F478648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 287 | 1484 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0032320|Ga0395899_0032320_524_1624 |
| Length | 366 |
| Sequence | MRNVNGLRRFLHTAQAGGDAASAQFRPMARNPFDDVARGLRQLGERLSQTTGAGDPADWISDQLRRPEPARTMAELQAELDSLTGLETVKDQVRALVAFLQVQAERQRHGLPEVATSQHLVFLGNPGTGKTTVARLLAEMYRAMGLLRRGHLVETDRAGLVGQYVGMTAIKTDRVVRRALDGVLFIDEAYALAPIDERLDFGPEAIETLLKRMEDYRHRLVVIVAGYPRLMHHFLQSNPGLRSRFSREIEFPDYATDELVAITEKFAAEYQYTLDIGATDVLRQILAGAARSEGFGNARFSRTLFEQALNAQALRLAGVQGAELAELDRLELMTLRGDDFLAGARALGEEPAVAQPRSSFWRRRVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 178 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 181 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 182 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 183 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 12.4 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0032320 | 3300037312 | Bacteria | 3930 |
| 2 | JGI24742J22300_10014015 | 3300002244 | Bacteria | 1345 |
| 3 | JGI25407J50210_10000170 | 3300003373 | Bacteria | 10520 |
| 4 | JGI25407J50210_10020677 | 3300003373 | Bacteria | 1710 |
| 5 | JGI25407J50210_10022634 | 3300003373 | Bacteria | 1633 |
| 6 | Ga0070658_10021724 | 3300005327 | Bacteria | 5144 |
| 7 | Ga0070658_10040945 | 3300005327 | Bacteria | 3737 |
| 8 | Ga0070658_10049115 | 3300005327 | Bacteria | 3418 |
| 9 | Ga0070658_10072397 | 3300005327 | Bacteria | 2824 |
| 10 | Ga0070658_10203105 | 3300005327 | Bacteria | 1673 |
| 11 | Ga0070683_100001509 | 3300005329 | Bacteria | 17973 |
| 12 | Ga0070683_100022643 | 3300005329 | Bacteria | 5618 |
| 13 | Ga0070683_100031073 | 3300005329 | Bacteria | 4852 |
| 14 | Ga0070683_100066977 | 3300005329 | Bacteria | 3344 |
| 15 | Ga0070683_100096319 | 3300005329 | Bacteria | 2783 |
| 16 | Ga0070683_100165394 | 3300005329 | Bacteria | 2099 |
| 17 | Ga0070683_100186591 | 3300005329 | Bacteria | 1969 |
| 18 | Ga0070690_100049642 | 3300005330 | Bacteria | 2676 |
| 19 | Ga0070680_100005741 | 3300005336 | Bacteria | 9418 |
| 20 | Ga0070680_100026001 | 3300005336 | Bacteria | 4681 |
| 21 | Ga0070680_100191338 | 3300005336 | Bacteria | 1724 |
| 22 | Ga0070680_100285062 | 3300005336 | Bacteria | 1400 |
| 23 | Ga0070682_100008373 | 3300005337 | Bacteria | 5834 |
| 24 | Ga0070682_100127875 | 3300005337 | Bacteria | 1715 |
| 25 | Ga0070682_100147906 | 3300005337 | Unclassified | 1609 |
| 26 | Ga0068868_100108173 | 3300005338 | Bacteria | 2257 |
| 27 | Ga0068868_100364224 | 3300005338 | Bacteria | 1241 |
| 28 | Ga0070660_100000742 | 3300005339 | Bacteria | 21609 |
| 29 | Ga0070660_100007066 | 3300005339 | Bacteria | 7799 |
| 30 | Ga0070660_100009347 | 3300005339 | Bacteria | 6888 |
| 31 | Ga0070660_100010446 | 3300005339 | Bacteria | 6562 |
| 32 | Ga0070660_100017422 | 3300005339 | Bacteria | 5236 |
| 33 | Ga0070660_100138835 | 3300005339 | Bacteria | 1949 |
| 34 | Ga0070689_100022501 | 3300005340 | Bacteria | 4706 |
| 35 | Ga0070687_100058918 | 3300005343 | Bacteria | 2020 |
| 36 | Ga0070661_100015356 | 3300005344 | Bacteria | 5405 |
| 37 | Ga0070692_10182161 | 3300005345 | Bacteria | 1218 |
| 38 | Ga0070668_100115357 | 3300005347 | Bacteria | 2141 |
| 39 | Ga0070669_100194089 | 3300005353 | Bacteria | 1594 |
| 40 | Ga0070674_100002426 | 3300005356 | Bacteria | 10307 |
| 41 | Ga0070688_100027481 | 3300005365 | Bacteria | 3390 |
| 42 | Ga0070659_100023533 | 3300005366 | Bacteria | 4715 |
| 43 | Ga0070659_100023797 | 3300005366 | Bacteria | 4689 |
| 44 | Ga0070659_100030352 | 3300005366 | Bacteria | 4184 |
| 45 | Ga0070659_100238672 | 3300005366 | Bacteria | 1503 |
| 46 | Ga0070667_100235162 | 3300005367 | Bacteria | 1635 |
| 47 | Ga0070703_10009359 | 3300005406 | Bacteria | 2764 |
| 48 | Ga0070709_10015703 | 3300005434 | Bacteria | 4313 |
| 49 | Ga0070714_100060907 | 3300005435 | Bacteria | 3240 |
| 50 | Ga0070713_100018901 | 3300005436 | Bacteria | 5247 |
| 51 | Ga0070713_100024444 | 3300005436 | Bacteria | 4705 |
| 52 | Ga0070710_10023061 | 3300005437 | Bacteria | 3265 |
| 53 | Ga0070701_10094634 | 3300005438 | Bacteria | 1643 |
| 54 | Ga0070711_100005144 | 3300005439 | Bacteria | 7793 |
| 55 | Ga0070711_100014909 | 3300005439 | Bacteria | 4909 |
| 56 | Ga0070711_100016052 | 3300005439 | Bacteria | 4748 |
| 57 | Ga0070700_100001911 | 3300005441 | Bacteria | 10527 |
| 58 | Ga0070694_100009437 | 3300005444 | Bacteria | 5985 |
| 59 | Ga0070694_100066690 | 3300005444 | Bacteria | 2469 |
| 60 | Ga0070708_100218482 | 3300005445 | Bacteria | 1787 |
| 61 | Ga0070678_100009478 | 3300005456 | Bacteria | 5903 |
| 62 | Ga0070662_100229577 | 3300005457 | Bacteria | 1484 |
| 63 | Ga0070681_10017419 | 3300005458 | Bacteria | 7181 |
| 64 | Ga0070681_10020576 | 3300005458 | Bacteria | 6612 |
| 65 | Ga0070681_10036211 | 3300005458 | Bacteria | 4956 |
| 66 | Ga0070681_10060398 | 3300005458 | Bacteria | 3768 |
| 67 | Ga0070681_10087310 | 3300005458 | Bacteria | 3072 |
| 68 | Ga0070681_10292148 | 3300005458 | Bacteria | 1540 |
| 69 | Ga0068867_100021971 | 3300005459 | Bacteria | 4557 |
| 70 | Ga0070685_10039590 | 3300005466 | Bacteria | 2679 |
| 71 | Ga0070706_100059102 | 3300005467 | Bacteria | 3538 |
