 Ga0068867_100022803 Ga0068867_1000228037 149
374 3300005459 Ga0068867_100041281 Ga0068867_1000412813 149
375 3300005539 Ga0068853_100000281 Ga0068853_1000002815 149
376 3300005539 Ga0068853_100299481 Ga0068853_1002994812 149
377 3300005543 Ga0070672_100004276 Ga0070672_1000042769 149
378 3300005543 Ga0070672_100020270 Ga0070672_1000202707 149
379 3300005543 Ga0070672_100068141 Ga0070672_1000681412 149
380 3300005544 Ga0070686_100220581 Ga0070686_1002205812 149
381 3300005544 Ga0070686_100534044 Ga0070686_1005340442 149
382 3300005545 Ga0070695_100368081 Ga0070695_1003680812 149
383 3300005547 Ga0070693_100111115 Ga0070693_1001111153 149
384 3300005547 Ga0070693_100158561 Ga0070693_1001585613 149
385 3300005548 Ga0070665_100000080 Ga0070665_10000008032 149
386 3300005548 Ga0070665_100012762 Ga0070665_1000127625 149
387 3300005548 Ga0070665_100019598 Ga0070665_1000195986 149
388 3300005548 Ga0070665_100379149 Ga0070665_1003791492 149
389 3300005563 Ga0068855_100005738 Ga0068855_1000057386 149
390 3300005563 Ga0068855_100108004 Ga0068855_1001080044 149
391 3300005563 Ga0068855_100175206 Ga0068855_1001752063 149
392 3300005564 Ga0070664_100099669 Ga0070664_1000996692 149
393 3300005564 Ga0070664_100313076 Ga0070664_1003130764 149
394 3300005564 Ga0070664_101135041 Ga0070664_1011350412 149
395 3300005577 Ga0068857_100000686 Ga0068857_1000006862 149
396 3300005577 Ga0068857_100047076 Ga0068857_1000470762 149
397 3300005578 Ga0068854_100001510 Ga0068854_1000015107 149
398 3300005615 Ga0070702_100050228 Ga0070702_1000502285 149
399 3300005616 Ga0068852_100018863 Ga0068852_1000188635 149
400 3300005616 Ga0068852_100037585 Ga0068852_1000375854 149
401 3300005616 Ga0068852_100673695 Ga0068852_1006736952 149
402 3300005617 Ga0068859_100000281 Ga0068859_10000028135 149
403 3300005617 Ga0068859_100064511 Ga0068859_1000645113 149
404 3300005617 Ga0068859_100092689 Ga0068859_1000926892 149
405 3300005617 Ga0068859_100154149 Ga0068859_1001541493 149
406 3300005618 Ga0068864_100000261 Ga0068864_10000026115 149
407 3300005618 Ga0068864_101797130 Ga0068864_1017971302 149
408 3300005718 Ga0068866_10011347 Ga0068866_100113477 149
409 3300005719 Ga0068861_100142586 Ga0068861_1001425862 149
410 3300005840 Ga0068870_10108690 Ga0068870_101086902 149
411 3300005841 Ga0068863_100000012 Ga0068863_10000001248 149
412 3300005841 Ga0068863_100000807 Ga0068863_10000080721 149
413 3300005841 Ga0068863_100136054 Ga0068863_1001360543 149
414 3300005841 Ga0068863_101970210 Ga0068863_1019702101 149
415 3300005842 Ga0068858_100002051 Ga0068858_10000205114 149
416 3300005843 Ga0068860_100000007 Ga0068860_100000007315 149
417 3300005843 Ga0068860_100000867 Ga0068860_10000086734 149
418 3300005843 Ga0068860_100021722 Ga0068860_1000217228 149
419 3300005843 Ga0068860_100115857 Ga0068860_1001158571 149
420 3300005844 Ga0068862_100007953 Ga0068862_1000079533 149
421 3300005844 Ga0068862_100035671 Ga0068862_1000356712 149
