F478782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 745 | 257 | 1490 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100102792|Ga0070690_1001027922 |
| Length | 228 |
| Sequence | MNWANRLTLSRLALTILFVAALSSPWRYAHTTALITFLIAGITDFFDGEIARRYQTVTNFGKLMDPLVDKIMIAAAFISLVPLRAIPAWAATIVVGRDFLITGLRLMAISKGQVLTAERLGKHKTSWQIITVLFFLTLLAIAEWSRNIMASDWWQRAWNQAGAVLVWLTVVLTLYSGLGYAWRHRAVIESDVSPIRVSRNKAPVVFPAKRLQQCGRTGNSLSARVSRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 198 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 199 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.98 |
| Rhizosphere | 91.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100102792 | 3300005330 | Bacteria | 1897 |
| 2 | SwRhRL2b_contig_1723717 | 2162886007 | Bacteria | 1517 |
| 3 | SwRhRL2b_contig_3743133 | 2162886007 | Unclassified | 1009 |
| 4 | JGI25406J46586_10003607 | 3300003203 | Bacteria | 7257 |
| 5 | rootH2_10115373 | 3300003320 | Bacteria | 2686 |
| 6 | rootL2_10002087 | 3300003322 | Bacteria | 13991 |
| 7 | JGI25404J52841_10005585 | 3300003659 | Bacteria | 2598 |
| 8 | JGI25405J52794_10000025 | 3300003911 | Bacteria | 15808 |
| 9 | JGI25405J52794_10001870 | 3300003911 | Bacteria | 3544 |
| 10 | JGI25405J52794_10036019 | 3300003911 | Unclassified | 1037 |
| 11 | Ga0065703_1021188 | 3300005272 | Unclassified | 1357 |
| 12 | Ga0065704_10221970 | 3300005289 | Unclassified | 1063 |
| 13 | Ga0065712_10080895 | 3300005290 | Bacteria | 3059 |
| 14 | Ga0065712_10100480 | 3300005290 | Bacteria | 2053 |
| 15 | Ga0065712_10116137 | 3300005290 | Bacteria | 1727 |
| 16 | Ga0065712_10135926 | 3300005290 | Bacteria | 1498 |
| 17 | Ga0065715_10015731 | 3300005293 | Unclassified | 1714 |
| 18 | Ga0065715_10089651 | 3300005293 | Bacteria | 9068 |
| 19 | Ga0065715_10105160 | 3300005293 | Bacteria | 2910 |
| 20 | Ga0065715_10112633 | 3300005293 | Bacteria | 2522 |
| 21 | Ga0065715_10131220 | 3300005293 | Unclassified | 2011 |
| 22 | Ga0065707_10387648 | 3300005295 | Unclassified | 869 |
| 23 | Ga0070658_10620356 | 3300005327 | Unclassified | 938 |
| 24 | Ga0070676_10012807 | 3300005328 | Bacteria | 4589 |
| 25 | Ga0070676_10038170 | 3300005328 | Unclassified | 2773 |
| 26 | Ga0070676_10052269 | 3300005328 | Bacteria | 2402 |
| 27 | Ga0070676_10057319 | 3300005328 | Bacteria | 2305 |
| 28 | Ga0070676_10101430 | 3300005328 | Unclassified | 1778 |
| 29 | Ga0070676_10132772 | 3300005328 | Bacteria | 1576 |
| 30 | Ga0070683_100160631 | 3300005329 | Bacteria | 2132 |
| 31 | Ga0070683_100176304 | 3300005329 | Bacteria | 2029 |
| 32 | Ga0070690_100138368 | 3300005330 | Bacteria | 1651 |
| 33 | Ga0070690_100144021 | 3300005330 | Bacteria | 1620 |
| 34 | Ga0070690_100150935 | 3300005330 | Bacteria | 1585 |
| 35 | Ga0070690_100866582 | 3300005330 | Viruses | 704 |
| 36 | Ga0070670_100017779 | 3300005331 | Bacteria | 6100 |
| 37 | Ga0070670_100246960 | 3300005331 | Bacteria | 1554 |
| 38 | Ga0068869_100166636 | 3300005334 | Bacteria | 1718 |
| 39 | Ga0068869_100358544 | 3300005334 | Bacteria | 1190 |
| 40 | Ga0068869_101094208 | 3300005334 | Unclassified | 697 |
| 41 | Ga0070666_10007141 | 3300005335 | Bacteria | 6884 |
| 42 | Ga0070666_10084340 | 3300005335 | Bacteria | 2174 |
| 43 | Ga0070666_10220452 | 3300005335 | Unclassified | 1338 |
| 44 | Ga0070666_10291209 | 3300005335 | Unclassified | 1162 |
| 45 | Ga0070680_100314226 | 3300005336 | Unclassified | 1330 |
| 46 | Ga0070682_100245887 | 3300005337 | Bacteria | 1287 |
| 47 | Ga0070682_100467446 | 3300005337 | Bacteria | 970 |
| 48 | Ga0068868_100299764 | 3300005338 | Unclassified | 1365 |
| 49 | Ga0068868_100492411 | 3300005338 | Unclassified | 1072 |
| 50 | Ga0068868_100692494 | 3300005338 | Unclassified | 911 |
| 51 | Ga0070660_100206298 | 3300005339 | Bacteria | 1595 |
| 52 | Ga0070660_100777078 | 3300005339 | Unclassified | 805 |
| 53 | Ga0070689_100004932 | 3300005340 | Bacteria | 9056 |
| 54 | Ga0070689_100013094 | 3300005340 | Bacteria | 5994 |
| 55 | Ga0070689_100033715 | 3300005340 | Bacteria | 3903 |
| 56 | Ga0070689_100102165 | 3300005340 | Unclassified | 2271 |
| 57 | Ga0070689_100108351 | 3300005340 | Bacteria | 2207 |
| 58 | Ga0070689_100711224 | 3300005340 | Bacteria | 878 |
| 59 | Ga0070687_100021439 | 3300005343 | Bacteria | 3037 |
| 60 | Ga0070687_100044635 | 3300005343 | Unclassified | 2259 |
| 61 | Ga0070687_100152767 | 3300005343 | Bacteria | 1357 |
| 62 | Ga0070661_100021759 | 3300005344 | Bacteria | 4586 |
| 63 | Ga0070692_10085714 | 3300005345 | Bacteria | 1704 |
| 64 | Ga0070668_100007228 | 3300005347 | Bacteria | 8233 |
| 65 | Ga0070668_100008323 | 3300005347 | Bacteria | 7700 |
| 66 | Ga0070668_100037931 | 3300005347 | Bacteria | 3681 |
| 67 | Ga0070668_100067891 | 3300005347 | Bacteria | 2771 |
| 68 | Ga0070668_100466107 | 3300005347 | Unclassified | 1089 |
| 69 | Ga0070668_100487077 | 3300005347 | Unclassified | 1066 |
| 70 | Ga0070669_100019043 | 3300005353 | Bacteria | 4907 |
| 71 | Ga0070669_100034628 | 3300005353 | Bacteria | 3656 |
| 72 | Ga0070669_100163845 | 3300005353 | Unclassified | 1729 |
| 73 | Ga0070669_100255177 | 3300005353 | Bacteria | 1397 |
| 74 | Ga0070675_100009745 | 3300005354 | Bacteria | 7483 |
| 75 | Ga0070675_100025077 | 3300005354 | Bacteria | 4779 |
| 76 | Ga0070675_100036035 | 3300005354 | Bacteria | 4024 |
| 77 | Ga0070675_100050963 | 3300005354 | Bacteria | 3400 |
| 78 | Ga0070675_100052111 | 3300005354 | Bacteria | 3363 |
| 79 | Ga0070675_100220228 | 3300005354 | Bacteria | 1652 |
| 80 | Ga0070671_100001414 | 3300005355 | Bacteria | 17942 |
| 81 | Ga0070671_100026498 | 3300005355 | Unclassified | 4764 |
| 82 | Ga0070671_100028937 | 3300005355 | Bacteria | 4566 |
| 83 | Ga0070671_100067054 | 3300005355 | Bacteria | 2992 |
| 84 | Ga0070671_100067224 | 3300005355 | Bacteria | 2988 |
| 85 | Ga0070671_100101926 | 3300005355 | Bacteria | 2408 |
| 86 | Ga0070671_100236700 | 3300005355 | Unclassified | 1550 |
| 87 | Ga0070674_100002527 | 3300005356 | Bacteria | 10129 |
| 88 | Ga0070674_100099297 | 3300005356 | Unclassified | 2117 |
| 89 | Ga0070673_100003425 | 3300005364 | Bacteria | 9882 |
| 90 | Ga0070673_100004995 | 3300005364 | Bacteria | 8459 |
| 91 | Ga0070673_100073360 | 3300005364 | Bacteria | 2754 |
| 92 | Ga0070673_100103169 | 3300005364 | Bacteria | 2352 |
| 93 | Ga0070673_100395637 | 3300005364 | Bacteria | 1235 |
| 94 | Ga0070673_101130010 | 3300005364 | Bacteria | 732 |
| 95 | Ga0070688_100003480 | 3300005365 | Bacteria | 8111 |
| 96 | Ga0070688_100006383 | 3300005365 | Bacteria | 6302 |
| 97 | Ga0070688_100019266 | 3300005365 | Bacteria | 3951 |
| 98 | Ga0070688_100098227 | 3300005365 | Unclassified | 1926 |
| 99 | Ga0070659_100011349 | 3300005366 | Bacteria | 6589 |
| 100 | Ga0070659_100241616 | 3300005366 | Unclassified | 1495 |
| 101 | Ga0070659_100940017 | 3300005366 | Unclassified | 757 |
| 102 | Ga0070667_100024177 | 3300005367 | Bacteria | 5046 |
| 103 | Ga0070667_100028056 | 3300005367 | Bacteria | 4685 |
| 104 | Ga0070667_100060584 | 3300005367 | Bacteria | 3202 |
| 105 | Ga0070667_100145108 | 3300005367 | Bacteria | 2081 |
| 106 | Ga0070667_100152645 | 3300005367 | Bacteria | 2030 |
| 107 | Ga0070667_100364944 | 3300005367 | Bacteria | 1309 |
| 108 | Ga0070667_101204974 | 3300005367 | Bacteria | 709 |
| 109 | Ga0070709_10082184 | 3300005434 | Unclassified | 2104 |
| 110 | Ga0070709_10196336 | 3300005434 | Unclassified | 1426 |
| 111 | Ga0070709_10481722 | 3300005434 | Bacteria | 939 |
| 112 | Ga0070709_10577889 | 3300005434 | Unclassified | 863 |
| 113 | Ga0070709_10619730 | 3300005434 | Bacteria | 835 |
| 114 | Ga0070709_10855487 | 3300005434 | Bacteria | 717 |
| 115 | Ga0070714_100015874 | 3300005435 | Bacteria | 6070 |
| 116 | Ga0070714_100392294 | 3300005435 | Bacteria | 1311 |
| 117 | Ga0070714_100394556 | 3300005435 | Unclassified | 1307 |
| 118 | Ga0070714_100493921 | 3300005435 | Unclassified | 1166 |
| 119 | Ga0070714_100870617 | 3300005435 | Unclassified | 874 |
| 120 | Ga0070714_100987939 | 3300005435 | Bacteria | 819 |
| 121 | Ga0070713_100095487 | 3300005436 | Bacteria | 2565 |
| 122 | Ga0070713_100166874 | 3300005436 | Bacteria | 1969 |
| 123 | Ga0070713_100236721 | 3300005436 | Bacteria | 1661 |
| 124 | Ga0070713_100282303 | 3300005436 | Unclassified | 1524 |
| 125 | Ga0070713_100742805 | 3300005436 | Unclassified | 938 |
| 126 | Ga0070710_10014909 | 3300005437 | Bacteria | 3920 |
| 127 | Ga0070710_10065446 | 3300005437 | Bacteria | 2082 |
| 128 | Ga0070701_10211769 | 3300005438 | Bacteria | 1151 |
| 129 | Ga0070711_100032206 | 3300005439 | Bacteria | 3484 |
| 130 | Ga0070711_100058723 | 3300005439 | Bacteria | 2668 |
| 131 | Ga0070711_100077261 | 3300005439 | Unclassified | 2363 |
| 132 | Ga0070711_100087726 | 3300005439 | Bacteria | 2234 |
| 133 | Ga0070711_100399668 | 3300005439 | Bacteria | 1115 |
| 134 | Ga0070705_100032935 | 3300005440 | Bacteria | 2884 |
| 135 | Ga0070705_100053612 | 3300005440 | Bacteria | 2362 |
| 136 | Ga0070705_100146333 | 3300005440 | Unclassified | 1561 |
| 137 | Ga0070705_100634993 | 3300005440 | Bacteria | 830 |
| 138 | Ga0070708_100003538 | 3300005445 | Bacteria | 12241 |
