F478692

General Info

Members Datasets Scaffolds Average Seq Length
743 339 685 312

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10074203|Ga0207691_100742032
Length 371
Sequence MINWFTSASLRFPCVSAFLSASLRSSLRLCFTFFATLSYPLRLWVTTTINYLLANLHIVMSITSLFKIEYPIVQAGMVWTSGWRLASAVSNAGGLGLIGSGSMYPDVLREHIRKCRAATDKPFGVNIPILYSDINKHMEIVMEEGVKIIFTSAGNPKTWTSVLKEKGITVVHVVSSSKFAKKAEESGCDAVVAEGFEAGGHNGREETTTFVLVPMVKEAVSIPVMAAGGIATGRQMLAAMVLGADGVQVGSRFAASEEASIHNNFKKAIIDATEGDTLLSLKQVVPVRLMKNKFYQLVEEAEKRGADAAELAALLGRGRAKKGMFEGDIENGELEIGQVSAMLYDILPAGKIVSQLWQEYLEALKDPIHQA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
15 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
16 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
17 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
20 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
21 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
22 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
25 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
26 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
27 2818991444 Filimonas endophytica 3197 Isolate Unclassified
28 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
29 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
30 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
31 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
32 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
33 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
34 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
35 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
36 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
37 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
38 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
39 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
40 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
41 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
42 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
43 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
44 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
45 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
46 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
47 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
48 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
49 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
50 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
51 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
52 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
53 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
54 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
55 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
56 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
57 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
103 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
104 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
105 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
110 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
142 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
143 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
236 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
241 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
269 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
272 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
316 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
317 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
336 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
337 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
338 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
339 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 0
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 3.5
Nodule 0.81
Rhizoplane 0.54
Rhizosphere 87.48
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_222865 2162886007 Bacteria 1282
2 JGI24751J29686_10000969 3300002459 Bacteria 6311
3 JGI25154J39366_1000002 3300002738 Bacteria 466942
4 JGI25159J45721_1022740 3300002987 Bacteria 1152
5 JGI25406J46586_10000469 3300003203 Bacteria 18825
6 JGI25153J46596_10000442 3300003215 Bacteria 26683
7 rootH1_10123138 3300003316 Bacteria 5152
8 rootH2_10072046 3300003320 Bacteria 6824
9 rootH2_10092365 3300003320 Bacteria 2057
10 rootH2_10094093 3300003320 Bacteria 1593
11 rootH2_10177331 3300003320 Bacteria 3480
12 rootL2_10060945 3300003322 Bacteria 2560
13 rootL2_10070185 3300003322 Bacteria 7356
14 rootL2_10077208 3300003322 Bacteria 1962
15 rootL2_10128079 3300003322 Bacteria 2630
16 rootL2_10198780 3300003322 Bacteria 2606
17 rootH1_10004531 3300003323 Bacteria 21017
18 rootH1_10047386 3300003323 Bacteria 13847
19 rootH1_10118920 3300003323 Bacteria 5683
20 JGI25160J50197_1003902 3300003354 Bacteria 6535
21 Ga0055542_1002479 3300003762 Bacteria 6031
22 Ga0055526_1038586 3300003771 Bacteria 1229
23 Ga0055528_1000403 3300003790 Bacteria 35028
24 Ga0055530_10000192 3300003791 Bacteria 54681
25 Ga0065165_1000471 3300005262 Bacteria 62792
26 Ga0065714_10006385 3300005288 Bacteria 4307
27 Ga0065704_10088122 3300005289 Bacteria 2966
28 Ga0065715_10007518 3300005293 Bacteria 3101
29 Ga0070658_10055020 3300005327 Bacteria 3232
30 Ga0070676_10052308 3300005328 Bacteria 2401
31 Ga0070683_100013297 3300005329 Bacteria 7176
32 Ga0070683_100013478 3300005329 Bacteria 7131
33 Ga0070683_100269621 3300005329 Bacteria 1619
34 Ga0070690_100076768 3300005330 Bacteria 2180
35 Ga0070670_100020475 3300005331 Bacteria 5687
36 Ga0070670_100059498 3300005331 Bacteria 3279
37 Ga0070670_100071414 3300005331 Bacteria 2981
38 Ga0070670_100113482 3300005331 Unclassified 2336
39 Ga0070670_100256490 3300005331 Bacteria 1524
40 Ga0070670_100275100 3300005331 Bacteria 1470
41 Ga0070677_10003773 3300005333 Bacteria 4900
42 Ga0068869_100006120 3300005334 Bacteria 7613
43 Ga0068869_100009276 3300005334 Bacteria 6380
44 Ga0068869_100011552 3300005334 Bacteria 5796
45 Ga0068869_100049809 3300005334 Unclassified 3034
46 Ga0068869_100112028 3300005334 Unclassified 2077
47 Ga0068869_100149228 3300005334 Bacteria 1812
48 Ga0070666_10000197 3300005335 Bacteria 41178
49 Ga0070666_10010755 3300005335 Bacteria 5725
50 Ga0070680_100001463 3300005336 Bacteria 17124
51 Ga0070680_100139213 3300005336 Bacteria 2034
52 Ga0070682_100000746 3300005337 Bacteria 19419
53 Ga0070682_100004192 3300005337 Bacteria 7996
54 Ga0070682_100013593 3300005337 Bacteria 4688
55 Ga0068868_100001462 3300005338 Bacteria 16301
56 Ga0068868_100015057 3300005338 Bacteria 5712
57 Ga0068868_100024322 3300005338 Bacteria 4595
58 Ga0068868_100034198 3300005338 Bacteria 3923
59 Ga0068868_100085227 3300005338 Bacteria 2538
60 Ga0068868_100098293 3300005338 Bacteria 2367
61 Ga0068868_100108663 3300005338 Bacteria 2252
62 Ga0070689_100033464 3300005340 Bacteria 3917
63 Ga0070689_100043322 3300005340 Bacteria 3458
64 Ga0070689_100101410 3300005340 Bacteria 2278
65 Ga0070691_10006228 3300005341 Bacteria 5445
66 Ga0070687_100023187 3300005343 Bacteria 2947
67 Ga0070687_100024252 3300005343 Bacteria 2893
68 Ga0070661_100048542 3300005344 Bacteria 3107
69 Ga0070668_100000150 3300005347 Bacteria 44112
70 Ga0070668_100115603 3300005347 Bacteria 2139
71 Ga0070668_100240828 3300005347 Bacteria 1498
72 Ga0070668_100303312 3300005347 Bacteria 1340
73 Ga0070669_100000684 3300005353 Bacteria 24819
74 Ga0070669_100069874 3300005353 Bacteria 2594
75 Ga0070669_100085461 3300005353 Bacteria 2356
76 Ga0070669_100151206 3300005353 Bacteria 1797
77 Ga0070669_100340567 3300005353 Bacteria 1215
78 Ga0070669_100354542 3300005353 Bacteria 1192
79 Ga0070675_100107298 3300005354 Bacteria 2358
80 Ga0070675_100126933 3300005354 Bacteria 2171
81 Ga0070675_100226505 3300005354 Bacteria 1630
82 Ga0070675_100261920 3300005354 Bacteria 1515
83 Ga0070671_100000785 3300005355 Bacteria 22867
84 Ga0070671_100015192 3300005355 Bacteria 6219
85 Ga0070671_100027026 3300005355 Bacteria 4722
86 Ga0070671_100040659 3300005355 Bacteria 3863
87 Ga0070674_100058996 3300005356 Bacteria 2670
88 Ga0070674_100128892 3300005356 Bacteria 1883
89 Ga0070673_100002484 3300005364 Bacteria 11257
90 Ga0070673_100006938 3300005364 Bacteria 7412
91 Ga0070673_100044198 3300005364 Bacteria 3448
92 Ga0070673_100053086 3300005364 Bacteria 3182
93 Ga0070673_100065753 3300005364 Unclassified 2894
94 Ga0070673_100083385 3300005364 Bacteria 2597
95 Ga0070688_100037591 3300005365 Bacteria 2950
96 Ga0070688_100078843 3300005365 Bacteria 2126
97 Ga0070688_100099885 3300005365 Unclassified 1911
98 Ga0070667_100004914 3300005367 Bacteria 11203
99 Ga0070667_100039271 3300005367 Bacteria 3967
100 Ga0070667_100051810 3300005367 Bacteria 3461
101 Ga0070667_100070666 3300005367 Bacteria 2972
102 Ga0070667_100076000 3300005367 Bacteria 2867
103 Ga0070701_10236176 3300005438 Bacteria 1097
104 Ga0070678_100019430 3300005456 Unclassified 4429
105 Ga0070662_100008456 3300005457 Bacteria 6712
106 Ga0070662_100027946 3300005457 Bacteria 3922
107 Ga0070662_100050949 3300005457 Bacteria 2988
108 Ga0070662_100069735 3300005457 Bacteria 2588
109 Ga0070662_100277653 3300005457 Bacteria 1355
110 Ga0070662_100403945 3300005457 Bacteria 1128
111 Ga0070681_10011641 3300005458 Bacteria 8710
112 Ga0068867_100003811 3300005459 Bacteria 10607
113 Ga0068867_100038807 3300005459 Bacteria 3469
114 Ga0068867_100134851 3300005459 Bacteria 1923
115 Ga0068867_100172879 3300005459 Bacteria 1712
116 Ga0070685_10013579 3300005466 Bacteria 4298
117 Ga0070685_10138355 3300005466 Bacteria 1530
118 Ga0070685_10253404 3300005466 Bacteria 1167
119 Ga0070706_100457222 3300005467 Bacteria 1188
120 Ga0070698_100001014 3300005471 Bacteria 30868
121 Ga0070698_100013818 3300005471 Bacteria 8541
122 Ga0070699_100043816 3300005518 Bacteria 3873
123 Ga0070679_100004632 3300005530 Bacteria 12694
124 Ga0070679_100020771 3300005530 Bacteria 6405
125 Ga0070679_100032240 3300005530 Bacteria 5181
126 Ga0070679_100049032 3300005530 Bacteria 4206
127 Ga0070679_100057004 3300005530 Bacteria 3893
128 Ga0070679_100089190 3300005530 Bacteria 3071
129 Ga0070684_100012410 3300005535 Bacteria 6828
130 Ga0070684_100061961 3300005535 Bacteria 3275
131 Ga0070684_100341933 3300005535 Bacteria 1376
132 Ga0068853_100006195 3300005539 Bacteria 9472
133 Ga0068853_100038073 3300005539 Bacteria 4095
134 Ga0068853_100049243 3300005539 Bacteria 3621
135 Ga0068853_100124603 3300005539 Bacteria 2301
136 Ga0070672_100026671 3300005543 Bacteria 4303
137 Ga0070672_100089337 3300005543 Unclassified 2482
138 Ga0070672_100199240 3300005543 Bacteria 1674
139 Ga0070686_100023936 3300005544 Unclassified 3656
140 Ga0070686_100079835 3300005544 Bacteria 2163
141 Ga0070693_100002444 3300005547 Bacteria 8558
142 Ga0070693_100009879 3300005547 Bacteria 4761
143 Ga0070665_100004781 3300005548 Bacteria 14098
144 Ga0070665_100152673 3300005548 Bacteria 2312
145 Ga0070704_100039067 3300005549 Bacteria 3256
146 Ga0068855_100031076 3300005563 Bacteria 6380
147 Ga0068855_100165265 3300005563 Bacteria 2509
148 Ga0070664_100007054 3300005564 Bacteria 9067
149 Ga0070664_100016373 3300005564 Bacteria 6077
150 Ga0070664_100051981 3300005564 Bacteria 3470
151 Ga0068857_100154255 3300005577 Bacteria 2082
152 Ga0068857_100442631 3300005577 Bacteria 1214
153 Ga0068857_100538287 3300005577 Bacteria 1099
154 Ga0068854_100227998 3300005578 Bacteria 1477
155 Ga0068856_100007483 3300005614 Bacteria 10660
156 Ga0070702_100006790 3300005615 Bacteria 5441
157 Ga0068852_100008988 3300005616 Bacteria 7396