422 3300005844 Ga0068862_100054627 Ga0068862_1000546273 149
423 3300005844 Ga0068862_100161212 Ga0068862_1001612123 149
424 3300005844 Ga0068862_100379468 Ga0068862_1003794683 149
425 3300005844 Ga0068862_100744130 Ga0068862_1007441301 149
426 3300006237 Ga0097621_100139323 Ga0097621_1001393233 149
427 3300006237 Ga0097621_100141616 Ga0097621_1001416163 149
428 3300006237 Ga0097621_101219077 Ga0097621_1012190771 149
429 3300006358 Ga0068871_100034420 Ga0068871_1000344205 149
430 3300006881 Ga0068865_100000790 Ga0068865_10000079015 149
431 3300006881 Ga0068865_100014327 Ga0068865_1000143274 149
432 3300006881 Ga0068865_100460882 Ga0068865_1004608822 149
433 3300006931 Ga0097620_100000281 Ga0097620_10000028135 149
434 3300006931 Ga0097620_100064511 Ga0097620_1000645113 149
435 3300006931 Ga0097620_100092684 Ga0097620_1000926842 149
436 3300006931 Ga0097620_100154153 Ga0097620_1001541533 149
437 3300009093 Ga0105240_10004806 Ga0105240_1000480611 149
438 3300009093 Ga0105240_10385779 Ga0105240_103857792 149
439 3300009098 Ga0105245_10000433 Ga0105245_1000043312 149
440 3300009098 Ga0105245_10257276 Ga0105245_102572763 149
441 3300009148 Ga0105243_10954273 Ga0105243_109542732 149
442 3300009174 Ga0105241_10005737 Ga0105241_1000573713 149
443 3300009176 Ga0105242_10819435 Ga0105242_108194352 149
444 3300009177 Ga0105248_10000313 Ga0105248_1000031351 149
445 3300009551 Ga0105238_10049340 Ga0105238_100493407 149
446 3300009551 Ga0105238_10409481 Ga0105238_104094812 149
447 3300009553 Ga0105249_10106551 Ga0105249_101065514 149
448 3300009553 Ga0105249_10381311 Ga0105249_103813113 149
449 3300009553 Ga0105249_12447354 Ga0105249_124473541 149
450 3300010375 Ga0105239_10083996 Ga0105239_100839962 149
451 3300011119 Ga0105246_10002636 Ga0105246_1000263615 149
452 3300011119 Ga0105246_10342842 Ga0105246_103428423 149
453 3300011119 Ga0105246_10513106 Ga0105246_105131062 149
454 3300013100 Ga0157373_10001179 Ga0157373_1000117916 149
455 3300013102 Ga0157371_10001574 Ga0157371_100015746 149
456 3300013102 Ga0157371_10062082 Ga0157371_100620823 149
457 3300013102 Ga0157371_10078664 Ga0157371_100786644 149
458 3300013104 Ga0157370_10443807 Ga0157370_104438072 149
459 3300013104 Ga0157370_10705715 Ga0157370_107057151 149
460 3300013105 Ga0157369_10021165 Ga0157369_100211655 149
461 3300013297 Ga0157378_10004425 Ga0157378_100044256 149
462 3300013297 Ga0157378_10389203 Ga0157378_103892032 149
463 3300013297 Ga0157378_10954625 Ga0157378_109546251 149
464 3300013306 Ga0163162_10008879 Ga0163162_100088793 149
465 3300013306 Ga0163162_10543359 Ga0163162_105433593 149
466 3300013307 Ga0157372_10009526 Ga0157372_1000952615 149
467 3300013307 Ga0157372_10168279 Ga0157372_101682794 149
468 3300013307 Ga0157372_10618378 Ga0157372_106183782 149
469 3300013308 Ga0157375_10008102 Ga0157375_1000810212 149
470 3300013308 Ga0157375_10039115 Ga0157375_100391151 149
471 3300013308 Ga0157375_10312088 Ga0157375_103120881 149