| 72 | Ga0070706_100258978 | 3300005467 | Bacteria | 1624 |
| 73 | Ga0070698_100005166 | 3300005471 | Bacteria | 14273 |
| 74 | Ga0070698_100039268 | 3300005471 | Bacteria | 4873 |
| 75 | Ga0070699_100003986 | 3300005518 | Bacteria | 13044 |
| 76 | Ga0070699_100062007 | 3300005518 | Bacteria | 3240 |
| 77 | Ga0070699_100072185 | 3300005518 | Bacteria | 3002 |
| 78 | Ga0070699_100108179 | 3300005518 | Bacteria | 2440 |
| 79 | Ga0070699_100176642 | 3300005518 | Bacteria | 1894 |
| 80 | Ga0070679_100013893 | 3300005530 | Bacteria | 7715 |
| 81 | Ga0070679_100070922 | 3300005530 | Bacteria | 3475 |
| 82 | Ga0070679_100091915 | 3300005530 | Bacteria | 3022 |
| 83 | Ga0070679_100093918 | 3300005530 | Bacteria | 2987 |
| 84 | Ga0070679_100127968 | 3300005530 | Bacteria | 2521 |
| 85 | Ga0070684_100000278 | 3300005535 | Bacteria | 35483 |
| 86 | Ga0070684_100044944 | 3300005535 | Bacteria | 3823 |
| 87 | Ga0070684_100053474 | 3300005535 | Bacteria | 3515 |
| 88 | Ga0070684_100086078 | 3300005535 | Bacteria | 2788 |
| 89 | Ga0070684_100328324 | 3300005535 | Bacteria | 1406 |
| 90 | Ga0070672_100040274 | 3300005543 | Bacteria | 3583 |
| 91 | Ga0070686_100004281 | 3300005544 | Bacteria | 7866 |
| 92 | Ga0070686_100045440 | 3300005544 | Bacteria | 2766 |
| 93 | Ga0070695_100117268 | 3300005545 | Bacteria | 1816 |
| 94 | Ga0070693_100030059 | 3300005547 | Bacteria | 2967 |
| 95 | Ga0070665_100044504 | 3300005548 | Bacteria | 4458 |
| 96 | Ga0070704_100030522 | 3300005549 | Bacteria | 3612 |
| 97 | Ga0070704_100312786 | 3300005549 | Bacteria | 1313 |
| 98 | Ga0068855_100011179 | 3300005563 | Bacteria | 10839 |
| 99 | Ga0068855_100025163 | 3300005563 | Bacteria | 7127 |
| 100 | Ga0068855_100043723 | 3300005563 | Bacteria | 5304 |
| 101 | Ga0068855_100044823 | 3300005563 | Bacteria | 5233 |
| 102 | Ga0068855_100060057 | 3300005563 | Bacteria | 4447 |
| 103 | Ga0068855_100097778 | 3300005563 | Bacteria | 3382 |
| 104 | Ga0068855_100214696 | 3300005563 | Bacteria | 2160 |
| 105 | Ga0068855_100250789 | 3300005563 | Bacteria | 1974 |
| 106 | Ga0068855_100296241 | 3300005563 | Bacteria | 1792 |
| 107 | Ga0070664_100363046 | 3300005564 | Bacteria | 1319 |
| 108 | Ga0068857_100004024 | 3300005577 | Bacteria | 12375 |
| 109 | Ga0068857_100114854 | 3300005577 | Bacteria | 2422 |
| 110 | Ga0068854_100019060 | 3300005578 | Bacteria | 4617 |
| 111 | Ga0068856_100016239 | 3300005614 | Bacteria | 7202 |
| 112 | Ga0068856_100102507 | 3300005614 | Bacteria | 2855 |
| 113 | Ga0068856_100202897 | 3300005614 | Bacteria | 1997 |
| 114 | Ga0070702_100006516 | 3300005615 | Bacteria | 5535 |
| 115 | Ga0068852_100016126 | 3300005616 | Bacteria | 5816 |
| 116 | Ga0068859_100423426 | 3300005617 | Bacteria | 1428 |
| 117 | Ga0068866_10005110 | 3300005718 | Bacteria | 5405 |
| 118 | Ga0068861_100034636 | 3300005719 | Bacteria | 3735 |
| 119 | Ga0068860_100055059 | 3300005843 | Bacteria | 3781 |
| 120 | Ga0081455_10026010 | 3300005937 | Bacteria | 5391 |
| 121 | Ga0081455_10093278 | 3300005937 | Bacteria | 2434 |
| 122 | Ga0081538_10000492 | 3300005981 | Bacteria | 44066 |
| 123 | Ga0081538_10001664 | 3300005981 | Bacteria | 22718 |
| 124 | Ga0081538_10002218 | 3300005981 | Bacteria | 19247 |
| 125 | Ga0081540_1001344 | 3300005983 | Bacteria | 21413 |
| 126 | Ga0081539_10000427 | 3300005985 | Bacteria | 89575 |
| 127 | Ga0081539_10007917 | 3300005985 | Bacteria | 9466 |
| 128 | Ga0070717_10157149 | 3300006028 | Bacteria | 1971 |
| 129 | Ga0075364_10002132 | 3300006051 | Bacteria | 11074 |
| 130 | Ga0070716_100183350 | 3300006173 | Bacteria | 1376 |
| 131 | Ga0070712_100161600 | 3300006175 | Bacteria | 1730 |
| 132 | Ga0070712_100193808 | 3300006175 | Unclassified | 1592 |
| 133 | Ga0075362_10028257 | 3300006177 | Bacteria | 2407 |
| 134 | Ga0097621_100030779 | 3300006237 | Bacteria | 4253 |
| 135 | Ga0097621_100331360 | 3300006237 | Bacteria | 1350 |
| 136 | Ga0068871_100015752 | 3300006358 | Bacteria | 5671 |
| 137 | Ga0075428_100099719 | 3300006844 | Bacteria | 3167 |
| 138 | Ga0075428_100301066 | 3300006844 | Bacteria | 1724 |
| 139 | Ga0075430_100197191 | 3300006846 | Bacteria | 1672 |
| 140 | Ga0075431_100050987 | 3300006847 | Bacteria | 4267 |
| 141 | Ga0075431_100060443 | 3300006847 | Bacteria | 3910 |
| 142 | Ga0075431_100099732 | 3300006847 | Bacteria | 2996 |
| 143 | Ga0075431_100133052 | 3300006847 | Bacteria | 2564 |
| 144 | Ga0075433_10003194 | 3300006852 | Bacteria | 12635 |
| 145 | Ga0075433_10004851 | 3300006852 | Bacteria | 10518 |
| 146 | Ga0075433_10037537 | 3300006852 | Bacteria | 4180 |
| 147 | Ga0075433_10081697 | 3300006852 | Bacteria | 2850 |
| 148 | Ga0075434_100003439 | 3300006871 | Bacteria | 14160 |
| 149 | Ga0075434_100003491 | 3300006871 | Bacteria | 14059 |
| 150 | Ga0075434_100045719 | 3300006871 | Bacteria | 4344 |
| 151 | Ga0075434_100286207 | 3300006871 | Bacteria | 1668 |
| 152 | Ga0068865_100001311 | 3300006881 | Bacteria | 14483 |
| 153 | Ga0068865_100043278 | 3300006881 | Bacteria | 3075 |
| 154 | Ga0075436_100002304 | 3300006914 | Bacteria | 13157 |
| 155 | Ga0075436_100049376 | 3300006914 | Bacteria | 2903 |
| 156 | Ga0097620_100423410 | 3300006931 | Bacteria | 1428 |