158 Ga0068852_100084002 3300005616 Bacteria 2832
159 Ga0068852_100208149 3300005616 Bacteria 1854
160 Ga0068852_100599348 3300005616 Bacteria 1106
161 Ga0068859_100000007 3300005617 Bacteria 390070
162 Ga0068859_100001558 3300005617 Bacteria 23386
163 Ga0068859_100028833 3300005617 Bacteria 5567
164 Ga0068859_100046339 3300005617 Bacteria 4366
165 Ga0068859_100087483 3300005617 Bacteria 3164
166 Ga0068859_100091904 3300005617 Bacteria 3086
167 Ga0068859_100122650 3300005617 Bacteria 2665
168 Ga0068859_100197792 3300005617 Bacteria 2094
169 Ga0068859_100205340 3300005617 Unclassified 2055
170 Ga0068859_100565995 3300005617 Bacteria 1230
171 Ga0068864_100000588 3300005618 Bacteria 30940
172 Ga0068864_100015735 3300005618 Bacteria 6291
173 Ga0068864_100101111 3300005618 Unclassified 2557
174 Ga0068864_100104636 3300005618 Bacteria 2514
175 Ga0068864_100276508 3300005618 Bacteria 1566
176 Ga0068861_100008331 3300005719 Bacteria 7129
177 Ga0068861_100106090 3300005719 Bacteria 2244
178 Ga0068861_100450809 3300005719 Bacteria 1153
179 Ga0068851_10009667 3300005834 Bacteria 4490
180 Ga0068851_10055112 3300005834 Bacteria 2025
181 Ga0068851_10065936 3300005834 Bacteria 1865
182 Ga0068870_10005271 3300005840 Bacteria 5631
183 Ga0068870_10044741 3300005840 Unclassified 2314
184 Ga0068863_100000444 3300005841 Bacteria 41977
185 Ga0068863_100007240 3300005841 Bacteria 10873
186 Ga0068863_100021443 3300005841 Bacteria 6165
187 Ga0068863_100067546 3300005841 Bacteria 3382
188 Ga0068858_100003038 3300005842 Bacteria 16817
189 Ga0068858_100125108 3300005842 Bacteria 2406
190 Ga0068858_100220572 3300005842 Bacteria 1796
191 Ga0068858_100429408 3300005842 Bacteria 1271
192 Ga0068860_100000661 3300005843 Bacteria 40073
193 Ga0068860_100002053 3300005843 Bacteria 21203
194 Ga0068860_100010583 3300005843 Bacteria 9112
195 Ga0068860_100075954 3300005843 Bacteria 3195
196 Ga0068860_100385533 3300005843 Bacteria 1384
197 Ga0068862_100002714 3300005844 Bacteria 15540
198 Ga0068862_100003587 3300005844 Bacteria 13289
199 Ga0068862_100184986 3300005844 Unclassified 1872
200 Ga0081539_10000345 3300005985 Bacteria 102083
201 Ga0081539_10039312 3300005985 Bacteria 2793
202 Ga0075366_10018368 3300006195 Bacteria 4036
203 Ga0097621_100000250 3300006237 Bacteria 36249
204 Ga0097621_100006407 3300006237 Bacteria 8353
205 Ga0097621_100017391 3300006237 Bacteria 5459
206 Ga0097621_100022094 3300006237 Bacteria 4935
207 Ga0097621_100040304 3300006237 Bacteria 3755
208 Ga0097621_100136371 3300006237 Bacteria 2093
209 Ga0097621_100178995 3300006237 Bacteria 1831
210 Ga0075370_10050635 3300006353 Bacteria 2356
211 Ga0068871_100001641 3300006358 Bacteria 15081
212 Ga0068871_100002754 3300006358 Bacteria 12010
213 Ga0068871_100007063 3300006358 Bacteria 8004
214 Ga0068871_100020767 3300006358 Bacteria 5036
215 Ga0068871_100025073 3300006358 Bacteria 4634
216 Ga0068871_100318460 3300006358 Bacteria 1369
217 Ga0075428_100000697 3300006844 Bacteria 34709
218 Ga0075430_100219420 3300006846 Bacteria 1578
219 Ga0075434_100062765 3300006871 Bacteria 3699
220 Ga0075429_100006131 3300006880 Bacteria 10392
221 Ga0068865_100000270 3300006881 Bacteria 28438
222 Ga0068865_100090604 3300006881 Unclassified 2218
223 Ga0097620_100000007 3300006931 Bacteria 390070
224 Ga0097620_100001558 3300006931 Bacteria 23386
225 Ga0097620_100028833 3300006931 Bacteria 5567
226 Ga0097620_100046340 3300006931 Bacteria 4366
227 Ga0097620_100087484 3300006931 Bacteria 3164
228 Ga0097620_100091906 3300006931 Bacteria 3086
229 Ga0097620_100122653 3300006931 Bacteria 2665
230 Ga0097620_100197791 3300006931 Bacteria 2094
231 Ga0097620_100205341 3300006931 Unclassified 2055
232 Ga0097620_100566013 3300006931 Bacteria 1230
233 Ga0099824_1018449 3300006942 Bacteria 5728
234 Ga0079104_1000271 3300006946 Bacteria 67895
235 Ga0099826_10001648 3300006948 Bacteria 13672
236 Ga0105240_10007181 3300009093 Bacteria 16222
237 Ga0105240_10009267 3300009093 Bacteria 13961
238 Ga0105240_10169854 3300009093 Bacteria 2584
239 Ga0105240_10205016 3300009093 Unclassified 2309
240 Ga0111539_10006077 3300009094 Bacteria 15590
241 Ga0111539_10236413 3300009094 Bacteria 2127
242 Ga0105247_10012726 3300009101 Bacteria 5049
243 Ga0105247_10072386 3300009101 Bacteria 2157
244 Ga0114129_10110174 3300009147 Bacteria 3800
245 Ga0105241_10000147 3300009174 Bacteria 50428
246 Ga0105241_10001335 3300009174 Bacteria 18732
247 Ga0105241_10016066 3300009174 Bacteria 5488
248 Ga0105241_10094160 3300009174 Bacteria 2368
249 Ga0105242_10025659 3300009176 Bacteria 4666
250 Ga0105242_10066533 3300009176 Bacteria 2976
251 Ga0105242_10071844 3300009176 Bacteria 2873
252 Ga0105242_10356068 3300009176 Bacteria 1353
253 Ga0105237_10001853 3300009545 Bacteria 27135
254 Ga0105237_10146102 3300009545 Bacteria 2360
255 Ga0105237_10270216 3300009545 Bacteria 1703
256 Ga0105249_10002091 3300009553 Bacteria 17312
257 Ga0105249_10029947 3300009553 Bacteria 4917
258 Ga0105249_10046883 3300009553 Bacteria 3935
259 Ga0105249_10255016 3300009553 Bacteria 1740
260 Ga0105249_10286814 3300009553 Bacteria 1646
261 Ga0105239_10000240 3300010375 Bacteria 81097
262 Ga0105239_10008674 3300010375 Bacteria 11515
263 Ga0105239_10694479 3300010375 Bacteria 1163
264 Ga0105239_10696851 3300010375 Bacteria 1161
265 Ga0105239_10868367 3300010375 Bacteria 1035
266 Ga0105246_10015172 3300011119 Bacteria 4860
267 Ga0105246_10033751 3300011119 Bacteria 3404
268 Ga0105246_10054852 3300011119 Unclassified 2748
269 Ga0105246_10114034 3300011119 Bacteria 1991
270 Ga0105246_10220100 3300011119 Bacteria 1488
271 Ga0157373_10000012 3300013100 Bacteria 188666
272 Ga0157373_10003271 3300013100 Bacteria 12236
273 Ga0157373_10083610 3300013100 Bacteria 2250
274 Ga0157371_10013452 3300013102 Bacteria 6213
275 Ga0157371_10029577 3300013102 Bacteria 3959
276 Ga0157371_10054414 3300013102 Bacteria 2842
277 Ga0157370_10000319 3300013104 Bacteria 60498
278 Ga0157370_10000549 3300013104 Bacteria 46792
279 Ga0157370_10006906 3300013104 Bacteria 12414
280 Ga0157370_10008707 3300013104 Bacteria 10919
281 Ga0157370_10012265 3300013104 Bacteria 8897
282 Ga0157370_10022264 3300013104 Bacteria 6306
283 Ga0157370_10131662 3300013104 Bacteria 2333
284 Ga0157370_10188098 3300013104 Bacteria 1917
285 Ga0157369_10009277 3300013105 Bacteria 11257
286 Ga0157369_10019067 3300013105 Bacteria 7680
287 Ga0157369_10114631 3300013105 Bacteria 2862
288 Ga0157369_10253642 3300013105 Bacteria 1836
289 Ga0157374_10003011 3300013296 Bacteria 14108
290 Ga0157374_10003032 3300013296 Bacteria 14074
291 Ga0157374_10005065 3300013296 Bacteria 11052
292 Ga0157374_10019854 3300013296 Bacteria 5956
293 Ga0157374_10021072 3300013296 Bacteria 5793
294 Ga0157374_10142237 3300013296 Bacteria 2329
295 Ga0157374_10326315 3300013296 Bacteria 1522
296 Ga0157378_10006187 3300013297 Bacteria 10471
297 Ga0157378_10012950 3300013297 Bacteria 7296
298 Ga0157378_10039467 3300013297 Bacteria 4187
299 Ga0157378_10100844 3300013297 Unclassified 2636
300 Ga0157378_10139763 3300013297 Bacteria 2248
301 Ga0157378_10271618 3300013297 Bacteria 1631
302 Ga0163162_10000406 3300013306 Bacteria 39456
303 Ga0163162_10004042 3300013306 Bacteria 14074
304 Ga0163162_10009348 3300013306 Bacteria 9533
305 Ga0163162_10012674 3300013306 Bacteria 8230
306 Ga0163162_10014865 3300013306 Bacteria 7601
307 Ga0163162_10040326 3300013306 Bacteria 4669
308 Ga0163162_10070766 3300013306 Bacteria 3540
309 Ga0163162_10119474 3300013306 Unclassified 2739
310 Ga0163162_10180192 3300013306 Bacteria 2239
311 Ga0163162_10275796 3300013306 Unclassified 1813
312 Ga0163162_10842777 3300013306 Bacteria 1032
313 Ga0157372_10002904 3300013307 Bacteria 18532
314 Ga0157372_10040228 3300013307 Bacteria 5162
315 Ga0157372_10047057 3300013307 Bacteria 4791
316 Ga0157372_10103231 3300013307 Bacteria 3257
317 Ga0157372_10126112 3300013307 Bacteria 2943
318 Ga0157372_10167412 3300013307 Bacteria 2542
319 Ga0157372_10248314 3300013307 Bacteria 2065
320 Ga0157372_10287337 3300013307 Bacteria 1913
321 Ga0157375_10000483 3300013308 Bacteria 36292
322 Ga0157375_10003520 3300013308 Bacteria 13581
323 Ga0157375_10009439 3300013308 Bacteria 8566
324 Ga0157375_10014733 3300013308 Bacteria 6987
325 Ga0157375_10038886 3300013308 Bacteria 4572
326 Ga0157375_10038922 3300013308 Bacteria 4570
327 Ga0157375_10065040 3300013308 Bacteria 3634
328 Ga0157375_10191858 3300013308 Bacteria 2198
329 Ga0157375_10350073 3300013308 Bacteria 1643
330 Ga0157375_10425604 3300013308 Bacteria 1494
331 Ga0163163_10000668 3300014325 Bacteria 29354
332 Ga0163163_10000814 3300014325 Bacteria 26541
333 Ga0163163_10003526 3300014325 Bacteria 13287
334 Ga0163163_10051366 3300014325 Bacteria 4065
335 Ga0163163_10112707 3300014325 Bacteria 2749
336 Ga0163163_10175721 3300014325 Bacteria 2188
337 Ga0163163_10189303 3300014325 Bacteria 2106
338 Ga0163163_10204283 3300014325 Bacteria 2024
339 Ga0157380_10023116 3300014326 Bacteria 4687
340 Ga0157380_10091802 3300014326 Unclassified 2508
341 Ga0157377_10010837 3300014745 Bacteria 4526
342 Ga0157377_10019341 3300014745 Bacteria 3557
343 Ga0157377_10028121 3300014745 Bacteria 3024
344 Ga0157379_10000784 3300014968 Bacteria 25788
345 Ga0157379_10022752 3300014968 Bacteria 5554
346 Ga0157379_10150942 3300014968 Bacteria 2096
347 Ga0157379_10261826 3300014968 Bacteria 1571
348 Ga0157376_10000353 3300014969 Bacteria 30588
349 Ga0157376_10003428 3300014969 Bacteria 10916
350 Ga0157376_10026021 3300014969 Bacteria 4617
351 Ga0157376_10027908 3300014969 Bacteria 4481
352 Ga0157376_10071914 3300014969 Bacteria 2941
353 Ga0157376_10090933 3300014969 Bacteria 2643
354 Ga0157376_10145283 3300014969 Bacteria 2133
355 Ga0157376_10322893 3300014969 Bacteria 1468
356 Ga0182006_1012778 3300015261 Bacteria 3666
357 Ga0182006_1038940 3300015261 Bacteria 1878
358 Ga0163161_10001881 3300017792 Bacteria 15314
359 Ga0163161_10004936 3300017792 Bacteria 9279
360 Ga0163161_10024983 3300017792 Bacteria 4224
361 Ga0163161_10150044 3300017792 Bacteria 1771
362 Ga0163161_10318761 3300017792 Bacteria 1228
363 Ga0213876_10003069 3300021384 Bacteria 9661
364 Ga0209258_100288 3300025242 Bacteria 82681
365 Ga0209646_1000005 3300025246 Bacteria 717627
366 Ga0209026_1000322 3300025250 Bacteria 50696
367 Ga0209148_1000269 3300025254 Bacteria 81695
368 Ga0209130_1008683 3300025284 Bacteria 2974
369 Ga0209758_1002054 3300025297 Bacteria 21540
370 Ga0209758_1006416 3300025297 Bacteria 8469
371 Ga0207426_1000189 3300025302 Bacteria 153457
372 Ga0207426_1000233 3300025302 Bacteria 127848
373 Ga0207426_1002647 3300025302 Bacteria 11036
374 Ga0207697_10018880 3300025315 Bacteria 2825
375 Ga0207656_10005441 3300025321 Bacteria 4501
376 Ga0207682_10011973 3300025893 Unclassified 3387
377 Ga0207682_10013516 3300025893 Bacteria 3181
378 Ga0207642_10065789 3300025899 Bacteria 1704
379 Ga0207710_10007460 3300025900 Bacteria 4631
380 Ga0207688_10037205 3300025901 Bacteria 2699
381 Ga0207688_10089788 3300025901 Bacteria 1763
382 Ga0207680_10000172 3300025903 Bacteria 31500
383 Ga0207680_10003430 3300025903 Bacteria 7474
384 Ga0207680_10258382 3300025903 Bacteria 1205
385 Ga0207647_10000530 3300025904 Bacteria 30443
386 Ga0207645_10000093 3300025907 Bacteria 64854
387 Ga0207645_10008578 3300025907 Bacteria 7120
388 Ga0207645_10010212 3300025907 Bacteria 6454
389 Ga0207645_10022768 3300025907 Bacteria 4073
390 Ga0207643_10012278 3300025908 Bacteria 4632
391 Ga0207643_10054452 3300025908 Unclassified 2274
392 Ga0207705_10135990 3300025909 Bacteria 1832
393 Ga0207654_10001168 3300025911 Bacteria 14087
394 Ga0207654_10002138 3300025911 Bacteria 10117