472 3300014325 Ga0163163_11248474 Ga0163163_112484741 149
473 3300014745 Ga0157377_10508560 Ga0157377_105085602 149
474 3300025315 Ga0207697_10000157 Ga0207697_1000015715 149
475 3300025315 Ga0207697_10058040 Ga0207697_100580402 149
476 3300025893 Ga0207682_10028209 Ga0207682_100282092 149
477 3300025893 Ga0207682_10064337 Ga0207682_100643372 149
478 3300025899 Ga0207642_10034332 Ga0207642_100343323 149
479 3300025901 Ga0207688_10000953 Ga0207688_1000095314 149
480 3300025901 Ga0207688_10005358 Ga0207688_100053585 149
481 3300025903 Ga0207680_10009968 Ga0207680_100099684 149
482 3300025903 Ga0207680_10046147 Ga0207680_100461473 149
483 3300025904 Ga0207647_10000047 Ga0207647_1000004728 149
484 3300025904 Ga0207647_10005300 Ga0207647_1000530010 149
485 3300025904 Ga0207647_10047918 Ga0207647_100479182 149
486 3300025904 Ga0207647_10055973 Ga0207647_100559732 149
487 3300025904 Ga0207647_10124675 Ga0207647_101246751 149
488 3300025907 Ga0207645_10008285 Ga0207645_100082855 149
489 3300025907 Ga0207645_10015768 Ga0207645_100157688 149
490 3300025908 Ga0207643_10013980 Ga0207643_100139805 149
491 3300025909 Ga0207705_10013983 Ga0207705_100139834 149
492 3300025909 Ga0207705_10124324 Ga0207705_101243244 149
493 3300025909 Ga0207705_10150945 Ga0207705_101509452 149
494 3300025911 Ga0207654_10550226 Ga0207654_105502262 149
495 3300025913 Ga0207695_10008169 Ga0207695_100081698 149
496 3300025919 Ga0207657_10000826 Ga0207657_1000082625 149
497 3300025919 Ga0207657_10010150 Ga0207657_100101509 149
498 3300025919 Ga0207657_10053736 Ga0207657_100537364 149
499 3300025919 Ga0207657_10707347 Ga0207657_107073471 149
500 3300025920 Ga0207649_10000106 Ga0207649_100001069 149
501 3300025920 Ga0207649_10039805 Ga0207649_100398056 149
502 3300025920 Ga0207649_10048199 Ga0207649_100481993 149
503 3300025920 Ga0207649_10309338 Ga0207649_103093382 149
504 3300025923 Ga0207681_10010855 Ga0207681_100108558 149
505 3300025923 Ga0207681_10046258 Ga0207681_100462584 149
506 3300025923 Ga0207681_10056807 Ga0207681_100568074 149
507 3300025923 Ga0207681_10168989 Ga0207681_101689893 149
508 3300025923 Ga0207681_10375853 Ga0207681_103758532 149
509 3300025923 Ga0207681_10402283 Ga0207681_104022832 149
510 3300025924 Ga0207694_10038889 Ga0207694_100388895 149
511 3300025925 Ga0207650_10008191 Ga0207650_100081917 149
512 3300025925 Ga0207650_10116027 Ga0207650_101160273 149
513 3300025925 Ga0207650_10262490 Ga0207650_102624902 149
514 3300025925 Ga0207650_10293142 Ga0207650_102931422 149
515 3300025926 Ga0207659_10005106 Ga0207659_100051063 149
516 3300025926 Ga0207659_10224819 Ga0207659_102248192 149
517 3300025927 Ga0207687_10001801 Ga0207687_1000180114 149
518 3300025927 Ga0207687_10084471 Ga0207687_100844714 149
519 3300025931 Ga0207644_10000070 Ga0207644_100000705 149
520 3300025931 Ga0207644_10000430 Ga0207644_1000043016 149
521 3300025931 Ga0207644_10209183 Ga0207644_102091832 149
522 3300025931 Ga0207644_10329917 Ga0207644_103299172 149