| 139 | Ga0070708_100080722 | 3300005445 | Bacteria | 2944 |
| 140 | Ga0070708_100083050 | 3300005445 | Bacteria | 2903 |
| 141 | Ga0070708_100088156 | 3300005445 | Bacteria | 2821 |
| 142 | Ga0070708_100090963 | 3300005445 | Bacteria | 2778 |
| 143 | Ga0070708_100134926 | 3300005445 | Bacteria | 2286 |
| 144 | Ga0070708_100161008 | 3300005445 | Bacteria | 2091 |
| 145 | Ga0070708_100192923 | 3300005445 | Bacteria | 1906 |
| 146 | Ga0070708_100448215 | 3300005445 | Unclassified | 1217 |
| 147 | Ga0070663_100414194 | 3300005455 | Unclassified | 1104 |
| 148 | Ga0070678_100035886 | 3300005456 | Bacteria | 3466 |
| 149 | Ga0070678_100054264 | 3300005456 | Bacteria | 2919 |
| 150 | Ga0070678_100150230 | 3300005456 | Unclassified | 1876 |
| 151 | Ga0070678_100287090 | 3300005456 | Unclassified | 1393 |
| 152 | Ga0070678_100667755 | 3300005456 | Unclassified | 934 |
| 153 | Ga0070678_100851419 | 3300005456 | Bacteria | 831 |
| 154 | Ga0070662_100159249 | 3300005457 | Bacteria | 1765 |
| 155 | Ga0070662_100229500 | 3300005457 | Unclassified | 1484 |
| 156 | Ga0070662_100355051 | 3300005457 | Bacteria | 1202 |
| 157 | Ga0068867_100005841 | 3300005459 | Bacteria | 8731 |
| 158 | Ga0070685_10050799 | 3300005466 | Unclassified | 2397 |
| 159 | Ga0070685_10097871 | 3300005466 | Bacteria | 1787 |
| 160 | Ga0070685_10234379 | 3300005466 | Bacteria | 1209 |
| 161 | Ga0070685_10292461 | 3300005466 | Bacteria | 1095 |
| 162 | Ga0070706_100000100 | 3300005467 | Bacteria | 104971 |
| 163 | Ga0070706_100003389 | 3300005467 | Bacteria | 15715 |
| 164 | Ga0070706_100007793 | 3300005467 | Bacteria | 10003 |
| 165 | Ga0070706_100049875 | 3300005467 | Bacteria | 3862 |
| 166 | Ga0070706_100088139 | 3300005467 | Bacteria | 2878 |
| 167 | Ga0070706_100105864 | 3300005467 | Bacteria | 2617 |
| 168 | Ga0070706_100122408 | 3300005467 | Bacteria | 2425 |
| 169 | Ga0070706_100145307 | 3300005467 | Bacteria | 2215 |
| 170 | Ga0070706_100170247 | 3300005467 | Bacteria | 2033 |
| 171 | Ga0070706_100267423 | 3300005467 | Unclassified | 1596 |
| 172 | Ga0070706_100289910 | 3300005467 | Bacteria | 1527 |
| 173 | Ga0070706_100410038 | 3300005467 | Bacteria | 1261 |
| 174 | Ga0070707_100003642 | 3300005468 | Bacteria | 14533 |
| 175 | Ga0070707_100008310 | 3300005468 | Bacteria | 9634 |
| 176 | Ga0070707_100008338 | 3300005468 | Bacteria | 9621 |
| 177 | Ga0070707_100013919 | 3300005468 | Bacteria | 7533 |
| 178 | Ga0070707_100029811 | 3300005468 | Bacteria | 5192 |
| 179 | Ga0070707_100054142 | 3300005468 | Bacteria | 3846 |
| 180 | Ga0070707_100113770 | 3300005468 | Bacteria | 2626 |
| 181 | Ga0070707_100121038 | 3300005468 | Bacteria | 2541 |
| 182 | Ga0070707_100134038 | 3300005468 | Bacteria | 2410 |
| 183 | Ga0070707_100141931 | 3300005468 | Bacteria | 2337 |
| 184 | Ga0070707_100229663 | 3300005468 | Bacteria | 1806 |
| 185 | Ga0070707_100261128 | 3300005468 | Bacteria | 1685 |
| 186 | Ga0070707_100529475 | 3300005468 | Unclassified | 1140 |
| 187 | Ga0070707_100598478 | 3300005468 | Unclassified | 1065 |
| 188 | Ga0070707_100745120 | 3300005468 | Unclassified | 943 |
| 189 | Ga0070698_100009634 | 3300005471 | Bacteria | 10334 |
| 190 | Ga0070698_100012104 | 3300005471 | Bacteria | 9144 |
| 191 | Ga0070698_100297435 | 3300005471 | Unclassified | 1545 |
| 192 | Ga0070698_100307677 | 3300005471 | Bacteria | 1516 |
| 193 | Ga0070698_100483255 | 3300005471 | Bacteria | 1176 |
| 194 | Ga0070699_100021747 | 3300005518 | Bacteria | 5529 |
| 195 | Ga0070699_100099155 | 3300005518 | Bacteria | 2553 |
| 196 | Ga0070699_100181583 | 3300005518 | Unclassified | 1867 |
| 197 | Ga0070699_100266256 | 3300005518 | Bacteria | 1533 |
| 198 | Ga0070679_100288891 | 3300005530 | Unclassified | 1591 |
| 199 | Ga0070679_100839676 | 3300005530 | Unclassified | 862 |
| 200 | Ga0070684_100001795 | 3300005535 | Bacteria | 15694 |
| 201 | Ga0070684_100082575 | 3300005535 | Unclassified | 2845 |
| 202 | Ga0070684_100222457 | 3300005535 | Unclassified | 1722 |
| 203 | Ga0070697_100002317 | 3300005536 | Bacteria | 14626 |
| 204 | Ga0070697_100008553 | 3300005536 | Bacteria | 7993 |
| 205 | Ga0070697_100009708 | 3300005536 | Bacteria | 7513 |
| 206 | Ga0070697_100025166 | 3300005536 | Unclassified | 4745 |
| 207 | Ga0070697_100028764 | 3300005536 | Bacteria | 4452 |
| 208 | Ga0070697_100143324 | 3300005536 | Bacteria | 2010 |
| 209 | Ga0070697_100147494 | 3300005536 | Unclassified | 1981 |
| 210 | Ga0070697_100213416 | 3300005536 | Unclassified | 1644 |
| 211 | Ga0070697_100340731 | 3300005536 | Bacteria | 1294 |
| 212 | Ga0068853_100000015 | 3300005539 | Bacteria | 226965 |
| 213 | Ga0070672_100027715 | 3300005543 | Bacteria | 4228 |
| 214 | Ga0070672_100064123 | 3300005543 | Unclassified | 2902 |
| 215 | Ga0070672_100071134 | 3300005543 | Bacteria | 2766 |
| 216 | Ga0070686_100011542 | 3300005544 | Bacteria | 5013 |
| 217 | Ga0070686_100198131 | 3300005544 | Unclassified | 1438 |
| 218 | Ga0070695_100097914 | 3300005545 | Bacteria | 1970 |
| 219 | Ga0070693_100587356 | 3300005547 | Bacteria | 802 |
| 220 | Ga0070665_100022668 | 3300005548 | Bacteria | 6322 |
| 221 | Ga0070665_100033304 | 3300005548 | Bacteria | 5185 |
| 222 | Ga0070665_100036617 | 3300005548 | Bacteria | 4935 |
| 223 | Ga0070665_100232257 | 3300005548 | Bacteria | 1845 |
| 224 | Ga0070665_100520891 | 3300005548 | Bacteria | 1200 |
| 225 | Ga0070704_100069879 | 3300005549 | Bacteria | 2546 |
| 226 | Ga0070704_100284257 | 3300005549 | Unclassified | 1372 |
| 227 | Ga0070664_100097721 | 3300005564 | Bacteria | 2550 |
| 228 | Ga0070664_100246915 | 3300005564 | Unclassified | 1603 |
| 229 | Ga0070664_100744170 | 3300005564 | Unclassified | 915 |
| 230 | Ga0068857_100266329 | 3300005577 | Bacteria | 1574 |
| 231 | Ga0068856_100029613 | 3300005614 | Bacteria | 5348 |
| 232 | Ga0068856_100228077 | 3300005614 | Bacteria | 1878 |
| 233 | Ga0070702_100012896 | 3300005615 | Bacteria | 4208 |
| 234 | Ga0068859_100040808 | 3300005617 | Bacteria | 4661 |
| 235 | Ga0068861_100092208 | 3300005719 | Bacteria | 2393 |
| 236 | Ga0068861_100114319 | 3300005719 | Bacteria | 2167 |
| 237 | Ga0068870_10185635 | 3300005840 | Unclassified | 1251 |
| 238 | Ga0068863_100006492 | 3300005841 | Bacteria | 11470 |
| 239 | Ga0068863_100155423 | 3300005841 | Bacteria | 2190 |
| 240 | Ga0068858_100078501 | 3300005842 | Bacteria | 3068 |
| 241 | Ga0068858_100096008 | 3300005842 | Bacteria | 2762 |
| 242 | Ga0068858_100662419 | 3300005842 | Unclassified | 1014 |
| 243 | Ga0068860_100003161 | 3300005843 | Bacteria | 17000 |
| 244 | Ga0068860_100027109 | 3300005843 | Bacteria | 5520 |
| 245 | Ga0068860_100154302 | 3300005843 | Bacteria | 2213 |
| 246 | Ga0081455_10000725 | 3300005937 | Bacteria | 42784 |
| 247 | Ga0081455_10001494 | 3300005937 | Bacteria | 28914 |
| 248 | Ga0081455_10001733 | 3300005937 | Bacteria | 26391 |
| 249 | Ga0081455_10003636 | 3300005937 | Bacteria | 17668 |
| 250 | Ga0081455_10092829 | 3300005937 | Bacteria | 2441 |
| 251 | Ga0081455_10145068 | 3300005937 | Bacteria | 1838 |
| 252 | Ga0081455_10152593 | 3300005937 | Bacteria | 1779 |
| 253 | Ga0081540_1000380 | 3300005983 | Bacteria | 44546 |
| 254 | Ga0081540_1089363 | 3300005983 | Unclassified | 1359 |
| 255 | Ga0081540_1211289 | 3300005983 | Unclassified | 697 |
| 256 | Ga0081539_10000673 | 3300005985 | Bacteria | 68473 |
| 257 | Ga0081539_10000723 | 3300005985 | Bacteria | 66108 |
| 258 | Ga0081539_10051383 | 3300005985 | Bacteria | 2323 |
| 259 | Ga0070717_10008656 | 3300006028 | Bacteria | 7610 |
| 260 | Ga0070717_10047835 | 3300006028 | Bacteria | 3506 |
| 261 | Ga0070717_10085272 | 3300006028 | Bacteria | 2658 |
| 262 | Ga0070717_10232474 | 3300006028 | Bacteria | 1623 |
| 263 | Ga0070717_10452925 | 3300006028 | Unclassified | 1157 |
| 264 | Ga0070717_10565251 | 3300006028 | Bacteria | 1030 |
| 265 | Ga0070717_10660004 | 3300006028 | Unclassified | 949 |
| 266 | Ga0070715_10052220 | 3300006163 | Unclassified | 1762 |
| 267 | Ga0070715_10144299 | 3300006163 | Unclassified | 1160 |
| 268 | Ga0070715_10164893 | 3300006163 | Bacteria | 1098 |
| 269 | Ga0070716_100031422 | 3300006173 | Unclassified | 2887 |
| 270 | Ga0070716_100047621 | 3300006173 | Bacteria | 2419 |
| 271 | Ga0070716_100094661 | 3300006173 | Bacteria | 1816 |
| 272 | Ga0070716_100147715 | 3300006173 | Bacteria | 1508 |
| 273 | Ga0070716_100197313 | 3300006173 | Bacteria | 1335 |
| 274 | Ga0070716_100290092 | 3300006173 | Unclassified | 1133 |
| 275 | Ga0070716_100482884 | 3300006173 | Unclassified | 910 |
| 276 | Ga0070712_100019751 | 3300006175 | Bacteria | 4400 |
| 277 | Ga0070712_100042850 | 3300006175 | Bacteria | 3113 |
| 278 | Ga0070712_100091656 | 3300006175 | Bacteria | 2227 |
| 279 | Ga0070712_100216189 | 3300006175 | Bacteria | 1514 |
| 280 | Ga0070712_100236083 | 3300006175 | Bacteria | 1454 |
| 281 | Ga0070712_100346000 | 3300006175 | Unclassified | 1215 |
| 282 | Ga0097621_100090066 | 3300006237 | Bacteria | 2566 |
| 283 | Ga0097621_100334145 | 3300006237 | Unclassified | 1344 |
| 284 | Ga0068871_100204852 | 3300006358 | Bacteria | 1705 |
| 285 | Ga0068871_100598591 | 3300006358 | Unclassified | 1002 |
| 286 | Ga0075434_100468775 | 3300006871 | Bacteria | 1280 |
