F478782

General Info

Members Datasets Scaffolds Average Seq Length
745 257 1490 192

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100102792|Ga0070690_1001027922
Length 228
Sequence MNWANRLTLSRLALTILFVAALSSPWRYAHTTALITFLIAGITDFFDGEIARRYQTVTNFGKLMDPLVDKIMIAAAFISLVPLRAIPAWAATIVVGRDFLITGLRLMAISKGQVLTAERLGKHKTSWQIITVLFFLTLLAIAEWSRNIMASDWWQRAWNQAGAVLVWLTVVLTLYSGLGYAWRHRAVIESDVSPIRVSRNKAPVVFPAKRLQQCGRTGNSLSARVSRI

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
198 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.98
Rhizosphere 91.41
Stem 0
Stem Tuber 0
Unclassified 30.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100102792 3300005330 Bacteria 1897
2 SwRhRL2b_contig_1723717 2162886007 Bacteria 1517
3 SwRhRL2b_contig_3743133 2162886007 Unclassified 1009
4 JGI25406J46586_10003607 3300003203 Bacteria 7257
5 rootH2_10115373 3300003320 Bacteria 2686
6 rootL2_10002087 3300003322 Bacteria 13991
7 JGI25404J52841_10005585 3300003659 Bacteria 2598
8 JGI25405J52794_10000025 3300003911 Bacteria 15808
9 JGI25405J52794_10001870 3300003911 Bacteria 3544
10 JGI25405J52794_10036019 3300003911 Unclassified 1037
11 Ga0065703_1021188 3300005272 Unclassified 1357
12 Ga0065704_10221970 3300005289 Unclassified 1063
13 Ga0065712_10080895 3300005290 Bacteria 3059
14 Ga0065712_10100480 3300005290 Bacteria 2053
15 Ga0065712_10116137 3300005290 Bacteria 1727
16 Ga0065712_10135926 3300005290 Bacteria 1498
17 Ga0065715_10015731 3300005293 Unclassified 1714
18 Ga0065715_10089651 3300005293 Bacteria 9068
19 Ga0065715_10105160 3300005293 Bacteria 2910
20 Ga0065715_10112633 3300005293 Bacteria 2522
21 Ga0065715_10131220 3300005293 Unclassified 2011
22 Ga0065707_10387648 3300005295 Unclassified 869
23 Ga0070658_10620356 3300005327 Unclassified 938
24 Ga0070676_10012807 3300005328 Bacteria 4589
25 Ga0070676_10038170 3300005328 Unclassified 2773
26 Ga0070676_10052269 3300005328 Bacteria 2402
27 Ga0070676_10057319 3300005328 Bacteria 2305
28 Ga0070676_10101430 3300005328 Unclassified 1778
29 Ga0070676_10132772 3300005328 Bacteria 1576
30 Ga0070683_100160631 3300005329 Bacteria 2132
31 Ga0070683_100176304 3300005329 Bacteria 2029
32 Ga0070690_100138368 3300005330 Bacteria 1651
33 Ga0070690_100144021 3300005330 Bacteria 1620
34 Ga0070690_100150935 3300005330 Bacteria 1585
35 Ga0070690_100866582 3300005330 Viruses 704
36 Ga0070670_100017779 3300005331 Bacteria 6100
37 Ga0070670_100246960 3300005331 Bacteria 1554
38 Ga0068869_100166636 3300005334 Bacteria 1718
39 Ga0068869_100358544 3300005334 Bacteria 1190
40 Ga0068869_101094208 3300005334 Unclassified 697
41 Ga0070666_10007141 3300005335 Bacteria 6884
42 Ga0070666_10084340 3300005335 Bacteria 2174
43 Ga0070666_10220452 3300005335 Unclassified 1338
44 Ga0070666_10291209 3300005335 Unclassified 1162
45 Ga0070680_100314226 3300005336 Unclassified 1330
46 Ga0070682_100245887 3300005337 Bacteria 1287
47 Ga0070682_100467446 3300005337 Bacteria 970
48 Ga0068868_100299764 3300005338 Unclassified 1365
49 Ga0068868_100492411 3300005338 Unclassified 1072
50 Ga0068868_100692494 3300005338 Unclassified 911
51 Ga0070660_100206298 3300005339 Bacteria 1595
52 Ga0070660_100777078 3300005339 Unclassified 805
53 Ga0070689_100004932 3300005340 Bacteria 9056
54 Ga0070689_100013094 3300005340 Bacteria 5994
55 Ga0070689_100033715 3300005340 Bacteria 3903
56 Ga0070689_100102165 3300005340 Unclassified 2271
57 Ga0070689_100108351 3300005340 Bacteria 2207
58 Ga0070689_100711224 3300005340 Bacteria 878
59 Ga0070687_100021439 3300005343 Bacteria 3037
60 Ga0070687_100044635 3300005343 Unclassified 2259
61 Ga0070687_100152767 3300005343 Bacteria 1357
62 Ga0070661_100021759 3300005344 Bacteria 4586
63 Ga0070692_10085714 3300005345 Bacteria 1704
64 Ga0070668_100007228 3300005347 Bacteria 8233
65 Ga0070668_100008323 3300005347 Bacteria 7700
66 Ga0070668_100037931 3300005347 Bacteria 3681
67 Ga0070668_100067891 3300005347 Bacteria 2771
68 Ga0070668_100466107 3300005347 Unclassified 1089
69 Ga0070668_100487077 3300005347 Unclassified 1066
70 Ga0070669_100019043 3300005353 Bacteria 4907
71 Ga0070669_100034628 3300005353 Bacteria 3656
72 Ga0070669_100163845 3300005353 Unclassified 1729
73 Ga0070669_100255177 3300005353 Bacteria 1397
74 Ga0070675_100009745 3300005354 Bacteria 7483
75 Ga0070675_100025077 3300005354 Bacteria 4779
76 Ga0070675_100036035 3300005354 Bacteria 4024
77 Ga0070675_100050963 3300005354 Bacteria 3400
78 Ga0070675_100052111 3300005354 Bacteria 3363
79 Ga0070675_100220228 3300005354 Bacteria 1652
80 Ga0070671_100001414 3300005355 Bacteria 17942
81 Ga0070671_100026498 3300005355 Unclassified 4764
82 Ga0070671_100028937 3300005355 Bacteria 4566
83 Ga0070671_100067054 3300005355 Bacteria 2992
84 Ga0070671_100067224 3300005355 Bacteria 2988
85 Ga0070671_100101926 3300005355 Bacteria 2408
86 Ga0070671_100236700 3300005355 Unclassified 1550
87 Ga0070674_100002527 3300005356 Bacteria 10129
88 Ga0070674_100099297 3300005356 Unclassified 2117
89 Ga0070673_100003425 3300005364 Bacteria 9882
90 Ga0070673_100004995 3300005364 Bacteria 8459
91 Ga0070673_100073360 3300005364 Bacteria 2754
92 Ga0070673_100103169 3300005364 Bacteria 2352
93 Ga0070673_100395637 3300005364 Bacteria 1235
94 Ga0070673_101130010 3300005364 Bacteria 732
95 Ga0070688_100003480 3300005365 Bacteria 8111
96 Ga0070688_100006383 3300005365 Bacteria 6302
97 Ga0070688_100019266 3300005365 Bacteria 3951
98 Ga0070688_100098227 3300005365 Unclassified 1926
99 Ga0070659_100011349 3300005366 Bacteria 6589
100 Ga0070659_100241616 3300005366 Unclassified 1495
101 Ga0070659_100940017 3300005366 Unclassified 757
102 Ga0070667_100024177 3300005367 Bacteria 5046
103 Ga0070667_100028056 3300005367 Bacteria 4685
104 Ga0070667_100060584 3300005367 Bacteria 3202
105 Ga0070667_100145108 3300005367 Bacteria 2081
106 Ga0070667_100152645 3300005367 Bacteria 2030
107 Ga0070667_100364944 3300005367 Bacteria 1309
108 Ga0070667_101204974 3300005367 Bacteria 709
109 Ga0070709_10082184 3300005434 Unclassified 2104
110 Ga0070709_10196336 3300005434 Unclassified 1426
111 Ga0070709_10481722 3300005434 Bacteria 939
112 Ga0070709_10577889 3300005434 Unclassified 863
113 Ga0070709_10619730 3300005434 Bacteria 835
114 Ga0070709_10855487 3300005434 Bacteria 717
115 Ga0070714_100015874 3300005435 Bacteria 6070
116 Ga0070714_100392294 3300005435 Bacteria 1311
117 Ga0070714_100394556 3300005435 Unclassified 1307
118 Ga0070714_100493921 3300005435 Unclassified 1166
119 Ga0070714_100870617 3300005435 Unclassified 874
120 Ga0070714_100987939 3300005435 Bacteria 819
121 Ga0070713_100095487 3300005436 Bacteria 2565
122 Ga0070713_100166874 3300005436 Bacteria 1969
123 Ga0070713_100236721 3300005436 Bacteria 1661
124 Ga0070713_100282303 3300005436 Unclassified 1524
125 Ga0070713_100742805 3300005436 Unclassified 938
126 Ga0070710_10014909 3300005437 Bacteria 3920
127 Ga0070710_10065446 3300005437 Bacteria 2082
128 Ga0070701_10211769 3300005438 Bacteria 1151
129 Ga0070711_100032206 3300005439 Bacteria 3484
130 Ga0070711_100058723 3300005439 Bacteria 2668
131 Ga0070711_100077261 3300005439 Unclassified 2363