395 Ga0207654_10015092 3300025911 Bacteria 4000
396 Ga0207707_10000293 3300025912 Bacteria 53373
397 Ga0207695_10000010 3300025913 Bacteria 981919
398 Ga0207695_10028248 3300025913 Bacteria 6226
399 Ga0207695_10028466 3300025913 Bacteria 6196
400 Ga0207695_10125120 3300025913 Bacteria 2534
401 Ga0207695_10140001 3300025913 Bacteria 2369
402 Ga0207695_10324911 3300025913 Unclassified 1428
403 Ga0207671_10000126 3300025914 Bacteria 118967
404 Ga0207671_10002103 3300025914 Bacteria 21762
405 Ga0207671_10025114 3300025914 Bacteria 4476
406 Ga0207671_10236586 3300025914 Unclassified 1434
407 Ga0207660_10001044 3300025917 Bacteria 18326
408 Ga0207660_10144584 3300025917 Bacteria 1821
409 Ga0207662_10040491 3300025918 Bacteria 2739
410 Ga0207662_10274437 3300025918 Unclassified 1114
411 Ga0207657_10019421 3300025919 Bacteria 6454
412 Ga0207649_10050499 3300025920 Bacteria 2573
413 Ga0207652_10002374 3300025921 Bacteria 15916
414 Ga0207652_10020483 3300025921 Bacteria 5446
415 Ga0207681_10004037 3300025923 Bacteria 9105
416 Ga0207681_10010995 3300025923 Bacteria 5560
417 Ga0207681_10118875 3300025923 Bacteria 1935
418 Ga0207681_10148091 3300025923 Bacteria 1756
419 Ga0207681_10224965 3300025923 Unclassified 1453
420 Ga0207650_10002421 3300025925 Bacteria 12992
421 Ga0207650_10013718 3300025925 Bacteria 5617
422 Ga0207650_10076987 3300025925 Bacteria 2521
423 Ga0207659_10031409 3300025926 Bacteria 3635
424 Ga0207659_10051279 3300025926 Bacteria 2934
425 Ga0207659_10064248 3300025926 Bacteria 2655
426 Ga0207659_10161176 3300025926 Bacteria 1761
427 Ga0207687_10162063 3300025927 Bacteria 1717
428 Ga0207644_10025842 3300025931 Bacteria 4040
429 Ga0207644_10038744 3300025931 Bacteria 3360
430 Ga0207644_10144728 3300025931 Bacteria 1834
431 Ga0207706_10008178 3300025933 Bacteria 9650
432 Ga0207706_10009135 3300025933 Bacteria 9112
433 Ga0207706_10207399 3300025933 Bacteria 1718
434 Ga0207706_10223175 3300025933 Bacteria 1650
435 Ga0207706_10306801 3300025933 Bacteria 1382
436 Ga0207686_10001124 3300025934 Bacteria 15459
437 Ga0207686_10012741 3300025934 Bacteria 4631
438 Ga0207686_10130834 3300025934 Bacteria 1721
439 Ga0207670_10027994 3300025936 Bacteria 3571
440 Ga0207670_10033175 3300025936 Bacteria 3325
441 Ga0207670_10034096 3300025936 Unclassified 3286
442 Ga0207670_10172348 3300025936 Bacteria 1623
443 Ga0207670_10224949 3300025936 Bacteria 1438
444 Ga0207669_10048989 3300025937 Bacteria 2515
445 Ga0207669_10065229 3300025937 Bacteria 2258
446 Ga0207704_10005332 3300025938 Bacteria 5926
447 Ga0207704_10020901 3300025938 Bacteria 3474
448 Ga0207704_10383847 3300025938 Bacteria 1103
449 Ga0207691_10000012 3300025940 Bacteria 147942
450 Ga0207691_10003790 3300025940 Bacteria 14676
451 Ga0207691_10012726 3300025940 Bacteria 8060
452 Ga0207691_10064705 3300025940 Bacteria 3312
453 Ga0207691_10074203 3300025940 Bacteria 3068
454 Ga0207691_10075791 3300025940 Unclassified 3032
455 Ga0207691_10239591 3300025940 Bacteria 1568
456 Ga0207689_10001304 3300025942 Bacteria 24024
457 Ga0207689_10002620 3300025942 Bacteria 16648
458 Ga0207689_10003101 3300025942 Bacteria 15285
459 Ga0207689_10007834 3300025942 Bacteria 9337
460 Ga0207689_10011955 3300025942 Bacteria 7439
461 Ga0207689_10013056 3300025942 Bacteria 7093
462 Ga0207689_10071824 3300025942 Bacteria 2843
463 Ga0207661_10009997 3300025944 Bacteria 6818
464 Ga0207661_10137906 3300025944 Bacteria 2097
465 Ga0207679_10007257 3300025945 Bacteria 7023
466 Ga0207679_10418864 3300025945 Bacteria 1181
467 Ga0207667_10125681 3300025949 Bacteria 2642
468 Ga0207667_10301871 3300025949 Bacteria 1636
469 Ga0207667_10364332 3300025949 Bacteria 1474
470 Ga0207651_10001926 3300025960 Bacteria 9740
471 Ga0207651_10026736 3300025960 Bacteria 3611
472 Ga0207651_10028310 3300025960 Bacteria 3533
473 Ga0207651_10084514 3300025960 Unclassified 2299
474 Ga0207651_10145679 3300025960 Bacteria 1836
475 Ga0207651_10191634 3300025960 Unclassified 1631
476 Ga0207651_10370413 3300025960 Bacteria 1211
477 Ga0207712_10021930 3300025961 Bacteria 4198
478 Ga0207712_10036448 3300025961 Bacteria 3350
479 Ga0207712_10042977 3300025961 Bacteria 3115
480 Ga0207712_10119146 3300025961 Bacteria 1994
481 Ga0207668_10039622 3300025972 Bacteria 3173
482 Ga0207668_10085338 3300025972 Bacteria 2303
483 Ga0207668_10103528 3300025972 Bacteria 2120
484 Ga0207640_10206476 3300025981 Bacteria 1493
485 Ga0207658_10002697 3300025986 Bacteria 12818
486 Ga0207658_10014460 3300025986 Bacteria 5405
487 Ga0207658_10045476 3300025986 Bacteria 3200
488 Ga0207658_10066095 3300025986 Bacteria 2719
489 Ga0207658_10083654 3300025986 Bacteria 2453
490 Ga0207658_10094611 3300025986 Bacteria 2326
491 Ga0207658_10136906 3300025986 Bacteria 1976
492 Ga0207658_10237409 3300025986 Bacteria 1542
493 Ga0207677_10005962 3300026023 Bacteria 6636
494 Ga0207677_10008400 3300026023 Bacteria 5762
495 Ga0207677_10041915 3300026023 Bacteria 3030
496 Ga0207677_10137476 3300026023 Bacteria 1865
497 Ga0207703_10244506 3300026035 Bacteria 1614
498 Ga0207639_10009544 3300026041 Bacteria 6698
499 Ga0207639_10038404 3300026041 Bacteria 3561
500 Ga0207639_10106292 3300026041 Bacteria 2278
501 Ga0207708_10150620 3300026075 Unclassified 1831
502 Ga0207641_10000090 3300026088 Bacteria 127735
503 Ga0207641_10006270 3300026088 Bacteria 10057
504 Ga0207641_10018885 3300026088 Bacteria 5655
505 Ga0207641_10022878 3300026088 Bacteria 5148
506 Ga0207641_10046968 3300026088 Bacteria 3640
507 Ga0207641_10076769 3300026088 Bacteria 2889
508 Ga0207648_10002423 3300026089 Bacteria 20073
509 Ga0207648_10007046 3300026089 Bacteria 11110
510 Ga0207648_10010083 3300026089 Bacteria 8982
511 Ga0207648_10014891 3300026089 Bacteria 7169
512 Ga0207648_10037382 3300026089 Bacteria 4276
513 Ga0207648_10039420 3300026089 Bacteria 4155
514 Ga0207648_10045069 3300026089 Bacteria 3869
515 Ga0207648_10261809 3300026089 Unclassified 1543
516 Ga0207676_10002953 3300026095 Bacteria 12129
517 Ga0207676_10004398 3300026095 Bacteria 9968
518 Ga0207676_10106918 3300026095 Bacteria 2332
519 Ga0207676_10154686 3300026095 Bacteria 1979
520 Ga0207674_10008150 3300026116 Bacteria 12147
521 Ga0207674_10016068 3300026116 Bacteria 8199
522 Ga0207674_10061678 3300026116 Bacteria 3788
523 Ga0207674_10149606 3300026116 Bacteria 2292
524 Ga0207674_10211292 3300026116 Unclassified 1889
525 Ga0207674_10320438 3300026116 Bacteria 1499
526 Ga0207675_100000599 3300026118 Bacteria 35195
527 Ga0207675_100014459 3300026118 Bacteria 7358
528 Ga0207675_100040594 3300026118 Bacteria 4346
529 Ga0207675_100250545 3300026118 Unclassified 1714
530 Ga0207683_10011150 3300026121 Bacteria 7662
531 Ga0207683_10019343 3300026121 Bacteria 5815
532 Ga0207698_10082811 3300026142 Bacteria 2595
533 Ga0207698_10083806 3300026142 Bacteria 2581
534 Ga0207698_10101749 3300026142 Bacteria 2384
535 Ga0207698_10178782 3300026142 Bacteria 1877
536 Ga0209281_1000396 3300027111 Bacteria 67930
537 Ga0209489_115670 3300027361 Bacteria 4487
538 Ga0209282_1014230 3300027666 Bacteria 5065
539 Ga0268266_10156944 3300028379 Bacteria 2056
540 Ga0268265_10031497 3300028380 Bacteria 3830
541 Ga0268264_10001333 3300028381 Bacteria 23222
542 Ga0268264_10013877 3300028381 Bacteria 6625
543 Ga0268264_10024998 3300028381 Bacteria 4881
544 Ga0268264_10361866 3300028381 Bacteria 1384
545 Ga0265318_10006751 3300028577 Bacteria 5253
546 Ga0307517_10005589 3300028786 Bacteria 18886
547 Ga0307515_10000010 3300028794 Bacteria 651586
548 Ga0307515_10000078 3300028794 Bacteria 227988
549 Ga0265330_10000202 3300031235 Bacteria 46065
550 Ga0265332_10000426 3300031238 Bacteria 29736
551 Ga0265320_10045545 3300031240 Bacteria 2155
552 Ga0265329_10008872 3300031242 Bacteria 3788
553 Ga0265339_10029916 3300031249 Bacteria 3087
554 Ga0265339_10079097 3300031249 Bacteria 1740
555 Ga0265331_10003139 3300031250 Bacteria 10788
556 Ga0265331_10034036 3300031250 Bacteria 2516
557 Ga0265327_10000089 3300031251 Bacteria 197227
558 Ga0265327_10000099 3300031251 Bacteria 190474
559 Ga0265327_10000404 3300031251 Bacteria 80704
560 Ga0265327_10027616 3300031251 Bacteria 3262
561 Ga0265327_10069821 3300031251 Bacteria 1762
562 Ga0265316_10000084 3300031344 Bacteria 99744
563 Ga0307509_10059815 3300031507 Bacteria 4030
564 Ga0307509_10112909 3300031507 Bacteria 2716
565 Ga0307508_10142565 3300031616 Bacteria 2000
566 Ga0265314_10000076 3300031711 Bacteria 146266
567 Ga0265342_10000147 3300031712 Bacteria 79849
568 Ga0316576_10141436 3300031727 Bacteria 1812
569 Ga0307516_10002555 3300031730 Bacteria 24195
570 Ga0307405_10000001 3300031731 Bacteria 1731270
571 Ga0307413_10000054 3300031824 Bacteria 30198
572 Ga0307410_10030652 3300031852 Bacteria 3440
573 Ga0307410_10156448 3300031852 Unclassified 1703
574 Ga0307406_10000106 3300031901 Bacteria 48892
575 Ga0307412_10166082 3300031911 Bacteria 1646
576 Ga0307416_100005748 3300032002 Bacteria 7680
577 Ga0307414_10002930 3300032004 Bacteria 9021
578 Ga0307414_10106217 3300032004 Bacteria 2125
579 Ga0307414_10207491 3300032004 Bacteria 1599
580 Ga0307414_10221375 3300032004 Bacteria 1554
581 Ga0307411_10000005 3300032005 Bacteria 391311
582 Ga0373955_0055185 3300035172 Bacteria 2175
583 Ga0316574_0168967 3300035398 Bacteria 1408
584 Ga0373933_0014955 3300035724 Bacteria 4322
585 Ga0373937_0038820 3300036401 Bacteria 4339
586 Ga0395900_0018785 3300037418 Bacteria 7049
587 Ga0395900_0027165 3300037418 Bacteria 5861
588 Ga0395905_0001907 3300037471 Bacteria 24001
589 Ga0395905_0357381 3300037471 Bacteria 1353
590 Ga0395901_0140923 3300038443 Bacteria 2534
591 Ga0395901_0368452 3300038443 Bacteria 1480
592 Ga0436365_0741238 3300039437 Bacteria 21789
593 Ga0436365_0751285 3300039437 Bacteria 9848
594 Ga0436365_1685836 3300039437 Unclassified 1278
595 Ga0439447_001386 3300041407 Bacteria 8869
596 Ga0451837_0561395 3300041494 Bacteria 3969
597 Ga0439449_0045602 3300042007 Bacteria 1625
598 Ga0439457_001352 3300042014 Bacteria 7369
599 Ga0439457_007426 3300042014 Bacteria 2631
600 Ga0450898_012608 3300042134 Unclassified 1399
601 Ga0453683_0013816 3300044673 Bacteria 5253
602 Ga0453684_0213135 3300044712 Bacteria 2243
603 Ga0453684_0259456 3300044712 Bacteria 1991
604 Ga0453684_0267700 3300044712 Unclassified 1954
605 Ga0453684_0282375 3300044712 Bacteria 1893
606 Ga0451576_0023699 3300045051 Bacteria 6641
607 Ga0495627_000178 3300046453 Bacteria 72186
608 Ga0495650_0087018 3300046471 Bacteria 1195
609 Ga0495580_0083987 3300046472 Bacteria 2219
610 Ga0495606_0132101 3300046507 Bacteria 1483
611 Ga0495630_0006491 3300046517 Bacteria 8327
612 Ga0495643_0002422 3300046522 Bacteria 14827
613 Ga0495654_0000099 3300046530 Bacteria 98758
614 Ga0495654_0017069 3300046530 Bacteria 3822
615 Ga0495633_0000108 3300046558 Bacteria 111235
616 Ga0495633_0000575 3300046558 Bacteria 35732
617 Ga0495634_0090043 3300046642 Bacteria 1994
618 Ga0495625_0041275 3300046660 Bacteria 3359
619 Ga0495635_0071895 3300046663 Bacteria 2371
620 Ga0495657_0047599 3300046675 Bacteria 2898
621 Ga0495613_0303943 3300046689 Bacteria 1104
622 Ga0495670_0124777 3300046691 Bacteria 1339
623 Ga0495672_0021476 3300047320 Bacteria 4211
624 Ga0495672_0061382 3300047320 Bacteria 2167
625 Ga0495680_0147702 3300047322 Bacteria 1716
626 Ga0495684_0174299 3300047471 Bacteria 1597
627 Ga0495686_0000234 3300047472 Bacteria 101539
628 Ga0495686_0000982 3300047472 Bacteria 34919
629 Ga0495686_0035962 3300047472 Bacteria 3180
630 Ga0495686_0059901 3300047472 Bacteria 2368
631 Ga0495602_0161958 3300048088 Unclassified 1746
632 Ga0496101_0192286 3300048904 Bacteria 1575