| 287 | Ga0068865_100021029 | 3300006881 | Bacteria | 4240 |
| 288 | Ga0068865_100093670 | 3300006881 | Bacteria | 2185 |
| 289 | Ga0068865_100193956 | 3300006881 | Unclassified | 1573 |
| 290 | Ga0068865_100319199 | 3300006881 | Bacteria | 1249 |
| 291 | Ga0075436_100082978 | 3300006914 | Bacteria | 2224 |
| 292 | Ga0075436_100129779 | 3300006914 | Bacteria | 1767 |
| 293 | Ga0075436_100181825 | 3300006914 | Unclassified | 1486 |
| 294 | Ga0075436_100386039 | 3300006914 | Unclassified | 1013 |
| 295 | Ga0097620_100040808 | 3300006931 | Bacteria | 4661 |
| 296 | Ga0075435_100700730 | 3300007076 | Unclassified | 880 |
| 297 | Ga0099794_10055660 | 3300007265 | Unclassified | 1912 |
| 298 | Ga0099794_10163993 | 3300007265 | Unclassified | 1131 |
| 299 | Ga0099795_10050510 | 3300007788 | Bacteria | 1513 |
| 300 | Ga0099795_10274887 | 3300007788 | Unclassified | 733 |
| 301 | Ga0105240_10122067 | 3300009093 | Bacteria | 3136 |
| 302 | Ga0111539_10437641 | 3300009094 | Unclassified | 1522 |
| 303 | Ga0105245_10760092 | 3300009098 | Bacteria | 1005 |
| 304 | Ga0105247_10092251 | 3300009101 | Bacteria | 1924 |
| 305 | Ga0105247_10139412 | 3300009101 | Bacteria | 1588 |
| 306 | Ga0105247_10529105 | 3300009101 | Unclassified | 863 |
| 307 | Ga0114129_10008863 | 3300009147 | Bacteria | 14354 |
| 308 | Ga0114129_10195062 | 3300009147 | Bacteria | 2747 |
| 309 | Ga0114129_10406451 | 3300009147 | Bacteria | 1793 |
| 310 | Ga0105242_10007976 | 3300009176 | Bacteria | 8156 |
| 311 | Ga0105242_10208331 | 3300009176 | Unclassified | 1740 |
| 312 | Ga0105242_10303673 | 3300009176 | Unclassified | 1458 |
| 313 | Ga0105242_11171138 | 3300009176 | Unclassified | 786 |
| 314 | Ga0105248_10182617 | 3300009177 | Bacteria | 2364 |
| 315 | Ga0105237_10138436 | 3300009545 | Bacteria | 2429 |
| 316 | Ga0105237_10145951 | 3300009545 | Bacteria | 2361 |
| 317 | Ga0105249_10009902 | 3300009553 | Bacteria | 8356 |
| 318 | Ga0105249_10049932 | 3300009553 | Bacteria | 3815 |
| 319 | Ga0105249_10224990 | 3300009553 | Bacteria | 1848 |
| 320 | Ga0105249_10482612 | 3300009553 | Bacteria | 1283 |
| 321 | Ga0099796_10014764 | 3300010159 | Unclassified | 2265 |
| 322 | Ga0099796_10137416 | 3300010159 | Bacteria | 952 |
| 323 | Ga0105239_10119609 | 3300010375 | Bacteria | 2924 |
| 324 | Ga0105239_10180851 | 3300010375 | Bacteria | 2359 |
| 325 | Ga0105246_10044901 | 3300011119 | Bacteria | 3006 |
| 326 | Ga0105246_10186886 | 3300011119 | Bacteria | 1600 |
| 327 | Ga0157373_10435186 | 3300013100 | Unclassified | 942 |
| 328 | Ga0157371_10249979 | 3300013102 | Bacteria | 1276 |
| 329 | Ga0157369_10269366 | 3300013105 | Bacteria | 1775 |
| 330 | Ga0157374_10021137 | 3300013296 | Bacteria | 5785 |
| 331 | Ga0157374_10035185 | 3300013296 | Bacteria | 4581 |
| 332 | Ga0157374_10261968 | 3300013296 | Bacteria | 1703 |
| 333 | Ga0157374_10297608 | 3300013296 | Bacteria | 1596 |
| 334 | Ga0157374_10312188 | 3300013296 | Bacteria | 1557 |
| 335 | Ga0157374_10326076 | 3300013296 | Bacteria | 1522 |
| 336 | Ga0157374_10343879 | 3300013296 | Unclassified | 1481 |
| 337 | Ga0157374_10382785 | 3300013296 | Bacteria | 1401 |
| 338 | Ga0157374_10652212 | 3300013296 | Unclassified | 1064 |
| 339 | Ga0157374_10714983 | 3300013296 | Bacteria | 1015 |
| 340 | Ga0157374_10760788 | 3300013296 | Unclassified | 984 |
| 341 | Ga0157374_10883184 | 3300013296 | Bacteria | 911 |
| 342 | Ga0157374_11645254 | 3300013296 | Unclassified | 666 |
| 343 | Ga0157378_10004866 | 3300013297 | Bacteria | 11778 |
| 344 | Ga0157378_10023999 | 3300013297 | Bacteria | 5365 |
| 345 | Ga0157378_10036089 | 3300013297 | Bacteria | 4375 |
| 346 | Ga0157378_10200689 | 3300013297 | Unclassified | 1886 |
| 347 | Ga0157378_10241837 | 3300013297 | Unclassified | 1724 |
| 348 | Ga0157378_10412445 | 3300013297 | Bacteria | 1333 |
| 349 | Ga0157378_10468492 | 3300013297 | Unclassified | 1253 |
| 350 | Ga0157378_10690792 | 3300013297 | Unclassified | 1039 |
| 351 | Ga0163162_10004971 | 3300013306 | Bacteria | 12803 |
| 352 | Ga0163162_10090240 | 3300013306 | Bacteria | 3146 |
| 353 | Ga0163162_10139468 | 3300013306 | Bacteria | 2537 |
| 354 | Ga0163162_10179632 | 3300013306 | Bacteria | 2242 |
| 355 | Ga0163162_10211618 | 3300013306 | Bacteria | 2069 |
| 356 | Ga0163162_10262328 | 3300013306 | Bacteria | 1859 |
| 357 | Ga0163162_10277418 | 3300013306 | Bacteria | 1808 |
| 358 | Ga0163162_10780988 | 3300013306 | Unclassified | 1073 |
| 359 | Ga0157372_10020989 | 3300013307 | Bacteria | 7052 |
| 360 | Ga0157372_10154707 | 3300013307 | Unclassified | 2648 |
| 361 | Ga0157372_10450369 | 3300013307 | Unclassified | 1500 |
| 362 | Ga0157375_10013802 | 3300013308 | Bacteria | 7199 |
| 363 | Ga0157375_10040342 | 3300013308 | Bacteria | 4499 |
| 364 | Ga0157375_10077547 | 3300013308 | Bacteria | 3353 |
| 365 | Ga0157375_10152282 | 3300013308 | Bacteria | 2449 |
| 366 | Ga0157375_10220736 | 3300013308 | Bacteria | 2054 |
| 367 | Ga0157375_10441241 | 3300013308 | Viruses | 1467 |
| 368 | Ga0157375_11205941 | 3300013308 | Bacteria | 888 |
| 369 | Ga0163163_10049027 | 3300014325 | Unclassified | 4155 |
| 370 | Ga0163163_10800922 | 3300014325 | Bacteria | 1006 |
| 371 | Ga0157377_10030069 | 3300014745 | Bacteria | 2939 |
| 372 | Ga0157377_10403311 | 3300014745 | Unclassified | 932 |
| 373 | Ga0157379_10012044 | 3300014968 | Bacteria | 7556 |
| 374 | Ga0157379_10901795 | 3300014968 | Bacteria | 839 |
| 375 | Ga0157379_11029681 | 3300014968 | Bacteria | 786 |
| 376 | Ga0157376_10000359 | 3300014969 | Bacteria | 30267 |
| 377 | Ga0157376_10013693 | 3300014969 | Bacteria | 6062 |
| 378 | Ga0157376_10026423 | 3300014969 | Bacteria | 4588 |
| 379 | Ga0157376_10058997 | 3300014969 | Bacteria | 3217 |
| 380 | Ga0157376_10106107 | 3300014969 | Bacteria | 2464 |
| 381 | Ga0157376_10167472 | 3300014969 | Bacteria | 1998 |
| 382 | Ga0163161_10069837 | 3300017792 | Unclassified | 2568 |
| 383 | Ga0163161_10113234 | 3300017792 | Unclassified | 2030 |
| 384 | Ga0213874_10151092 | 3300021377 | Bacteria | 810 |
| 385 | Ga0213876_10011355 | 3300021384 | Bacteria | 4758 |
| 386 | Ga0213876_10062816 | 3300021384 | Bacteria | 1960 |
| 387 | Ga0207666_1001106 | 3300025271 | Bacteria | 3189 |
| 388 | Ga0207666_1013162 | 3300025271 | Bacteria | 1160 |
| 389 | Ga0207666_1015124 | 3300025271 | Unclassified | 1096 |
| 390 | Ga0207666_1036567 | 3300025271 | Unclassified | 763 |
| 391 | Ga0207673_1000231 | 3300025290 | Bacteria | 5669 |
| 392 | Ga0207673_1003111 | 3300025290 | Bacteria | 1930 |
| 393 | Ga0207673_1010386 | 3300025290 | Unclassified | 1198 |
| 394 | Ga0207697_10000198 | 3300025315 | Bacteria | 32108 |
| 395 | Ga0207697_10000199 | 3300025315 | Bacteria | 32092 |
| 396 | Ga0207697_10000492 | 3300025315 | Bacteria | 22218 |
| 397 | Ga0207697_10001376 | 3300025315 | Bacteria | 13313 |
| 398 | Ga0207697_10001603 | 3300025315 | Bacteria | 12221 |
| 399 | Ga0207697_10001623 | 3300025315 | Bacteria | 12142 |
| 400 | Ga0207697_10012813 | 3300025315 | Bacteria | 3507 |
| 401 | Ga0207697_10027653 | 3300025315 | Bacteria | 2319 |
| 402 | Ga0207697_10198854 | 3300025315 | Unclassified | 881 |
| 403 | Ga0207653_10010406 | 3300025885 | Bacteria | 2900 |
| 404 | Ga0207653_10189428 | 3300025885 | Unclassified | 772 |
| 405 | Ga0207692_10059463 | 3300025898 | Unclassified | 1974 |
| 406 | Ga0207692_10099986 | 3300025898 | Bacteria | 1590 |
| 407 | Ga0207692_10250271 | 3300025898 | Unclassified | 1062 |
| 408 | Ga0207680_10019989 | 3300025903 | Bacteria | 3593 |
| 409 | Ga0207680_10030665 | 3300025903 | Bacteria | 3036 |
| 410 | Ga0207685_10041136 | 3300025905 | Unclassified | 1727 |
| 411 | Ga0207685_10080121 | 3300025905 | Unclassified | 1349 |
| 412 | Ga0207685_10086835 | 3300025905 | Unclassified | 1308 |
| 413 | Ga0207685_10183028 | 3300025905 | Bacteria | 973 |
| 414 | Ga0207699_10008646 | 3300025906 | Bacteria | 5036 |
| 415 | Ga0207645_10002552 | 3300025907 | Bacteria | 14232 |
| 416 | Ga0207645_10017267 | 3300025907 | Bacteria | 4767 |
| 417 | Ga0207645_10065841 | 3300025907 | Unclassified | 2316 |
| 418 | Ga0207645_10118747 | 3300025907 | Unclassified | 1716 |
| 419 | Ga0207645_10140268 | 3300025907 | Unclassified | 1575 |
| 420 | Ga0207645_10152190 | 3300025907 | Unclassified | 1510 |
| 421 | Ga0207684_10000128 | 3300025910 | Bacteria | 139233 |
| 422 | Ga0207684_10002590 | 3300025910 | Bacteria | 18114 |
| 423 | Ga0207684_10004639 | 3300025910 | Bacteria | 12904 |
| 424 | Ga0207684_10005486 | 3300025910 | Bacteria | 11684 |
| 425 | Ga0207684_10008708 | 3300025910 | Bacteria | 9007 |
| 426 | Ga0207684_10027410 | 3300025910 | Bacteria | 4855 |
| 427 | Ga0207684_10105346 | 3300025910 | Bacteria | 2412 |
| 428 | Ga0207684_10121148 | 3300025910 | Bacteria | 2243 |
| 429 | Ga0207684_10181120 | 3300025910 | Bacteria | 1817 |
| 430 | Ga0207684_10219772 | 3300025910 | Unclassified | 1640 |
| 431 | Ga0207684_10233616 | 3300025910 | Unclassified | 1586 |
| 432 | Ga0207684_10241182 | 3300025910 | Bacteria | 1559 |
| 433 | Ga0207684_10257073 | 3300025910 | Bacteria | 1507 |
| 434 | Ga0207654_10429660 | 3300025911 | Bacteria | 923 |