132 Ga0070711_100087726 3300005439 Bacteria 2234
133 Ga0070711_100399668 3300005439 Bacteria 1115
134 Ga0070705_100032935 3300005440 Bacteria 2884
135 Ga0070705_100053612 3300005440 Bacteria 2362
136 Ga0070705_100146333 3300005440 Unclassified 1561
137 Ga0070705_100634993 3300005440 Bacteria 830
138 Ga0070708_100003538 3300005445 Bacteria 12241
139 Ga0070708_100080722 3300005445 Bacteria 2944
140 Ga0070708_100083050 3300005445 Bacteria 2903
141 Ga0070708_100088156 3300005445 Bacteria 2821
142 Ga0070708_100090963 3300005445 Bacteria 2778
143 Ga0070708_100134926 3300005445 Bacteria 2286
144 Ga0070708_100161008 3300005445 Bacteria 2091
145 Ga0070708_100192923 3300005445 Bacteria 1906
146 Ga0070708_100448215 3300005445 Unclassified 1217
147 Ga0070663_100414194 3300005455 Unclassified 1104
148 Ga0070678_100035886 3300005456 Bacteria 3466
149 Ga0070678_100054264 3300005456 Bacteria 2919
150 Ga0070678_100150230 3300005456 Unclassified 1876
151 Ga0070678_100287090 3300005456 Unclassified 1393
152 Ga0070678_100667755 3300005456 Unclassified 934
153 Ga0070678_100851419 3300005456 Bacteria 831
154 Ga0070662_100159249 3300005457 Bacteria 1765
155 Ga0070662_100229500 3300005457 Unclassified 1484
156 Ga0070662_100355051 3300005457 Bacteria 1202
157 Ga0068867_100005841 3300005459 Bacteria 8731
158 Ga0070685_10050799 3300005466 Unclassified 2397
159 Ga0070685_10097871 3300005466 Bacteria 1787
160 Ga0070685_10234379 3300005466 Bacteria 1209
161 Ga0070685_10292461 3300005466 Bacteria 1095
162 Ga0070706_100000100 3300005467 Bacteria 104971
163 Ga0070706_100003389 3300005467 Bacteria 15715
164 Ga0070706_100007793 3300005467 Bacteria 10003
165 Ga0070706_100049875 3300005467 Bacteria 3862
166 Ga0070706_100088139 3300005467 Bacteria 2878
167 Ga0070706_100105864 3300005467 Bacteria 2617
168 Ga0070706_100122408 3300005467 Bacteria 2425
169 Ga0070706_100145307 3300005467 Bacteria 2215
170 Ga0070706_100170247 3300005467 Bacteria 2033
171 Ga0070706_100267423 3300005467 Unclassified 1596
172 Ga0070706_100289910 3300005467 Bacteria 1527
173 Ga0070706_100410038 3300005467 Bacteria 1261
174 Ga0070707_100003642 3300005468 Bacteria 14533
175 Ga0070707_100008310 3300005468 Bacteria 9634
176 Ga0070707_100008338 3300005468 Bacteria 9621
177 Ga0070707_100013919 3300005468 Bacteria 7533
178 Ga0070707_100029811 3300005468 Bacteria 5192
179 Ga0070707_100054142 3300005468 Bacteria 3846
180 Ga0070707_100113770 3300005468 Bacteria 2626
181 Ga0070707_100121038 3300005468 Bacteria 2541
182 Ga0070707_100134038 3300005468 Bacteria 2410
183 Ga0070707_100141931 3300005468 Bacteria 2337
184 Ga0070707_100229663 3300005468 Bacteria 1806
185 Ga0070707_100261128 3300005468 Bacteria 1685
186 Ga0070707_100529475 3300005468 Unclassified 1140
187 Ga0070707_100598478 3300005468 Unclassified 1065
188 Ga0070707_100745120 3300005468 Unclassified 943
189 Ga0070698_100009634 3300005471 Bacteria 10334
190 Ga0070698_100012104 3300005471 Bacteria 9144
191 Ga0070698_100297435 3300005471 Unclassified 1545
192 Ga0070698_100307677 3300005471 Bacteria 1516
193 Ga0070698_100483255 3300005471 Bacteria 1176
194 Ga0070699_100021747 3300005518 Bacteria 5529
195 Ga0070699_100099155 3300005518 Bacteria 2553
196 Ga0070699_100181583 3300005518 Unclassified 1867
197 Ga0070699_100266256 3300005518 Bacteria 1533
198 Ga0070679_100288891 3300005530 Unclassified 1591
199 Ga0070679_100839676 3300005530 Unclassified 862
200 Ga0070684_100001795 3300005535 Bacteria 15694
201 Ga0070684_100082575 3300005535 Unclassified 2845
202 Ga0070684_100222457 3300005535 Unclassified 1722
203 Ga0070697_100002317 3300005536 Bacteria 14626
204 Ga0070697_100008553 3300005536 Bacteria 7993
205 Ga0070697_100009708 3300005536 Bacteria 7513
206 Ga0070697_100025166 3300005536 Unclassified 4745
207 Ga0070697_100028764 3300005536 Bacteria 4452
208 Ga0070697_100143324 3300005536 Bacteria 2010
209 Ga0070697_100147494 3300005536 Unclassified 1981
210 Ga0070697_100213416 3300005536 Unclassified 1644
211 Ga0070697_100340731 3300005536 Bacteria 1294
212 Ga0068853_100000015 3300005539 Bacteria 226965
213 Ga0070672_100027715 3300005543 Bacteria 4228
214 Ga0070672_100064123 3300005543 Unclassified 2902
215 Ga0070672_100071134 3300005543 Bacteria 2766
216 Ga0070686_100011542 3300005544 Bacteria 5013
217 Ga0070686_100198131 3300005544 Unclassified 1438
218 Ga0070695_100097914 3300005545 Bacteria 1970
219 Ga0070693_100587356 3300005547 Bacteria 802
220 Ga0070665_100022668 3300005548 Bacteria 6322
221 Ga0070665_100033304 3300005548 Bacteria 5185
222 Ga0070665_100036617 3300005548 Bacteria 4935
223 Ga0070665_100232257 3300005548 Bacteria 1845
224 Ga0070665_100520891 3300005548 Bacteria 1200
225 Ga0070704_100069879 3300005549 Bacteria 2546
226 Ga0070704_100284257 3300005549 Unclassified 1372
227 Ga0070664_100097721 3300005564 Bacteria 2550
228 Ga0070664_100246915 3300005564 Unclassified 1603
229 Ga0070664_100744170 3300005564 Unclassified 915
230 Ga0068857_100266329 3300005577 Bacteria 1574
231 Ga0068856_100029613 3300005614 Bacteria 5348
232 Ga0068856_100228077 3300005614 Bacteria 1878
233 Ga0070702_100012896 3300005615 Bacteria 4208
234 Ga0068859_100040808 3300005617 Bacteria 4661
235 Ga0068861_100092208 3300005719 Bacteria 2393
236 Ga0068861_100114319 3300005719 Bacteria 2167
237 Ga0068870_10185635 3300005840 Unclassified 1251
238 Ga0068863_100006492 3300005841 Bacteria 11470
239 Ga0068863_100155423 3300005841 Bacteria 2190
240 Ga0068858_100078501 3300005842 Bacteria 3068
241 Ga0068858_100096008 3300005842 Bacteria 2762
242 Ga0068858_100662419 3300005842 Unclassified 1014
243 Ga0068860_100003161 3300005843 Bacteria 17000
244 Ga0068860_100027109 3300005843 Bacteria 5520
245 Ga0068860_100154302 3300005843 Bacteria 2213
246 Ga0081455_10000725 3300005937 Bacteria 42784
247 Ga0081455_10001494 3300005937 Bacteria 28914
248 Ga0081455_10001733 3300005937 Bacteria 26391
249 Ga0081455_10003636 3300005937 Bacteria 17668
250 Ga0081455_10092829 3300005937 Bacteria 2441
251 Ga0081455_10145068 3300005937 Bacteria 1838
252 Ga0081455_10152593 3300005937 Bacteria 1779
253 Ga0081540_1000380 3300005983 Bacteria 44546
254 Ga0081540_1089363 3300005983 Unclassified 1359
255 Ga0081540_1211289 3300005983 Unclassified 697
256 Ga0081539_10000673 3300005985 Bacteria 68473
257 Ga0081539_10000723 3300005985 Bacteria 66108
258 Ga0081539_10051383 3300005985 Bacteria 2323
259 Ga0070717_10008656 3300006028 Bacteria 7610
260 Ga0070717_10047835 3300006028 Bacteria 3506
261 Ga0070717_10085272 3300006028 Bacteria 2658
262 Ga0070717_10232474 3300006028 Bacteria 1623
263 Ga0070717_10452925 3300006028 Unclassified 1157
264 Ga0070717_10565251 3300006028 Bacteria 1030
265 Ga0070717_10660004 3300006028 Unclassified 949
266 Ga0070715_10052220 3300006163 Unclassified 1762
267 Ga0070715_10144299 3300006163 Unclassified 1160
268 Ga0070715_10164893 3300006163 Bacteria 1098
269 Ga0070716_100031422 3300006173 Unclassified 2887
270 Ga0070716_100047621 3300006173 Bacteria 2419
271 Ga0070716_100094661 3300006173 Bacteria 1816
272 Ga0070716_100147715 3300006173 Bacteria 1508