523 3300025932 Ga0207690_10000680 Ga0207690_1000068024 149
524 3300025932 Ga0207690_10009628 Ga0207690_100096288 149
525 3300025932 Ga0207690_10039377 Ga0207690_100393772 149
526 3300025932 Ga0207690_10103221 Ga0207690_101032213 149
527 3300025932 Ga0207690_10474801 Ga0207690_104748012 149
528 3300025933 Ga0207706_10000103 Ga0207706_1000010337 149
529 3300025933 Ga0207706_10014063 Ga0207706_100140638 149
530 3300025933 Ga0207706_10020563 Ga0207706_100205637 149
531 3300025933 Ga0207706_10237882 Ga0207706_102378823 149
532 3300025933 Ga0207706_10373975 Ga0207706_103739752 149
533 3300025935 Ga0207709_10330798 Ga0207709_103307982 149
534 3300025936 Ga0207670_10014163 Ga0207670_100141632 149
535 3300025937 Ga0207669_10062133 Ga0207669_100621333 149
536 3300025937 Ga0207669_10111387 Ga0207669_101113873 149
537 3300025937 Ga0207669_10183913 Ga0207669_101839132 149
538 3300025937 Ga0207669_10209548 Ga0207669_102095482 149
539 3300025938 Ga0207704_10005465 Ga0207704_100054658 149
540 3300025938 Ga0207704_10022804 Ga0207704_100228045 149
541 3300025938 Ga0207704_10156861 Ga0207704_101568612 149
542 3300025940 Ga0207691_10000586 Ga0207691_1000058624 149
543 3300025940 Ga0207691_10025895 Ga0207691_100258956 149
544 3300025940 Ga0207691_10034401 Ga0207691_100344015 149
545 3300025940 Ga0207691_10153224 Ga0207691_101532243 149
546 3300025940 Ga0207691_10176798 Ga0207691_101767983 149
547 3300025940 Ga0207691_10640877 Ga0207691_106408771 149
548 3300025941 Ga0207711_10001081 Ga0207711_1000108131 149
549 3300025942 Ga0207689_10000242 Ga0207689_1000024229 149
550 3300025942 Ga0207689_10005615 Ga0207689_100056155 149
551 3300025942 Ga0207689_10290166 Ga0207689_102901663 149
552 3300025945 Ga0207679_10009996 Ga0207679_1000999612 149
553 3300025945 Ga0207679_10012970 Ga0207679_100129707 149
554 3300025945 Ga0207679_10988307 Ga0207679_109883072 149
555 3300025945 Ga0207679_10993410 Ga0207679_109934102 149
556 3300025949 Ga0207667_10002726 Ga0207667_1000272614 149
557 3300025949 Ga0207667_10046246 Ga0207667_100462463 149
558 3300025949 Ga0207667_10085821 Ga0207667_100858212 149
559 3300025960 Ga0207651_10003302 Ga0207651_1000330211 149
560 3300025960 Ga0207651_10023724 Ga0207651_100237243 149
561 3300025960 Ga0207651_10048471 Ga0207651_100484714 149
562 3300025960 Ga0207651_10053312 Ga0207651_100533124 149
563 3300025961 Ga0207712_10006473 Ga0207712_100064734 149
564 3300025961 Ga0207712_10124175 Ga0207712_101241754 149
565 3300025961 Ga0207712_10247325 Ga0207712_102473253 149
566 3300025972 Ga0207668_10000061 Ga0207668_1000006169 149
567 3300025972 Ga0207668_10000129 Ga0207668_1000012956 149
568 3300025972 Ga0207668_10034881 Ga0207668_100348815 149
569 3300025972 Ga0207668_10050910 Ga0207668_100509107 149
570 3300025981 Ga0207640_10000173 Ga0207640_1000017329 149
571 3300025986 Ga0207658_10011114 Ga0207658_100111148 149
572 3300025986 Ga0207658_10016898 Ga0207658_100168983 149
573 3300025986 Ga0207658_10046760 Ga0207658_100467603 149