633 Ga0496108_0146220 3300048911 Bacteria 2038
634 Ga0496109_0380319 3300048912 Unclassified 1334
635 Ga0496115_0219420 3300048918 Bacteria 1569
636 Ga0496125_0000443 3300048928 Bacteria 75675
637 Ga0496126_0020255 3300048929 Bacteria 6529
638 Ga0501031_0010511 3300049568 Bacteria 6027
639 Ga0501034_0000111 3300049571 Bacteria 150159
640 Ga0501034_0038786 3300049571 Bacteria 4825
641 Ga0501034_0059795 3300049571 Bacteria 3828
642 Ga0501036_0015334 3300049572 Bacteria 6400
643 Ga0501036_0023469 3300049572 Bacteria 5196
644 Ga0501037_0075137 3300049573 Bacteria 2455
645 Ga0501038_0010541 3300049574 Bacteria 8453
646 Ga0501038_0092826 3300049574 Bacteria 2527
647 Ga0501039_0012373 3300049575 Bacteria 6511
648 Ga0501043_0022411 3300049579 Bacteria 4954
649 Ga0501043_0031567 3300049579 Bacteria 4164
650 Ga0501046_0008958 3300049580 Bacteria 8689
651 Ga0501046_0085739 3300049580 Unclassified 2428
652 Ga0501047_0232674 3300049581 Bacteria 1696
653 Ga0501047_0266220 3300049581 Bacteria 1561
654 Ga0501047_0330409 3300049581 Unclassified 1363
655 Ga0501048_0281393 3300049582 Bacteria 1183
656 Ga0501070_0090647 3300049586 Bacteria 2530
657 Ga0501073_0013600 3300049589 Bacteria 5918
658 Ga0501074_0130420 3300049590 Bacteria 1798
659 Ga0501249_001601 3300049679 Bacteria 4630
660 Ga0501253_002620 3300049683 Bacteria 2049
661 Ga0501257_003920 3300049686 Bacteria 3226
662 Ga0501259_004807 3300049688 Bacteria 2142
663 Ga0501241_000212 3300049758 Bacteria 13175
664 Ga0501266_000015 3300049763 Bacteria 177219
665 Ga0501035_0020068 3300049822 Bacteria 6137
666 Ga0501035_0147749 3300049822 Bacteria 2041
667 Ga0501044_0031497 3300049823 Bacteria 5582
668 Ga0501044_0041619 3300049823 Bacteria 4783
669 Ga0501044_0112564 3300049823 Bacteria 2728
670 nmdc:mga05p37_115948_c1 3300050507 Bacteria 3292
671 nmdc:mga09592_11770_c1 3300050508 Bacteria 3723
672 nmdc:mga0qj67_151648_c1 3300050509 Bacteria 1880
673 nmdc:mga06r32_304937_c1 3300050510 Bacteria 1578
674 nmdc:mga08y16_23269_c1 3300050511 Bacteria 6542
675 nmdc:mga08y16_275626_c1 3300050511 Bacteria 1736
676 nmdc:mga08y16_6461_c1 3300050511 Bacteria 12298
677 Ga0495619_0097895 3300053085 Bacteria 1994
678 Ga0500641_0000594 3300053096 Bacteria 13048
679 Ga0500652_004401 3300053131 Bacteria 4362
680 Ga0500658_0000008 3300053134 Bacteria 273324
681 Ga0500559_0055747 3300053136 Bacteria 1753
682 Ga0500568_0011168 3300053139 Bacteria 4182
683 Ga0500622_0002110 3300053156 Bacteria 14814
684 Ga0500636_0044270 3300053177 Bacteria 2625
685 Ga0500611_000029 3300053727 Bacteria 89288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0075137 Ga0501037_0075137_1066_2082 278
2 3300049581 Ga0501047_0266220 Ga0501047_0266220_376_1392 278
3 3300003354 JGI25160J50197_1003902 JGI25160J50197_10039023 293
4 3300003771 Ga0055526_1038586 Ga0055526_10385861 293
5 3300003790 Ga0055528_1000403 Ga0055528_100040310 293
6 3300003791 Ga0055530_10000192 Ga0055530_100001924 293
7 3300005262 Ga0065165_1000471 Ga0065165_100047127 293
8 3300031730 Ga0307516_10002555 Ga0307516_1000255512 293
9 3300005467 Ga0070706_100457222 Ga0070706_1004572222 294
10 3300025297 Ga0209758_1006416 Ga0209758_10064167 294
11 3300013105 Ga0157369_10253642 Ga0157369_102536421 295
12 3300014969 Ga0157376_10071914 Ga0157376_100719144 295
13 3300025927 Ga0207687_10162063 Ga0207687_101620632 295
14 3300026041 Ga0207639_10106292 Ga0207639_101062922 295
15 3300046691 Ga0495670_0124777 Ga0495670_0124777_284_1246 295
16 3300048911 Ga0496108_0146220 Ga0496108_0146220_34_987 295
17 3300005347 Ga0070668_100000150 Ga0070668_1000001505 296
18 3300005367 Ga0070667_100004914 Ga0070667_1000049143 296
19 3300005457 Ga0070662_100008456 Ga0070662_1000084564 296
20 3300005459 Ga0068867_100003811 Ga0068867_1000038113 296
21 3300005548 Ga0070665_100004781 Ga0070665_1000047815 296
22 3300005618 Ga0068864_100000588 Ga0068864_10000058817 296
23 3300005841 Ga0068863_100007240 Ga0068863_1000072403 296
24 3300005843 Ga0068860_100075954 Ga0068860_1000759543 296
25 3300006237 Ga0097621_100040304 Ga0097621_1000403044 296
26 3300006358 Ga0068871_100001641 Ga0068871_10000164110 296
27 3300006881 Ga0068865_100000270 Ga0068865_1000002708 296
28 3300009093 Ga0105240_10169854 Ga0105240_101698543 296
29 3300009176 Ga0105242_10066533 Ga0105242_100665333 296
30 3300013296 Ga0157374_10005065 Ga0157374_100050653 296
31 3300013297 Ga0157378_10006187 Ga0157378_100061876 296
32 3300013306 Ga0163162_10012674 Ga0163162_100126745 296
33 3300013307 Ga0157372_10248314 Ga0157372_102483142 296
34 3300013308 Ga0157375_10003520 Ga0157375_1000352010 296
35 3300014325 Ga0163163_10003526 Ga0163163_100035265 296
36 3300014968 Ga0157379_10000784 Ga0157379_1000078414 296
37 3300014969 Ga0157376_10090933 Ga0157376_100909333 296
38 3300025321 Ga0207656_10005441 Ga0207656_100054413 296
39 3300025903 Ga0207680_10003430 Ga0207680_100034303 296
40 3300025907 Ga0207645_10008578 Ga0207645_100085784 296
41 3300025933 Ga0207706_10009135 Ga0207706_100091354 296
42 3300025938 Ga0207704_10005332 Ga0207704_100053323 296
43 3300025940 Ga0207691_10000012 Ga0207691_1000001211 296
44 3300025942 Ga0207689_10071824 Ga0207689_100718242 296
45 3300025960 Ga0207651_10001926 Ga0207651_100019267 296
46 3300025972 Ga0207668_10039622 Ga0207668_100396223 296
47 3300026041 Ga0207639_10038404 Ga0207639_100384043 296
48 3300026088 Ga0207641_10018885 Ga0207641_100188854 296
49 3300026089 Ga0207648_10007046 Ga0207648_1000704611 296
50 3300028381 Ga0268264_10013877 Ga0268264_100138776 296
51 3300031616 Ga0307508_10142565 Ga0307508_101425652 296
52 3300006353 Ga0075370_10050635 Ga0075370_100506352 297
53 3300009093 Ga0105240_10007181 Ga0105240_1000718112 297
54 3300017792 Ga0163161_10318761 Ga0163161_103187611 297
55 3300025913 Ga0207695_10140001 Ga0207695_101400012 297
56 3300031911 Ga0307412_10166082 Ga0307412_101660822 297
57 3300032004 Ga0307414_10207491 Ga0307414_102074912 297
58 3300032004 Ga0307414_10106217 Ga0307414_101062172 298
59 3300014969 Ga0157376_10027908 Ga0157376_100279084 299
60 3300031251 Ga0265327_10000404 Ga0265327_1000040413 299
61 3300032004 Ga0307414_10221375 Ga0307414_102213752 299
62 3300044673 Ga0453683_0013816 Ga0453683_0013816_4173_5120 299
63 3300044712 Ga0453684_0213135 Ga0453684_0213135_1085_2032 299
64 3300045051 Ga0451576_0023699 Ga0451576_0023699_5262_6209 299
65 3300046453 Ga0495627_000178 Ga0495627_000178_21346_22335 299
66 3300046530 Ga0495654_0000099 Ga0495654_0000099_52856_53845 299
67 3300046558 Ga0495633_0000108 Ga0495633_0000108_51726_52715 299
68 3300047472 Ga0495686_0000982 Ga0495686_0000982_12688_13677 299
69 3300049571 Ga0501034_0000111 Ga0501034_0000111_59024_59971 299
70 3300005843 Ga0068860_100385533 Ga0068860_1003855332 300
71 3300026089 Ga0207648_10039420 Ga0207648_100394203 300
72 3300028381 Ga0268264_10361866 Ga0268264_103618662 300
73 3300028786 Ga0307517_10005589 Ga0307517_100055898 300
74 3300035398 Ga0316574_0168967 Ga0316574_0168967_142_1083 300
75 3300047320 Ga0495672_0021476 Ga0495672_0021476_2994_3947 300
76 3300005578 Ga0068854_100227998 Ga0068854_1002279982 301
77 3300013102 Ga0157371_10013452 Ga0157371_100134525 301
78 3300025981 Ga0207640_10206476 Ga0207640_102064761 301
79 3300037418 Ga0395900_0027165 Ga0395900_0027165_3686_4645 301
80 3300037471 Ga0395905_0001907 Ga0395905_0001907_4791_5750 301
81 3300005331 Ga0070670_100020475 Ga0070670_1000204751 302
82 3300005338 Ga0068868_100024322 Ga0068868_1000243223 302
83 3300005355 Ga0070671_100040659 Ga0070671_1000406593 302
84 3300005466 Ga0070685_10138355 Ga0070685_101383552 302
85 3300005617 Ga0068859_100091904 Ga0068859_1000919043 302
86 3300005618 Ga0068864_100101111 Ga0068864_1001011113 302
87 3300005841 Ga0068863_100067546 Ga0068863_1000675463 302
88 3300005843 Ga0068860_100010583 Ga0068860_10001058312 302
89 3300006237 Ga0097621_100006407 Ga0097621_1000064072 302
90 3300006358 Ga0068871_100002754 Ga0068871_1000027544 302
91 3300006931 Ga0097620_100091906 Ga0097620_1000919063 302
92 3300013100 Ga0157373_10083610 Ga0157373_100836103 302
93 3300013296 Ga0157374_10021072 Ga0157374_100210723 302
94 3300013306 Ga0163162_10040326 Ga0163162_100403264 302
95 3300014325 Ga0163163_10189303 Ga0163163_101893033 302
96 3300014969 Ga0157376_10026021 Ga0157376_100260214 302
97 3300025925 Ga0207650_10013718 Ga0207650_100137187 302
98 3300025960 Ga0207651_10084514 Ga0207651_100845143 302
99 3300025986 Ga0207658_10002697 Ga0207658_100026973 302
100 3300026023 Ga0207677_10005962 Ga0207677_100059624 302
101 3300026088 Ga0207641_10046968 Ga0207641_100469684 302
102 3300031251 Ga0265327_10069821 Ga0265327_100698212 302
103 3300038443 Ga0395901_0368452 Ga0395901_0368452_297_1259 302
104 3300049683 Ga0501253_002620 Ga0501253_002620_46_1107 302
105 3300049686 Ga0501257_003920 Ga0501257_003920_1492_2553 302
106 3300049688 Ga0501259_004807 Ga0501259_004807_537_1598 302
107 3300003322 rootL2_10077208 rootL2_100772082 303
108 3300003322 rootL2_10198780 rootL2_101987802 303
109 3300013104 Ga0157370_10000319 Ga0157370_1000031958 303
110 3300013104 Ga0157370_10012265 Ga0157370_100122653 303
111 3300013104 Ga0157370_10131662 Ga0157370_101316623 303
112 3300013306 Ga0163162_10275796 Ga0163162_102757961 303
113 3300013307 Ga0157372_10167412 Ga0157372_101674122 303
114 3300025949 Ga0207667_10125681 Ga0207667_101256813 303
115 3300031251 Ga0265327_10000099 Ga0265327_10000099161 303
116 3300031901 Ga0307406_10000106 Ga0307406_1000010625 303
117 3300039437 Ga0436365_0741238 Ga0436365_0741238_1163_2122 303
118 3300041494 Ga0451837_0561395 Ga0451837_0561395_253_1194 303
119 3300046507 Ga0495606_0132101 Ga0495606_0132101_326_1264 303
120 3300046522 Ga0495643_0002422 Ga0495643_0002422_12311_13249 303
121 3300046530 Ga0495654_0017069 Ga0495654_0017069_993_1937 303
122 3300046660 Ga0495625_0041275 Ga0495625_0041275_817_1755 303
123 3300048918 Ga0496115_0219420 Ga0496115_0219420_248_1186 303
124 3300048928 Ga0496125_0000443 Ga0496125_0000443_40046_40984 303
125 3300048929 Ga0496126_0020255 Ga0496126_0020255_4338_5276 303
126 3300049572 Ga0501036_0015334 Ga0501036_0015334_4613_5563 303
127 3300049574 Ga0501038_0092826 Ga0501038_0092826_409_1359 303
128 3300049579 Ga0501043_0022411 Ga0501043_0022411_2701_3651 303
129 3300049580 Ga0501046_0008958 Ga0501046_0008958_4070_5020 303
130 3300049582 Ga0501048_0281393 Ga0501048_0281393_165_1115 303
131 3300049586 Ga0501070_0090647 Ga0501070_0090647_1011_1961 303
132 3300049589 Ga0501073_0013600 Ga0501073_0013600_4063_5013 303
133 3300049590 Ga0501074_0130420 Ga0501074_0130420_11_961 303
134 3300049823 Ga0501044_0031497 Ga0501044_0031497_428_1378 303
135 3300053096 Ga0500641_0000594 Ga0500641_0000594_4718_5656 303
136 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002142 304
137 3300003215 JGI25153J46596_10000442 JGI25153J46596_1000044210 304
138 3300003316 rootH1_10123138 rootH1_101231384 304
139 3300003320 rootH2_10177331 rootH2_101773313 304
140 3300005334 Ga0068869_100006120 Ga0068869_1000061203 304
141 3300005335 Ga0070666_10000197 Ga0070666_1000019710 304
142 3300005338 Ga0068868_100108663 Ga0068868_1001086633 304
143 3300005616 Ga0068852_100008988 Ga0068852_1000089883 304
144 3300005617 Ga0068859_100000007 Ga0068859_100000007222 304
145 3300005841 Ga0068863_100000444 Ga0068863_10000044443 304
146 3300005842 Ga0068858_100003038 Ga0068858_1000030382 304
147 3300005843 Ga0068860_100000661 Ga0068860_10000066137 304
148 3300006237 Ga0097621_100022094 Ga0097621_1000220941 304
149 3300006358 Ga0068871_100020767 Ga0068871_1000207674 304
150 3300006931 Ga0097620_100000007 Ga0097620_100000007223 304