273 Ga0070716_100197313 3300006173 Bacteria 1335
274 Ga0070716_100290092 3300006173 Unclassified 1133
275 Ga0070716_100482884 3300006173 Unclassified 910
276 Ga0070712_100019751 3300006175 Bacteria 4400
277 Ga0070712_100042850 3300006175 Bacteria 3113
278 Ga0070712_100091656 3300006175 Bacteria 2227
279 Ga0070712_100216189 3300006175 Bacteria 1514
280 Ga0070712_100236083 3300006175 Bacteria 1454
281 Ga0070712_100346000 3300006175 Unclassified 1215
282 Ga0097621_100090066 3300006237 Bacteria 2566
283 Ga0097621_100334145 3300006237 Unclassified 1344
284 Ga0068871_100204852 3300006358 Bacteria 1705
285 Ga0068871_100598591 3300006358 Unclassified 1002
286 Ga0075434_100468775 3300006871 Bacteria 1280
287 Ga0068865_100021029 3300006881 Bacteria 4240
288 Ga0068865_100093670 3300006881 Bacteria 2185
289 Ga0068865_100193956 3300006881 Unclassified 1573
290 Ga0068865_100319199 3300006881 Bacteria 1249
291 Ga0075436_100082978 3300006914 Bacteria 2224
292 Ga0075436_100129779 3300006914 Bacteria 1767
293 Ga0075436_100181825 3300006914 Unclassified 1486
294 Ga0075436_100386039 3300006914 Unclassified 1013
295 Ga0097620_100040808 3300006931 Bacteria 4661
296 Ga0075435_100700730 3300007076 Unclassified 880
297 Ga0099794_10055660 3300007265 Unclassified 1912
298 Ga0099794_10163993 3300007265 Unclassified 1131
299 Ga0099795_10050510 3300007788 Bacteria 1513
300 Ga0099795_10274887 3300007788 Unclassified 733
301 Ga0105240_10122067 3300009093 Bacteria 3136
302 Ga0111539_10437641 3300009094 Unclassified 1522
303 Ga0105245_10760092 3300009098 Bacteria 1005
304 Ga0105247_10092251 3300009101 Bacteria 1924
305 Ga0105247_10139412 3300009101 Bacteria 1588
306 Ga0105247_10529105 3300009101 Unclassified 863
307 Ga0114129_10008863 3300009147 Bacteria 14354
308 Ga0114129_10195062 3300009147 Bacteria 2747
309 Ga0114129_10406451 3300009147 Bacteria 1793
310 Ga0105242_10007976 3300009176 Bacteria 8156
311 Ga0105242_10208331 3300009176 Unclassified 1740
312 Ga0105242_10303673 3300009176 Unclassified 1458
313 Ga0105242_11171138 3300009176 Unclassified 786
314 Ga0105248_10182617 3300009177 Bacteria 2364
315 Ga0105237_10138436 3300009545 Bacteria 2429
316 Ga0105237_10145951 3300009545 Bacteria 2361
317 Ga0105249_10009902 3300009553 Bacteria 8356
318 Ga0105249_10049932 3300009553 Bacteria 3815
319 Ga0105249_10224990 3300009553 Bacteria 1848
320 Ga0105249_10482612 3300009553 Bacteria 1283
321 Ga0099796_10014764 3300010159 Unclassified 2265
322 Ga0099796_10137416 3300010159 Bacteria 952
323 Ga0105239_10119609 3300010375 Bacteria 2924
324 Ga0105239_10180851 3300010375 Bacteria 2359
325 Ga0105246_10044901 3300011119 Bacteria 3006
326 Ga0105246_10186886 3300011119 Bacteria 1600
327 Ga0157373_10435186 3300013100 Unclassified 942
328 Ga0157371_10249979 3300013102 Bacteria 1276
329 Ga0157369_10269366 3300013105 Bacteria 1775
330 Ga0157374_10021137 3300013296 Bacteria 5785
331 Ga0157374_10035185 3300013296 Bacteria 4581
332 Ga0157374_10261968 3300013296 Bacteria 1703
333 Ga0157374_10297608 3300013296 Bacteria 1596
334 Ga0157374_10312188 3300013296 Bacteria 1557
335 Ga0157374_10326076 3300013296 Bacteria 1522
336 Ga0157374_10343879 3300013296 Unclassified 1481
337 Ga0157374_10382785 3300013296 Bacteria 1401
338 Ga0157374_10652212 3300013296 Unclassified 1064
339 Ga0157374_10714983 3300013296 Bacteria 1015
340 Ga0157374_10760788 3300013296 Unclassified 984
341 Ga0157374_10883184 3300013296 Bacteria 911
342 Ga0157374_11645254 3300013296 Unclassified 666
343 Ga0157378_10004866 3300013297 Bacteria 11778
344 Ga0157378_10023999 3300013297 Bacteria 5365
345 Ga0157378_10036089 3300013297 Bacteria 4375
346 Ga0157378_10200689 3300013297 Unclassified 1886
347 Ga0157378_10241837 3300013297 Unclassified 1724
348 Ga0157378_10412445 3300013297 Bacteria 1333
349 Ga0157378_10468492 3300013297 Unclassified 1253
350 Ga0157378_10690792 3300013297 Unclassified 1039
351 Ga0163162_10004971 3300013306 Bacteria 12803
352 Ga0163162_10090240 3300013306 Bacteria 3146
353 Ga0163162_10139468 3300013306 Bacteria 2537
354 Ga0163162_10179632 3300013306 Bacteria 2242
355 Ga0163162_10211618 3300013306 Bacteria 2069
356 Ga0163162_10262328 3300013306 Bacteria 1859
357 Ga0163162_10277418 3300013306 Bacteria 1808
358 Ga0163162_10780988 3300013306 Unclassified 1073
359 Ga0157372_10020989 3300013307 Bacteria 7052
360 Ga0157372_10154707 3300013307 Unclassified 2648
361 Ga0157372_10450369 3300013307 Unclassified 1500
362 Ga0157375_10013802 3300013308 Bacteria 7199
363 Ga0157375_10040342 3300013308 Bacteria 4499
364 Ga0157375_10077547 3300013308 Bacteria 3353
365 Ga0157375_10152282 3300013308 Bacteria 2449
366 Ga0157375_10220736 3300013308 Bacteria 2054
367 Ga0157375_10441241 3300013308 Viruses 1467
368 Ga0157375_11205941 3300013308 Bacteria 888
369 Ga0163163_10049027 3300014325 Unclassified 4155
370 Ga0163163_10800922 3300014325 Bacteria 1006
371 Ga0157377_10030069 3300014745 Bacteria 2939
372 Ga0157377_10403311 3300014745 Unclassified 932
373 Ga0157379_10012044 3300014968 Bacteria 7556
374 Ga0157379_10901795 3300014968 Bacteria 839
375 Ga0157379_11029681 3300014968 Bacteria 786
376 Ga0157376_10000359 3300014969 Bacteria 30267
377 Ga0157376_10013693 3300014969 Bacteria 6062
378 Ga0157376_10026423 3300014969 Bacteria 4588
379 Ga0157376_10058997 3300014969 Bacteria 3217
380 Ga0157376_10106107 3300014969 Bacteria 2464
381 Ga0157376_10167472 3300014969 Bacteria 1998
382 Ga0163161_10069837 3300017792 Unclassified 2568
383 Ga0163161_10113234 3300017792 Unclassified 2030
384 Ga0213874_10151092 3300021377 Bacteria 810
385 Ga0213876_10011355 3300021384 Bacteria 4758
386 Ga0213876_10062816 3300021384 Bacteria 1960
387 Ga0207666_1001106 3300025271 Bacteria 3189
388 Ga0207666_1013162 3300025271 Bacteria 1160
389 Ga0207666_1015124 3300025271 Unclassified 1096
390 Ga0207666_1036567 3300025271 Unclassified 763
391 Ga0207673_1000231 3300025290 Bacteria 5669
392 Ga0207673_1003111 3300025290 Bacteria 1930
393 Ga0207673_1010386 3300025290 Unclassified 1198
394 Ga0207697_10000198 3300025315 Bacteria 32108
395 Ga0207697_10000199 3300025315 Bacteria 32092
396 Ga0207697_10000492 3300025315 Bacteria 22218
397 Ga0207697_10001376 3300025315 Bacteria 13313
398 Ga0207697_10001603 3300025315 Bacteria 12221
399 Ga0207697_10001623 3300025315 Bacteria 12142
400 Ga0207697_10012813 3300025315 Bacteria 3507
401 Ga0207697_10027653 3300025315 Bacteria 2319
402 Ga0207697_10198854 3300025315 Unclassified 881
403 Ga0207653_10010406 3300025885 Bacteria 2900
404 Ga0207653_10189428 3300025885 Unclassified 772
405 Ga0207692_10059463 3300025898 Unclassified 1974
406 Ga0207692_10099986 3300025898 Bacteria 1590
407 Ga0207692_10250271 3300025898 Unclassified 1062
408 Ga0207680_10019989 3300025903 Bacteria 3593
409 Ga0207680_10030665 3300025903 Bacteria 3036
410 Ga0207685_10041136 3300025905 Unclassified 1727
411 Ga0207685_10080121 3300025905 Unclassified 1349
412 Ga0207685_10086835 3300025905 Unclassified 1308
413 Ga0207685_10183028 3300025905 Bacteria 973
414 Ga0207699_10008646 3300025906 Bacteria 5036
415 Ga0207645_10002552 3300025907 Bacteria 14232