574 3300025986 Ga0207658_10187294 Ga0207658_101872942 149
575 3300026023 Ga0207677_10001214 Ga0207677_1000121419 149
576 3300026023 Ga0207677_12181681 Ga0207677_121816811 149
577 3300026035 Ga0207703_10003929 Ga0207703_1000392914 149
578 3300026041 Ga0207639_10000267 Ga0207639_100002675 149
579 3300026041 Ga0207639_10255233 Ga0207639_102552332 149
580 3300026041 Ga0207639_10279592 Ga0207639_102795921 149
581 3300026067 Ga0207678_10012675 Ga0207678_100126756 149
582 3300026067 Ga0207678_10200620 Ga0207678_102006203 149
583 3300026067 Ga0207678_10883908 Ga0207678_108839083 149
584 3300026088 Ga0207641_10000024 Ga0207641_1000002470 149
585 3300026088 Ga0207641_10004167 Ga0207641_1000416717 149
586 3300026088 Ga0207641_10014286 Ga0207641_1001428611 149
587 3300026089 Ga0207648_10000838 Ga0207648_1000083812 149
588 3300026089 Ga0207648_10036826 Ga0207648_100368263 149
589 3300026095 Ga0207676_10001202 Ga0207676_100012023 149
590 3300026095 Ga0207676_11895262 Ga0207676_118952622 149
591 3300026116 Ga0207674_10000899 Ga0207674_100008992 149
592 3300026116 Ga0207674_10024788 Ga0207674_100247887 149
593 3300026116 Ga0207674_10340423 Ga0207674_103404233 149
594 3300026118 Ga0207675_100072458 Ga0207675_1000724584 149
595 3300026121 Ga0207683_10034323 Ga0207683_100343236 149
596 3300026142 Ga0207698_10000760 Ga0207698_100007607 149
597 3300026142 Ga0207698_10218291 Ga0207698_102182913 149
598 3300026142 Ga0207698_10758957 Ga0207698_107589571 149
599 3300027876 Ga0209974_10005015 Ga0209974_100050154 149
600 3300028379 Ga0268266_10000055 Ga0268266_10000055135 149
601 3300028379 Ga0268266_10000315 Ga0268266_1000031578 149
602 3300028379 Ga0268266_10020218 Ga0268266_100202183 149
603 3300028379 Ga0268266_10051783 Ga0268266_100517835 149
604 3300028379 Ga0268266_10067429 Ga0268266_100674293 149
605 3300028379 Ga0268266_10320390 Ga0268266_103203901 149
606 3300028380 Ga0268265_10142184 Ga0268265_101421844 149
607 3300028380 Ga0268265_10212933 Ga0268265_102129332 149
608 3300028380 Ga0268265_10262799 Ga0268265_102627992 149
609 3300028380 Ga0268265_10610924 Ga0268265_106109242 149
610 3300028381 Ga0268264_10000134 Ga0268264_10000134100 149
611 3300028381 Ga0268264_10006123 Ga0268264_1000612310 149
612 3300028381 Ga0268264_10007677 Ga0268264_1000767713 149
613 3300028381 Ga0268264_10015771 Ga0268264_100157714 149
614 3300028381 Ga0268264_10092182 Ga0268264_100921822 149
615 3300031251 Ga0265327_10052086 Ga0265327_100520863 149
616 3300031548 Ga0307408_100044383 Ga0307408_1000443834 149
617 3300031548 Ga0307408_100070037 Ga0307408_1000700371 149
618 3300031548 Ga0307408_100226306 Ga0307408_1002263062 149
619 3300031548 Ga0307408_100515299 Ga0307408_1005152992 149
620 3300031548 Ga0307408_100539982 Ga0307408_1005399823 149
621 3300031731 Ga0307405_10028963 Ga0307405_100289633 149
622 3300031731 Ga0307405_10308258 Ga0307405_103082582 149
623 3300031731 Ga0307405_10616464 Ga0307405_106164642 149