| 157 | Ga0075435_100005413 | 3300007076 | Bacteria | 8905 |
| 158 | Ga0075435_100005887 | 3300007076 | Bacteria | 8626 |
| 159 | Ga0075435_100011438 | 3300007076 | Bacteria | 6530 |
| 160 | Ga0105240_10026395 | 3300009093 | Bacteria | 7620 |
| 161 | Ga0105240_10096505 | 3300009093 | Bacteria | 3603 |
| 162 | Ga0111539_10015143 | 3300009094 | Bacteria | 9609 |
| 163 | Ga0111539_10015626 | 3300009094 | Bacteria | 9437 |
| 164 | Ga0111539_10023141 | 3300009094 | Bacteria | 7630 |
| 165 | Ga0111539_10095724 | 3300009094 | Bacteria | 3487 |
| 166 | Ga0111539_10282162 | 3300009094 | Bacteria | 1933 |
| 167 | Ga0111539_10617970 | 3300009094 | Bacteria | 1262 |
| 168 | Ga0111539_10727044 | 3300009094 | Bacteria | 1156 |
| 169 | Ga0105245_10038628 | 3300009098 | Bacteria | 4247 |
| 170 | Ga0105245_10116272 | 3300009098 | Bacteria | 2494 |
| 171 | Ga0105245_10120016 | 3300009098 | Bacteria | 2455 |
| 172 | Ga0105245_10473098 | 3300009098 | Bacteria | 1265 |
| 173 | Ga0114129_10001381 | 3300009147 | Bacteria | 32671 |
| 174 | Ga0114129_10006178 | 3300009147 | Bacteria | 16996 |
| 175 | Ga0114129_10019128 | 3300009147 | Bacteria | 9755 |
| 176 | Ga0114129_10029149 | 3300009147 | Bacteria | 7819 |
| 177 | Ga0114129_10038724 | 3300009147 | Bacteria | 6723 |
| 178 | Ga0114129_10193025 | 3300009147 | Bacteria | 2764 |
| 179 | Ga0114129_10224783 | 3300009147 | Bacteria | 2531 |
| 180 | Ga0114129_10382467 | 3300009147 | Bacteria | 1858 |
| 181 | Ga0105243_10015194 | 3300009148 | Bacteria | 5827 |
| 182 | Ga0105243_10054333 | 3300009148 | Bacteria | 3180 |
| 183 | Ga0105241_10107904 | 3300009174 | Bacteria | 2225 |
| 184 | Ga0105242_10016564 | 3300009176 | Bacteria | 5732 |
| 185 | Ga0105242_10065304 | 3300009176 | Bacteria | 3002 |
| 186 | Ga0105248_10025473 | 3300009177 | Bacteria | 6578 |
| 187 | Ga0105248_10278921 | 3300009177 | Bacteria | 1881 |
| 188 | Ga0105248_10300097 | 3300009177 | Bacteria | 1809 |
| 189 | Ga0105237_10206194 | 3300009545 | Bacteria | 1966 |
| 190 | Ga0105238_10103870 | 3300009551 | Bacteria | 2823 |
| 191 | Ga0105249_10004393 | 3300009553 | Bacteria | 12194 |
| 192 | Ga0105249_10013589 | 3300009553 | Bacteria | 7193 |
| 193 | Ga0105239_10050473 | 3300010375 | Bacteria | 4563 |
| 194 | Ga0105239_10082616 | 3300010375 | Bacteria | 3538 |
| 195 | Ga0105239_10457836 | 3300010375 | Bacteria | 1448 |
| 196 | Ga0157373_10065948 | 3300013100 | Bacteria | 2562 |
| 197 | Ga0157371_10101022 | 3300013102 | Bacteria | 2046 |
| 198 | Ga0157370_10012124 | 3300013104 | Bacteria | 8966 |
| 199 | Ga0157370_10033841 | 3300013104 | Bacteria | 4981 |
| 200 | Ga0157370_10085305 | 3300013104 | Bacteria | 2966 |
| 201 | Ga0157370_10117652 | 3300013104 | Bacteria | 2482 |
| 202 | Ga0157369_10003011 | 3300013105 | Bacteria | 20152 |
| 203 | Ga0157369_10122917 | 3300013105 | Bacteria | 2753 |
| 204 | Ga0157369_10142706 | 3300013105 | Bacteria | 2533 |
| 205 | Ga0157374_10036355 | 3300013296 | Bacteria | 4510 |
| 206 | Ga0157378_10317636 | 3300013297 | Unclassified | 1512 |
| 207 | Ga0163162_10019155 | 3300013306 | Bacteria | 6711 |
| 208 | Ga0157372_10346954 | 3300013307 | Bacteria | 1729 |
| 209 | Ga0157375_10290386 | 3300013308 | Bacteria | 1798 |
| 210 | Ga0157375_10335832 | 3300013308 | Bacteria | 1676 |
| 211 | Ga0163163_10483274 | 3300014325 | Bacteria | 1300 |
| 212 | Ga0157380_10023630 | 3300014326 | Bacteria | 4640 |
| 213 | Ga0157380_10086700 | 3300014326 | Bacteria | 2573 |
| 214 | Ga0182008_10005314 | 3300014497 | Bacteria | 7353 |
| 215 | Ga0157377_10096344 | 3300014745 | Bacteria | 1755 |
| 216 | Ga0157376_10082408 | 3300014969 | Bacteria | 2764 |
| 217 | Ga0157376_10231779 | 3300014969 | Bacteria | 1716 |
| 218 | Ga0182006_1025671 | 3300015261 | Bacteria | 2418 |
| 219 | Ga0163161_10047861 | 3300017792 | Bacteria | 3087 |
| 220 | Ga0206356_11599872 | 3300020070 | Bacteria | 2050 |
| 221 | Ga0206353_10421368 | 3300020082 | Bacteria | 3407 |
| 222 | Ga0206353_11575940 | 3300020082 | Bacteria | 3633 |
| 223 | Ga0206353_11621997 | 3300020082 | Bacteria | 2863 |
| 224 | Ga0207653_10021654 | 3300025885 | Bacteria | 2039 |
| 225 | Ga0207642_10065073 | 3300025899 | Bacteria | 1711 |
| 226 | Ga0207699_10060890 | 3300025906 | Bacteria | 2269 |
| 227 | Ga0207699_10305299 | 3300025906 | Bacteria | 1112 |
| 228 | Ga0207705_10069424 | 3300025909 | Bacteria | 2552 |
| 229 | Ga0207705_10072066 | 3300025909 | Bacteria | 2505 |
| 230 | Ga0207705_10375190 | 3300025909 | Bacteria | 1098 |
| 231 | Ga0207707_10032607 | 3300025912 | Bacteria | 4559 |
| 232 | Ga0207707_10033240 | 3300025912 | Bacteria | 4515 |
| 233 | Ga0207707_10067376 | 3300025912 | Bacteria | 3118 |
| 234 | Ga0207707_10090501 | 3300025912 | Bacteria | 2674 |
| 235 | Ga0207707_10335261 | 3300025912 | Bacteria | 1305 |
| 236 | Ga0207695_10060005 | 3300025913 | Bacteria | 3941 |
| 237 | Ga0207693_10001537 | 3300025915 | Bacteria | 20394 |
| 238 | Ga0207693_10178139 | 3300025915 | Bacteria | 1673 |
| 239 | Ga0207663_10009584 | 3300025916 | Bacteria | 5125 |
| 240 | Ga0207663_10055932 | 3300025916 | Bacteria | 2478 |
| 241 | Ga0207660_10006990 | 3300025917 | Bacteria | 7308 |