| 435 | Ga0207654_10559365 | 3300025911 | Bacteria | 813 |
| 436 | Ga0207707_10031645 | 3300025912 | Bacteria | 4631 |
| 437 | Ga0207671_10409122 | 3300025914 | Unclassified | 1079 |
| 438 | Ga0207693_10001095 | 3300025915 | Bacteria | 24368 |
| 439 | Ga0207693_10006558 | 3300025915 | Bacteria | 9630 |
| 440 | Ga0207693_10020690 | 3300025915 | Bacteria | 5233 |
| 441 | Ga0207693_10020698 | 3300025915 | Bacteria | 5232 |
| 442 | Ga0207693_10033555 | 3300025915 | Bacteria | 4050 |
| 443 | Ga0207693_10037139 | 3300025915 | Bacteria | 3839 |
| 444 | Ga0207693_10048365 | 3300025915 | Bacteria | 3339 |
| 445 | Ga0207693_10052073 | 3300025915 | Bacteria | 3211 |
| 446 | Ga0207693_10269314 | 3300025915 | Bacteria | 1335 |
| 447 | Ga0207693_10289411 | 3300025915 | Bacteria | 1284 |
| 448 | Ga0207663_10013301 | 3300025916 | Bacteria | 4469 |
| 449 | Ga0207663_10073144 | 3300025916 | Unclassified | 2217 |
| 450 | Ga0207663_10074143 | 3300025916 | Bacteria | 2205 |
| 451 | Ga0207663_10231890 | 3300025916 | Unclassified | 1349 |
| 452 | Ga0207663_10256842 | 3300025916 | Bacteria | 1289 |
| 453 | Ga0207663_10376163 | 3300025916 | Bacteria | 1081 |
| 454 | Ga0207660_10199270 | 3300025917 | Bacteria | 1563 |
| 455 | Ga0207660_10364693 | 3300025917 | Unclassified | 1159 |
| 456 | Ga0207662_10013481 | 3300025918 | Bacteria | 4570 |
| 457 | Ga0207662_10157076 | 3300025918 | Bacteria | 1450 |
| 458 | Ga0207657_10117697 | 3300025919 | Bacteria | 2188 |
| 459 | Ga0207657_10238529 | 3300025919 | Bacteria | 1452 |
| 460 | Ga0207649_10064479 | 3300025920 | Unclassified | 2316 |
| 461 | Ga0207652_10101800 | 3300025921 | Bacteria | 2538 |
| 462 | Ga0207646_10003886 | 3300025922 | Bacteria | 16577 |
| 463 | Ga0207646_10004817 | 3300025922 | Bacteria | 14466 |
| 464 | Ga0207646_10006990 | 3300025922 | Bacteria | 11559 |
| 465 | Ga0207646_10013567 | 3300025922 | Bacteria | 7785 |
| 466 | Ga0207646_10094871 | 3300025922 | Bacteria | 2672 |
| 467 | Ga0207646_10133924 | 3300025922 | Unclassified | 2231 |
| 468 | Ga0207646_10150392 | 3300025922 | Bacteria | 2099 |
| 469 | Ga0207646_10208552 | 3300025922 | Bacteria | 1764 |
| 470 | Ga0207646_10237817 | 3300025922 | Bacteria | 1646 |
| 471 | Ga0207681_10070932 | 3300025923 | Unclassified | 2428 |
| 472 | Ga0207681_10138700 | 3300025923 | Bacteria | 1808 |
| 473 | Ga0207681_10157271 | 3300025923 | Bacteria | 1709 |
| 474 | Ga0207650_10101579 | 3300025925 | Bacteria | 2214 |
| 475 | Ga0207650_10207761 | 3300025925 | Bacteria | 1571 |
| 476 | Ga0207659_10030146 | 3300025926 | Bacteria | 3703 |
| 477 | Ga0207659_10044848 | 3300025926 | Unclassified | 3113 |
| 478 | Ga0207659_10090372 | 3300025926 | Unclassified | 2285 |
| 479 | Ga0207659_10135420 | 3300025926 | Bacteria | 1906 |
| 480 | Ga0207659_10199970 | 3300025926 | Bacteria | 1595 |
| 481 | Ga0207659_10524976 | 3300025926 | Unclassified | 1004 |
| 482 | Ga0207687_10270530 | 3300025927 | Unclassified | 1358 |
| 483 | Ga0207687_10798003 | 3300025927 | Bacteria | 805 |
| 484 | Ga0207700_10034816 | 3300025928 | Bacteria | 3619 |
| 485 | Ga0207700_10089357 | 3300025928 | Bacteria | 2428 |
| 486 | Ga0207700_10440993 | 3300025928 | Unclassified | 1146 |
| 487 | Ga0207700_10848336 | 3300025928 | Unclassified | 817 |
| 488 | Ga0207664_10258032 | 3300025929 | Unclassified | 1523 |
| 489 | Ga0207664_10413578 | 3300025929 | Unclassified | 1201 |
| 490 | Ga0207664_10815362 | 3300025929 | Unclassified | 839 |
| 491 | Ga0207644_10023266 | 3300025931 | Unclassified | 4242 |
| 492 | Ga0207644_10046488 | 3300025931 | Bacteria | 3093 |
| 493 | Ga0207644_10086121 | 3300025931 | Bacteria | 2332 |
| 494 | Ga0207644_10103889 | 3300025931 | Bacteria | 2138 |
| 495 | Ga0207644_10149873 | 3300025931 | Unclassified | 1804 |
| 496 | Ga0207644_10344208 | 3300025931 | Unclassified | 1209 |
| 497 | Ga0207644_10408826 | 3300025931 | Unclassified | 1110 |
| 498 | Ga0207690_10006328 | 3300025932 | Bacteria | 7013 |
| 499 | Ga0207690_10109574 | 3300025932 | Bacteria | 1986 |
| 500 | Ga0207706_10004103 | 3300025933 | Bacteria | 13759 |
| 501 | Ga0207706_10052726 | 3300025933 | Bacteria | 3591 |
| 502 | Ga0207706_10104223 | 3300025933 | Unclassified | 2495 |
| 503 | Ga0207706_10141340 | 3300025933 | Bacteria | 2118 |
| 504 | Ga0207706_10278124 | 3300025933 | Unclassified | 1460 |
| 505 | Ga0207706_10322382 | 3300025933 | Unclassified | 1345 |
| 506 | Ga0207686_10006480 | 3300025934 | Bacteria | 6302 |
| 507 | Ga0207670_10002895 | 3300025936 | Bacteria | 9064 |
| 508 | Ga0207670_10007754 | 3300025936 | Bacteria | 6021 |
| 509 | Ga0207670_10058220 | 3300025936 | Bacteria | 2624 |
| 510 | Ga0207669_10004423 | 3300025937 | Bacteria | 6182 |
| 511 | Ga0207669_10039343 | 3300025937 | Bacteria | 2731 |
| 512 | Ga0207669_10063883 | 3300025937 | Bacteria | 2275 |
| 513 | Ga0207704_10015844 | 3300025938 | Bacteria | 3855 |
| 514 | Ga0207704_10020503 | 3300025938 | Bacteria | 3499 |
| 515 | Ga0207704_10071700 | 3300025938 | Bacteria | 2199 |
| 516 | Ga0207704_10965137 | 3300025938 | Unclassified | 719 |
| 517 | Ga0207665_10015418 | 3300025939 | Bacteria | 5017 |
| 518 | Ga0207665_10242743 | 3300025939 | Bacteria | 1328 |
| 519 | Ga0207665_10623900 | 3300025939 | Unclassified | 843 |
| 520 | Ga0207691_10000297 | 3300025940 | Bacteria | 49253 |
| 521 | Ga0207691_10030825 | 3300025940 | Bacteria | 5009 |
| 522 | Ga0207691_10099074 | 3300025940 | Bacteria | 2603 |
| 523 | Ga0207691_10625099 | 3300025940 | Bacteria | 911 |
| 524 | Ga0207711_10258581 | 3300025941 | Unclassified | 1600 |
| 525 | Ga0207689_10124555 | 3300025942 | Bacteria | 2120 |
| 526 | Ga0207689_10179963 | 3300025942 | Bacteria | 1744 |
| 527 | Ga0207689_10852468 | 3300025942 | Bacteria | 769 |
| 528 | Ga0207689_10952063 | 3300025942 | Unclassified | 724 |
| 529 | Ga0207661_10013405 | 3300025944 | Bacteria | 5986 |
| 530 | Ga0207661_10022879 | 3300025944 | Bacteria | 4714 |
| 531 | Ga0207661_10098253 | 3300025944 | Bacteria | 2453 |
| 532 | Ga0207661_10102570 | 3300025944 | Bacteria | 2406 |
| 533 | Ga0207661_10602929 | 3300025944 | Unclassified | 1008 |
| 534 | Ga0207679_10066965 | 3300025945 | Unclassified | 2693 |
| 535 | Ga0207679_10096659 | 3300025945 | Bacteria | 2299 |
| 536 | Ga0207679_10909156 | 3300025945 | Unclassified | 805 |
| 537 | Ga0207651_10009937 | 3300025960 | Bacteria | 5242 |
| 538 | Ga0207651_10060338 | 3300025960 | Bacteria | 2632 |
| 539 | Ga0207651_10080049 | 3300025960 | Bacteria | 2350 |
| 540 | Ga0207651_10081285 | 3300025960 | Unclassified | 2335 |
| 541 | Ga0207651_10277451 | 3300025960 | Unclassified | 1383 |
| 542 | Ga0207651_11032315 | 3300025960 | Unclassified | 735 |
| 543 | Ga0207712_10034687 | 3300025961 | Bacteria | 3421 |
| 544 | Ga0207712_10061319 | 3300025961 | Bacteria | 2669 |
| 545 | Ga0207712_10271922 | 3300025961 | Bacteria | 1379 |
| 546 | Ga0207668_10043513 | 3300025972 | Bacteria | 3048 |
| 547 | Ga0207668_10061172 | 3300025972 | Unclassified | 2647 |
| 548 | Ga0207668_10205846 | 3300025972 | Bacteria | 1570 |
| 549 | Ga0207658_10048549 | 3300025986 | Bacteria | 3113 |
| 550 | Ga0207658_10058219 | 3300025986 | Bacteria | 2875 |
| 551 | Ga0207658_10077422 | 3300025986 | Bacteria | 2537 |
| 552 | Ga0207658_10085657 | 3300025986 | Bacteria | 2427 |
| 553 | Ga0207658_10517561 | 3300025986 | Unclassified | 1064 |
| 554 | Ga0207658_11023884 | 3300025986 | Unclassified | 754 |
| 555 | Ga0207677_10064296 | 3300026023 | Bacteria | 2554 |
| 556 | Ga0207677_10187875 | 3300026023 | Bacteria | 1632 |
| 557 | Ga0207703_10077973 | 3300026035 | Unclassified | 2752 |
| 558 | Ga0207703_10340056 | 3300026035 | Bacteria | 1379 |
| 559 | Ga0207639_10000022 | 3300026041 | Bacteria | 226983 |
| 560 | Ga0207678_10004776 | 3300026067 | Bacteria | 12161 |
| 561 | Ga0207708_10018830 | 3300026075 | Bacteria | 5200 |
| 562 | Ga0207708_10410194 | 3300026075 | Bacteria | 1122 |
| 563 | Ga0207702_10113902 | 3300026078 | Unclassified | 2409 |
| 564 | Ga0207702_10737370 | 3300026078 | Unclassified | 972 |
| 565 | Ga0207641_10012790 | 3300026088 | Bacteria | 6879 |
| 566 | Ga0207641_10631676 | 3300026088 | Bacteria | 1051 |
| 567 | Ga0207648_10041835 | 3300026089 | Bacteria | 4024 |
| 568 | Ga0207675_100078710 | 3300026118 | Bacteria | 3089 |
| 569 | Ga0207683_10003256 | 3300026121 | Bacteria | 14160 |
| 570 | Ga0207683_10022180 | 3300026121 | Bacteria | 5450 |
| 571 | Ga0207683_10043757 | 3300026121 | Unclassified | 3913 |
| 572 | Ga0207683_10070355 | 3300026121 | Bacteria | 3091 |
| 573 | Ga0207683_10131255 | 3300026121 | Bacteria | 2253 |
| 574 | Ga0207683_10640885 | 3300026121 | Unclassified | 984 |
| 575 | Ga0207698_11182051 | 3300026142 | Bacteria | 779 |
| 576 | Ga0209974_10064994 | 3300027876 | Unclassified | 1239 |
| 577 | Ga0268266_10012128 | 3300028379 | Bacteria | 7459 |
| 578 | Ga0268266_10048393 | 3300028379 | Bacteria | 3644 |
| 579 | Ga0268266_10188780 | 3300028379 | Bacteria | 1880 |
| 580 | Ga0268266_11373269 | 3300028379 | Bacteria | 682 |
| 581 | Ga0268265_10373779 | 3300028380 | Bacteria | 1309 |
| 582 | Ga0268265_10893945 | 3300028380 | Bacteria | 872 |
| 583 | Ga0268264_10000626 | 3300028381 | Bacteria | 42069 |
| 584 | Ga0268264_10017273 | 3300028381 | Bacteria | 5911 |