624 3300031731 Ga0307405_10636995 Ga0307405_106369952 149
625 3300031731 Ga0307405_10656199 Ga0307405_106561991 149
626 3300031824 Ga0307413_10004731 Ga0307413_100047317 149
627 3300031824 Ga0307413_10034128 Ga0307413_100341283 149
628 3300031824 Ga0307413_10045118 Ga0307413_100451183 149
629 3300031824 Ga0307413_10080900 Ga0307413_100809002 149
630 3300031824 Ga0307413_10197197 Ga0307413_101971972 149
631 3300031824 Ga0307413_10271019 Ga0307413_102710192 149
632 3300031824 Ga0307413_10303344 Ga0307413_103033442 149
633 3300031824 Ga0307413_10469024 Ga0307413_104690242 149
634 3300031824 Ga0307413_10601497 Ga0307413_106014972 149
635 3300031852 Ga0307410_10021686 Ga0307410_100216863 149
636 3300031852 Ga0307410_10022287 Ga0307410_100222874 149
637 3300031852 Ga0307410_10079951 Ga0307410_100799514 149
638 3300031852 Ga0307410_10108246 Ga0307410_101082461 149
639 3300031852 Ga0307410_10181995 Ga0307410_101819954 149
640 3300031852 Ga0307410_10292913 Ga0307410_102929132 149
641 3300031852 Ga0307410_10343456 Ga0307410_103434561 149
642 3300031852 Ga0307410_11198113 Ga0307410_111981131 149
643 3300031901 Ga0307406_10094196 Ga0307406_100941962 149
644 3300031901 Ga0307406_10209725 Ga0307406_102097252 149
645 3300031901 Ga0307406_10335117 Ga0307406_103351172 149
646 3300031903 Ga0307407_10023926 Ga0307407_100239263 149
647 3300031903 Ga0307407_10042917 Ga0307407_100429173 149
648 3300031903 Ga0307407_10066541 Ga0307407_100665413 149
649 3300031903 Ga0307407_10192540 Ga0307407_101925403 149
650 3300031903 Ga0307407_10241749 Ga0307407_102417493 149
651 3300031903 Ga0307407_10446019 Ga0307407_104460192 149
652 3300031911 Ga0307412_10130272 Ga0307412_101302723 149
653 3300031911 Ga0307412_10169174 Ga0307412_101691743 149
654 3300031911 Ga0307412_10173453 Ga0307412_101734533 149
655 3300031911 Ga0307412_10347349 Ga0307412_103473491 149
656 3300031911 Ga0307412_10511574 Ga0307412_105115742 149
657 3300031995 Ga0307409_100008505 Ga0307409_1000085058 149
658 3300031995 Ga0307409_100020648 Ga0307409_1000206484 149
659 3300031995 Ga0307409_100038493 Ga0307409_1000384932 149
660 3300031995 Ga0307409_100050142 Ga0307409_1000501423 149
661 3300031995 Ga0307409_100214113 Ga0307409_1002141133 149
662 3300031995 Ga0307409_100741163 Ga0307409_1007411631 149
663 3300031995 Ga0307409_100752999 Ga0307409_1007529992 149
664 3300031995 Ga0307409_101881578 Ga0307409_1018815781 149
665 3300032002 Ga0307416_100054472 Ga0307416_1000544722 149
666 3300032002 Ga0307416_100102541 Ga0307416_1001025414 149
667 3300032002 Ga0307416_100154356 Ga0307416_1001543563 149
668 3300032002 Ga0307416_100647574 Ga0307416_1006475742 149
669 3300032002 Ga0307416_101204091 Ga0307416_1012040912 149
670 3300032002 Ga0307416_101339090 Ga0307416_1013390902 149
671 3300032002 Ga0307416_101493691 Ga0307416_1014936912 149
672 3300032004 Ga0307414_10027386 Ga0307414_100273865 149
673 3300032004 Ga0307414_10035280 Ga0307414_100352803 149