416 Ga0207645_10017267 3300025907 Bacteria 4767
417 Ga0207645_10065841 3300025907 Unclassified 2316
418 Ga0207645_10118747 3300025907 Unclassified 1716
419 Ga0207645_10140268 3300025907 Unclassified 1575
420 Ga0207645_10152190 3300025907 Unclassified 1510
421 Ga0207684_10000128 3300025910 Bacteria 139233
422 Ga0207684_10002590 3300025910 Bacteria 18114
423 Ga0207684_10004639 3300025910 Bacteria 12904
424 Ga0207684_10005486 3300025910 Bacteria 11684
425 Ga0207684_10008708 3300025910 Bacteria 9007
426 Ga0207684_10027410 3300025910 Bacteria 4855
427 Ga0207684_10105346 3300025910 Bacteria 2412
428 Ga0207684_10121148 3300025910 Bacteria 2243
429 Ga0207684_10181120 3300025910 Bacteria 1817
430 Ga0207684_10219772 3300025910 Unclassified 1640
431 Ga0207684_10233616 3300025910 Unclassified 1586
432 Ga0207684_10241182 3300025910 Bacteria 1559
433 Ga0207684_10257073 3300025910 Bacteria 1507
434 Ga0207654_10429660 3300025911 Bacteria 923
435 Ga0207654_10559365 3300025911 Bacteria 813
436 Ga0207707_10031645 3300025912 Bacteria 4631
437 Ga0207671_10409122 3300025914 Unclassified 1079
438 Ga0207693_10001095 3300025915 Bacteria 24368
439 Ga0207693_10006558 3300025915 Bacteria 9630
440 Ga0207693_10020690 3300025915 Bacteria 5233
441 Ga0207693_10020698 3300025915 Bacteria 5232
442 Ga0207693_10033555 3300025915 Bacteria 4050
443 Ga0207693_10037139 3300025915 Bacteria 3839
444 Ga0207693_10048365 3300025915 Bacteria 3339
445 Ga0207693_10052073 3300025915 Bacteria 3211
446 Ga0207693_10269314 3300025915 Bacteria 1335
447 Ga0207693_10289411 3300025915 Bacteria 1284
448 Ga0207663_10013301 3300025916 Bacteria 4469
449 Ga0207663_10073144 3300025916 Unclassified 2217
450 Ga0207663_10074143 3300025916 Bacteria 2205
451 Ga0207663_10231890 3300025916 Unclassified 1349
452 Ga0207663_10256842 3300025916 Bacteria 1289
453 Ga0207663_10376163 3300025916 Bacteria 1081
454 Ga0207660_10199270 3300025917 Bacteria 1563
455 Ga0207660_10364693 3300025917 Unclassified 1159
456 Ga0207662_10013481 3300025918 Bacteria 4570
457 Ga0207662_10157076 3300025918 Bacteria 1450
458 Ga0207657_10117697 3300025919 Bacteria 2188
459 Ga0207657_10238529 3300025919 Bacteria 1452
460 Ga0207649_10064479 3300025920 Unclassified 2316
461 Ga0207652_10101800 3300025921 Bacteria 2538
462 Ga0207646_10003886 3300025922 Bacteria 16577
463 Ga0207646_10004817 3300025922 Bacteria 14466
464 Ga0207646_10006990 3300025922 Bacteria 11559
465 Ga0207646_10013567 3300025922 Bacteria 7785
466 Ga0207646_10094871 3300025922 Bacteria 2672
467 Ga0207646_10133924 3300025922 Unclassified 2231
468 Ga0207646_10150392 3300025922 Bacteria 2099
469 Ga0207646_10208552 3300025922 Bacteria 1764
470 Ga0207646_10237817 3300025922 Bacteria 1646
471 Ga0207681_10070932 3300025923 Unclassified 2428
472 Ga0207681_10138700 3300025923 Bacteria 1808
473 Ga0207681_10157271 3300025923 Bacteria 1709
474 Ga0207650_10101579 3300025925 Bacteria 2214
475 Ga0207650_10207761 3300025925 Bacteria 1571
476 Ga0207659_10030146 3300025926 Bacteria 3703
477 Ga0207659_10044848 3300025926 Unclassified 3113
478 Ga0207659_10090372 3300025926 Unclassified 2285
479 Ga0207659_10135420 3300025926 Bacteria 1906
480 Ga0207659_10199970 3300025926 Bacteria 1595
481 Ga0207659_10524976 3300025926 Unclassified 1004
482 Ga0207687_10270530 3300025927 Unclassified 1358
483 Ga0207687_10798003 3300025927 Bacteria 805
484 Ga0207700_10034816 3300025928 Bacteria 3619
485 Ga0207700_10089357 3300025928 Bacteria 2428
486 Ga0207700_10440993 3300025928 Unclassified 1146
487 Ga0207700_10848336 3300025928 Unclassified 817
488 Ga0207664_10258032 3300025929 Unclassified 1523
489 Ga0207664_10413578 3300025929 Unclassified 1201
490 Ga0207664_10815362 3300025929 Unclassified 839
491 Ga0207644_10023266 3300025931 Unclassified 4242
492 Ga0207644_10046488 3300025931 Bacteria 3093
493 Ga0207644_10086121 3300025931 Bacteria 2332
494 Ga0207644_10103889 3300025931 Bacteria 2138
495 Ga0207644_10149873 3300025931 Unclassified 1804
496 Ga0207644_10344208 3300025931 Unclassified 1209
497 Ga0207644_10408826 3300025931 Unclassified 1110
498 Ga0207690_10006328 3300025932 Bacteria 7013
499 Ga0207690_10109574 3300025932 Bacteria 1986
500 Ga0207706_10004103 3300025933 Bacteria 13759
501 Ga0207706_10052726 3300025933 Bacteria 3591
502 Ga0207706_10104223 3300025933 Unclassified 2495
503 Ga0207706_10141340 3300025933 Bacteria 2118
504 Ga0207706_10278124 3300025933 Unclassified 1460
505 Ga0207706_10322382 3300025933 Unclassified 1345
506 Ga0207686_10006480 3300025934 Bacteria 6302
507 Ga0207670_10002895 3300025936 Bacteria 9064
508 Ga0207670_10007754 3300025936 Bacteria 6021
509 Ga0207670_10058220 3300025936 Bacteria 2624
510 Ga0207669_10004423 3300025937 Bacteria 6182
511 Ga0207669_10039343 3300025937 Bacteria 2731
512 Ga0207669_10063883 3300025937 Bacteria 2275
513 Ga0207704_10015844 3300025938 Bacteria 3855
514 Ga0207704_10020503 3300025938 Bacteria 3499
515 Ga0207704_10071700 3300025938 Bacteria 2199
516 Ga0207704_10965137 3300025938 Unclassified 719
517 Ga0207665_10015418 3300025939 Bacteria 5017
518 Ga0207665_10242743 3300025939 Bacteria 1328
519 Ga0207665_10623900 3300025939 Unclassified 843
520 Ga0207691_10000297 3300025940 Bacteria 49253
521 Ga0207691_10030825 3300025940 Bacteria 5009
522 Ga0207691_10099074 3300025940 Bacteria 2603
523 Ga0207691_10625099 3300025940 Bacteria 911
524 Ga0207711_10258581 3300025941 Unclassified 1600
525 Ga0207689_10124555 3300025942 Bacteria 2120
526 Ga0207689_10179963 3300025942 Bacteria 1744
527 Ga0207689_10852468 3300025942 Bacteria 769
528 Ga0207689_10952063 3300025942 Unclassified 724
529 Ga0207661_10013405 3300025944 Bacteria 5986
530 Ga0207661_10022879 3300025944 Bacteria 4714
531 Ga0207661_10098253 3300025944 Bacteria 2453
532 Ga0207661_10102570 3300025944 Bacteria 2406
533 Ga0207661_10602929 3300025944 Unclassified 1008
534 Ga0207679_10066965 3300025945 Unclassified 2693
535 Ga0207679_10096659 3300025945 Bacteria 2299
536 Ga0207679_10909156 3300025945 Unclassified 805
537 Ga0207651_10009937 3300025960 Bacteria 5242
538 Ga0207651_10060338 3300025960 Bacteria 2632
539 Ga0207651_10080049 3300025960 Bacteria 2350
540 Ga0207651_10081285 3300025960 Unclassified 2335
541 Ga0207651_10277451 3300025960 Unclassified 1383
542 Ga0207651_11032315 3300025960 Unclassified 735
543 Ga0207712_10034687 3300025961 Bacteria 3421
544 Ga0207712_10061319 3300025961 Bacteria 2669
545 Ga0207712_10271922 3300025961 Bacteria 1379
546 Ga0207668_10043513 3300025972 Bacteria 3048
547 Ga0207668_10061172 3300025972 Unclassified 2647
548 Ga0207668_10205846 3300025972 Bacteria 1570
549 Ga0207658_10048549 3300025986 Bacteria 3113
550 Ga0207658_10058219 3300025986 Bacteria 2875
551 Ga0207658_10077422 3300025986 Bacteria 2537
552 Ga0207658_10085657 3300025986 Bacteria 2427
553 Ga0207658_10517561 3300025986 Unclassified 1064
554 Ga0207658_11023884 3300025986 Unclassified 754
555 Ga0207677_10064296 3300026023 Bacteria 2554
556 Ga0207677_10187875 3300026023 Bacteria 1632
557 Ga0207703_10077973 3300026035 Unclassified 2752
558 Ga0207703_10340056 3300026035 Bacteria 1379
559 Ga0207639_10000022 3300026041 Bacteria 226983