| 585 | Ga0268264_10259714 | 3300028381 | Bacteria | 1617 |
| 586 | Ga0268264_10555874 | 3300028381 | Unclassified | 1126 |
| 587 | Ga0373948_0088409 | 3300034817 | Unclassified | 716 |
| 588 | Ga0373944_0115072 | 3300035089 | Unclassified | 922 |
| 589 | Ga0373923_0103709 | 3300035111 | Bacteria | 1257 |
| 590 | Ga0373953_0100006 | 3300035117 | Bacteria | 1220 |
| 591 | Ga0373957_0133798 | 3300035120 | Unclassified | 1011 |
| 592 | Ga0373943_0095578 | 3300035170 | Bacteria | 1546 |
| 593 | Ga0373943_0231306 | 3300035170 | Unclassified | 1033 |
| 594 | Ga0373946_0051749 | 3300035171 | Bacteria | 1720 |
| 595 | Ga0373946_0081088 | 3300035171 | Bacteria | 1421 |
| 596 | Ga0373946_0098900 | 3300035171 | Unclassified | 1305 |
| 597 | Ga0373935_0163759 | 3300035692 | Unclassified | 1517 |
| 598 | Ga0373935_0265204 | 3300035692 | Unclassified | 1205 |
| 599 | Ga0373935_0309641 | 3300035692 | Bacteria | 1118 |
| 600 | Ga0373935_0392132 | 3300035692 | Unclassified | 996 |
| 601 | Ga0373927_0099219 | 3300035695 | Bacteria | 1894 |
| 602 | Ga0373927_0445086 | 3300035695 | Unclassified | 855 |
| 603 | Ga0373933_0033926 | 3300035724 | Bacteria | 2972 |
| 604 | Ga0373947_0041015 | 3300035725 | Bacteria | 2759 |
| 605 | Ga0373947_0058729 | 3300035725 | Unclassified | 2331 |
| 606 | Ga0373947_0087012 | 3300035725 | Bacteria | 1943 |
| 607 | Ga0373947_0134058 | 3300035725 | Bacteria | 1583 |
| 608 | Ga0373947_0281981 | 3300035725 | Bacteria | 1105 |
| 609 | Ga0373937_0045397 | 3300036401 | Bacteria | 4015 |
| 610 | Ga0373937_0221143 | 3300036401 | Unclassified | 1783 |
| 611 | Ga0373925_0021781 | 3300037068 | Bacteria | 4672 |
| 612 | Ga0373925_0512160 | 3300037068 | Bacteria | 985 |
| 613 | Ga0395899_0236157 | 3300037312 | Unclassified | 1260 |
| 614 | Ga0395900_0079966 | 3300037418 | Unclassified | 3359 |
| 615 | Ga0395900_0137435 | 3300037418 | Bacteria | 2504 |
| 616 | Ga0395900_0172537 | 3300037418 | Bacteria | 2201 |
| 617 | Ga0395898_0015715 | 3300037466 | Bacteria | 7757 |
| 618 | Ga0395898_0391891 | 3300037466 | Unclassified | 1324 |
| 619 | Ga0395898_0563025 | 3300037466 | Bacteria | 1082 |
| 620 | Ga0395905_0004356 | 3300037471 | Bacteria | 14738 |
| 621 | Ga0436364_0223079 | 3300037853 | Bacteria | 1428 |
| 622 | Ga0395901_0013525 | 3300038443 | Bacteria | 8299 |
| 623 | Ga0395901_0061139 | 3300038443 | Bacteria | 3920 |
| 624 | Ga0395901_0181434 | 3300038443 | Unclassified | 2208 |
| 625 | Ga0395901_0307595 | 3300038443 | Unclassified | 1642 |
| 626 | Ga0395901_0308725 | 3300038443 | Unclassified | 1639 |
| 627 | Ga0436365_0016244 | 3300039437 | Bacteria | 17201 |
| 628 | Ga0436365_0042856 | 3300039437 | Bacteria | 8524 |
| 629 | Ga0436365_0067186 | 3300039437 | Bacteria | 4959 |
| 630 | Ga0436363_1151520 | 3300039450 | Unclassified | 1282 |
| 631 | Ga0436363_1576806 | 3300039450 | Bacteria | 1357 |
| 632 | Ga0436362_0467398 | 3300039453 | Unclassified | 677 |
| 633 | Ga0451849_1477180 | 3300041505 | Bacteria | 1459 |
| 634 | Ga0439451_014798 | 3300042009 | Bacteria | 1574 |
| 635 | Ga0439455_0067458 | 3300042012 | Bacteria | 957 |
| 636 | Ga0439458_0060953 | 3300042157 | Bacteria | 942 |
| 637 | Ga0439460_0050621 | 3300042461 | Bacteria | 1245 |
| 638 | Ga0495629_0155610 | 3300046459 | Bacteria | 1588 |
| 639 | Ga0495580_0031728 | 3300046472 | Bacteria | 3816 |
| 640 | Ga0495580_0424772 | 3300046472 | Unclassified | 894 |
| 641 | Ga0495662_0031534 | 3300046476 | Bacteria | 2561 |
| 642 | Ga0495664_0110542 | 3300046477 | Bacteria | 1659 |
| 643 | Ga0495584_0069634 | 3300046491 | Bacteria | 1768 |
| 644 | Ga0495608_0288536 | 3300046511 | Unclassified | 1017 |
| 645 | Ga0495618_0098429 | 3300046514 | Unclassified | 1871 |
| 646 | Ga0495628_0033015 | 3300046516 | Unclassified | 4174 |
| 647 | Ga0495630_0006745 | 3300046517 | Bacteria | 8183 |
| 648 | Ga0495630_0848610 | 3300046517 | Unclassified | 696 |
| 649 | Ga0495665_0133914 | 3300046531 | Bacteria | 1297 |
| 650 | Ga0495640_0165362 | 3300046533 | Unclassified | 1416 |
| 651 | Ga0495640_0192251 | 3300046533 | Unclassified | 1297 |
| 652 | Ga0495640_0209281 | 3300046533 | Bacteria | 1234 |
| 653 | Ga0495586_0164379 | 3300046535 | Bacteria | 1252 |
| 654 | Ga0495587_0139986 | 3300046536 | Unclassified | 1381 |
| 655 | Ga0495609_0150804 | 3300046538 | Unclassified | 989 |
| 656 | Ga0495645_0378126 | 3300046543 | Unclassified | 907 |
| 657 | Ga0495667_0303556 | 3300046559 | Unclassified | 1011 |
| 658 | Ga0495667_0500086 | 3300046559 | Unclassified | 762 |
| 659 | Ga0495634_0037776 | 3300046642 | Unclassified | 3297 |
| 660 | Ga0495635_0129162 | 3300046663 | Bacteria | 1723 |
| 661 | Ga0495635_0570418 | 3300046663 | Unclassified | 741 |
| 662 | Ga0495657_0178449 | 3300046675 | Unclassified | 1305 |
| 663 | Ga0495599_0112688 | 3300046678 | Unclassified | 1693 |
| 664 | Ga0495646_0026698 | 3300046680 | Bacteria | 3625 |
| 665 | Ga0495647_0069053 | 3300046681 | Bacteria | 1411 |
| 666 | Ga0495658_0031587 | 3300046683 | Bacteria | 2886 |
| 667 | Ga0495658_0132003 | 3300046683 | Unclassified | 1521 |
| 668 | Ga0495669_0150350 | 3300046684 | Unclassified | 1102 |
| 669 | Ga0495613_0390429 | 3300046689 | Bacteria | 951 |
| 670 | Ga0495624_0164005 | 3300046690 | Bacteria | 1357 |
| 671 | Ga0495604_0065324 | 3300047317 | Unclassified | 2770 |
| 672 | Ga0495604_0091081 | 3300047317 | Unclassified | 2263 |
| 673 | Ga0495604_0254563 | 3300047317 | Bacteria | 1196 |
| 674 | Ga0495604_0366045 | 3300047317 | Unclassified | 955 |
| 675 | Ga0495604_0568845 | 3300047317 | Unclassified | 729 |
| 676 | Ga0495674_0328635 | 3300047319 | Unclassified | 1244 |
| 677 | Ga0495676_0382101 | 3300047321 | Unclassified | 937 |
| 678 | Ga0495680_0504155 | 3300047322 | Unclassified | 821 |
| 679 | Ga0495680_0587327 | 3300047322 | Unclassified | 747 |
| 680 | Ga0495675_0023071 | 3300047444 | Bacteria | 3966 |
| 681 | Ga0495684_0005005 | 3300047471 | Bacteria | 10334 |
| 682 | Ga0495593_0378554 | 3300047673 | Unclassified | 708 |
| 683 | Ga0496100_0040454 | 3300048903 | Bacteria | 2966 |
| 684 | Ga0496100_0060179 | 3300048903 | Bacteria | 2499 |
| 685 | Ga0496100_0398458 | 3300048903 | Unclassified | 1048 |
| 686 | Ga0496100_0472229 | 3300048903 | Unclassified | 964 |
| 687 | Ga0496100_0923585 | 3300048903 | Unclassified | 686 |
| 688 | Ga0496101_0019721 | 3300048904 | Bacteria | 4609 |
| 689 | Ga0496101_0058452 | 3300048904 | Bacteria | 2793 |
| 690 | Ga0496101_0407472 | 3300048904 | Unclassified | 1071 |
| 691 | Ga0496101_0852023 | 3300048904 | Bacteria | 718 |
| 692 | Ga0496102_0028483 | 3300048905 | Bacteria | 4990 |
| 693 | Ga0496102_0061982 | 3300048905 | Bacteria | 3424 |
| 694 | Ga0496102_0067380 | 3300048905 | Bacteria | 3283 |
| 695 | Ga0496102_0556192 | 3300048905 | Unclassified | 1070 |
| 696 | Ga0496103_0035273 | 3300048906 | Bacteria | 3062 |
| 697 | Ga0496103_0542514 | 3300048906 | Unclassified | 743 |
| 698 | Ga0496104_0214599 | 3300048907 | Bacteria | 1836 |
| 699 | Ga0496104_0310695 | 3300048907 | Unclassified | 1489 |
| 700 | Ga0496104_0383799 | 3300048907 | Bacteria | 1317 |
| 701 | Ga0496104_0722009 | 3300048907 | Bacteria | 904 |
| 702 | Ga0496105_0063115 | 3300048908 | Bacteria | 3057 |
| 703 | Ga0496105_0393740 | 3300048908 | Unclassified | 1101 |
| 704 | Ga0496106_0013446 | 3300048909 | Bacteria | 6041 |
| 705 | Ga0496106_0115505 | 3300048909 | Bacteria | 2093 |
| 706 | Ga0496106_0387719 | 3300048909 | Bacteria | 1123 |
| 707 | Ga0496107_0025904 | 3300048910 | Bacteria | 4156 |
| 708 | Ga0496107_0072248 | 3300048910 | Bacteria | 2508 |
| 709 | Ga0496108_0051616 | 3300048911 | Bacteria | 3445 |
| 710 | Ga0496108_0268729 | 3300048911 | Bacteria | 1484 |
| 711 | Ga0496108_0353233 | 3300048911 | Bacteria | 1283 |
| 712 | Ga0496109_0023921 | 3300048912 | Bacteria | 5425 |
| 713 | Ga0496109_0076860 | 3300048912 | Bacteria | 3072 |
| 714 | Ga0496109_0081656 | 3300048912 | Bacteria | 2979 |
| 715 | Ga0496109_0082880 | 3300048912 | Bacteria | 2957 |
| 716 | Ga0496109_0119535 | 3300048912 | Bacteria | 2454 |
| 717 | Ga0496109_0274082 | 3300048912 | Bacteria | 1590 |
| 718 | Ga0496110_0135146 | 3300048913 | Bacteria | 2228 |
| 719 | Ga0496110_0193669 | 3300048913 | Bacteria | 1846 |
| 720 | Ga0496110_0563549 | 3300048913 | Unclassified | 1035 |
| 721 | Ga0496112_0019873 | 3300048915 | Bacteria | 6356 |
| 722 | Ga0496112_0184618 | 3300048915 | Bacteria | 2049 |
| 723 | Ga0496112_0245040 | 3300048915 | Bacteria | 1744 |
| 724 | Ga0496112_0288277 | 3300048915 | Bacteria | 1588 |
| 725 | Ga0496112_0601425 | 3300048915 | Unclassified | 1031 |
| 726 | Ga0496112_0813075 | 3300048915 | Bacteria | 859 |
| 727 | Ga0496112_0974302 | 3300048915 | Unclassified | 768 |
| 728 | Ga0496113_0031658 | 3300048916 | Bacteria | 3840 |
| 729 | Ga0496113_0153299 | 3300048916 | Bacteria | 1819 |
| 730 | Ga0496114_0458231 | 3300048917 | Unclassified | 1129 |
| 731 | Ga0496114_0673639 | 3300048917 | Unclassified | 908 |
| 732 | Ga0496115_0005638 | 3300048918 | Bacteria | 9109 |
| 733 | Ga0496115_0037653 | 3300048918 | Bacteria | 3834 |
| 734 | Ga0496115_0232710 | 3300048918 | Bacteria | 1519 |