674 3300032004 Ga0307414_10193677 Ga0307414_101936772 149
675 3300032004 Ga0307414_10270967 Ga0307414_102709673 149
676 3300032004 Ga0307414_10634120 Ga0307414_106341202 149
677 3300032004 Ga0307414_11211234 Ga0307414_112112341 149
678 3300032005 Ga0307411_10000291 Ga0307411_1000029120 149
679 3300032005 Ga0307411_10003039 Ga0307411_1000303910 149
680 3300032005 Ga0307411_10016408 Ga0307411_100164082 149
681 3300032005 Ga0307411_10016864 Ga0307411_100168647 149
682 3300032005 Ga0307411_10018843 Ga0307411_100188435 149
683 3300032005 Ga0307411_10073141 Ga0307411_100731415 149
684 3300032005 Ga0307411_10371099 Ga0307411_103710991 149
685 3300032005 Ga0307411_10371407 Ga0307411_103714072 149
686 3300032005 Ga0307411_11245928 Ga0307411_112459281 149
687 3300032126 Ga0307415_100039698 Ga0307415_1000396982 149
688 3300032126 Ga0307415_100376875 Ga0307415_1003768752 149
689 3300032126 Ga0307415_100384743 Ga0307415_1003847432 149
690 3300032126 Ga0307415_100524503 Ga0307415_1005245032 149
691 3300032126 Ga0307415_100626065 Ga0307415_1006260652 149
692 3300032126 Ga0307415_101295064 Ga0307415_1012950641 149
693 3300037312 Ga0395899_0042544 Ga0395899_0042544_826_1302 149
694 3300037312 Ga0395899_0325202 Ga0395899_0325202_30_479 149
695 3300037418 Ga0395900_0011557 Ga0395900_0011557_4195_4644 149
696 3300037418 Ga0395900_0016659 Ga0395900_0016659_776_1225 149
697 3300037418 Ga0395900_0017797 Ga0395900_0017797_4522_4971 149
698 3300037418 Ga0395900_0022251 Ga0395900_0022251_2881_3330 149
699 3300037418 Ga0395900_0045518 Ga0395900_0045518_1192_1641 149
700 3300037418 Ga0395900_0084615 Ga0395900_0084615_2126_2602 149
701 3300037418 Ga0395900_0116720 Ga0395900_0116720_1510_1959 149
702 3300037418 Ga0395900_0142421 Ga0395900_0142421_687_1136 149
703 3300037418 Ga0395900_0405575 Ga0395900_0405575_82_582 149
704 3300037466 Ga0395898_0004993 Ga0395898_0004993_4151_4600 149
705 3300037466 Ga0395898_0056828 Ga0395898_0056828_1915_2391 149
706 3300037466 Ga0395898_0489496 Ga0395898_0489496_155_604 149
707 3300037471 Ga0395905_0002455 Ga0395905_0002455_15210_15659 149
708 3300037471 Ga0395905_0005327 Ga0395905_0005327_9361_9810 149
709 3300037471 Ga0395905_0013658 Ga0395905_0013658_3087_3536 149
710 3300037471 Ga0395905_0017889 Ga0395905_0017889_3180_3656 149
711 3300037471 Ga0395905_0023676 Ga0395905_0023676_1227_1676 149
712 3300037471 Ga0395905_0091320 Ga0395905_0091320_433_882 149
713 3300037471 Ga0395905_0139472 Ga0395905_0139472_1209_1658 149
714 3300037471 Ga0395905_0164262 Ga0395905_0164262_840_1340 149
715 3300037471 Ga0395905_0279283 Ga0395905_0279283_672_1121 149
716 3300037471 Ga0395905_0313835 Ga0395905_0313835_733_1182 149
717 3300037471 Ga0395905_0548430 Ga0395905_0548430_357_806 149
718 3300037471 Ga0395905_0940552 Ga0395905_0940552_22_471 149
719 3300037853 Ga0436364_1241845 Ga0436364_1241845_509_982 149
720 3300038443 Ga0395901_0005521 Ga0395901_0005521_544_993 149
721 3300038443 Ga0395901_0040376 Ga0395901_0040376_826_1302 149