| 242 | Ga0207660_10008142 | 3300025917 | Bacteria | 6782 |
| 243 | Ga0207660_10031984 | 3300025917 | Bacteria | 3628 |
| 244 | Ga0207660_10178166 | 3300025917 | Bacteria | 1649 |
| 245 | Ga0207662_10017739 | 3300025918 | Bacteria | 4030 |
| 246 | Ga0207662_10090990 | 3300025918 | Bacteria | 1876 |
| 247 | Ga0207657_10000150 | 3300025919 | Bacteria | 70716 |
| 248 | Ga0207657_10001085 | 3300025919 | Bacteria | 28819 |
| 249 | Ga0207657_10002795 | 3300025919 | Bacteria | 18789 |
| 250 | Ga0207657_10014969 | 3300025919 | Bacteria | 7536 |
| 251 | Ga0207657_10017118 | 3300025919 | Bacteria | 6966 |
| 252 | Ga0207657_10020811 | 3300025919 | Bacteria | 6190 |
| 253 | Ga0207657_10021272 | 3300025919 | Bacteria | 6110 |
| 254 | Ga0207657_10045537 | 3300025919 | Bacteria | 3849 |
| 255 | Ga0207657_10052406 | 3300025919 | Bacteria | 3541 |
| 256 | Ga0207657_10073012 | 3300025919 | Bacteria | 2901 |
| 257 | Ga0207657_10133245 | 3300025919 | Bacteria | 2035 |
| 258 | Ga0207652_10051617 | 3300025921 | Bacteria | 3526 |
| 259 | Ga0207652_10052173 | 3300025921 | Bacteria | 3508 |
| 260 | Ga0207652_10078178 | 3300025921 | Bacteria | 2888 |
| 261 | Ga0207652_10166382 | 3300025921 | Bacteria | 1977 |
| 262 | Ga0207652_10189081 | 3300025921 | Bacteria | 1852 |
| 263 | Ga0207652_10374483 | 3300025921 | Bacteria | 1285 |
| 264 | Ga0207659_10344031 | 3300025926 | Bacteria | 1236 |
| 265 | Ga0207687_10006594 | 3300025927 | Bacteria | 7655 |
| 266 | Ga0207687_10049029 | 3300025927 | Bacteria | 2934 |
| 267 | Ga0207700_10000021 | 3300025928 | Bacteria | 168335 |
| 268 | Ga0207700_10286053 | 3300025928 | Bacteria | 1420 |
| 269 | Ga0207664_10036757 | 3300025929 | Bacteria | 3786 |
| 270 | Ga0207690_10013075 | 3300025932 | Bacteria | 4979 |
| 271 | Ga0207706_10084349 | 3300025933 | Bacteria | 2793 |
| 272 | Ga0207686_10007141 | 3300025934 | Bacteria | 6011 |
| 273 | Ga0207686_10033014 | 3300025934 | Bacteria | 3085 |
| 274 | Ga0207686_10072979 | 3300025934 | Unclassified | 2213 |
| 275 | Ga0207709_10002924 | 3300025935 | Bacteria | 10431 |
| 276 | Ga0207670_10020461 | 3300025936 | Bacteria | 4066 |
| 277 | Ga0207669_10010478 | 3300025937 | Bacteria | 4465 |
| 278 | Ga0207704_10005826 | 3300025938 | Bacteria | 5702 |
| 279 | Ga0207665_10014902 | 3300025939 | Bacteria | 5109 |
| 280 | Ga0207665_10146862 | 3300025939 | Bacteria | 1686 |
| 281 | Ga0207691_10035082 | 3300025940 | Bacteria | 4660 |
| 282 | Ga0207711_10226916 | 3300025941 | Bacteria | 1710 |
| 283 | Ga0207661_10012236 | 3300025944 | Bacteria | 6233 |
| 284 | Ga0207661_10022256 | 3300025944 | Bacteria | 4769 |
| 285 | Ga0207661_10062350 | 3300025944 | Bacteria | 3016 |
| 286 | Ga0207661_10069766 | 3300025944 | Bacteria | 2867 |
| 287 | Ga0207661_10110434 | 3300025944 | Bacteria | 2324 |
| 288 | Ga0207661_10408389 | 3300025944 | Bacteria | 1232 |
| 289 | Ga0207667_10035948 | 3300025949 | Bacteria | 5312 |
| 290 | Ga0207667_10046219 | 3300025949 | Bacteria | 4610 |
| 291 | Ga0207667_10185637 | 3300025949 | Bacteria | 2135 |
| 292 | Ga0207667_10342298 | 3300025949 | Bacteria | 1526 |
| 293 | Ga0207667_10616215 | 3300025949 | Bacteria | 1093 |
| 294 | Ga0207712_10030896 | 3300025961 | Bacteria | 3604 |
| 295 | Ga0207677_10274179 | 3300026023 | Bacteria | 1381 |
| 296 | Ga0207677_10280650 | 3300026023 | Bacteria | 1367 |
| 297 | Ga0207639_10095151 | 3300026041 | Bacteria | 2393 |
| 298 | Ga0207678_10011184 | 3300026067 | Bacteria | 7881 |
| 299 | Ga0207678_10266835 | 3300026067 | Bacteria | 1467 |
| 300 | Ga0207708_10000447 | 3300026075 | Bacteria | 32102 |
| 301 | Ga0207708_10041076 | 3300026075 | Bacteria | 3527 |
| 302 | Ga0207702_10158957 | 3300026078 | Bacteria | 2062 |
| 303 | Ga0207641_10216257 | 3300026088 | Bacteria | 1775 |
| 304 | Ga0207648_10001449 | 3300026089 | Bacteria | 26129 |
| 305 | Ga0207674_10000863 | 3300026116 | Bacteria | 39645 |
| 306 | Ga0207674_10027030 | 3300026116 | Bacteria | 6080 |
| 307 | Ga0207674_10093597 | 3300026116 | Bacteria | 2993 |
| 308 | Ga0207674_10163396 | 3300026116 | Bacteria | 2181 |
| 309 | Ga0207675_100013590 | 3300026118 | Bacteria | 7600 |
| 310 | Ga0207675_100033310 | 3300026118 | Bacteria | 4801 |
| 311 | Ga0207683_10008535 | 3300026121 | Bacteria | 8767 |
| 312 | Ga0207698_10078710 | 3300026142 | Bacteria | 2648 |
| 313 | Ga0207698_10112247 | 3300026142 | Bacteria | 2287 |
| 314 | Ga0207698_10343113 | 3300026142 | Bacteria | 1407 |
| 315 | Ga0207428_10034955 | 3300027907 | Bacteria | 4112 |
| 316 | Ga0207428_10039813 | 3300027907 | Bacteria | 3816 |
| 317 | Ga0268264_10115972 | 3300028381 | Bacteria | 2353 |
| 318 | Ga0268264_10299949 | 3300028381 | Bacteria | 1512 |
| 319 | Ga0265326_10008864 | 3300028558 | Bacteria | 3016 |
| 320 | Ga0265325_10010492 | 3300031241 | Bacteria | 5360 |
| 321 | Ga0265327_10012208 | 3300031251 | Bacteria | 5824 |
| 322 | Ga0307408_100281543 | 3300031548 | Bacteria | 1385 |
| 323 | Ga0265314_10011624 | 3300031711 | Bacteria | 7246 |
| 324 | Ga0265342_10006813 | 3300031712 | Bacteria | 8448 |
| 325 | Ga0307416_100033055 | 3300032002 | Bacteria | 3917 |
| 326 | Ga0373926_0035321 | 3300035083 | Bacteria | 1773 |
| 327 | Ga0373944_0044311 | 3300035089 | Bacteria | 1385 |