| 735 | Ga0501067_0153289 | 3300049583 | Unclassified | 1284 |
| 736 | nmdc:mga05p37_182533_c1 | 3300050507 | Bacteria | 2552 |
| 737 | nmdc:mga05p37_5948_c1 | 3300050507 | Bacteria | 14354 |
| 738 | nmdc:mga05p37_817414_c1 | 3300050507 | Unclassified | 1017 |
| 739 | nmdc:mga08y16_500506_c1 | 3300050511 | Bacteria | 1234 |
| 740 | nmdc:mga0n895_774975_c1 | 3300050512 | Bacteria | 951 |
| 741 | nmdc:mga08x19_637232_c1 | 3300050514 | Unclassified | 756 |
| 742 | Ga0495601_0024231 | 3300053077 | Bacteria | 3737 |
| 743 | Ga0495595_0149273 | 3300053084 | Bacteria | 1150 |
| 744 | Ga0495619_0372338 | 3300053085 | Unclassified | 987 |
| 745 | Ga0495619_0422103 | 3300053085 | Unclassified | 920 |
| 746 | Ga0070690_100102792 | |||
| 747 | SwRhRL2b_contig_1723717 | |||
| 748 | SwRhRL2b_contig_3743133 | |||
| 749 | JGI25406J46586_10003607 | |||
| 750 | rootH2_10115373 | |||
| 751 | rootL2_10002087 | |||
| 752 | JGI25404J52841_10005585 | |||
| 753 | JGI25405J52794_10000025 | |||
| 754 | JGI25405J52794_10001870 | |||
| 755 | JGI25405J52794_10036019 | |||
| 756 | Ga0065703_1021188 | |||
| 757 | Ga0065704_10221970 | |||
| 758 | Ga0065712_10080895 | |||
| 759 | Ga0065712_10100480 | |||
| 760 | Ga0065712_10116137 | |||
| 761 | Ga0065712_10135926 | |||
| 762 | Ga0065715_10015731 | |||
| 763 | Ga0065715_10089651 | |||
| 764 | Ga0065715_10105160 | |||
| 765 | Ga0065715_10112633 | |||
| 766 | Ga0065715_10131220 | |||
| 767 | Ga0065707_10387648 | |||
| 768 | Ga0070658_10620356 | |||
| 769 | Ga0070676_10012807 | |||
| 770 | Ga0070676_10038170 | |||
| 771 | Ga0070676_10052269 | |||
| 772 | Ga0070676_10057319 | |||
| 773 | Ga0070676_10101430 | |||
| 774 | Ga0070676_10132772 | |||
| 775 | Ga0070683_100160631 | |||
| 776 | Ga0070683_100176304 | |||
| 777 | Ga0070690_100138368 | |||
| 778 | Ga0070690_100144021 | |||
| 779 | Ga0070690_100150935 | |||
| 780 | Ga0070690_100866582 | |||
| 781 | Ga0070670_100017779 | |||
| 782 | Ga0070670_100246960 | |||
| 783 | Ga0068869_100166636 | |||
| 784 | Ga0068869_100358544 | |||
| 785 | Ga0068869_101094208 | |||
| 786 | Ga0070666_10007141 | |||
| 787 | Ga0070666_10084340 | |||
| 788 | Ga0070666_10220452 | |||
| 789 | Ga0070666_10291209 | |||
| 790 | Ga0070680_100314226 | |||
| 791 | Ga0070682_100245887 | |||
| 792 | Ga0070682_100467446 | |||
| 793 | Ga0068868_100299764 | |||
| 794 | Ga0068868_100492411 | |||
| 795 | Ga0068868_100692494 | |||
| 796 | Ga0070660_100206298 | |||
| 797 | Ga0070660_100777078 | |||
| 798 | Ga0070689_100004932 | |||
| 799 | Ga0070689_100013094 | |||
| 800 | Ga0070689_100033715 | |||
| 801 | Ga0070689_100102165 | |||
| 802 | Ga0070689_100108351 | |||
| 803 | Ga0070689_100711224 | |||
| 804 | Ga0070687_100021439 | |||
| 805 | Ga0070687_100044635 | |||
| 806 | Ga0070687_100152767 | |||
| 807 | Ga0070661_100021759 | |||
| 808 | Ga0070692_10085714 | |||
| 809 | Ga0070668_100007228 | |||
| 810 | Ga0070668_100008323 | |||
| 811 | Ga0070668_100037931 | |||
| 812 | Ga0070668_100067891 | |||
| 813 | Ga0070668_100466107 | |||
| 814 | Ga0070668_100487077 | |||
| 815 | Ga0070669_100019043 | |||
| 816 | Ga0070669_100034628 | |||
| 817 | Ga0070669_100163845 | |||
| 818 | Ga0070669_100255177 | |||
| 819 | Ga0070675_100009745 | |||
| 820 | Ga0070675_100025077 | |||
| 821 | Ga0070675_100036035 | |||
| 822 | Ga0070675_100050963 | |||
| 823 | Ga0070675_100052111 | |||
| 824 | Ga0070675_100220228 | |||
| 825 | Ga0070671_100001414 | |||
| 826 | Ga0070671_100026498 | |||
| 827 | Ga0070671_100028937 | |||
| 828 | Ga0070671_100067054 | |||
| 829 | Ga0070671_100067224 | |||
| 830 | Ga0070671_100101926 | |||
| 831 | Ga0070671_100236700 | |||
| 832 | Ga0070674_100002527 | |||
| 833 | Ga0070674_100099297 | |||
| 834 | Ga0070673_100003425 | |||
| 835 | Ga0070673_100004995 | |||
| 836 | Ga0070673_100073360 | |||
| 837 | Ga0070673_100103169 | |||
| 838 | Ga0070673_100395637 | |||
| 839 | Ga0070673_101130010 | |||
| 840 | Ga0070688_100003480 | |||
| 841 | Ga0070688_100006383 | |||
| 842 | Ga0070688_100019266 | |||
| 843 | Ga0070688_100098227 | |||
| 844 | Ga0070659_100011349 | |||
| 845 | Ga0070659_100241616 | |||
| 846 | Ga0070659_100940017 | |||
| 847 | Ga0070667_100024177 | |||
| 848 | Ga0070667_100028056 | |||
| 849 | Ga0070667_100060584 | |||
| 850 | Ga0070667_100145108 | |||
| 851 | Ga0070667_100152645 | |||
| 852 | Ga0070667_100364944 | |||
| 853 | Ga0070667_101204974 | |||
| 854 | Ga0070709_10082184 | |||
| 855 | Ga0070709_10196336 | |||
| 856 | Ga0070709_10481722 | |||
| 857 | Ga0070709_10577889 | |||
| 858 | Ga0070709_10619730 | |||
| 859 | Ga0070709_10855487 | |||
| 860 | Ga0070714_100015874 | |||
| 861 | Ga0070714_100392294 | |||
| 862 | Ga0070714_100394556 | |||
| 863 | Ga0070714_100493921 | |||
| 864 | Ga0070714_100870617 | |||
| 865 | Ga0070714_100987939 | |||
| 866 | Ga0070713_100095487 | |||
| 867 | Ga0070713_100166874 | |||
| 868 | Ga0070713_100236721 | |||
| 869 | Ga0070713_100282303 | |||
| 870 | Ga0070713_100742805 | |||
| 871 | Ga0070710_10014909 | |||
| 872 | Ga0070710_10065446 | |||
| 873 | Ga0070701_10211769 | |||
| 874 | Ga0070711_100032206 | |||
| 875 | Ga0070711_100058723 | |||
| 876 | Ga0070711_100077261 | |||
| 877 | Ga0070711_100087726 | |||
| 878 | Ga0070711_100399668 | |||
| 879 | Ga0070705_100032935 | |||
| 880 | Ga0070705_100053612 | |||
| 881 | Ga0070705_100146333 | |||
| 882 | Ga0070705_100634993 | |||
| 883 | Ga0070708_100003538 | |||
| 884 | Ga0070708_100080722 | |||
| 885 | Ga0070708_100083050 | |||
| 886 | Ga0070708_100088156 | |||
| 887 | Ga0070708_100090963 | |||
| 888 | Ga0070708_100134926 | |||
| 889 | Ga0070708_100161008 | |||
| 890 | Ga0070708_100192923 | |||
| 891 | Ga0070708_100448215 | |||
| 892 | Ga0070663_100414194 | |||
| 893 | Ga0070678_100035886 | |||
| 894 | Ga0070678_100054264 | |||
| 895 | Ga0070678_100150230 | |||
| 896 | Ga0070678_100287090 | |||
| 897 | Ga0070678_100667755 | |||
| 898 | Ga0070678_100851419 | |||
| 899 | Ga0070662_100159249 | |||
| 900 | Ga0070662_100229500 | |||
| 901 | Ga0070662_100355051 | |||
| 902 | Ga0068867_100005841 | |||
| 903 | Ga0070685_10050799 | |||
| 904 | Ga0070685_10097871 | |||
| 905 | Ga0070685_10234379 | |||
| 906 | Ga0070685_10292461 | |||
| 907 | Ga0070706_100000100 | |||
| 908 | Ga0070706_100003389 | |||
| 909 | Ga0070706_100007793 | |||
| 910 | Ga0070706_100049875 | |||
| 911 | Ga0070706_100088139 | |||
| 912 | Ga0070706_100105864 | |||
| 913 | Ga0070706_100122408 | |||
| 914 | Ga0070706_100145307 | |||
| 915 | Ga0070706_100170247 | |||
| 916 | Ga0070706_100267423 | |||
| 917 | Ga0070706_100289910 | |||
| 918 | Ga0070706_100410038 | |||
| 919 | Ga0070707_100003642 | |||
| 920 | Ga0070707_100008310 | |||
| 921 | Ga0070707_100008338 | |||
| 922 | Ga0070707_100013919 | |||
| 923 | Ga0070707_100029811 | |||
| 924 | Ga0070707_100054142 | |||
| 925 | Ga0070707_100113770 | |||
| 926 | Ga0070707_100121038 | |||
| 927 | Ga0070707_100134038 | |||
| 928 | Ga0070707_100141931 | |||
| 929 | Ga0070707_100229663 | |||
| 930 | Ga0070707_100261128 | |||
| 931 | Ga0070707_100529475 | |||
| 932 | Ga0070707_100598478 | |||
| 933 | Ga0070707_100745120 | |||
| 934 | Ga0070698_100009634 | |||
| 935 | Ga0070698_100012104 | |||
| 936 | Ga0070698_100297435 | |||
| 937 | Ga0070698_100307677 | |||
| 938 | Ga0070698_100483255 | |||
| 939 | Ga0070699_100021747 | |||
| 940 | Ga0070699_100099155 | |||
| 941 | Ga0070699_100181583 | |||
| 942 | Ga0070699_100266256 | |||
| 943 | Ga0070679_100288891 | |||
| 944 | Ga0070679_100839676 | |||
| 945 | Ga0070684_100001795 | |||
| 946 | Ga0070684_100082575 | |||
| 947 | Ga0070684_100222457 | |||
| 948 | Ga0070697_100002317 | |||
| 949 | Ga0070697_100008553 | |||
| 950 | Ga0070697_100009708 | |||
| 951 | Ga0070697_100025166 | |||
| 952 | Ga0070697_100028764 | |||
| 953 | Ga0070697_100143324 | |||
| 954 | Ga0070697_100147494 | |||
| 955 | Ga0070697_100213416 | |||
| 956 | Ga0070697_100340731 | |||
| 957 | Ga0068853_100000015 | |||
| 958 | Ga0070672_100027715 | |||
| 959 | Ga0070672_100064123 | |||
| 960 | Ga0070672_100071134 | |||
| 961 | Ga0070686_100011542 | |||
| 962 | Ga0070686_100198131 | |||
| 963 | Ga0070695_100097914 | |||
| 964 | Ga0070693_100587356 | |||
| 965 | Ga0070665_100022668 | |||
| 966 | Ga0070665_100033304 | |||
| 967 | Ga0070665_100036617 | |||
| 968 | Ga0070665_100232257 | |||
| 969 | Ga0070665_100520891 | |||
| 970 | Ga0070704_100069879 | |||
| 971 | Ga0070704_100284257 | |||
| 972 | Ga0070664_100097721 | |||
| 973 | Ga0070664_100246915 | |||
| 974 | Ga0070664_100744170 | |||
| 975 | Ga0068857_100266329 | |||
| 976 | Ga0068856_100029613 | |||
| 977 | Ga0068856_100228077 | |||
| 978 | Ga0070702_100012896 | |||
| 979 | Ga0068859_100040808 | |||
| 980 | Ga0068861_100092208 | |||
| 981 | Ga0068861_100114319 | |||
| 982 | Ga0068870_10185635 | |||
| 983 | Ga0068863_100006492 | |||
| 984 | Ga0068863_100155423 | |||
| 985 | Ga0068858_100078501 | |||
| 986 | Ga0068858_100096008 | |||
| 987 | Ga0068858_100662419 | |||
| 988 | Ga0068860_100003161 | |||
| 989 | Ga0068860_100027109 | |||
| 990 | Ga0068860_100154302 | |||
| 991 | Ga0081455_10000725 | |||
| 992 | Ga0081455_10001494 | |||
| 993 | Ga0081455_10001733 | |||
| 994 | Ga0081455_10003636 | |||