151 3300006942 Ga0099824_1018449 Ga0099824_10184492 304
152 3300006948 Ga0099826_10001648 Ga0099826_100016484 304
153 3300009174 Ga0105241_10001335 Ga0105241_100013352 304
154 3300009176 Ga0105242_10356068 Ga0105242_103560682 304
155 3300009545 Ga0105237_10146102 Ga0105237_101461023 304
156 3300010375 Ga0105239_10868367 Ga0105239_108683671 304
157 3300011119 Ga0105246_10015172 Ga0105246_100151721 304
158 3300011119 Ga0105246_10033751 Ga0105246_100337514 304
159 3300013297 Ga0157378_10139763 Ga0157378_101397631 304
160 3300013306 Ga0163162_10000406 Ga0163162_1000040622 304
161 3300013307 Ga0157372_10002904 Ga0157372_1000290428 304
162 3300014968 Ga0157379_10022752 Ga0157379_100227525 304
163 3300025246 Ga0209646_1000005 Ga0209646_1000005235 304
164 3300025250 Ga0209026_1000322 Ga0209026_100032215 304
165 3300025297 Ga0209758_1002054 Ga0209758_10020549 304
166 3300025302 Ga0207426_1002647 Ga0207426_10026473 304
167 3300025903 Ga0207680_10000172 Ga0207680_1000017232 304
168 3300025911 Ga0207654_10001168 Ga0207654_100011684 304
169 3300025914 Ga0207671_10002103 Ga0207671_1000210313 304
170 3300025942 Ga0207689_10001304 Ga0207689_1000130412 304
171 3300025986 Ga0207658_10083654 Ga0207658_100836542 304
172 3300026088 Ga0207641_10000090 Ga0207641_1000009063 304
173 3300026116 Ga0207674_10211292 Ga0207674_102112922 304
174 3300026142 Ga0207698_10082811 Ga0207698_100828112 304
175 3300027361 Ga0209489_115670 Ga0209489_1156704 304
176 3300027666 Ga0209282_1014230 Ga0209282_10142303 304
177 3300028381 Ga0268264_10001333 Ga0268264_1000133320 304
178 3300031507 Ga0307509_10112909 Ga0307509_101129092 304
179 3300032002 Ga0307416_100005748 Ga0307416_1000057482 304
180 3300037418 Ga0395900_0018785 Ga0395900_0018785_5215_6156 304
181 3300042014 Ga0439457_007426 Ga0439457_007426_97_1050 304
182 3300042134 Ga0450898_012608 Ga0450898_012608_322_1275 304
183 3300053131 Ga0500652_004401 Ga0500652_004401_2166_3110 304
184 3300053139 Ga0500568_0011168 Ga0500568_0011168_1174_2118 304
185 3300002987 JGI25159J45721_1022740 JGI25159J45721_10227401 305
186 3300003320 rootH2_10072046 rootH2_100720465 305
187 3300005347 Ga0070668_100115603 Ga0070668_1001156032 305
188 3300005459 Ga0068867_100038807 Ga0068867_1000388072 305
189 3300005530 Ga0070679_100057004 Ga0070679_1000570043 305
190 3300006844 Ga0075428_100000697 Ga0075428_10000069727 305
191 3300010375 Ga0105239_10694479 Ga0105239_106944792 305
192 3300025284 Ga0209130_1008683 Ga0209130_10086832 305
193 3300025302 Ga0207426_1000233 Ga0207426_100023390 305
194 3300025907 Ga0207645_10022768 Ga0207645_100227684 305
195 3300025937 Ga0207669_10065229 Ga0207669_100652292 305
196 3300026089 Ga0207648_10002423 Ga0207648_100024236 305
197 3300026116 Ga0207674_10320438 Ga0207674_103204382 305
198 3300031852 Ga0307410_10156448 Ga0307410_101564482 305
199 3300039437 Ga0436365_1685836 Ga0436365_1685836_283_1227 305
200 3300005334 Ga0068869_100149228 Ga0068869_1001492281 306
201 3300005336 Ga0070680_100001463 Ga0070680_10000146314 306
202 3300005337 Ga0070682_100000746 Ga0070682_10000074616 306
203 3300005341 Ga0070691_10006228 Ga0070691_100062285 306
204 3300005458 Ga0070681_10011641 Ga0070681_100116412 306
205 3300005466 Ga0070685_10013579 Ga0070685_100135791 306
206 3300005471 Ga0070698_100013818 Ga0070698_1000138182 306
207 3300005530 Ga0070679_100004632 Ga0070679_1000046327 306
208 3300005539 Ga0068853_100006195 Ga0068853_1000061957 306
209 3300005547 Ga0070693_100002444 Ga0070693_1000024444 306
210 3300005616 Ga0068852_100208149 Ga0068852_1002081492 306
211 3300005616 Ga0068852_100599348 Ga0068852_1005993481 306
212 3300005617 Ga0068859_100197792 Ga0068859_1001977922 306
213 3300006931 Ga0097620_100197791 Ga0097620_1001977912 306
214 3300009093 Ga0105240_10009267 Ga0105240_100092674 306
215 3300009174 Ga0105241_10000147 Ga0105241_100001477 306
216 3300009176 Ga0105242_10025659 Ga0105242_100256592 306
217 3300009545 Ga0105237_10270216 Ga0105237_102702162 306
218 3300009553 Ga0105249_10046883 Ga0105249_100468832 306
219 3300009553 Ga0105249_10255016 Ga0105249_102550162 306
220 3300010375 Ga0105239_10000240 Ga0105239_100002402 306
221 3300013104 Ga0157370_10006906 Ga0157370_1000690611 306
222 3300013296 Ga0157374_10142237 Ga0157374_101422372 306
223 3300013306 Ga0163162_10004042 Ga0163162_100040425 306
224 3300013306 Ga0163162_10180192 Ga0163162_101801922 306
225 3300013308 Ga0157375_10038886 Ga0157375_100388864 306
226 3300013308 Ga0157375_10038922 Ga0157375_100389222 306
227 3300013308 Ga0157375_10191858 Ga0157375_101918581 306
228 3300014325 Ga0163163_10112707 Ga0163163_101127072 306
229 3300014325 Ga0163163_10204283 Ga0163163_102042832 306
230 3300017792 Ga0163161_10024983 Ga0163161_100249835 306
231 3300025911 Ga0207654_10002138 Ga0207654_100021388 306
232 3300025912 Ga0207707_10000293 Ga0207707_1000029348 306
233 3300025913 Ga0207695_10125120 Ga0207695_101251202 306
234 3300025917 Ga0207660_10001044 Ga0207660_1000104410 306
235 3300025921 Ga0207652_10002374 Ga0207652_100023749 306
236 3300025934 Ga0207686_10012741 Ga0207686_100127412 306
237 3300025936 Ga0207670_10172348 Ga0207670_101723483 306
238 3300025942 Ga0207689_10011955 Ga0207689_100119551 306
239 3300025961 Ga0207712_10042977 Ga0207712_100429774 306
240 3300025961 Ga0207712_10119146 Ga0207712_101191462 306
241 3300026041 Ga0207639_10009544 Ga0207639_100095442 306
242 3300026088 Ga0207641_10006270 Ga0207641_100062702 306
243 3300026088 Ga0207641_10076769 Ga0207641_100767691 306
244 3300026116 Ga0207674_10149606 Ga0207674_101496062 306
245 3300026142 Ga0207698_10101749 Ga0207698_101017492 306
246 3300026142 Ga0207698_10178782 Ga0207698_101787822 306
247 3300053156 Ga0500622_0002110 Ga0500622_0002110_13516_14451 306
248 3300003323 rootH1_10004531 rootH1_1000453117 307
249 3300005293 Ga0065715_10007518 Ga0065715_100075184 307
250 3300005329 Ga0070683_100013478 Ga0070683_1000134786 307
251 3300005331 Ga0070670_100059498 Ga0070670_1000594983 307
252 3300005334 Ga0068869_100112028 Ga0068869_1001120282 307
253 3300005335 Ga0070666_10010755 Ga0070666_100107554 307
254 3300005338 Ga0068868_100098293 Ga0068868_1000982931 307
255 3300005340 Ga0070689_100043322 Ga0070689_1000433223 307
256 3300005343 Ga0070687_100024252 Ga0070687_1000242524 307
257 3300005353 Ga0070669_100069874 Ga0070669_1000698741 307
258 3300005354 Ga0070675_100261920 Ga0070675_1002619201 307
259 3300005364 Ga0070673_100006938 Ga0070673_1000069384 307
260 3300005365 Ga0070688_100099885 Ga0070688_1000998852 307
261 3300005457 Ga0070662_100050949 Ga0070662_1000509491 307
262 3300005530 Ga0070679_100032240 Ga0070679_1000322404 307
263 3300005543 Ga0070672_100089337 Ga0070672_1000893374 307
264 3300005549 Ga0070704_100039067 Ga0070704_1000390672 307
265 3300005563 Ga0068855_100031076 Ga0068855_1000310763 307
266 3300005617 Ga0068859_100046339 Ga0068859_1000463392 307
267 3300005617 Ga0068859_100205340 Ga0068859_1002053402 307
268 3300005840 Ga0068870_10044741 Ga0068870_100447412 307
269 3300005842 Ga0068858_100429408 Ga0068858_1004294081 307
270 3300005844 Ga0068862_100184986 Ga0068862_1001849862 307
271 3300006237 Ga0097621_100178995 Ga0097621_1001789952 307
272 3300006881 Ga0068865_100090604 Ga0068865_1000906043 307
273 3300006931 Ga0097620_100046340 Ga0097620_1000463405 307
274 3300006931 Ga0097620_100205341 Ga0097620_1002053412 307
275 3300009176 Ga0105242_10071844 Ga0105242_100718443 307
276 3300009553 Ga0105249_10286814 Ga0105249_102868141 307
277 3300011119 Ga0105246_10220100 Ga0105246_102201001 307
278 3300013104 Ga0157370_10022264 Ga0157370_100222642 307
279 3300013308 Ga0157375_10425604 Ga0157375_104256041 307
280 3300017792 Ga0163161_10150044 Ga0163161_101500442 307
281 3300025918 Ga0207662_10040491 Ga0207662_100404914 307
282 3300025923 Ga0207681_10010995 Ga0207681_100109954 307
283 3300025923 Ga0207681_10224965 Ga0207681_102249651 307
284 3300025925 Ga0207650_10076987 Ga0207650_100769871 307
285 3300025926 Ga0207659_10031409 Ga0207659_100314093 307
286 3300025933 Ga0207706_10207399 Ga0207706_102073992 307
287 3300025934 Ga0207686_10001124 Ga0207686_1000112411 307
288 3300025936 Ga0207670_10034096 Ga0207670_100340963 307
289 3300025940 Ga0207691_10075791 Ga0207691_100757912 307
290 3300025942 Ga0207689_10013056 Ga0207689_100130562 307
291 3300025945 Ga0207679_10418864 Ga0207679_104188641 307
292 3300025949 Ga0207667_10364332 Ga0207667_103643322 307
293 3300025960 Ga0207651_10026736 Ga0207651_100267362 307
294 3300025960 Ga0207651_10370413 Ga0207651_103704131 307
295 3300025986 Ga0207658_10094611 Ga0207658_100946111 307
296 3300026023 Ga0207677_10041915 Ga0207677_100419152 307
297 3300047472 Ga0495686_0000234 Ga0495686_0000234_81323_82276 307
298 iso_pu_bacteria 2513020052 2513235504 307
299 iso_pu_bacteria 2519899754 2520878424 307
300 iso_pu_bacteria 2643221600 2644011828 307
301 iso_pu_bacteria 2643221667 2644370210 307
302 iso_pu_bacteria 2643221716 2644641949 307
303 iso_pu_bacteria 2643221725 2644685610 307
304 iso_pu_bacteria 2739367857 2740003350 307
305 iso_pu_bacteria 2739367858 2740008167 307
306 iso_pu_bacteria 2816332280 2817415449 307
307 iso_pu_bacteria 2818991442 2819571688 307
308 iso_pu_bacteria 2857613821 2857614217 307
309 iso_pu_bacteria 2857618242 2857619451 307
310 iso_pu_bacteria 2881359912 2881362274 307
311 iso_pu_bacteria 2884791551 2884797400 307
312 iso_pu_bacteria 2903895155 2903898225 307
313 iso_pu_bacteria 2904419702 2904424117 307
314 iso_pu_bacteria 2904467357 2904469532 307
315 iso_pu_bacteria 2919191525 2919193331 307
316 iso_pu_bacteria 2919509842 2919511000 307
317 iso_pu_bacteria 2919683626 2919686152 307
318 iso_pu_bacteria 2929150217 2929152683 307
319 iso_pu_bacteria 2958458903 2958462543 307
320 iso_pu_bacteria 2958512119 2958512794 307
321 iso_pu_bacteria 2965320100 2965323592 307
322 iso_pu_bacteria 8054307821 8054312022 307
323 iso_pu_bacteria 8055419101 8055421080 307
324 iso_pu_bacteria 8055592153 8055594506 307
325 3300003320 rootH2_10094093 rootH2_100940932 308
326 3300009101 Ga0105247_10012726 Ga0105247_100127263 308
327 3300025900 Ga0207710_10007460 Ga0207710_100074603 308
328 3300028577 Ga0265318_10006751 Ga0265318_100067515 308
329 3300031249 Ga0265339_10079097 Ga0265339_100790971 308
330 3300031250 Ga0265331_10003139 Ga0265331_100031392 308
331 3300048088 Ga0495602_0161958 Ga0495602_0161958_367_1323 308
332 iso_pu_bacteria 2818991460 2819677472 308
333 iso_pu_bacteria 2929177148 2929183544 308
334 iso_pu_bacteria 2929921140 2929927944 308
335 iso_pu_bacteria 2945977869 2945979508 308
336 iso_pu_bacteria 2946013367 2946014623 308
337 iso_pu_bacteria 8003151029 8003152433 308
338 3300005333 Ga0070677_10003773 Ga0070677_100037735 309
339 3300006846 Ga0075430_100219420 Ga0075430_1002194202 309
340 3300006880 Ga0075429_100006131 Ga0075429_1000061318 309
341 3300014326 Ga0157380_10091802 Ga0157380_100918022 309
342 3300025893 Ga0207682_10011973 Ga0207682_100119733 309
343 3300025908 Ga0207643_10054452 Ga0207643_100544522 309
344 3300025926 Ga0207659_10051279 Ga0207659_100512791 309
345 3300031235 Ga0265330_10000202 Ga0265330_100002022 309
346 3300031238 Ga0265332_10000426 Ga0265332_100004265 309
347 3300031240 Ga0265320_10045545 Ga0265320_100455452 309
348 3300031242 Ga0265329_10008872 Ga0265329_100088724 309
349 3300031249 Ga0265339_10029916 Ga0265339_100299163 309
350 3300031250 Ga0265331_10034036 Ga0265331_100340362 309
351 3300031344 Ga0265316_10000084 Ga0265316_1000008453 309
352 3300031711 Ga0265314_10000076 Ga0265314_1000007664 309
353 3300031712 Ga0265342_10000147 Ga0265342_1000014731 309