| 328 | Ga0373945_0009438 | 3300035116 | Bacteria | 3197 |
| 329 | Ga0373943_0003300 | 3300035170 | Bacteria | 7329 |
| 330 | Ga0373943_0004089 | 3300035170 | Bacteria | 6624 |
| 331 | Ga0373943_0026317 | 3300035170 | Bacteria | 2724 |
| 332 | Ga0373946_0006834 | 3300035171 | Bacteria | 4151 |
| 333 | Ga0373924_0028689 | 3300035410 | Bacteria | 2219 |
| 334 | Ga0373927_0277886 | 3300035695 | Bacteria | 1101 |
| 335 | Ga0373947_0002021 | 3300035725 | Bacteria | 12378 |
| 336 | Ga0373947_0033040 | 3300035725 | Bacteria | 3052 |
| 337 | Ga0373937_0141210 | 3300036401 | Bacteria | 2253 |
| 338 | Ga0373937_0176816 | 3300036401 | Bacteria | 2004 |
| 339 | Ga0373925_0007843 | 3300037068 | Bacteria | 7774 |
| 340 | Ga0373925_0043112 | 3300037068 | Bacteria | 3348 |
| 341 | Ga0373925_0135891 | 3300037068 | Bacteria | 1921 |
| 342 | Ga0395899_0000921 | 3300037312 | Bacteria | 27676 |
| 343 | Ga0395899_0004606 | 3300037312 | Bacteria | 10747 |
| 344 | Ga0395899_0012501 | 3300037312 | Bacteria | 6503 |
| 345 | Ga0395899_0047090 | 3300037312 | Bacteria | 3210 |
| 346 | Ga0395899_0069478 | 3300037312 | Bacteria | 2579 |
| 347 | Ga0395899_0088216 | 3300037312 | Bacteria | 2251 |
| 348 | Ga0395899_0105194 | 3300037312 | Bacteria | 2033 |
| 349 | Ga0395899_0172039 | 3300037312 | Bacteria | 1525 |
| 350 | Ga0395900_0002725 | 3300037418 | Bacteria | 19307 |
| 351 | Ga0395900_0004525 | 3300037418 | Bacteria | 14710 |
| 352 | Ga0395900_0007949 | 3300037418 | Bacteria | 10917 |
| 353 | Ga0395900_0009949 | 3300037418 | Bacteria | 9736 |
| 354 | Ga0395900_0009967 | 3300037418 | Bacteria | 9726 |
| 355 | Ga0395900_0011306 | 3300037418 | Bacteria | 9131 |
| 356 | Ga0395900_0020230 | 3300037418 | Bacteria | 6792 |
| 357 | Ga0395900_0021258 | 3300037418 | Bacteria | 6635 |
| 358 | Ga0395900_0035747 | 3300037418 | Bacteria | 5118 |
| 359 | Ga0395900_0039528 | 3300037418 | Bacteria | 4860 |
| 360 | Ga0395900_0055214 | 3300037418 | Bacteria | 4090 |
| 361 | Ga0395900_0073366 | 3300037418 | Bacteria | 3518 |
| 362 | Ga0395900_0084843 | 3300037418 | Bacteria | 3255 |
| 363 | Ga0395900_0106004 | 3300037418 | Bacteria | 2887 |
| 364 | Ga0395900_0107855 | 3300037418 | Bacteria | 2861 |
| 365 | Ga0395900_0124754 | 3300037418 | Bacteria | 2641 |
| 366 | Ga0395898_0001403 | 3300037466 | Bacteria | 34348 |
| 367 | Ga0395898_0002309 | 3300037466 | Bacteria | 22851 |
| 368 | Ga0395898_0003108 | 3300037466 | Bacteria | 18761 |
| 369 | Ga0395898_0004586 | 3300037466 | Bacteria | 15079 |
| 370 | Ga0395898_0006398 | 3300037466 | Bacteria | 12572 |
| 371 | Ga0395898_0006592 | 3300037466 | Bacteria | 12382 |
| 372 | Ga0395898_0011120 | 3300037466 | Bacteria | 9370 |
| 373 | Ga0395898_0017311 | 3300037466 | Bacteria | 7362 |
| 374 | Ga0395898_0019283 | 3300037466 | Bacteria | 6944 |
| 375 | Ga0395898_0020119 | 3300037466 | Bacteria | 6780 |
| 376 | Ga0395898_0025158 | 3300037466 | Bacteria | 6003 |
| 377 | Ga0395898_0033779 | 3300037466 | Bacteria | 5102 |
| 378 | Ga0395898_0044814 | 3300037466 | Bacteria | 4351 |
| 379 | Ga0395898_0045365 | 3300037466 | Bacteria | 4321 |
| 380 | Ga0395898_0062885 | 3300037466 | Bacteria | 3603 |
| 381 | Ga0395898_0087872 | 3300037466 | Bacteria | 2994 |
| 382 | Ga0395898_0098421 | 3300037466 | Bacteria | 2808 |
| 383 | Ga0395898_0099297 | 3300037466 | Bacteria | 2796 |
| 384 | Ga0395898_0107948 | 3300037466 | Bacteria | 2669 |
| 385 | Ga0395898_0189841 | 3300037466 | Bacteria | 1963 |
| 386 | Ga0395898_0332617 | 3300037466 | Bacteria | 1448 |
| 387 | Ga0395898_0411008 | 3300037466 | Bacteria | 1290 |
| 388 | Ga0395905_0001294 | 3300037471 | Bacteria | 30743 |
| 389 | Ga0395905_0003029 | 3300037471 | Bacteria | 18205 |
| 390 | Ga0395905_0003158 | 3300037471 | Bacteria | 17749 |
| 391 | Ga0395905_0008964 | 3300037471 | Bacteria | 9816 |
| 392 | Ga0395905_0010383 | 3300037471 | Bacteria | 9064 |
| 393 | Ga0395905_0010714 | 3300037471 | Bacteria | 8891 |
| 394 | Ga0395905_0021031 | 3300037471 | Bacteria | 6178 |
| 395 | Ga0395905_0036646 | 3300037471 | Bacteria | 4607 |
| 396 | Ga0395905_0049871 | 3300037471 | Bacteria | 3923 |
| 397 | Ga0395905_0069786 | 3300037471 | Bacteria | 3291 |
| 398 | Ga0395905_0140287 | 3300037471 | Bacteria | 2274 |
| 399 | Ga0395905_0154089 | 3300037471 | Bacteria | 2161 |
| 400 | Ga0395905_0225670 | 3300037471 | Bacteria | 1752 |
| 401 | Ga0395905_0304029 | 3300037471 | Bacteria | 1483 |
| 402 | Ga0395905_0458306 | 3300037471 | Bacteria | 1173 |
| 403 | Ga0395905_0500231 | 3300037471 | Bacteria | 1116 |
| 404 | Ga0395905_0523199 | 3300037471 | Bacteria | 1086 |
| 405 | Ga0395901_0000478 | 3300038443 | Bacteria | 46475 |
| 406 | Ga0395901_0002362 | 3300038443 | Bacteria | 19195 |
| 407 | Ga0395901_0004338 | 3300038443 | Bacteria | 14312 |
| 408 | Ga0395901_0005627 | 3300038443 | Bacteria | 12679 |
| 409 | Ga0395901_0007489 | 3300038443 | Bacteria | 11025 |
| 410 | Ga0395901_0021451 | 3300038443 | Bacteria | 6617 |
| 411 | Ga0395901_0028223 | 3300038443 | Bacteria | 5773 |
| 412 | Ga0395901_0036835 | 3300038443 | Bacteria | 5057 |
| 413 | Ga0395901_0041519 | 3300038443 | Bacteria | 4768 |