| 995 | Ga0081455_10092829 | |||
| 996 | Ga0081455_10145068 | |||
| 997 | Ga0081455_10152593 | |||
| 998 | Ga0081540_1000380 | |||
| 999 | Ga0081540_1089363 | |||
| 1000 | Ga0081540_1211289 | |||
| 1001 | Ga0081539_10000673 | |||
| 1002 | Ga0081539_10000723 | |||
| 1003 | Ga0081539_10051383 | |||
| 1004 | Ga0070717_10008656 | |||
| 1005 | Ga0070717_10047835 | |||
| 1006 | Ga0070717_10085272 | |||
| 1007 | Ga0070717_10232474 | |||
| 1008 | Ga0070717_10452925 | |||
| 1009 | Ga0070717_10565251 | |||
| 1010 | Ga0070717_10660004 | |||
| 1011 | Ga0070715_10052220 | |||
| 1012 | Ga0070715_10144299 | |||
| 1013 | Ga0070715_10164893 | |||
| 1014 | Ga0070716_100031422 | |||
| 1015 | Ga0070716_100047621 | |||
| 1016 | Ga0070716_100094661 | |||
| 1017 | Ga0070716_100147715 | |||
| 1018 | Ga0070716_100197313 | |||
| 1019 | Ga0070716_100290092 | |||
| 1020 | Ga0070716_100482884 | |||
| 1021 | Ga0070712_100019751 | |||
| 1022 | Ga0070712_100042850 | |||
| 1023 | Ga0070712_100091656 | |||
| 1024 | Ga0070712_100216189 | |||
| 1025 | Ga0070712_100236083 | |||
| 1026 | Ga0070712_100346000 | |||
| 1027 | Ga0097621_100090066 | |||
| 1028 | Ga0097621_100334145 | |||
| 1029 | Ga0068871_100204852 | |||
| 1030 | Ga0068871_100598591 | |||
| 1031 | Ga0075434_100468775 | |||
| 1032 | Ga0068865_100021029 | |||
| 1033 | Ga0068865_100093670 | |||
| 1034 | Ga0068865_100193956 | |||
| 1035 | Ga0068865_100319199 | |||
| 1036 | Ga0075436_100082978 | |||
| 1037 | Ga0075436_100129779 | |||
| 1038 | Ga0075436_100181825 | |||
| 1039 | Ga0075436_100386039 | |||
| 1040 | Ga0097620_100040808 | |||
| 1041 | Ga0075435_100700730 | |||
| 1042 | Ga0099794_10055660 | |||
| 1043 | Ga0099794_10163993 | |||
| 1044 | Ga0099795_10050510 | |||
| 1045 | Ga0099795_10274887 | |||
| 1046 | Ga0105240_10122067 | |||
| 1047 | Ga0111539_10437641 | |||
| 1048 | Ga0105245_10760092 | |||
| 1049 | Ga0105247_10092251 | |||
| 1050 | Ga0105247_10139412 | |||
| 1051 | Ga0105247_10529105 | |||
| 1052 | Ga0114129_10008863 | |||
| 1053 | Ga0114129_10195062 | |||
| 1054 | Ga0114129_10406451 | |||
| 1055 | Ga0105242_10007976 | |||
| 1056 | Ga0105242_10208331 | |||
| 1057 | Ga0105242_10303673 | |||
| 1058 | Ga0105242_11171138 | |||
| 1059 | Ga0105248_10182617 | |||
| 1060 | Ga0105237_10138436 | |||
| 1061 | Ga0105237_10145951 | |||
| 1062 | Ga0105249_10009902 | |||
| 1063 | Ga0105249_10049932 | |||
| 1064 | Ga0105249_10224990 | |||
| 1065 | Ga0105249_10482612 | |||
| 1066 | Ga0099796_10014764 | |||
| 1067 | Ga0099796_10137416 | |||
| 1068 | Ga0105239_10119609 | |||
| 1069 | Ga0105239_10180851 | |||
| 1070 | Ga0105246_10044901 | |||
| 1071 | Ga0105246_10186886 | |||
| 1072 | Ga0157373_10435186 | |||
| 1073 | Ga0157371_10249979 | |||
| 1074 | Ga0157369_10269366 | |||
| 1075 | Ga0157374_10021137 | |||
| 1076 | Ga0157374_10035185 | |||
| 1077 | Ga0157374_10261968 | |||
| 1078 | Ga0157374_10297608 | |||
| 1079 | Ga0157374_10312188 | |||
| 1080 | Ga0157374_10326076 | |||
| 1081 | Ga0157374_10343879 | |||
| 1082 | Ga0157374_10382785 | |||
| 1083 | Ga0157374_10652212 | |||
| 1084 | Ga0157374_10714983 | |||
| 1085 | Ga0157374_10760788 | |||
| 1086 | Ga0157374_10883184 | |||
| 1087 | Ga0157374_11645254 | |||
| 1088 | Ga0157378_10004866 | |||
| 1089 | Ga0157378_10023999 | |||
| 1090 | Ga0157378_10036089 | |||
| 1091 | Ga0157378_10200689 | |||
| 1092 | Ga0157378_10241837 | |||
| 1093 | Ga0157378_10412445 | |||
| 1094 | Ga0157378_10468492 | |||
| 1095 | Ga0157378_10690792 | |||
| 1096 | Ga0163162_10004971 | |||
| 1097 | Ga0163162_10090240 | |||
| 1098 | Ga0163162_10139468 | |||
| 1099 | Ga0163162_10179632 | |||
| 1100 | Ga0163162_10211618 | |||
| 1101 | Ga0163162_10262328 | |||
| 1102 | Ga0163162_10277418 | |||
| 1103 | Ga0163162_10780988 | |||
| 1104 | Ga0157372_10020989 | |||
| 1105 | Ga0157372_10154707 | |||
| 1106 | Ga0157372_10450369 | |||
| 1107 | Ga0157375_10013802 | |||
| 1108 | Ga0157375_10040342 | |||
| 1109 | Ga0157375_10077547 | |||
| 1110 | Ga0157375_10152282 | |||
| 1111 | Ga0157375_10220736 | |||
| 1112 | Ga0157375_10441241 | |||
| 1113 | Ga0157375_11205941 | |||
| 1114 | Ga0163163_10049027 | |||
| 1115 | Ga0163163_10800922 | |||
| 1116 | Ga0157377_10030069 | |||
| 1117 | Ga0157377_10403311 | |||
| 1118 | Ga0157379_10012044 | |||
| 1119 | Ga0157379_10901795 | |||
| 1120 | Ga0157379_11029681 | |||
| 1121 | Ga0157376_10000359 | |||
| 1122 | Ga0157376_10013693 | |||
| 1123 | Ga0157376_10026423 | |||
| 1124 | Ga0157376_10058997 | |||
| 1125 | Ga0157376_10106107 | |||
| 1126 | Ga0157376_10167472 | |||
| 1127 | Ga0163161_10069837 | |||
| 1128 | Ga0163161_10113234 | |||
| 1129 | Ga0213874_10151092 | |||
| 1130 | Ga0213876_10011355 | |||
| 1131 | Ga0213876_10062816 | |||
| 1132 | Ga0207666_1001106 | |||
| 1133 | Ga0207666_1013162 | |||
| 1134 | Ga0207666_1015124 | |||
| 1135 | Ga0207666_1036567 | |||
| 1136 | Ga0207673_1000231 | |||
| 1137 | Ga0207673_1003111 | |||
| 1138 | Ga0207673_1010386 | |||
| 1139 | Ga0207697_10000198 | |||
| 1140 | Ga0207697_10000199 | |||
| 1141 | Ga0207697_10000492 | |||
| 1142 | Ga0207697_10001376 | |||
| 1143 | Ga0207697_10001603 | |||
| 1144 | Ga0207697_10001623 | |||
| 1145 | Ga0207697_10012813 | |||
| 1146 | Ga0207697_10027653 | |||
| 1147 | Ga0207697_10198854 | |||
| 1148 | Ga0207653_10010406 | |||
| 1149 | Ga0207653_10189428 | |||
| 1150 | Ga0207692_10059463 | |||
| 1151 | Ga0207692_10099986 | |||
| 1152 | Ga0207692_10250271 | |||
| 1153 | Ga0207680_10019989 | |||
| 1154 | Ga0207680_10030665 | |||
| 1155 | Ga0207685_10041136 | |||
| 1156 | Ga0207685_10080121 | |||
| 1157 | Ga0207685_10086835 | |||
| 1158 | Ga0207685_10183028 | |||
| 1159 | Ga0207699_10008646 | |||
| 1160 | Ga0207645_10002552 | |||
| 1161 | Ga0207645_10017267 | |||
| 1162 | Ga0207645_10065841 | |||
| 1163 | Ga0207645_10118747 | |||
| 1164 | Ga0207645_10140268 | |||
| 1165 | Ga0207645_10152190 | |||
| 1166 | Ga0207684_10000128 | |||
| 1167 | Ga0207684_10002590 | |||
| 1168 | Ga0207684_10004639 | |||
| 1169 | Ga0207684_10005486 | |||
| 1170 | Ga0207684_10008708 | |||
| 1171 | Ga0207684_10027410 | |||
| 1172 | Ga0207684_10105346 | |||
| 1173 | Ga0207684_10121148 | |||
| 1174 | Ga0207684_10181120 | |||
| 1175 | Ga0207684_10219772 | |||
| 1176 | Ga0207684_10233616 | |||
| 1177 | Ga0207684_10241182 | |||
| 1178 | Ga0207684_10257073 | |||
| 1179 | Ga0207654_10429660 | |||
| 1180 | Ga0207654_10559365 | |||
| 1181 | Ga0207707_10031645 | |||
| 1182 | Ga0207671_10409122 | |||
| 1183 | Ga0207693_10001095 | |||
| 1184 | Ga0207693_10006558 | |||
| 1185 | Ga0207693_10020690 | |||
| 1186 | Ga0207693_10020698 | |||
| 1187 | Ga0207693_10033555 | |||
| 1188 | Ga0207693_10037139 | |||
| 1189 | Ga0207693_10048365 | |||
| 1190 | Ga0207693_10052073 | |||
| 1191 | Ga0207693_10269314 | |||
| 1192 | Ga0207693_10289411 | |||
| 1193 | Ga0207663_10013301 | |||
| 1194 | Ga0207663_10073144 | |||
| 1195 | Ga0207663_10074143 | |||
| 1196 | Ga0207663_10231890 | |||
| 1197 | Ga0207663_10256842 | |||
| 1198 | Ga0207663_10376163 | |||
| 1199 | Ga0207660_10199270 | |||
| 1200 | Ga0207660_10364693 | |||
| 1201 | Ga0207662_10013481 | |||
| 1202 | Ga0207662_10157076 | |||
| 1203 | Ga0207657_10117697 | |||
| 1204 | Ga0207657_10238529 | |||
| 1205 | Ga0207649_10064479 | |||
| 1206 | Ga0207652_10101800 | |||
| 1207 | Ga0207646_10003886 | |||
| 1208 | Ga0207646_10004817 | |||
| 1209 | Ga0207646_10006990 | |||
| 1210 | Ga0207646_10013567 | |||
| 1211 | Ga0207646_10094871 | |||
| 1212 | Ga0207646_10133924 | |||
| 1213 | Ga0207646_10150392 | |||
| 1214 | Ga0207646_10208552 | |||
| 1215 | Ga0207646_10237817 | |||
| 1216 | Ga0207681_10070932 | |||
| 1217 | Ga0207681_10138700 | |||
| 1218 | Ga0207681_10157271 | |||
| 1219 | Ga0207650_10101579 | |||
| 1220 | Ga0207650_10207761 | |||
| 1221 | Ga0207659_10030146 | |||
| 1222 | Ga0207659_10044848 | |||
| 1223 | Ga0207659_10090372 | |||
| 1224 | Ga0207659_10135420 | |||
| 1225 | Ga0207659_10199970 | |||
| 1226 | Ga0207659_10524976 | |||
| 1227 | Ga0207687_10270530 | |||
| 1228 | Ga0207687_10798003 | |||
| 1229 | Ga0207700_10034816 | |||
| 1230 | Ga0207700_10089357 | |||
| 1231 | Ga0207700_10440993 | |||
| 1232 | Ga0207700_10848336 | |||
| 1233 | Ga0207664_10258032 | |||
| 1234 | Ga0207664_10413578 | |||
| 1235 | Ga0207664_10815362 | |||
| 1236 | Ga0207644_10023266 | |||
| 1237 | Ga0207644_10046488 | |||
| 1238 | Ga0207644_10086121 | |||
| 1239 | Ga0207644_10103889 | |||
| 1240 | Ga0207644_10149873 | |||
| 1241 | Ga0207644_10344208 | |||
| 1242 | Ga0207644_10408826 | |||
| 1243 | Ga0207690_10006328 | |||
| 1244 | Ga0207690_10109574 | |||
| 1245 | Ga0207706_10004103 | |||
| 1246 | Ga0207706_10052726 | |||
| 1247 | Ga0207706_10104223 | |||
| 1248 | Ga0207706_10141340 | |||
| 1249 | Ga0207706_10278124 | |||
| 1250 | Ga0207706_10322382 | |||
| 1251 | Ga0207686_10006480 | |||
| 1252 | Ga0207670_10002895 | |||
| 1253 | Ga0207670_10007754 | |||
| 1254 | Ga0207670_10058220 | |||
| 1255 | Ga0207669_10004423 | |||
| 1256 | Ga0207669_10039343 | |||
| 1257 | Ga0207669_10063883 | |||
| 1258 | Ga0207704_10015844 | |||
| 1259 | Ga0207704_10020503 | |||
| 1260 | Ga0207704_10071700 | |||
| 1261 | Ga0207704_10965137 | |||