560 Ga0207678_10004776 3300026067 Bacteria 12161
561 Ga0207708_10018830 3300026075 Bacteria 5200
562 Ga0207708_10410194 3300026075 Bacteria 1122
563 Ga0207702_10113902 3300026078 Unclassified 2409
564 Ga0207702_10737370 3300026078 Unclassified 972
565 Ga0207641_10012790 3300026088 Bacteria 6879
566 Ga0207641_10631676 3300026088 Bacteria 1051
567 Ga0207648_10041835 3300026089 Bacteria 4024
568 Ga0207675_100078710 3300026118 Bacteria 3089
569 Ga0207683_10003256 3300026121 Bacteria 14160
570 Ga0207683_10022180 3300026121 Bacteria 5450
571 Ga0207683_10043757 3300026121 Unclassified 3913
572 Ga0207683_10070355 3300026121 Bacteria 3091
573 Ga0207683_10131255 3300026121 Bacteria 2253
574 Ga0207683_10640885 3300026121 Unclassified 984
575 Ga0207698_11182051 3300026142 Bacteria 779
576 Ga0209974_10064994 3300027876 Unclassified 1239
577 Ga0268266_10012128 3300028379 Bacteria 7459
578 Ga0268266_10048393 3300028379 Bacteria 3644
579 Ga0268266_10188780 3300028379 Bacteria 1880
580 Ga0268266_11373269 3300028379 Bacteria 682
581 Ga0268265_10373779 3300028380 Bacteria 1309
582 Ga0268265_10893945 3300028380 Bacteria 872
583 Ga0268264_10000626 3300028381 Bacteria 42069
584 Ga0268264_10017273 3300028381 Bacteria 5911
585 Ga0268264_10259714 3300028381 Bacteria 1617
586 Ga0268264_10555874 3300028381 Unclassified 1126
587 Ga0373948_0088409 3300034817 Unclassified 716
588 Ga0373944_0115072 3300035089 Unclassified 922
589 Ga0373923_0103709 3300035111 Bacteria 1257
590 Ga0373953_0100006 3300035117 Bacteria 1220
591 Ga0373957_0133798 3300035120 Unclassified 1011
592 Ga0373943_0095578 3300035170 Bacteria 1546
593 Ga0373943_0231306 3300035170 Unclassified 1033
594 Ga0373946_0051749 3300035171 Bacteria 1720
595 Ga0373946_0081088 3300035171 Bacteria 1421
596 Ga0373946_0098900 3300035171 Unclassified 1305
597 Ga0373935_0163759 3300035692 Unclassified 1517
598 Ga0373935_0265204 3300035692 Unclassified 1205
599 Ga0373935_0309641 3300035692 Bacteria 1118
600 Ga0373935_0392132 3300035692 Unclassified 996
601 Ga0373927_0099219 3300035695 Bacteria 1894
602 Ga0373927_0445086 3300035695 Unclassified 855
603 Ga0373933_0033926 3300035724 Bacteria 2972
604 Ga0373947_0041015 3300035725 Bacteria 2759
605 Ga0373947_0058729 3300035725 Unclassified 2331
606 Ga0373947_0087012 3300035725 Bacteria 1943
607 Ga0373947_0134058 3300035725 Bacteria 1583
608 Ga0373947_0281981 3300035725 Bacteria 1105
609 Ga0373937_0045397 3300036401 Bacteria 4015
610 Ga0373937_0221143 3300036401 Unclassified 1783
611 Ga0373925_0021781 3300037068 Bacteria 4672
612 Ga0373925_0512160 3300037068 Bacteria 985
613 Ga0395899_0236157 3300037312 Unclassified 1260
614 Ga0395900_0079966 3300037418 Unclassified 3359
615 Ga0395900_0137435 3300037418 Bacteria 2504
616 Ga0395900_0172537 3300037418 Bacteria 2201
617 Ga0395898_0015715 3300037466 Bacteria 7757
618 Ga0395898_0391891 3300037466 Unclassified 1324
619 Ga0395898_0563025 3300037466 Bacteria 1082
620 Ga0395905_0004356 3300037471 Bacteria 14738
621 Ga0436364_0223079 3300037853 Bacteria 1428
622 Ga0395901_0013525 3300038443 Bacteria 8299
623 Ga0395901_0061139 3300038443 Bacteria 3920
624 Ga0395901_0181434 3300038443 Unclassified 2208
625 Ga0395901_0307595 3300038443 Unclassified 1642
626 Ga0395901_0308725 3300038443 Unclassified 1639
627 Ga0436365_0016244 3300039437 Bacteria 17201
628 Ga0436365_0042856 3300039437 Bacteria 8524
629 Ga0436365_0067186 3300039437 Bacteria 4959
630 Ga0436363_1151520 3300039450 Unclassified 1282
631 Ga0436363_1576806 3300039450 Bacteria 1357
632 Ga0436362_0467398 3300039453 Unclassified 677
633 Ga0451849_1477180 3300041505 Bacteria 1459
634 Ga0439451_014798 3300042009 Bacteria 1574
635 Ga0439455_0067458 3300042012 Bacteria 957
636 Ga0439458_0060953 3300042157 Bacteria 942
637 Ga0439460_0050621 3300042461 Bacteria 1245
638 Ga0495629_0155610 3300046459 Bacteria 1588
639 Ga0495580_0031728 3300046472 Bacteria 3816
640 Ga0495580_0424772 3300046472 Unclassified 894
641 Ga0495662_0031534 3300046476 Bacteria 2561
642 Ga0495664_0110542 3300046477 Bacteria 1659
643 Ga0495584_0069634 3300046491 Bacteria 1768
644 Ga0495608_0288536 3300046511 Unclassified 1017
645 Ga0495618_0098429 3300046514 Unclassified 1871
646 Ga0495628_0033015 3300046516 Unclassified 4174
647 Ga0495630_0006745 3300046517 Bacteria 8183
648 Ga0495630_0848610 3300046517 Unclassified 696
649 Ga0495665_0133914 3300046531 Bacteria 1297
650 Ga0495640_0165362 3300046533 Unclassified 1416
651 Ga0495640_0192251 3300046533 Unclassified 1297
652 Ga0495640_0209281 3300046533 Bacteria 1234
653 Ga0495586_0164379 3300046535 Bacteria 1252
654 Ga0495587_0139986 3300046536 Unclassified 1381
655 Ga0495609_0150804 3300046538 Unclassified 989
656 Ga0495645_0378126 3300046543 Unclassified 907
657 Ga0495667_0303556 3300046559 Unclassified 1011
658 Ga0495667_0500086 3300046559 Unclassified 762
659 Ga0495634_0037776 3300046642 Unclassified 3297
660 Ga0495635_0129162 3300046663 Bacteria 1723
661 Ga0495635_0570418 3300046663 Unclassified 741
662 Ga0495657_0178449 3300046675 Unclassified 1305
663 Ga0495599_0112688 3300046678 Unclassified 1693
664 Ga0495646_0026698 3300046680 Bacteria 3625
665 Ga0495647_0069053 3300046681 Bacteria 1411
666 Ga0495658_0031587 3300046683 Bacteria 2886
667 Ga0495658_0132003 3300046683 Unclassified 1521
668 Ga0495669_0150350 3300046684 Unclassified 1102
669 Ga0495613_0390429 3300046689 Bacteria 951
670 Ga0495624_0164005 3300046690 Bacteria 1357
671 Ga0495604_0065324 3300047317 Unclassified 2770
672 Ga0495604_0091081 3300047317 Unclassified 2263
673 Ga0495604_0254563 3300047317 Bacteria 1196
674 Ga0495604_0366045 3300047317 Unclassified 955
675 Ga0495604_0568845 3300047317 Unclassified 729
676 Ga0495674_0328635 3300047319 Unclassified 1244
677 Ga0495676_0382101 3300047321 Unclassified 937
678 Ga0495680_0504155 3300047322 Unclassified 821
679 Ga0495680_0587327 3300047322 Unclassified 747
680 Ga0495675_0023071 3300047444 Bacteria 3966
681 Ga0495684_0005005 3300047471 Bacteria 10334
682 Ga0495593_0378554 3300047673 Unclassified 708
683 Ga0496100_0040454 3300048903 Bacteria 2966
684 Ga0496100_0060179 3300048903 Bacteria 2499
685 Ga0496100_0398458 3300048903 Unclassified 1048
686 Ga0496100_0472229 3300048903 Unclassified 964
687 Ga0496100_0923585 3300048903 Unclassified 686
688 Ga0496101_0019721 3300048904 Bacteria 4609
689 Ga0496101_0058452 3300048904 Bacteria 2793
690 Ga0496101_0407472 3300048904 Unclassified 1071
691 Ga0496101_0852023 3300048904 Bacteria 718
692 Ga0496102_0028483 3300048905 Bacteria 4990
693 Ga0496102_0061982 3300048905 Bacteria 3424
694 Ga0496102_0067380 3300048905 Bacteria 3283
695 Ga0496102_0556192 3300048905 Unclassified 1070
696 Ga0496103_0035273 3300048906 Bacteria 3062
697 Ga0496103_0542514 3300048906 Unclassified 743
698 Ga0496104_0214599 3300048907 Bacteria 1836
699 Ga0496104_0310695 3300048907 Unclassified 1489
700 Ga0496104_0383799 3300048907 Bacteria 1317
701 Ga0496104_0722009 3300048907 Bacteria 904
702 Ga0496105_0063115 3300048908 Bacteria 3057
703 Ga0496105_0393740 3300048908 Unclassified 1101
704 Ga0496106_0013446 3300048909 Bacteria 6041