354 3300050508 nmdc:mga09592_11770_c1 nmdc:mga09592_11770_c1_1233_2186 309
355 3300050509 nmdc:mga0qj67_151648_c1 nmdc:mga0qj67_151648_c1_619_1572 309
356 3300050510 nmdc:mga06r32_304937_c1 nmdc:mga06r32_304937_c1_534_1487 309
357 3300031251 Ga0265327_10027616 Ga0265327_100276162 310
358 iso_pu_bacteria 2511231000 2511232194 310
359 iso_pu_bacteria 2582581281 2585155864 310
360 iso_pu_bacteria 2582581282 2585160212 310
361 iso_pu_bacteria 2582581873 2585425632 310
362 iso_pu_bacteria 2585428045 2587678253 310
363 iso_pu_bacteria 2585428115 2587942093 310
364 iso_pu_bacteria 2585428183 2588216080 310
365 iso_pu_bacteria 2588254255 2590602581 310
366 iso_pu_bacteria 2588254257 2590611006 310
367 iso_pu_bacteria 2739367874 2740061152 310
368 iso_pu_bacteria 2751185877 2753671691 310
369 iso_pu_bacteria 2772190705 2772606382 310
370 iso_pu_bacteria 2775506739 2775673685 310
371 iso_pu_bacteria 2881955468 2881956706 310
372 iso_pu_bacteria 2883068021 2883070619 310
373 iso_pu_bacteria 2984572630 2984575111 310
374 iso_pu_bacteria 2984606641 2984608562 310
375 3300003320 rootH2_10092365 rootH2_100923652 311
376 3300003322 rootL2_10060945 rootL2_100609452 311
377 3300003322 rootL2_10128079 rootL2_101280795 311
378 3300003762 Ga0055542_1002479 Ga0055542_10024792 311
379 3300005288 Ga0065714_10006385 Ga0065714_100063853 311
380 3300005289 Ga0065704_10088122 Ga0065704_100881224 311
381 3300005364 Ga0070673_100044198 Ga0070673_1000441985 311
382 3300005530 Ga0070679_100020771 Ga0070679_1000207714 311
383 3300005547 Ga0070693_100009879 Ga0070693_1000098794 311
384 3300005563 Ga0068855_100165265 Ga0068855_1001652652 311
385 3300005616 Ga0068852_100084002 Ga0068852_1000840022 311
386 3300005834 Ga0068851_10065936 Ga0068851_100659362 311
387 3300006946 Ga0079104_1000271 Ga0079104_100027155 311
388 3300013100 Ga0157373_10000012 Ga0157373_1000001299 311
389 3300013104 Ga0157370_10188098 Ga0157370_101880982 311
390 3300015261 Ga0182006_1012778 Ga0182006_10127784 311
391 3300015261 Ga0182006_1038940 Ga0182006_10389402 311
392 3300025242 Ga0209258_100288 Ga0209258_10028847 311
393 3300025254 Ga0209148_1000269 Ga0209148_100026946 311
394 3300025909 Ga0207705_10135990 Ga0207705_101359902 311
395 3300025921 Ga0207652_10020483 Ga0207652_100204832 311
396 3300025949 Ga0207667_10301871 Ga0207667_103018712 311
397 3300027111 Ga0209281_1000396 Ga0209281_100039653 311
398 3300031731 Ga0307405_10000001 Ga0307405_100000011296 311
399 3300031824 Ga0307413_10000054 Ga0307413_1000005427 311
400 3300032004 Ga0307414_10002930 Ga0307414_100029309 311
401 3300032005 Ga0307411_10000005 Ga0307411_10000005295 311
402 3300041407 Ga0439447_001386 Ga0439447_001386_4887_5831 311
403 3300042007 Ga0439449_0045602 Ga0439449_0045602_401_1336 311
404 3300046558 Ga0495633_0000575 Ga0495633_0000575_32629_33582 311
405 3300049679 Ga0501249_001601 Ga0501249_001601_1708_2652 311
406 3300049758 Ga0501241_000212 Ga0501241_000212_6166_7101 311
407 3300049763 Ga0501266_000015 Ga0501266_000015_116774_117718 311
408 3300049822 Ga0501035_0147749 Ga0501035_0147749_722_1669 311
409 3300053134 Ga0500658_0000008 Ga0500658_0000008_186228_187172 311
410 3300053136 Ga0500559_0055747 Ga0500559_0055747_554_1513 311
411 3300053177 Ga0500636_0044270 Ga0500636_0044270_934_1893 311
412 iso_pu_bacteria 2523533629 2524004828 311
413 iso_pu_bacteria 2840677318 2840678178 311
414 iso_pu_bacteria 2896085136 2896085996 311
415 iso_pu_bacteria 2896109856 2896115461 311
416 iso_pu_bacteria 2993372514 2993374370 311
417 iso_pu_bacteria 2993480792 2993481260 311
418 3300005331 Ga0070670_100256490 Ga0070670_1002564902 312
419 3300005353 Ga0070669_100151206 Ga0070669_1001512061 312
420 3300005355 Ga0070671_100027026 Ga0070671_1000270264 312
421 3300005356 Ga0070674_100058996 Ga0070674_1000589963 312
422 3300005367 Ga0070667_100039271 Ga0070667_1000392711 312
423 3300005530 Ga0070679_100049032 Ga0070679_1000490321 312
424 3300005539 Ga0068853_100124603 Ga0068853_1001246032 312
425 3300005577 Ga0068857_100538287 Ga0068857_1005382871 312
426 3300005614 Ga0068856_100007483 Ga0068856_1000074835 312
427 3300005615 Ga0070702_100006790 Ga0070702_1000067905 312
428 3300005617 Ga0068859_100001558 Ga0068859_10000155810 312
429 3300005617 Ga0068859_100087483 Ga0068859_1000874832 312
430 3300005618 Ga0068864_100276508 Ga0068864_1002765082 312
431 3300005834 Ga0068851_10009667 Ga0068851_100096672 312
432 3300005842 Ga0068858_100220572 Ga0068858_1002205721 312
433 3300005843 Ga0068860_100002053 Ga0068860_1000020534 312
434 3300005844 Ga0068862_100003587 Ga0068862_1000035879 312
435 3300006195 Ga0075366_10018368 Ga0075366_100183682 312
436 3300006931 Ga0097620_100001558 Ga0097620_10000155811 312
437 3300006931 Ga0097620_100087484 Ga0097620_1000874842 312
438 3300009174 Ga0105241_10016066 Ga0105241_100160662 312
439 3300013102 Ga0157371_10029577 Ga0157371_100295772 312
440 3300013104 Ga0157370_10000549 Ga0157370_1000054927 312
441 3300013105 Ga0157369_10019067 Ga0157369_100190676 312
442 3300013105 Ga0157369_10114631 Ga0157369_101146312 312
443 3300013297 Ga0157378_10271618 Ga0157378_102716181 312
444 3300013306 Ga0163162_10842777 Ga0163162_108427771 312
445 3300013307 Ga0157372_10040228 Ga0157372_100402282 312
446 3300013307 Ga0157372_10287337 Ga0157372_102873372 312
447 3300025901 Ga0207688_10089788 Ga0207688_100897881 312
448 3300025904 Ga0207647_10000530 Ga0207647_1000053015 312
449 3300025911 Ga0207654_10015092 Ga0207654_100150922 312
450 3300025913 Ga0207695_10028466 Ga0207695_100284665 312
451 3300025914 Ga0207671_10236586 Ga0207671_102365862 312
452 3300025923 Ga0207681_10148091 Ga0207681_101480911 312
453 3300025926 Ga0207659_10161176 Ga0207659_101611761 312
454 3300025931 Ga0207644_10025842 Ga0207644_100258422 312
455 3300025933 Ga0207706_10223175 Ga0207706_102231753 312
456 3300025934 Ga0207686_10130834 Ga0207686_101308341 312
457 3300025937 Ga0207669_10048989 Ga0207669_100489893 312
458 3300025960 Ga0207651_10145679 Ga0207651_101456791 312
459 3300025986 Ga0207658_10136906 Ga0207658_101369062 312
460 3300026095 Ga0207676_10154686 Ga0207676_101546862 312
461 3300026142 Ga0207698_10083806 Ga0207698_100838063 312
462 3300028380 Ga0268265_10031497 Ga0268265_100314972 312
463 3300028381 Ga0268264_10024998 Ga0268264_100249983 312
464 3300028794 Ga0307515_10000010 Ga0307515_10000010429 312
465 3300038443 Ga0395901_0140923 Ga0395901_0140923_1483_2454 312
466 3300044712 Ga0453684_0267700 Ga0453684_0267700_348_1319 312
467 3300047472 Ga0495686_0035962 Ga0495686_0035962_1164_2108 312
468 3300049581 Ga0501047_0232674 Ga0501047_0232674_128_1072 312
469 3300049823 Ga0501044_0112564 Ga0501044_0112564_1099_2043 312
470 3300050511 nmdc:mga08y16_23269_c1 nmdc:mga08y16_23269_c1_494_1441 312
471 3300003203 JGI25406J46586_10000469 JGI25406J46586_100004694 313
472 3300005329 Ga0070683_100013297 Ga0070683_1000132974 313
473 3300005330 Ga0070690_100076768 Ga0070690_1000767682 313
474 3300005331 Ga0070670_100275100 Ga0070670_1002751001 313
475 3300005334 Ga0068869_100009276 Ga0068869_1000092769 313
476 3300005334 Ga0068869_100011552 Ga0068869_1000115522 313
477 3300005334 Ga0068869_100049809 Ga0068869_1000498094 313
478 3300005338 Ga0068868_100001462 Ga0068868_1000014624 313
479 3300005338 Ga0068868_100015057 Ga0068868_1000150572 313
480 3300005338 Ga0068868_100085227 Ga0068868_1000852272 313
481 3300005340 Ga0070689_100101410 Ga0070689_1001014101 313
482 3300005344 Ga0070661_100048542 Ga0070661_1000485422 313
483 3300005353 Ga0070669_100340567 Ga0070669_1003405671 313
484 3300005354 Ga0070675_100107298 Ga0070675_1001072982 313
485 3300005354 Ga0070675_100126933 Ga0070675_1001269333 313
486 3300005355 Ga0070671_100015192 Ga0070671_1000151924 313
487 3300005364 Ga0070673_100053086 Ga0070673_1000530863 313
488 3300005364 Ga0070673_100065753 Ga0070673_1000657533 313
489 3300005365 Ga0070688_100078843 Ga0070688_1000788433 313
490 3300005367 Ga0070667_100070666 Ga0070667_1000706663 313
491 3300005456 Ga0070678_100019430 Ga0070678_1000194303 313
492 3300005457 Ga0070662_100027946 Ga0070662_1000279464 313
493 3300005457 Ga0070662_100069735 Ga0070662_1000697352 313
494 3300005457 Ga0070662_100277653 Ga0070662_1002776531 313
495 3300005459 Ga0068867_100172879 Ga0068867_1001728791 313
496 3300005530 Ga0070679_100089190 Ga0070679_1000891901 313
497 3300005535 Ga0070684_100012410 Ga0070684_1000124104 313
498 3300005535 Ga0070684_100341933 Ga0070684_1003419332 313
499 3300005543 Ga0070672_100026671 Ga0070672_1000266712 313
500 3300005544 Ga0070686_100023936 Ga0070686_1000239364 313
501 3300005548 Ga0070665_100152673 Ga0070665_1001526732 313
502 3300005564 Ga0070664_100007054 Ga0070664_1000070549 313
503 3300005564 Ga0070664_100051981 Ga0070664_1000519813 313
504 3300005577 Ga0068857_100154255 Ga0068857_1001542552 313
505 3300005617 Ga0068859_100565995 Ga0068859_1005659951 313
506 3300005618 Ga0068864_100015735 Ga0068864_1000157356 313
507 3300005842 Ga0068858_100125108 Ga0068858_1001251083 313
508 3300005985 Ga0081539_10000345 Ga0081539_1000034529 313
509 3300005985 Ga0081539_10039312 Ga0081539_100393122 313
510 3300006871 Ga0075434_100062765 Ga0075434_1000627655 313
511 3300006931 Ga0097620_100566013 Ga0097620_1005660131 313
512 3300009093 Ga0105240_10205016 Ga0105240_102050162 313
513 3300009101 Ga0105247_10072386 Ga0105247_100723863 313
514 3300009174 Ga0105241_10094160 Ga0105241_100941602 313
515 3300011119 Ga0105246_10114034 Ga0105246_101140342 313
516 3300013296 Ga0157374_10003011 Ga0157374_1000301111 313
517 3300013296 Ga0157374_10003032 Ga0157374_1000303213 313
518 3300013297 Ga0157378_10039467 Ga0157378_100394674 313
519 3300013297 Ga0157378_10100844 Ga0157378_101008442 313
520 3300013306 Ga0163162_10009348 Ga0163162_100093484 313
521 3300013306 Ga0163162_10119474 Ga0163162_101194742 313
522 3300013308 Ga0157375_10014733 Ga0157375_100147339 313
523 3300013308 Ga0157375_10065040 Ga0157375_100650403 313
524 3300014325 Ga0163163_10000668 Ga0163163_1000066813 313
525 3300014325 Ga0163163_10000814 Ga0163163_1000081415 313
526 3300014325 Ga0163163_10051366 Ga0163163_100513665 313
527 3300014745 Ga0157377_10028121 Ga0157377_100281212 313
528 3300014968 Ga0157379_10261826 Ga0157379_102618262 313
529 3300014969 Ga0157376_10003428 Ga0157376_1000342812 313
530 3300014969 Ga0157376_10322893 Ga0157376_103228931 313
531 3300017792 Ga0163161_10004936 Ga0163161_1000493610 313
532 3300025302 Ga0207426_1000189 Ga0207426_100018980 313
533 3300025907 Ga0207645_10010212 Ga0207645_100102122 313
534 3300025913 Ga0207695_10000010 Ga0207695_10000010238 313
535 3300025913 Ga0207695_10324911 Ga0207695_103249112 313
536 3300025918 Ga0207662_10274437 Ga0207662_102744371 313
537 3300025926 Ga0207659_10064248 Ga0207659_100642483 313
538 3300025931 Ga0207644_10038744 Ga0207644_100387445 313
539 3300025931 Ga0207644_10144728 Ga0207644_101447282 313
540 3300025933 Ga0207706_10008178 Ga0207706_100081782 313
541 3300025936 Ga0207670_10027994 Ga0207670_100279944 313
542 3300025936 Ga0207670_10224949 Ga0207670_102249492 313
543 3300025940 Ga0207691_10012726 Ga0207691_100127268 313
544 3300025940 Ga0207691_10074203 Ga0207691_100742032 313
545 3300025942 Ga0207689_10002620 Ga0207689_100026208 313
546 3300025942 Ga0207689_10003101 Ga0207689_1000310110 313
547 3300025942 Ga0207689_10007834 Ga0207689_100078342 313
548 3300025944 Ga0207661_10009997 Ga0207661_100099973 313
549 3300025944 Ga0207661_10137906 Ga0207661_101379062 313
550 3300025945 Ga0207679_10007257 Ga0207679_100072576 313
551 3300025960 Ga0207651_10028310 Ga0207651_100283103 313
552 3300025960 Ga0207651_10191634 Ga0207651_101916342 313