| 414 | Ga0395901_0041653 | 3300038443 | Bacteria | 4760 |
| 415 | Ga0395901_0042964 | 3300038443 | Bacteria | 4688 |
| 416 | Ga0395901_0045398 | 3300038443 | Bacteria | 4559 |
| 417 | Ga0395901_0067658 | 3300038443 | Bacteria | 3720 |
| 418 | Ga0395901_0071554 | 3300038443 | Bacteria | 3614 |
| 419 | Ga0395901_0087361 | 3300038443 | Bacteria | 3260 |
| 420 | Ga0395901_0103160 | 3300038443 | Bacteria | 2993 |
| 421 | Ga0395901_0106288 | 3300038443 | Bacteria | 2946 |
| 422 | Ga0395901_0122156 | 3300038443 | Bacteria | 2737 |
| 423 | Ga0395901_0174525 | 3300038443 | Bacteria | 2254 |
| 424 | Ga0395901_0191097 | 3300038443 | Bacteria | 2147 |
| 425 | Ga0395901_0193020 | 3300038443 | Bacteria | 2135 |
| 426 | Ga0395901_0250949 | 3300038443 | Bacteria | 1843 |
| 427 | Ga0395901_0315833 | 3300038443 | Bacteria | 1617 |
| 428 | Ga0451789_1063148 | 3300041443 | Bacteria | 1312 |
| 429 | Ga0451793_0231043 | 3300041452 | Bacteria | 2194 |
| 430 | Ga0451795_0821794 | 3300041456 | Bacteria | 1375 |
| 431 | Ga0451802_0438937 | 3300041460 | Bacteria | 1435 |
| 432 | Ga0451849_0309738 | 3300041505 | Bacteria | 3554 |
| 433 | Ga0451853_1008775 | 3300041512 | Bacteria | 2235 |
| 434 | Ga0439454_002115 | 3300042011 | Bacteria | 2043 |
| 435 | Ga0450920_010048 | 3300042122 | Bacteria | 1751 |
| 436 | Ga0439446_0011133 | 3300042156 | Bacteria | 2437 |
| 437 | Ga0466961_0014856 | 3300044693 | Bacteria | 5002 |
| 438 | Ga0466961_0213057 | 3300044693 | Bacteria | 1192 |
| 439 | Ga0466963_0001590 | 3300044694 | Bacteria | 12335 |
| 440 | Ga0466963_0007079 | 3300044694 | Bacteria | 6680 |
| 441 | Ga0466963_0013998 | 3300044694 | Bacteria | 4940 |
| 442 | Ga0466963_0016808 | 3300044694 | Bacteria | 4554 |
| 443 | Ga0466963_0029024 | 3300044694 | Bacteria | 3557 |
| 444 | Ga0466963_0047655 | 3300044694 | Bacteria | 2829 |
| 445 | Ga0466963_0081709 | 3300044694 | Bacteria | 2189 |
| 446 | Ga0466963_0091081 | 3300044694 | Bacteria | 2076 |
| 447 | Ga0466963_0105746 | 3300044694 | Bacteria | 1929 |
| 448 | Ga0466964_0018549 | 3300044706 | Bacteria | 2670 |
| 449 | Ga0466964_0121521 | 3300044706 | Bacteria | 1178 |
| 450 | Ga0466971_0000857 | 3300044719 | Bacteria | 12409 |
| 451 | Ga0466971_0036052 | 3300044719 | Bacteria | 2218 |
| 452 | Ga0466970_0024467 | 3300044765 | Bacteria | 3158 |
| 453 | Ga0466957_0002804 | 3300044842 | Bacteria | 9427 |
| 454 | Ga0466957_0216610 | 3300044842 | Bacteria | 1263 |
| 455 | Ga0466960_0004520 | 3300044901 | Bacteria | 5451 |
| 456 | Ga0466960_0014520 | 3300044901 | Bacteria | 3374 |
| 457 | Ga0466959_0002573 | 3300045049 | Bacteria | 11646 |
| 458 | Ga0466959_0007757 | 3300045049 | Bacteria | 7549 |
| 459 | Ga0466959_0036292 | 3300045049 | Bacteria | 3642 |
| 460 | Ga0466959_0045365 | 3300045049 | Bacteria | 3237 |
| 461 | Ga0466959_0145341 | 3300045049 | Bacteria | 1674 |
| 462 | Ga0466959_0330357 | 3300045049 | Bacteria | 1041 |
| 463 | Ga0466958_0034458 | 3300045836 | Bacteria | 3020 |
| 464 | Ga0466958_0049167 | 3300045836 | Bacteria | 2551 |
| 465 | Ga0466958_0082909 | 3300045836 | Bacteria | 1975 |
| 466 | Ga0466958_0088482 | 3300045836 | Bacteria | 1914 |
| 467 | Ga0466958_0182520 | 3300045836 | Bacteria | 1332 |
| 468 | Ga0466967_0001695 | 3300045976 | Bacteria | 13109 |
| 469 | Ga0466967_0002600 | 3300045976 | Bacteria | 11346 |
| 470 | Ga0466967_0005994 | 3300045976 | Bacteria | 8536 |
| 471 | Ga0466967_0008574 | 3300045976 | Bacteria | 7511 |
| 472 | Ga0466967_0010023 | 3300045976 | Bacteria | 7077 |
| 473 | Ga0466967_0012459 | 3300045976 | Bacteria | 6506 |
| 474 | Ga0466967_0016091 | 3300045976 | Bacteria | 5885 |
| 475 | Ga0466967_0064610 | 3300045976 | Bacteria | 3255 |
| 476 | Ga0466967_0090020 | 3300045976 | Bacteria | 2787 |
| 477 | Ga0466967_0126122 | 3300045976 | Bacteria | 2371 |
| 478 | Ga0466967_0136464 | 3300045976 | Bacteria | 2281 |
| 479 | Ga0466967_0154936 | 3300045976 | Bacteria | 2145 |
| 480 | Ga0466967_0238246 | 3300045976 | Bacteria | 1734 |
| 481 | Ga0466967_0372912 | 3300045976 | Bacteria | 1384 |
| 482 | Ga0466967_0399901 | 3300045976 | Bacteria | 1336 |
| 483 | Ga0466967_0524471 | 3300045976 | Bacteria | 1164 |
| 484 | Ga0495603_0022300 | 3300046455 | Bacteria | 3835 |
| 485 | Ga0495603_0043589 | 3300046455 | Bacteria | 2679 |
| 486 | Ga0495629_0010392 | 3300046459 | Bacteria | 6774 |
| 487 | Ga0495641_0000951 | 3300046461 | Bacteria | 24785 |
| 488 | Ga0495641_0078809 | 3300046461 | Bacteria | 1476 |
| 489 | Ga0495651_0024380 | 3300046462 | Bacteria | 4707 |
| 490 | Ga0495651_0071779 | 3300046462 | Bacteria | 2631 |
| 491 | Ga0495653_0020948 | 3300046463 | Bacteria | 5298 |
| 492 | Ga0495653_0055422 | 3300046463 | Bacteria | 3025 |
| 493 | Ga0495653_0230234 | 3300046463 | Bacteria | 1240 |
| 494 | Ga0495580_0258069 | 3300046472 | Bacteria | 1192 |
| 495 | Ga0495582_0000477 | 3300046473 | Bacteria | 21956 |
| 496 | Ga0495639_0006991 | 3300046475 | Bacteria | 4851 |
| 497 | Ga0495662_0000844 | 3300046476 | Bacteria | 14906 |
| 498 | Ga0495664_0057190 | 3300046477 | Bacteria | 2320 |
| 499 | Ga0495584_0044724 | 3300046491 | Bacteria | 2234 |
| 500 | Ga0495594_0090928 | 3300046499 | Bacteria | 1710 |