722 3300038443 Ga0395901_0060625 Ga0395901_0060625_3277_3726 149
723 3300038443 Ga0395901_0075162 Ga0395901_0075162_1864_2313 149
724 3300038443 Ga0395901_0208699 Ga0395901_0208699_948_1397 149
725 3300038443 Ga0395901_0399022 Ga0395901_0399022_437_886 149
726 3300038443 Ga0395901_0416042 Ga0395901_0416042_78_578 149
727 3300038443 Ga0395901_0475249 Ga0395901_0475249_42_491 149
728 3300038443 Ga0395901_0507413 Ga0395901_0507413_526_1026 149
729 3300038443 Ga0395901_1046550 Ga0395901_1046550_197_646 149
730 3300038443 Ga0395901_1457294 Ga0395901_1457294_127_576 149
731 3300038443 Ga0395901_1477749 Ga0395901_1477749_137_586 149
732 3300042006 Ga0439432_050298 Ga0439432_050298_734_1183 149
733 3300042439 Ga0439464_0000949 Ga0439464_0000949_1660_2115 149
734 3300042876 Ga0451577_0652911 Ga0451577_0652911_383_856 149
735 3300046519 Ga0495632_0218964 Ga0495632_0218964_356_838 149
736 3300046528 Ga0495642_0073339 Ga0495642_0073339_126_602 149
737 3300046684 Ga0495669_0023160 Ga0495669_0023160_891_1340 149
738 3300046691 Ga0495670_0005480 Ga0495670_0005480_749_1198 149
739 3300048920 Ga0496117_0050659 Ga0496117_0050659_956_1429 149
740 3300048924 Ga0496121_0002435 Ga0496121_0002435_19795_20268 149
741 3300048929 Ga0496126_0129105 Ga0496126_0129105_156_632 149
742 3300049571 Ga0501034_0117957 Ga0501034_0117957_222_692 149
743 3300050493 nmdc:mga0k408_438174_c1 nmdc:mga0k408_438174_c1_175_624 149
744 3300053739 Ga0500587_000543 Ga0500587_000543_2775_3251 149
745 3300054114 Ga0501084_1373829 Ga0501084_1373829_130_582 149
746 3300059424 Ga0590075_166462 Ga0590075_166462_26_475 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9215 1 118
5cb9-assembly1.cif.gz_A crystal structure of c-as lyase with mercaptoethonal 0.9116 1 117
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9069 1 118
5hcw-assembly5.cif.gz_A crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.9037 1 117
6xck-assembly3.cif.gz_A crystal structure of c-as lyase with mutation k105e 0.9013 1 117
ID Description Score Start End Superfamily
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9172 5 51 3.30.720.120
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8884 1 119 3.10.180.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8833 5 52 3.30.720.120
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.881 1 119 3.10.180.10
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7798 5 51 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A5E4RUQ9-F1-model_v4 Cadmium-induced protein CadI 1.005 1 50
AF-A0A537USZ9-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 1.003 1 52 GO:0046686
GO:0051213
AF-A0A6M0BJY0-F1-model_v4 Glyoxalase/bleomycin resistance/dioxygenase family protein 0.9927 3 52 GO:0046686
GO:0051213
AF-A0A238DSV9-F1-model_v4 deleted 0.9914 1 50
AF-A0A7Y7BHR2-F1-model_v4 VOC family protein 0.9849 1 124 GO:0046686

Feature Viewer

pLDDT pTM Quality
75.18 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map