553 3300025986 Ga0207658_10014460 Ga0207658_100144604 313
554 3300025986 Ga0207658_10237409 Ga0207658_102374092 313
555 3300026023 Ga0207677_10008400 Ga0207677_100084001 313
556 3300026023 Ga0207677_10137476 Ga0207677_101374761 313
557 3300026035 Ga0207703_10244506 Ga0207703_102445062 313
558 3300026075 Ga0207708_10150620 Ga0207708_101506202 313
559 3300026089 Ga0207648_10014891 Ga0207648_100148911 313
560 3300026089 Ga0207648_10261809 Ga0207648_102618092 313
561 3300026095 Ga0207676_10004398 Ga0207676_100043987 313
562 3300026116 Ga0207674_10008150 Ga0207674_100081502 313
563 3300026118 Ga0207675_100250545 Ga0207675_1002505452 313
564 3300026121 Ga0207683_10019343 Ga0207683_100193434 313
565 3300028379 Ga0268266_10156944 Ga0268266_101569442 313
566 3300031727 Ga0316576_10141436 Ga0316576_101414362 313
567 3300035172 Ga0373955_0055185 Ga0373955_0055185_462_1412 313
568 3300035724 Ga0373933_0014955 Ga0373933_0014955_1605_2555 313
569 3300036401 Ga0373937_0038820 Ga0373937_0038820_1215_2177 313
570 3300037471 Ga0395905_0357381 Ga0395905_0357381_107_1048 313
571 3300044712 Ga0453684_0282375 Ga0453684_0282375_292_1242 313
572 3300046472 Ga0495580_0083987 Ga0495580_0083987_301_1251 313
573 3300046517 Ga0495630_0006491 Ga0495630_0006491_7102_8052 313
574 3300046642 Ga0495634_0090043 Ga0495634_0090043_552_1502 313
575 3300046663 Ga0495635_0071895 Ga0495635_0071895_276_1226 313
576 3300046675 Ga0495657_0047599 Ga0495657_0047599_801_1751 313
577 3300046689 Ga0495613_0303943 Ga0495613_0303943_63_1013 313
578 3300047322 Ga0495680_0147702 Ga0495680_0147702_349_1299 313
579 3300047471 Ga0495684_0174299 Ga0495684_0174299_390_1340 313
580 3300048912 Ga0496109_0380319 Ga0496109_0380319_168_1118 313
581 3300049571 Ga0501034_0038786 Ga0501034_0038786_1125_2075 313
582 3300049571 Ga0501034_0059795 Ga0501034_0059795_1369_2319 313
583 3300053085 Ga0495619_0097895 Ga0495619_0097895_245_1195 313
584 iso_pu_bacteria 2728369107 2729202850 313
585 2162886007 SwRhRL2b_contig_222865 SwRhRL2b_0931.00006410 314
586 3300002459 JGI24751J29686_10000969 JGI24751J29686_100009692 314
587 3300003322 rootL2_10070185 rootL2_100701853 314
588 3300003323 rootH1_10047386 rootH1_100473864 314
589 3300003323 rootH1_10118920 rootH1_101189202 314
590 3300005327 Ga0070658_10055020 Ga0070658_100550203 314
591 3300005328 Ga0070676_10052308 Ga0070676_100523081 314
592 3300005329 Ga0070683_100269621 Ga0070683_1002696211 314
593 3300005331 Ga0070670_100071414 Ga0070670_1000714142 314
594 3300005331 Ga0070670_100113482 Ga0070670_1001134823 314
595 3300005336 Ga0070680_100139213 Ga0070680_1001392132 314
596 3300005337 Ga0070682_100004192 Ga0070682_1000041923 314
597 3300005337 Ga0070682_100013593 Ga0070682_1000135932 314
598 3300005338 Ga0068868_100034198 Ga0068868_1000341982 314
599 3300005340 Ga0070689_100033464 Ga0070689_1000334644 314
600 3300005343 Ga0070687_100023187 Ga0070687_1000231874 314
601 3300005347 Ga0070668_100240828 Ga0070668_1002408282 314
602 3300005347 Ga0070668_100303312 Ga0070668_1003033121 314
603 3300005353 Ga0070669_100000684 Ga0070669_10000068412 314
604 3300005353 Ga0070669_100085461 Ga0070669_1000854613 314
605 3300005353 Ga0070669_100354542 Ga0070669_1003545421 314
606 3300005354 Ga0070675_100226505 Ga0070675_1002265052 314
607 3300005355 Ga0070671_100000785 Ga0070671_10000078511 314
608 3300005356 Ga0070674_100128892 Ga0070674_1001288922 314
609 3300005364 Ga0070673_100002484 Ga0070673_10000248411 314
610 3300005364 Ga0070673_100083385 Ga0070673_1000833853 314
611 3300005365 Ga0070688_100037591 Ga0070688_1000375914 314
612 3300005367 Ga0070667_100051810 Ga0070667_1000518101 314
613 3300005367 Ga0070667_100076000 Ga0070667_1000760001 314
614 3300005438 Ga0070701_10236176 Ga0070701_102361761 314
615 3300005457 Ga0070662_100403945 Ga0070662_1004039451 314
616 3300005459 Ga0068867_100134851 Ga0068867_1001348513 314
617 3300005466 Ga0070685_10253404 Ga0070685_102534042 314
618 3300005471 Ga0070698_100001014 Ga0070698_10000101410 314
619 3300005518 Ga0070699_100043816 Ga0070699_1000438162 314
620 3300005535 Ga0070684_100061961 Ga0070684_1000619612 314
621 3300005539 Ga0068853_100038073 Ga0068853_1000380733 314
622 3300005539 Ga0068853_100049243 Ga0068853_1000492433 314
623 3300005543 Ga0070672_100199240 Ga0070672_1001992401 314
624 3300005544 Ga0070686_100079835 Ga0070686_1000798353 314
625 3300005564 Ga0070664_100016373 Ga0070664_1000163735 314
626 3300005577 Ga0068857_100442631 Ga0068857_1004426311 314
627 3300005617 Ga0068859_100028833 Ga0068859_1000288336 314
628 3300005617 Ga0068859_100122650 Ga0068859_1001226502 314
629 3300005618 Ga0068864_100104636 Ga0068864_1001046363 314
630 3300005719 Ga0068861_100008331 Ga0068861_1000083315 314
631 3300005719 Ga0068861_100106090 Ga0068861_1001060902 314
632 3300005719 Ga0068861_100450809 Ga0068861_1004508092 314
633 3300005834 Ga0068851_10055112 Ga0068851_100551121 314
634 3300005840 Ga0068870_10005271 Ga0068870_100052714 314
635 3300005841 Ga0068863_100021443 Ga0068863_1000214433 314
636 3300005844 Ga0068862_100002714 Ga0068862_10000271414 314
637 3300006237 Ga0097621_100000250 Ga0097621_10000025014 314
638 3300006237 Ga0097621_100017391 Ga0097621_1000173913 314
639 3300006237 Ga0097621_100136371 Ga0097621_1001363712 314
640 3300006358 Ga0068871_100007063 Ga0068871_1000070634 314
641 3300006358 Ga0068871_100025073 Ga0068871_10002507310 314
642 3300006358 Ga0068871_100318460 Ga0068871_1003184601 314
643 3300006931 Ga0097620_100028833 Ga0097620_1000288333 314
644 3300006931 Ga0097620_100122653 Ga0097620_1001226532 314
645 3300009094 Ga0111539_10006077 Ga0111539_100060773 314
646 3300009094 Ga0111539_10236413 Ga0111539_102364133 314
647 3300009147 Ga0114129_10110174 Ga0114129_101101743 314
648 3300009545 Ga0105237_10001853 Ga0105237_1000185312 314
649 3300009553 Ga0105249_10002091 Ga0105249_1000209110 314
650 3300009553 Ga0105249_10029947 Ga0105249_100299474 314
651 3300010375 Ga0105239_10008674 Ga0105239_100086744 314
652 3300010375 Ga0105239_10696851 Ga0105239_106968512 314
653 3300011119 Ga0105246_10054852 Ga0105246_100548522 314
654 3300013100 Ga0157373_10003271 Ga0157373_1000327114 314
655 3300013102 Ga0157371_10054414 Ga0157371_100544142 314
656 3300013104 Ga0157370_10008707 Ga0157370_100087078 314
657 3300013105 Ga0157369_10009277 Ga0157369_1000927713 314
658 3300013296 Ga0157374_10019854 Ga0157374_100198543 314
659 3300013296 Ga0157374_10326315 Ga0157374_103263152 314
660 3300013297 Ga0157378_10012950 Ga0157378_100129507 314
661 3300013306 Ga0163162_10014865 Ga0163162_100148657 314
662 3300013306 Ga0163162_10070766 Ga0163162_100707663 314
663 3300013307 Ga0157372_10047057 Ga0157372_100470575 314
664 3300013307 Ga0157372_10103231 Ga0157372_101032313 314
665 3300013307 Ga0157372_10126112 Ga0157372_101261123 314
666 3300013308 Ga0157375_10000483 Ga0157375_1000048317 314
667 3300013308 Ga0157375_10009439 Ga0157375_100094391 314
668 3300013308 Ga0157375_10350073 Ga0157375_103500731 314
669 3300014325 Ga0163163_10175721 Ga0163163_101757212 314
670 3300014326 Ga0157380_10023116 Ga0157380_100231164 314
671 3300014745 Ga0157377_10010837 Ga0157377_100108374 314
672 3300014745 Ga0157377_10019341 Ga0157377_100193413 314
673 3300014968 Ga0157379_10150942 Ga0157379_101509422 314
674 3300014969 Ga0157376_10000353 Ga0157376_100003538 314
675 3300014969 Ga0157376_10145283 Ga0157376_101452833 314
676 3300017792 Ga0163161_10001881 Ga0163161_1000188115 314
677 3300021384 Ga0213876_10003069 Ga0213876_100030694 314
678 3300025315 Ga0207697_10018880 Ga0207697_100188801 314
679 3300025893 Ga0207682_10013516 Ga0207682_100135163 314
680 3300025899 Ga0207642_10065789 Ga0207642_100657894 314
681 3300025901 Ga0207688_10037205 Ga0207688_100372055 314
682 3300025903 Ga0207680_10258382 Ga0207680_102583821 314
683 3300025907 Ga0207645_10000093 Ga0207645_100000934 314
684 3300025908 Ga0207643_10012278 Ga0207643_100122781 314
685 3300025913 Ga0207695_10028248 Ga0207695_100282486 314
686 3300025914 Ga0207671_10000126 Ga0207671_1000012641 314
687 3300025914 Ga0207671_10025114 Ga0207671_100251144 314
688 3300025917 Ga0207660_10144584 Ga0207660_101445842 314
689 3300025919 Ga0207657_10019421 Ga0207657_100194214 314
690 3300025920 Ga0207649_10050499 Ga0207649_100504993 314
691 3300025923 Ga0207681_10004037 Ga0207681_100040378 314
692 3300025923 Ga0207681_10118875 Ga0207681_101188752 314
693 3300025925 Ga0207650_10002421 Ga0207650_1000242113 314
694 3300025933 Ga0207706_10306801 Ga0207706_103068012 314
695 3300025936 Ga0207670_10033175 Ga0207670_100331753 314
696 3300025938 Ga0207704_10020901 Ga0207704_100209015 314
697 3300025938 Ga0207704_10383847 Ga0207704_103838471 314
698 3300025940 Ga0207691_10003790 Ga0207691_100037904 314
699 3300025940 Ga0207691_10064705 Ga0207691_100647054 314
700 3300025940 Ga0207691_10239591 Ga0207691_102395911 314
701 3300025961 Ga0207712_10021930 Ga0207712_100219304 314
702 3300025961 Ga0207712_10036448 Ga0207712_100364484 314
703 3300025972 Ga0207668_10085338 Ga0207668_100853384 314
704 3300025972 Ga0207668_10103528 Ga0207668_101035281 314
705 3300025986 Ga0207658_10045476 Ga0207658_100454763 314
706 3300025986 Ga0207658_10066095 Ga0207658_100660954 314
707 3300026088 Ga0207641_10022878 Ga0207641_100228783 314
708 3300026089 Ga0207648_10010083 Ga0207648_100100835 314
709 3300026089 Ga0207648_10037382 Ga0207648_100373823 314
710 3300026089 Ga0207648_10045069 Ga0207648_100450692 314
711 3300026095 Ga0207676_10002953 Ga0207676_100029534 314
712 3300026095 Ga0207676_10106918 Ga0207676_101069182 314
713 3300026116 Ga0207674_10016068 Ga0207674_100160682 314
714 3300026116 Ga0207674_10061678 Ga0207674_100616782 314
715 3300026118 Ga0207675_100000599 Ga0207675_1000005994 314
716 3300026118 Ga0207675_100014459 Ga0207675_1000144594 314
717 3300026118 Ga0207675_100040594 Ga0207675_1000405944 314
718 3300026121 Ga0207683_10011150 Ga0207683_100111506 314
719 3300028794 Ga0307515_10000078 Ga0307515_10000078135 314
720 3300031251 Ga0265327_10000089 Ga0265327_1000008972 314
721 3300031507 Ga0307509_10059815 Ga0307509_100598152 314
722 3300031852 Ga0307410_10030652 Ga0307410_100306523 314
723 3300039437 Ga0436365_0751285 Ga0436365_0751285_3671_4621 314
724 3300042014 Ga0439457_001352 Ga0439457_001352_5402_6430 314
725 3300044712 Ga0453684_0259456 Ga0453684_0259456_758_1759 314
726 3300046471 Ga0495650_0087018 Ga0495650_0087018_117_1070 314
727 3300047320 Ga0495672_0061382 Ga0495672_0061382_628_1581 314
728 3300047472 Ga0495686_0059901 Ga0495686_0059901_1050_2003 314
729 3300048904 Ga0496101_0192286 Ga0496101_0192286_486_1433 314
730 3300049568 Ga0501031_0010511 Ga0501031_0010511_4342_5295 314
731 3300049572 Ga0501036_0023469 Ga0501036_0023469_4057_5010 314
732 3300049574 Ga0501038_0010541 Ga0501038_0010541_2218_3171 314
733 3300049575 Ga0501039_0012373 Ga0501039_0012373_3473_4426 314
734 3300049579 Ga0501043_0031567 Ga0501043_0031567_3171_4124 314
735 3300049580 Ga0501046_0085739 Ga0501046_0085739_373_1326 314
736 3300049581 Ga0501047_0330409 Ga0501047_0330409_373_1326 314
737 3300049822 Ga0501035_0020068 Ga0501035_0020068_671_1624 314
738 3300049823 Ga0501044_0041619 Ga0501044_0041619_3091_4044 314
739 3300050507 nmdc:mga05p37_115948_c1 nmdc:mga05p37_115948_c1_691_1644 314
740 3300050511 nmdc:mga08y16_275626_c1 nmdc:mga08y16_275626_c1_226_1176 314
741 3300050511 nmdc:mga08y16_6461_c1 nmdc:mga08y16_6461_c1_10717_11670 314
742 3300053727 Ga0500611_000029 Ga0500611_000029_25265_26218 314
743 iso_pu_bacteria 2818991444 2819589920 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