705 Ga0496106_0115505 3300048909 Bacteria 2093
706 Ga0496106_0387719 3300048909 Bacteria 1123
707 Ga0496107_0025904 3300048910 Bacteria 4156
708 Ga0496107_0072248 3300048910 Bacteria 2508
709 Ga0496108_0051616 3300048911 Bacteria 3445
710 Ga0496108_0268729 3300048911 Bacteria 1484
711 Ga0496108_0353233 3300048911 Bacteria 1283
712 Ga0496109_0023921 3300048912 Bacteria 5425
713 Ga0496109_0076860 3300048912 Bacteria 3072
714 Ga0496109_0081656 3300048912 Bacteria 2979
715 Ga0496109_0082880 3300048912 Bacteria 2957
716 Ga0496109_0119535 3300048912 Bacteria 2454
717 Ga0496109_0274082 3300048912 Bacteria 1590
718 Ga0496110_0135146 3300048913 Bacteria 2228
719 Ga0496110_0193669 3300048913 Bacteria 1846
720 Ga0496110_0563549 3300048913 Unclassified 1035
721 Ga0496112_0019873 3300048915 Bacteria 6356
722 Ga0496112_0184618 3300048915 Bacteria 2049
723 Ga0496112_0245040 3300048915 Bacteria 1744
724 Ga0496112_0288277 3300048915 Bacteria 1588
725 Ga0496112_0601425 3300048915 Unclassified 1031
726 Ga0496112_0813075 3300048915 Bacteria 859
727 Ga0496112_0974302 3300048915 Unclassified 768
728 Ga0496113_0031658 3300048916 Bacteria 3840
729 Ga0496113_0153299 3300048916 Bacteria 1819
730 Ga0496114_0458231 3300048917 Unclassified 1129
731 Ga0496114_0673639 3300048917 Unclassified 908
732 Ga0496115_0005638 3300048918 Bacteria 9109
733 Ga0496115_0037653 3300048918 Bacteria 3834
734 Ga0496115_0232710 3300048918 Bacteria 1519
735 Ga0501067_0153289 3300049583 Unclassified 1284
736 nmdc:mga05p37_182533_c1 3300050507 Bacteria 2552
737 nmdc:mga05p37_5948_c1 3300050507 Bacteria 14354
738 nmdc:mga05p37_817414_c1 3300050507 Unclassified 1017
739 nmdc:mga08y16_500506_c1 3300050511 Bacteria 1234
740 nmdc:mga0n895_774975_c1 3300050512 Bacteria 951
741 nmdc:mga08x19_637232_c1 3300050514 Unclassified 756
742 Ga0495601_0024231 3300053077 Bacteria 3737
743 Ga0495595_0149273 3300053084 Bacteria 1150
744 Ga0495619_0372338 3300053085 Unclassified 987
745 Ga0495619_0422103 3300053085 Unclassified 920
746 Ga0070690_100102792
747 SwRhRL2b_contig_1723717
748 SwRhRL2b_contig_3743133
749 JGI25406J46586_10003607
750 rootH2_10115373
751 rootL2_10002087
752 JGI25404J52841_10005585
753 JGI25405J52794_10000025
754 JGI25405J52794_10001870
755 JGI25405J52794_10036019
756 Ga0065703_1021188
757 Ga0065704_10221970
758 Ga0065712_10080895
759 Ga0065712_10100480
760 Ga0065712_10116137
761 Ga0065712_10135926
762 Ga0065715_10015731
763 Ga0065715_10089651
764 Ga0065715_10105160
765 Ga0065715_10112633
766 Ga0065715_10131220
767 Ga0065707_10387648
768 Ga0070658_10620356
769 Ga0070676_10012807
770 Ga0070676_10038170
771 Ga0070676_10052269
772 Ga0070676_10057319
773 Ga0070676_10101430
774 Ga0070676_10132772
775 Ga0070683_100160631
776 Ga0070683_100176304
777 Ga0070690_100138368
778 Ga0070690_100144021
779 Ga0070690_100150935
780 Ga0070690_100866582
781 Ga0070670_100017779
782 Ga0070670_100246960
783 Ga0068869_100166636
784 Ga0068869_100358544
785 Ga0068869_101094208
786 Ga0070666_10007141
787 Ga0070666_10084340
788 Ga0070666_10220452
789 Ga0070666_10291209
790 Ga0070680_100314226
791 Ga0070682_100245887
792 Ga0070682_100467446
793 Ga0068868_100299764
794 Ga0068868_100492411
795 Ga0068868_100692494
796 Ga0070660_100206298
797 Ga0070660_100777078
798 Ga0070689_100004932
799 Ga0070689_100013094
800 Ga0070689_100033715
801 Ga0070689_100102165
802 Ga0070689_100108351
803 Ga0070689_100711224
804 Ga0070687_100021439
805 Ga0070687_100044635
806 Ga0070687_100152767
807 Ga0070661_100021759
808 Ga0070692_10085714
809 Ga0070668_100007228
810 Ga0070668_100008323
811 Ga0070668_100037931
812 Ga0070668_100067891
813 Ga0070668_100466107
814 Ga0070668_100487077
815 Ga0070669_100019043
816 Ga0070669_100034628
817 Ga0070669_100163845
818 Ga0070669_100255177
819 Ga0070675_100009745
820 Ga0070675_100025077
821 Ga0070675_100036035
822 Ga0070675_100050963
823 Ga0070675_100052111
824 Ga0070675_100220228
825 Ga0070671_100001414
826 Ga0070671_100026498
827 Ga0070671_100028937
828 Ga0070671_100067054
829 Ga0070671_100067224
830 Ga0070671_100101926
831 Ga0070671_100236700
832 Ga0070674_100002527
833 Ga0070674_100099297
834 Ga0070673_100003425
835 Ga0070673_100004995
836 Ga0070673_100073360
837 Ga0070673_100103169
838 Ga0070673_100395637
839 Ga0070673_101130010
840 Ga0070688_100003480
841 Ga0070688_100006383
842 Ga0070688_100019266
843 Ga0070688_100098227
844 Ga0070659_100011349
845 Ga0070659_100241616
846 Ga0070659_100940017
847 Ga0070667_100024177
848 Ga0070667_100028056
849 Ga0070667_100060584
850 Ga0070667_100145108
851 Ga0070667_100152645
852 Ga0070667_100364944
853 Ga0070667_101204974
854 Ga0070709_10082184
855 Ga0070709_10196336
856 Ga0070709_10481722
857 Ga0070709_10577889
858 Ga0070709_10619730
859 Ga0070709_10855487
860 Ga0070714_100015874
861 Ga0070714_100392294
862 Ga0070714_100394556
863 Ga0070714_100493921
864 Ga0070714_100870617
865 Ga0070714_100987939
866 Ga0070713_100095487
867 Ga0070713_100166874
868 Ga0070713_100236721
869 Ga0070713_100282303
870 Ga0070713_100742805
871 Ga0070710_10014909
872 Ga0070710_10065446
873 Ga0070701_10211769
874 Ga0070711_100032206
875 Ga0070711_100058723
876 Ga0070711_100077261
877 Ga0070711_100087726
878 Ga0070711_100399668
879 Ga0070705_100032935
880 Ga0070705_100053612
881 Ga0070705_100146333
882 Ga0070705_100634993
883 Ga0070708_100003538
884 Ga0070708_100080722
885 Ga0070708_100083050
886 Ga0070708_100088156
887 Ga0070708_100090963
888 Ga0070708_100134926
889 Ga0070708_100161008
890 Ga0070708_100192923
891 Ga0070708_100448215
892 Ga0070663_100414194
893 Ga0070678_100035886
894 Ga0070678_100054264
895 Ga0070678_100150230
896 Ga0070678_100287090
897 Ga0070678_100667755
898 Ga0070678_100851419
899 Ga0070662_100159249
900 Ga0070662_100229500
901 Ga0070662_100355051
902 Ga0068867_100005841
903 Ga0070685_10050799
904 Ga0070685_10097871
905 Ga0070685_10234379
906 Ga0070685_10292461
907 Ga0070706_100000100
908 Ga0070706_100003389
909 Ga0070706_100007793
910 Ga0070706_100049875
911 Ga0070706_100088139
912 Ga0070706_100105864
913 Ga0070706_100122408
914 Ga0070706_100145307
915 Ga0070706_100170247
916 Ga0070706_100267423
917 Ga0070706_100289910
918 Ga0070706_100410038
919 Ga0070707_100003642
920 Ga0070707_100008310
921 Ga0070707_100008338
922 Ga0070707_100013919
923 Ga0070707_100029811
924 Ga0070707_100054142
925 Ga0070707_100113770
926 Ga0070707_100121038
927 Ga0070707_100134038
928 Ga0070707_100141931
929 Ga0070707_100229663
930 Ga0070707_100261128
931 Ga0070707_100529475
932 Ga0070707_100598478
933 Ga0070707_100745120
934 Ga0070698_100009634
935 Ga0070698_100012104
936 Ga0070698_100297435
937 Ga0070698_100307677
938 Ga0070698_100483255
939 Ga0070699_100021747
940 Ga0070699_100099155
941 Ga0070699_100181583
942 Ga0070699_100266256
943 Ga0070679_100288891
944 Ga0070679_100839676
945 Ga0070684_100001795
946 Ga0070684_100082575
947 Ga0070684_100222457
948 Ga0070697_100002317
949 Ga0070697_100008553
950 Ga0070697_100009708
951 Ga0070697_100025166
952 Ga0070697_100028764
953 Ga0070697_100143324
954 Ga0070697_100147494
955 Ga0070697_100213416
956 Ga0070697_100340731