| 501 | Ga0495608_0039599 | 3300046511 | Bacteria | 3158 |
| 502 | Ga0495608_0073221 | 3300046511 | Bacteria | 2234 |
| 503 | Ga0495618_0068696 | 3300046514 | Bacteria | 2253 |
| 504 | Ga0495618_0133112 | 3300046514 | Bacteria | 1591 |
| 505 | Ga0495630_0025223 | 3300046517 | Bacteria | 4395 |
| 506 | Ga0495630_0079299 | 3300046517 | Bacteria | 2477 |
| 507 | Ga0495630_0300220 | 3300046517 | Bacteria | 1227 |
| 508 | Ga0495631_0062152 | 3300046518 | Bacteria | 1619 |
| 509 | Ga0495663_0036087 | 3300046525 | Bacteria | 1487 |
| 510 | Ga0495666_0036583 | 3300046526 | Bacteria | 2391 |
| 511 | Ga0495642_0050357 | 3300046528 | Bacteria | 1713 |
| 512 | Ga0495642_0052946 | 3300046528 | Bacteria | 1672 |
| 513 | Ga0495652_0105441 | 3300046529 | Bacteria | 2277 |
| 514 | Ga0495665_0001760 | 3300046531 | Bacteria | 11661 |
| 515 | Ga0495665_0100352 | 3300046531 | Bacteria | 1519 |
| 516 | Ga0495665_0122083 | 3300046531 | Bacteria | 1364 |
| 517 | Ga0495640_0169049 | 3300046533 | Bacteria | 1397 |
| 518 | Ga0495587_0045310 | 3300046536 | Bacteria | 2614 |
| 519 | Ga0495667_0011724 | 3300046559 | Bacteria | 5935 |
| 520 | Ga0495667_0175460 | 3300046559 | Bacteria | 1376 |
| 521 | Ga0495656_0019016 | 3300046615 | Bacteria | 2646 |
| 522 | Ga0495656_0059980 | 3300046615 | Bacteria | 1657 |
| 523 | Ga0495634_0014790 | 3300046642 | Bacteria | 5615 |
| 524 | Ga0495634_0095685 | 3300046642 | Bacteria | 1923 |
| 525 | Ga0495635_0033941 | 3300046663 | Bacteria | 3539 |
| 526 | Ga0495657_0024737 | 3300046675 | Bacteria | 4271 |
| 527 | Ga0495657_0071086 | 3300046675 | Bacteria | 2273 |
| 528 | Ga0495657_0109124 | 3300046675 | Bacteria | 1755 |
| 529 | Ga0495599_0073771 | 3300046678 | Bacteria | 2130 |
| 530 | Ga0495623_0022902 | 3300046679 | Bacteria | 4033 |
| 531 | Ga0495623_0115196 | 3300046679 | Bacteria | 1625 |
| 532 | Ga0495658_0001285 | 3300046683 | Bacteria | 13156 |
| 533 | Ga0495658_0007429 | 3300046683 | Bacteria | 5422 |
| 534 | Ga0495658_0054509 | 3300046683 | Bacteria | 2275 |
| 535 | Ga0495613_0001535 | 3300046689 | Bacteria | 17574 |
| 536 | Ga0495613_0068033 | 3300046689 | Bacteria | 2598 |
| 537 | Ga0495624_0008969 | 3300046690 | Bacteria | 6950 |
| 538 | Ga0495624_0138221 | 3300046690 | Bacteria | 1493 |
| 539 | Ga0495600_0012129 | 3300046809 | Bacteria | 5383 |
| 540 | Ga0495581_0001739 | 3300047315 | Bacteria | 12134 |
| 541 | Ga0495581_0002855 | 3300047315 | Bacteria | 9864 |
| 542 | Ga0495604_0046745 | 3300047317 | Bacteria | 3374 |
| 543 | Ga0495604_0066407 | 3300047317 | Bacteria | 2744 |
| 544 | Ga0495604_0071564 | 3300047317 | Bacteria | 2623 |
| 545 | Ga0495674_0001113 | 3300047319 | Bacteria | 25841 |
| 546 | Ga0495674_0069542 | 3300047319 | Bacteria | 3044 |
| 547 | Ga0495674_0277978 | 3300047319 | Bacteria | 1372 |
| 548 | Ga0495676_0003749 | 3300047321 | Bacteria | 13806 |
| 549 | Ga0495676_0006243 | 3300047321 | Bacteria | 10966 |
| 550 | Ga0495676_0198265 | 3300047321 | Bacteria | 1396 |
| 551 | Ga0495676_0246594 | 3300047321 | Bacteria | 1220 |
| 552 | Ga0495680_0000451 | 3300047322 | Bacteria | 45992 |
| 553 | Ga0495680_0006850 | 3300047322 | Bacteria | 10527 |
| 554 | Ga0495680_0030465 | 3300047322 | Bacteria | 4405 |
| 555 | Ga0495680_0042195 | 3300047322 | Bacteria | 3622 |
| 556 | Ga0495684_0013902 | 3300047471 | Bacteria | 6191 |
| 557 | Ga0495684_0027149 | 3300047471 | Bacteria | 4395 |
| 558 | Ga0495684_0182486 | 3300047471 | Bacteria | 1555 |
| 559 | Ga0495684_0211828 | 3300047471 | Bacteria | 1424 |
| 560 | Ga0495593_0005695 | 3300047673 | Bacteria | 7351 |
| 561 | Ga0495593_0114345 | 3300047673 | Bacteria | 1376 |
| 562 | Ga0495602_0016438 | 3300048088 | Bacteria | 7442 |
| 563 | Ga0495602_0044949 | 3300048088 | Bacteria | 4001 |
| 564 | Ga0495602_0071751 | 3300048088 | Bacteria | 2956 |
| 565 | Ga0496100_0005266 | 3300048903 | Bacteria | 6951 |
| 566 | Ga0496100_0008696 | 3300048903 | Bacteria | 5672 |
| 567 | Ga0496100_0011825 | 3300048903 | Bacteria | 4980 |
| 568 | Ga0496100_0018554 | 3300048903 | Bacteria | 4128 |
| 569 | Ga0496100_0057478 | 3300048903 | Bacteria | 2548 |
| 570 | Ga0496100_0061115 | 3300048903 | Bacteria | 2482 |
| 571 | Ga0496100_0113016 | 3300048903 | Bacteria | 1890 |
| 572 | Ga0496101_0000460 | 3300048904 | Bacteria | 25835 |
| 573 | Ga0496101_0010491 | 3300048904 | Bacteria | 6119 |
| 574 | Ga0496101_0020347 | 3300048904 | Bacteria | 4540 |
| 575 | Ga0496101_0076231 | 3300048904 | Bacteria | 2470 |
| 576 | Ga0496102_0013660 | 3300048905 | Bacteria | 7037 |
| 577 | Ga0496102_0030684 | 3300048905 | Bacteria | 4812 |
| 578 | Ga0496102_0115060 | 3300048905 | Bacteria | 2510 |
| 579 | Ga0496102_0428958 | 3300048905 | Bacteria | 1241 |
| 580 | Ga0496103_0007951 | 3300048906 | Bacteria | 6301 |
| 581 | Ga0496103_0025030 | 3300048906 | Bacteria | 3605 |
| 582 | Ga0496103_0055182 | 3300048906 | Bacteria | 2464 |
| 583 | Ga0496103_0075065 | 3300048906 | Bacteria | 2120 |
| 584 | Ga0496103_0102729 | 3300048906 | Bacteria | 1810 |
| 585 | Ga0496104_0001177 | 3300048907 | Bacteria | 22467 |
| 586 | Ga0496104_0010088 | 3300048907 | Bacteria | 8434 |
| 587 | Ga0496104_0012857 | 3300048907 | Bacteria | 7539 |