60

359

0.95

PF01070

FMN_dh

FMN-dependent dehydrogenase

137

270

0.88

PF05690

ThiG

Thiazole biosynthesis protein ThiG

147

282

0.82

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

36

269

0.8

PF01207

Dus

Dihydrouridine synthase (Dus)

172

321

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iql-assembly1.cif.gz_B crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors nadph and fmn 0.9789 4 314
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.9759 3 312
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.9736 3 312
7l00-assembly1.cif.gz_A crystal structure of c. difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.9714 5 308
2z6j-assembly1.cif.gz_B crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.9689 3 312
ID Description Score Start End Superfamily
af_A4I9N1_3_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9816 4 313 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9759 3 312 3.20.20.70
af_A4I9N1_3_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9692 4 313 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9564 3 312 3.20.20.70
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9534 3 313 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q5Y4I8-F1-model_v4 deleted 1.002 3 121
AF-A0A258JPQ4-F1-model_v4 Nitronate monooxygenase 1.001 4 143 GO:0018580
AF-A0A359MMT9-F1-model_v4 deleted 0.9989 22 112
AF-A0A4Q5W4L1-F1-model_v4 deleted 0.9982 153 310
AF-A0A3D3PJU3-F1-model_v4 Nitronate monooxygenase 0.9955 4 101 GO:0018580

Feature Viewer

pLDDT pTM Quality
96.07 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map