957 Ga0068853_100000015
958 Ga0070672_100027715
959 Ga0070672_100064123
960 Ga0070672_100071134
961 Ga0070686_100011542
962 Ga0070686_100198131
963 Ga0070695_100097914
964 Ga0070693_100587356
965 Ga0070665_100022668
966 Ga0070665_100033304
967 Ga0070665_100036617
968 Ga0070665_100232257
969 Ga0070665_100520891
970 Ga0070704_100069879
971 Ga0070704_100284257
972 Ga0070664_100097721
973 Ga0070664_100246915
974 Ga0070664_100744170
975 Ga0068857_100266329
976 Ga0068856_100029613
977 Ga0068856_100228077
978 Ga0070702_100012896
979 Ga0068859_100040808
980 Ga0068861_100092208
981 Ga0068861_100114319
982 Ga0068870_10185635
983 Ga0068863_100006492
984 Ga0068863_100155423
985 Ga0068858_100078501
986 Ga0068858_100096008
987 Ga0068858_100662419
988 Ga0068860_100003161
989 Ga0068860_100027109
990 Ga0068860_100154302
991 Ga0081455_10000725
992 Ga0081455_10001494
993 Ga0081455_10001733
994 Ga0081455_10003636
995 Ga0081455_10092829
996 Ga0081455_10145068
997 Ga0081455_10152593
998 Ga0081540_1000380
999 Ga0081540_1089363
1000 Ga0081540_1211289
1001 Ga0081539_10000673
1002 Ga0081539_10000723
1003 Ga0081539_10051383
1004 Ga0070717_10008656
1005 Ga0070717_10047835
1006 Ga0070717_10085272
1007 Ga0070717_10232474
1008 Ga0070717_10452925
1009 Ga0070717_10565251
1010 Ga0070717_10660004
1011 Ga0070715_10052220
1012 Ga0070715_10144299
1013 Ga0070715_10164893
1014 Ga0070716_100031422
1015 Ga0070716_100047621
1016 Ga0070716_100094661
1017 Ga0070716_100147715
1018 Ga0070716_100197313
1019 Ga0070716_100290092
1020 Ga0070716_100482884
1021 Ga0070712_100019751
1022 Ga0070712_100042850
1023 Ga0070712_100091656
1024 Ga0070712_100216189
1025 Ga0070712_100236083
1026 Ga0070712_100346000
1027 Ga0097621_100090066
1028 Ga0097621_100334145
1029 Ga0068871_100204852
1030 Ga0068871_100598591
1031 Ga0075434_100468775
1032 Ga0068865_100021029
1033 Ga0068865_100093670
1034 Ga0068865_100193956
1035 Ga0068865_100319199
1036 Ga0075436_100082978
1037 Ga0075436_100129779
1038 Ga0075436_100181825
1039 Ga0075436_100386039
1040 Ga0097620_100040808
1041 Ga0075435_100700730
1042 Ga0099794_10055660
1043 Ga0099794_10163993
1044 Ga0099795_10050510
1045 Ga0099795_10274887
1046 Ga0105240_10122067
1047 Ga0111539_10437641
1048 Ga0105245_10760092
1049 Ga0105247_10092251
1050 Ga0105247_10139412
1051 Ga0105247_10529105
1052 Ga0114129_10008863
1053 Ga0114129_10195062
1054 Ga0114129_10406451
1055 Ga0105242_10007976
1056 Ga0105242_10208331
1057 Ga0105242_10303673
1058 Ga0105242_11171138
1059 Ga0105248_10182617
1060 Ga0105237_10138436
1061 Ga0105237_10145951
1062 Ga0105249_10009902
1063 Ga0105249_10049932
1064 Ga0105249_10224990
1065 Ga0105249_10482612
1066 Ga0099796_10014764
1067 Ga0099796_10137416
1068 Ga0105239_10119609
1069 Ga0105239_10180851
1070 Ga0105246_10044901
1071 Ga0105246_10186886
1072 Ga0157373_10435186
1073 Ga0157371_10249979
1074 Ga0157369_10269366
1075 Ga0157374_10021137
1076 Ga0157374_10035185
1077 Ga0157374_10261968
1078 Ga0157374_10297608
1079 Ga0157374_10312188
1080 Ga0157374_10326076
1081 Ga0157374_10343879
1082 Ga0157374_10382785
1083 Ga0157374_10652212
1084 Ga0157374_10714983
1085 Ga0157374_10760788
1086 Ga0157374_10883184
1087 Ga0157374_11645254
1088 Ga0157378_10004866
1089 Ga0157378_10023999
1090 Ga0157378_10036089
1091 Ga0157378_10200689
1092 Ga0157378_10241837
1093 Ga0157378_10412445
1094 Ga0157378_10468492
1095 Ga0157378_10690792
1096 Ga0163162_10004971
1097 Ga0163162_10090240
1098 Ga0163162_10139468
1099 Ga0163162_10179632
1100 Ga0163162_10211618
1101 Ga0163162_10262328
1102 Ga0163162_10277418
1103 Ga0163162_10780988
1104 Ga0157372_10020989
1105 Ga0157372_10154707
1106 Ga0157372_10450369
1107 Ga0157375_10013802
1108 Ga0157375_10040342
1109 Ga0157375_10077547
1110 Ga0157375_10152282
1111 Ga0157375_10220736
1112 Ga0157375_10441241
1113 Ga0157375_11205941
1114 Ga0163163_10049027
1115 Ga0163163_10800922
1116 Ga0157377_10030069
1117 Ga0157377_10403311
1118 Ga0157379_10012044
1119 Ga0157379_10901795
1120 Ga0157379_11029681
1121 Ga0157376_10000359
1122 Ga0157376_10013693
1123 Ga0157376_10026423
1124 Ga0157376_10058997
1125 Ga0157376_10106107
1126 Ga0157376_10167472
1127 Ga0163161_10069837
1128 Ga0163161_10113234
1129 Ga0213874_10151092
1130 Ga0213876_10011355
1131 Ga0213876_10062816
1132 Ga0207666_1001106
1133 Ga0207666_1013162
1134 Ga0207666_1015124
1135 Ga0207666_1036567
1136 Ga0207673_1000231
1137 Ga0207673_1003111
1138 Ga0207673_1010386
1139 Ga0207697_10000198
1140 Ga0207697_10000199
1141 Ga0207697_10000492
1142 Ga0207697_10001376
1143 Ga0207697_10001603
1144 Ga0207697_10001623
1145 Ga0207697_10012813
1146 Ga0207697_10027653
1147 Ga0207697_10198854
1148 Ga0207653_10010406
1149 Ga0207653_10189428
1150 Ga0207692_10059463
1151 Ga0207692_10099986
1152 Ga0207692_10250271
1153 Ga0207680_10019989
1154 Ga0207680_10030665
1155 Ga0207685_10041136
1156 Ga0207685_10080121
1157 Ga0207685_10086835
1158 Ga0207685_10183028
1159 Ga0207699_10008646
1160 Ga0207645_10002552
1161 Ga0207645_10017267
1162 Ga0207645_10065841
1163 Ga0207645_10118747
1164 Ga0207645_10140268
1165 Ga0207645_10152190
1166 Ga0207684_10000128
1167 Ga0207684_10002590
1168 Ga0207684_10004639
1169 Ga0207684_10005486
1170 Ga0207684_10008708
1171 Ga0207684_10027410
1172 Ga0207684_10105346
1173 Ga0207684_10121148
1174 Ga0207684_10181120
1175 Ga0207684_10219772
1176 Ga0207684_10233616
1177 Ga0207684_10241182
1178 Ga0207684_10257073
1179 Ga0207654_10429660
1180 Ga0207654_10559365
1181 Ga0207707_10031645
1182 Ga0207671_10409122
1183 Ga0207693_10001095
1184 Ga0207693_10006558
1185 Ga0207693_10020690
1186 Ga0207693_10020698
1187 Ga0207693_10033555
1188 Ga0207693_10037139
1189 Ga0207693_10048365
1190 Ga0207693_10052073
1191 Ga0207693_10269314
1192 Ga0207693_10289411
1193 Ga0207663_10013301
1194 Ga0207663_10073144
1195 Ga0207663_10074143
1196 Ga0207663_10231890
1197 Ga0207663_10256842
1198 Ga0207663_10376163
1199 Ga0207660_10199270
1200 Ga0207660_10364693
1201 Ga0207662_10013481
1202 Ga0207662_10157076
1203 Ga0207657_10117697
1204 Ga0207657_10238529
1205 Ga0207649_10064479
1206 Ga0207652_10101800
1207 Ga0207646_10003886
1208 Ga0207646_10004817
1209 Ga0207646_10006990
1210 Ga0207646_10013567
1211 Ga0207646_10094871
1212 Ga0207646_10133924
1213 Ga0207646_10150392
1214 Ga0207646_10208552
1215 Ga0207646_10237817
1216 Ga0207681_10070932
1217 Ga0207681_10138700
1218 Ga0207681_10157271
1219 Ga0207650_10101579
1220 Ga0207650_10207761
1221 Ga0207659_10030146
1222 Ga0207659_10044848
1223 Ga0207659_10090372
1224 Ga0207659_10135420
1225 Ga0207659_10199970
1226 Ga0207659_10524976
1227 Ga0207687_10270530
1228 Ga0207687_10798003
1229 Ga0207700_10034816
1230 Ga0207700_10089357
1231 Ga0207700_10440993
1232 Ga0207700_10848336
1233 Ga0207664_10258032
1234 Ga0207664_10413578
1235 Ga0207664_10815362
1236 Ga0207644_10023266
1237 Ga0207644_10046488
1238 Ga0207644_10086121
1239 Ga0207644_10103889
1240 Ga0207644_10149873
1241 Ga0207644_10344208
1242 Ga0207644_10408826
1243 Ga0207690_10006328
1244 Ga0207690_10109574
1245 Ga0207706_10004103
1246 Ga0207706_10052726
1247 Ga0207706_10104223
1248 Ga0207706_10141340
1249 Ga0207706_10278124
1250 Ga0207706_10322382