| 1262 | Ga0207665_10015418 | |||
| 1263 | Ga0207665_10242743 | |||
| 1264 | Ga0207665_10623900 | |||
| 1265 | Ga0207691_10000297 | |||
| 1266 | Ga0207691_10030825 | |||
| 1267 | Ga0207691_10099074 | |||
| 1268 | Ga0207691_10625099 | |||
| 1269 | Ga0207711_10258581 | |||
| 1270 | Ga0207689_10124555 | |||
| 1271 | Ga0207689_10179963 | |||
| 1272 | Ga0207689_10852468 | |||
| 1273 | Ga0207689_10952063 | |||
| 1274 | Ga0207661_10013405 | |||
| 1275 | Ga0207661_10022879 | |||
| 1276 | Ga0207661_10098253 | |||
| 1277 | Ga0207661_10102570 | |||
| 1278 | Ga0207661_10602929 | |||
| 1279 | Ga0207679_10066965 | |||
| 1280 | Ga0207679_10096659 | |||
| 1281 | Ga0207679_10909156 | |||
| 1282 | Ga0207651_10009937 | |||
| 1283 | Ga0207651_10060338 | |||
| 1284 | Ga0207651_10080049 | |||
| 1285 | Ga0207651_10081285 | |||
| 1286 | Ga0207651_10277451 | |||
| 1287 | Ga0207651_11032315 | |||
| 1288 | Ga0207712_10034687 | |||
| 1289 | Ga0207712_10061319 | |||
| 1290 | Ga0207712_10271922 | |||
| 1291 | Ga0207668_10043513 | |||
| 1292 | Ga0207668_10061172 | |||
| 1293 | Ga0207668_10205846 | |||
| 1294 | Ga0207658_10048549 | |||
| 1295 | Ga0207658_10058219 | |||
| 1296 | Ga0207658_10077422 | |||
| 1297 | Ga0207658_10085657 | |||
| 1298 | Ga0207658_10517561 | |||
| 1299 | Ga0207658_11023884 | |||
| 1300 | Ga0207677_10064296 | |||
| 1301 | Ga0207677_10187875 | |||
| 1302 | Ga0207703_10077973 | |||
| 1303 | Ga0207703_10340056 | |||
| 1304 | Ga0207639_10000022 | |||
| 1305 | Ga0207678_10004776 | |||
| 1306 | Ga0207708_10018830 | |||
| 1307 | Ga0207708_10410194 | |||
| 1308 | Ga0207702_10113902 | |||
| 1309 | Ga0207702_10737370 | |||
| 1310 | Ga0207641_10012790 | |||
| 1311 | Ga0207641_10631676 | |||
| 1312 | Ga0207648_10041835 | |||
| 1313 | Ga0207675_100078710 | |||
| 1314 | Ga0207683_10003256 | |||
| 1315 | Ga0207683_10022180 | |||
| 1316 | Ga0207683_10043757 | |||
| 1317 | Ga0207683_10070355 | |||
| 1318 | Ga0207683_10131255 | |||
| 1319 | Ga0207683_10640885 | |||
| 1320 | Ga0207698_11182051 | |||
| 1321 | Ga0209974_10064994 | |||
| 1322 | Ga0268266_10012128 | |||
| 1323 | Ga0268266_10048393 | |||
| 1324 | Ga0268266_10188780 | |||
| 1325 | Ga0268266_11373269 | |||
| 1326 | Ga0268265_10373779 | |||
| 1327 | Ga0268265_10893945 | |||
| 1328 | Ga0268264_10000626 | |||
| 1329 | Ga0268264_10017273 | |||
| 1330 | Ga0268264_10259714 | |||
| 1331 | Ga0268264_10555874 | |||
| 1332 | Ga0373948_0088409 | |||
| 1333 | Ga0373944_0115072 | |||
| 1334 | Ga0373923_0103709 | |||
| 1335 | Ga0373953_0100006 | |||
| 1336 | Ga0373957_0133798 | |||
| 1337 | Ga0373943_0095578 | |||
| 1338 | Ga0373943_0231306 | |||
| 1339 | Ga0373946_0051749 | |||
| 1340 | Ga0373946_0081088 | |||
| 1341 | Ga0373946_0098900 | |||
| 1342 | Ga0373935_0163759 | |||
| 1343 | Ga0373935_0265204 | |||
| 1344 | Ga0373935_0309641 | |||
| 1345 | Ga0373935_0392132 | |||
| 1346 | Ga0373927_0099219 | |||
| 1347 | Ga0373927_0445086 | |||
| 1348 | Ga0373933_0033926 | |||
| 1349 | Ga0373947_0041015 | |||
| 1350 | Ga0373947_0058729 | |||
| 1351 | Ga0373947_0087012 | |||
| 1352 | Ga0373947_0134058 | |||
| 1353 | Ga0373947_0281981 | |||
| 1354 | Ga0373937_0045397 | |||
| 1355 | Ga0373937_0221143 | |||
| 1356 | Ga0373925_0021781 | |||
| 1357 | Ga0373925_0512160 | |||
| 1358 | Ga0395899_0236157 | |||
| 1359 | Ga0395900_0079966 | |||
| 1360 | Ga0395900_0137435 | |||
| 1361 | Ga0395900_0172537 | |||
| 1362 | Ga0395898_0015715 | |||
| 1363 | Ga0395898_0391891 | |||
| 1364 | Ga0395898_0563025 | |||
| 1365 | Ga0395905_0004356 | |||
| 1366 | Ga0436364_0223079 | |||
| 1367 | Ga0395901_0013525 | |||
| 1368 | Ga0395901_0061139 | |||
| 1369 | Ga0395901_0181434 | |||
| 1370 | Ga0395901_0307595 | |||
| 1371 | Ga0395901_0308725 | |||
| 1372 | Ga0436365_0016244 | |||
| 1373 | Ga0436365_0042856 | |||
| 1374 | Ga0436365_0067186 | |||
| 1375 | Ga0436363_1151520 | |||
| 1376 | Ga0436363_1576806 | |||
| 1377 | Ga0436362_0467398 | |||
| 1378 | Ga0451849_1477180 | |||
| 1379 | Ga0439451_014798 | |||
| 1380 | Ga0439455_0067458 | |||
| 1381 | Ga0439458_0060953 | |||
| 1382 | Ga0439460_0050621 | |||
| 1383 | Ga0495629_0155610 | |||
| 1384 | Ga0495580_0031728 | |||
| 1385 | Ga0495580_0424772 | |||
| 1386 | Ga0495662_0031534 | |||
| 1387 | Ga0495664_0110542 | |||
| 1388 | Ga0495584_0069634 | |||
| 1389 | Ga0495608_0288536 | |||
| 1390 | Ga0495618_0098429 | |||
| 1391 | Ga0495628_0033015 | |||
| 1392 | Ga0495630_0006745 | |||
| 1393 | Ga0495630_0848610 | |||
| 1394 | Ga0495665_0133914 | |||
| 1395 | Ga0495640_0165362 | |||
| 1396 | Ga0495640_0192251 | |||
| 1397 | Ga0495640_0209281 | |||
| 1398 | Ga0495586_0164379 | |||
| 1399 | Ga0495587_0139986 | |||
| 1400 | Ga0495609_0150804 | |||
| 1401 | Ga0495645_0378126 | |||
| 1402 | Ga0495667_0303556 | |||
| 1403 | Ga0495667_0500086 | |||
| 1404 | Ga0495634_0037776 | |||
| 1405 | Ga0495635_0129162 | |||
| 1406 | Ga0495635_0570418 | |||
| 1407 | Ga0495657_0178449 | |||
| 1408 | Ga0495599_0112688 | |||
| 1409 | Ga0495646_0026698 | |||
| 1410 | Ga0495647_0069053 | |||
| 1411 | Ga0495658_0031587 | |||
| 1412 | Ga0495658_0132003 | |||
| 1413 | Ga0495669_0150350 | |||
| 1414 | Ga0495613_0390429 | |||
| 1415 | Ga0495624_0164005 | |||
| 1416 | Ga0495604_0065324 | |||
| 1417 | Ga0495604_0091081 | |||
| 1418 | Ga0495604_0254563 | |||
| 1419 | Ga0495604_0366045 | |||
| 1420 | Ga0495604_0568845 | |||
| 1421 | Ga0495674_0328635 | |||
| 1422 | Ga0495676_0382101 | |||
| 1423 | Ga0495680_0504155 | |||
| 1424 | Ga0495680_0587327 | |||
| 1425 | Ga0495675_0023071 | |||
| 1426 | Ga0495684_0005005 | |||
| 1427 | Ga0495593_0378554 | |||
| 1428 | Ga0496100_0040454 | |||
| 1429 | Ga0496100_0060179 | |||
| 1430 | Ga0496100_0398458 | |||
| 1431 | Ga0496100_0472229 | |||
| 1432 | Ga0496100_0923585 | |||
| 1433 | Ga0496101_0019721 | |||
| 1434 | Ga0496101_0058452 | |||
| 1435 | Ga0496101_0407472 | |||
| 1436 | Ga0496101_0852023 | |||
| 1437 | Ga0496102_0028483 | |||
| 1438 | Ga0496102_0061982 | |||
| 1439 | Ga0496102_0067380 | |||
| 1440 | Ga0496102_0556192 | |||
| 1441 | Ga0496103_0035273 | |||
| 1442 | Ga0496103_0542514 | |||
| 1443 | Ga0496104_0214599 | |||
| 1444 | Ga0496104_0310695 | |||
| 1445 | Ga0496104_0383799 | |||
| 1446 | Ga0496104_0722009 | |||
| 1447 | Ga0496105_0063115 | |||
| 1448 | Ga0496105_0393740 | |||
| 1449 | Ga0496106_0013446 | |||
| 1450 | Ga0496106_0115505 | |||
| 1451 | Ga0496106_0387719 | |||
| 1452 | Ga0496107_0025904 | |||
| 1453 | Ga0496107_0072248 | |||
| 1454 | Ga0496108_0051616 | |||
| 1455 | Ga0496108_0268729 | |||
| 1456 | Ga0496108_0353233 | |||
| 1457 | Ga0496109_0023921 | |||
| 1458 | Ga0496109_0076860 | |||
| 1459 | Ga0496109_0081656 | |||
| 1460 | Ga0496109_0082880 | |||
| 1461 | Ga0496109_0119535 | |||
| 1462 | Ga0496109_0274082 | |||
| 1463 | Ga0496110_0135146 | |||
| 1464 | Ga0496110_0193669 | |||
| 1465 | Ga0496110_0563549 | |||
| 1466 | Ga0496112_0019873 | |||
| 1467 | Ga0496112_0184618 | |||
| 1468 | Ga0496112_0245040 | |||
| 1469 | Ga0496112_0288277 | |||
| 1470 | Ga0496112_0601425 | |||
| 1471 | Ga0496112_0813075 | |||
| 1472 | Ga0496112_0974302 | |||
| 1473 | Ga0496113_0031658 | |||
| 1474 | Ga0496113_0153299 | |||
| 1475 | Ga0496114_0458231 | |||
| 1476 | Ga0496114_0673639 | |||
| 1477 | Ga0496115_0005638 | |||
| 1478 | Ga0496115_0037653 | |||
| 1479 | Ga0496115_0232710 | |||
| 1480 | Ga0501067_0153289 | |||
| 1481 | nmdc:mga05p37_182533_c1 | |||
| 1482 | nmdc:mga05p37_5948_c1 | |||
| 1483 | nmdc:mga05p37_817414_c1 | |||
| 1484 | nmdc:mga08y16_500506_c1 | |||
| 1485 | nmdc:mga0n895_774975_c1 | |||
| 1486 | nmdc:mga08x19_637232_c1 | |||
| 1487 | Ga0495601_0024231 | |||
| 1488 | Ga0495595_0149273 | |||
| 1489 | Ga0495619_0372338 | |||
| 1490 | Ga0495619_0422103 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.7771 | 1 | 183 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.7657 | 1 | 183 |
| 5d92-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.6864 | 4 | 186 |
| 6h59-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound | 0.6451 | 4 | 179 |
| 8gyw-assembly1.cif.gz_B | cryo-em structure of human cept1 complexed with cdp-choline | 0.6394 | 4 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8371 | 1 | 186 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8344 | 2 | 189 | 1.20.120.1760 |
| af_P9WPG5_6_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8323 | 1 | 188 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8243 | 1 | 186 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8021 | 2 | 189 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5K241-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9358 | 4 | 192 |
GO:0006777
GO:0008444 GO:0008654 GO:0016020 |
| AF-A0A1V4REM0-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9249 | 1 | 188 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A2V5K241-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9171 | 4 | 192 |
GO:0006777
GO:0008444 GO:0008654 GO:0016020 |
| AF-A0A2V6GPC5-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9102 | 1 | 192 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A2V6CMZ4-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9098 | 1 | 187 |
GO:0005886
GO:0008444 GO:0046474 |