1251 Ga0207686_10006480
1252 Ga0207670_10002895
1253 Ga0207670_10007754
1254 Ga0207670_10058220
1255 Ga0207669_10004423
1256 Ga0207669_10039343
1257 Ga0207669_10063883
1258 Ga0207704_10015844
1259 Ga0207704_10020503
1260 Ga0207704_10071700
1261 Ga0207704_10965137
1262 Ga0207665_10015418
1263 Ga0207665_10242743
1264 Ga0207665_10623900
1265 Ga0207691_10000297
1266 Ga0207691_10030825
1267 Ga0207691_10099074
1268 Ga0207691_10625099
1269 Ga0207711_10258581
1270 Ga0207689_10124555
1271 Ga0207689_10179963
1272 Ga0207689_10852468
1273 Ga0207689_10952063
1274 Ga0207661_10013405
1275 Ga0207661_10022879
1276 Ga0207661_10098253
1277 Ga0207661_10102570
1278 Ga0207661_10602929
1279 Ga0207679_10066965
1280 Ga0207679_10096659
1281 Ga0207679_10909156
1282 Ga0207651_10009937
1283 Ga0207651_10060338
1284 Ga0207651_10080049
1285 Ga0207651_10081285
1286 Ga0207651_10277451
1287 Ga0207651_11032315
1288 Ga0207712_10034687
1289 Ga0207712_10061319
1290 Ga0207712_10271922
1291 Ga0207668_10043513
1292 Ga0207668_10061172
1293 Ga0207668_10205846
1294 Ga0207658_10048549
1295 Ga0207658_10058219
1296 Ga0207658_10077422
1297 Ga0207658_10085657
1298 Ga0207658_10517561
1299 Ga0207658_11023884
1300 Ga0207677_10064296
1301 Ga0207677_10187875
1302 Ga0207703_10077973
1303 Ga0207703_10340056
1304 Ga0207639_10000022
1305 Ga0207678_10004776
1306 Ga0207708_10018830
1307 Ga0207708_10410194
1308 Ga0207702_10113902
1309 Ga0207702_10737370
1310 Ga0207641_10012790
1311 Ga0207641_10631676
1312 Ga0207648_10041835
1313 Ga0207675_100078710
1314 Ga0207683_10003256
1315 Ga0207683_10022180
1316 Ga0207683_10043757
1317 Ga0207683_10070355
1318 Ga0207683_10131255
1319 Ga0207683_10640885
1320 Ga0207698_11182051
1321 Ga0209974_10064994
1322 Ga0268266_10012128
1323 Ga0268266_10048393
1324 Ga0268266_10188780
1325 Ga0268266_11373269
1326 Ga0268265_10373779
1327 Ga0268265_10893945
1328 Ga0268264_10000626
1329 Ga0268264_10017273
1330 Ga0268264_10259714
1331 Ga0268264_10555874
1332 Ga0373948_0088409
1333 Ga0373944_0115072
1334 Ga0373923_0103709
1335 Ga0373953_0100006
1336 Ga0373957_0133798
1337 Ga0373943_0095578
1338 Ga0373943_0231306
1339 Ga0373946_0051749
1340 Ga0373946_0081088
1341 Ga0373946_0098900
1342 Ga0373935_0163759
1343 Ga0373935_0265204
1344 Ga0373935_0309641
1345 Ga0373935_0392132
1346 Ga0373927_0099219
1347 Ga0373927_0445086
1348 Ga0373933_0033926
1349 Ga0373947_0041015
1350 Ga0373947_0058729
1351 Ga0373947_0087012
1352 Ga0373947_0134058
1353 Ga0373947_0281981
1354 Ga0373937_0045397
1355 Ga0373937_0221143
1356 Ga0373925_0021781
1357 Ga0373925_0512160
1358 Ga0395899_0236157
1359 Ga0395900_0079966
1360 Ga0395900_0137435
1361 Ga0395900_0172537
1362 Ga0395898_0015715
1363 Ga0395898_0391891
1364 Ga0395898_0563025
1365 Ga0395905_0004356
1366 Ga0436364_0223079
1367 Ga0395901_0013525
1368 Ga0395901_0061139
1369 Ga0395901_0181434
1370 Ga0395901_0307595
1371 Ga0395901_0308725
1372 Ga0436365_0016244
1373 Ga0436365_0042856
1374 Ga0436365_0067186
1375 Ga0436363_1151520
1376 Ga0436363_1576806
1377 Ga0436362_0467398
1378 Ga0451849_1477180
1379 Ga0439451_014798
1380 Ga0439455_0067458
1381 Ga0439458_0060953
1382 Ga0439460_0050621
1383 Ga0495629_0155610
1384 Ga0495580_0031728
1385 Ga0495580_0424772
1386 Ga0495662_0031534
1387 Ga0495664_0110542
1388 Ga0495584_0069634
1389 Ga0495608_0288536
1390 Ga0495618_0098429
1391 Ga0495628_0033015
1392 Ga0495630_0006745
1393 Ga0495630_0848610
1394 Ga0495665_0133914
1395 Ga0495640_0165362
1396 Ga0495640_0192251
1397 Ga0495640_0209281
1398 Ga0495586_0164379
1399 Ga0495587_0139986
1400 Ga0495609_0150804
1401 Ga0495645_0378126
1402 Ga0495667_0303556
1403 Ga0495667_0500086
1404 Ga0495634_0037776
1405 Ga0495635_0129162
1406 Ga0495635_0570418
1407 Ga0495657_0178449
1408 Ga0495599_0112688
1409 Ga0495646_0026698
1410 Ga0495647_0069053
1411 Ga0495658_0031587
1412 Ga0495658_0132003
1413 Ga0495669_0150350
1414 Ga0495613_0390429
1415 Ga0495624_0164005
1416 Ga0495604_0065324
1417 Ga0495604_0091081
1418 Ga0495604_0254563
1419 Ga0495604_0366045
1420 Ga0495604_0568845
1421 Ga0495674_0328635
1422 Ga0495676_0382101
1423 Ga0495680_0504155
1424 Ga0495680_0587327
1425 Ga0495675_0023071
1426 Ga0495684_0005005
1427 Ga0495593_0378554
1428 Ga0496100_0040454
1429 Ga0496100_0060179
1430 Ga0496100_0398458
1431 Ga0496100_0472229
1432 Ga0496100_0923585
1433 Ga0496101_0019721
1434 Ga0496101_0058452
1435 Ga0496101_0407472
1436 Ga0496101_0852023
1437 Ga0496102_0028483
1438 Ga0496102_0061982
1439 Ga0496102_0067380
1440 Ga0496102_0556192
1441 Ga0496103_0035273
1442 Ga0496103_0542514
1443 Ga0496104_0214599
1444 Ga0496104_0310695
1445 Ga0496104_0383799
1446 Ga0496104_0722009
1447 Ga0496105_0063115
1448 Ga0496105_0393740
1449 Ga0496106_0013446
1450 Ga0496106_0115505
1451 Ga0496106_0387719
1452 Ga0496107_0025904
1453 Ga0496107_0072248
1454 Ga0496108_0051616
1455 Ga0496108_0268729
1456 Ga0496108_0353233
1457 Ga0496109_0023921
1458 Ga0496109_0076860
1459 Ga0496109_0081656
1460 Ga0496109_0082880
1461 Ga0496109_0119535
1462 Ga0496109_0274082
1463 Ga0496110_0135146
1464 Ga0496110_0193669
1465 Ga0496110_0563549
1466 Ga0496112_0019873
1467 Ga0496112_0184618
1468 Ga0496112_0245040
1469 Ga0496112_0288277
1470 Ga0496112_0601425
1471 Ga0496112_0813075
1472 Ga0496112_0974302
1473 Ga0496113_0031658
1474 Ga0496113_0153299
1475 Ga0496114_0458231
1476 Ga0496114_0673639
1477 Ga0496115_0005638
1478 Ga0496115_0037653
1479 Ga0496115_0232710
1480 Ga0501067_0153289
1481 nmdc:mga05p37_182533_c1
1482 nmdc:mga05p37_5948_c1
1483 nmdc:mga05p37_817414_c1
1484 nmdc:mga08y16_500506_c1
1485 nmdc:mga0n895_774975_c1
1486 nmdc:mga08x19_637232_c1
1487 Ga0495601_0024231
1488 Ga0495595_0149273
1489 Ga0495619_0372338
1490 Ga0495619_0422103

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

1

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7771 1 183
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7657 1 183
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6864 4 186
6h59-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound 0.6451 4 179
8gyw-assembly1.cif.gz_B cryo-em structure of human cept1 complexed with cdp-choline 0.6394 4 180
ID Description Score Start End Superfamily
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8371 1 186 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8344 2 189 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8323 1 188 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8243 1 186 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8021 2 189 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2V5K241-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9358 4 192 GO:0006777
GO:0008444
GO:0008654
GO:0016020
AF-A0A1V4REM0-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9249 1 188 GO:0005886
GO:0008444
GO:0046474
AF-A0A2V5K241-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9171 4 192 GO:0006777
GO:0008444
GO:0008654
GO:0016020
AF-A0A2V6GPC5-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9102 1 192 GO:0005886
GO:0008444
GO:0046474
AF-A0A2V6CMZ4-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9098 1 187 GO:0005886
GO:0008444
GO:0046474

Map