| 588 | Ga0496104_0043205 | 3300048907 | Bacteria | 4233 |
| 589 | Ga0496104_0071991 | 3300048907 | Bacteria | 3287 |
| 590 | Ga0496104_0218370 | 3300048907 | Bacteria | 1819 |
| 591 | Ga0496104_0288718 | 3300048907 | Bacteria | 1553 |
| 592 | Ga0496105_0000509 | 3300048908 | Bacteria | 25615 |
| 593 | Ga0496105_0012076 | 3300048908 | Bacteria | 6839 |
| 594 | Ga0496105_0056339 | 3300048908 | Bacteria | 3244 |
| 595 | Ga0496105_0074921 | 3300048908 | Bacteria | 2796 |
| 596 | Ga0496105_0115847 | 3300048908 | Bacteria | 2210 |
| 597 | Ga0496106_0000764 | 3300048909 | Bacteria | 23260 |
| 598 | Ga0496106_0005209 | 3300048909 | Bacteria | 9630 |
| 599 | Ga0496106_0011630 | 3300048909 | Bacteria | 6505 |
| 600 | Ga0496106_0012315 | 3300048909 | Bacteria | 6312 |
| 601 | Ga0496107_0010708 | 3300048910 | Bacteria | 6378 |
| 602 | Ga0496107_0024338 | 3300048910 | Bacteria | 4284 |
| 603 | Ga0496107_0284518 | 3300048910 | Bacteria | 1231 |
| 604 | Ga0496108_0003345 | 3300048911 | Bacteria | 12882 |
| 605 | Ga0496108_0004025 | 3300048911 | Bacteria | 11796 |
| 606 | Ga0496108_0050162 | 3300048911 | Bacteria | 3493 |
| 607 | Ga0496108_0058738 | 3300048911 | Bacteria | 3234 |
| 608 | Ga0496108_0061807 | 3300048911 | Bacteria | 3153 |
| 609 | Ga0496108_0384352 | 3300048911 | Unclassified | 1226 |
| 610 | Ga0496109_0002080 | 3300048912 | Bacteria | 16632 |
| 611 | Ga0496109_0004246 | 3300048912 | Bacteria | 11964 |
| 612 | Ga0496109_0024336 | 3300048912 | Bacteria | 5382 |
| 613 | Ga0496109_0029251 | 3300048912 | Bacteria | 4934 |
| 614 | Ga0496109_0122093 | 3300048912 | Bacteria | 2427 |
| 615 | Ga0496110_0005214 | 3300048913 | Bacteria | 10169 |
| 616 | Ga0496110_0013464 | 3300048913 | Bacteria | 6763 |
| 617 | Ga0496110_0043163 | 3300048913 | Bacteria | 3937 |
| 618 | Ga0496110_0058309 | 3300048913 | Bacteria | 3401 |
| 619 | Ga0496110_0133539 | 3300048913 | Bacteria | 2242 |
| 620 | Ga0496111_0000239 | 3300048914 | Bacteria | 26296 |
| 621 | Ga0496111_0025694 | 3300048914 | Bacteria | 4155 |
| 622 | Ga0496111_0049332 | 3300048914 | Bacteria | 3035 |
| 623 | Ga0496111_0098067 | 3300048914 | Bacteria | 2152 |
| 624 | Ga0496111_0151494 | 3300048914 | Bacteria | 1720 |
| 625 | Ga0496111_0178376 | 3300048914 | Bacteria | 1579 |
| 626 | Ga0496111_0190079 | 3300048914 | Unclassified | 1526 |
| 627 | Ga0496112_0003889 | 3300048915 | Bacteria | 12491 |
| 628 | Ga0496112_0009134 | 3300048915 | Bacteria | 8906 |
| 629 | Ga0496112_0027162 | 3300048915 | Bacteria | 5518 |
| 630 | Ga0496112_0030674 | 3300048915 | Bacteria | 5206 |
| 631 | Ga0496112_0049846 | 3300048915 | Bacteria | 4105 |
| 632 | Ga0496112_0134024 | 3300048915 | Bacteria | 2448 |
| 633 | Ga0496112_0135424 | 3300048915 | Bacteria | 2434 |
| 634 | Ga0496112_0269003 | 3300048915 | Bacteria | 1653 |
| 635 | Ga0496112_0293617 | 3300048915 | Bacteria | 1571 |
| 636 | Ga0496112_0477874 | 3300048915 | Bacteria | 1183 |
| 637 | Ga0496113_0419778 | 3300048916 | Bacteria | 1074 |
| 638 | Ga0496114_0010787 | 3300048917 | Bacteria | 7272 |
| 639 | Ga0496114_0014457 | 3300048917 | Bacteria | 6340 |
| 640 | Ga0496114_0023791 | 3300048917 | Bacteria | 4999 |
| 641 | Ga0496114_0043467 | 3300048917 | Bacteria | 3725 |
| 642 | Ga0496114_0056263 | 3300048917 | Bacteria | 3282 |
| 643 | Ga0496114_0078968 | 3300048917 | Bacteria | 2777 |
| 644 | Ga0496114_0106909 | 3300048917 | Bacteria | 2394 |
| 645 | Ga0496114_0180011 | 3300048917 | Bacteria | 1846 |
| 646 | Ga0496115_0002569 | 3300048918 | Bacteria | 13033 |
| 647 | Ga0496115_0009438 | 3300048918 | Bacteria | 7249 |
| 648 | Ga0496115_0013585 | 3300048918 | Bacteria | 6161 |
| 649 | Ga0496115_0063751 | 3300048918 | Bacteria | 2973 |
| 650 | Ga0496115_0063936 | 3300048918 | Bacteria | 2970 |
| 651 | Ga0496115_0085179 | 3300048918 | Bacteria | 2577 |
| 652 | Ga0496115_0241913 | 3300048918 | Bacteria | 1487 |
| 653 | Ga0501031_0018633 | 3300049568 | Bacteria | 4520 |
| 654 | Ga0501031_0225572 | 3300049568 | Bacteria | 1220 |
| 655 | Ga0501034_0014370 | 3300049571 | Bacteria | 8158 |
| 656 | Ga0501034_0241977 | 3300049571 | Bacteria | 1750 |
| 657 | Ga0501036_0008950 | 3300049572 | Bacteria | 8230 |
| 658 | Ga0501036_0327545 | 3300049572 | Bacteria | 1280 |
| 659 | Ga0501037_0014663 | 3300049573 | Bacteria | 5765 |
| 660 | Ga0501038_0011208 | 3300049574 | Bacteria | 8184 |
| 661 | Ga0501039_0010479 | 3300049575 | Bacteria | 7063 |
| 662 | Ga0501040_0012318 | 3300049576 | Bacteria | 5602 |
| 663 | Ga0501041_0052366 | 3300049577 | Bacteria | 2488 |
| 664 | Ga0501042_0002586 | 3300049578 | Bacteria | 11131 |
| 665 | Ga0501046_0014344 | 3300049580 | Bacteria | 6690 |
| 666 | Ga0501047_0025549 | 3300049581 | Bacteria | 5678 |
| 667 | Ga0501047_0056454 | 3300049581 | Bacteria | 3797 |
| 668 | Ga0501047_0165183 | 3300049581 | Bacteria | 2084 |
| 669 | Ga0501047_0267237 | 3300049581 | Bacteria | 1557 |
| 670 | Ga0501067_0015473 | 3300049583 | Bacteria | 4223 |
| 671 | Ga0501067_0045049 | 3300049583 | Bacteria | 2450 |
| 672 | Ga0501067_0104356 | 3300049583 | Bacteria | 1575 |
| 673 | Ga0501068_0008628 | 3300049584 | Bacteria | 5680 |
| 674 | Ga0501069_0027868 | 3300049585 | Bacteria | 3096 |
| 675 | Ga0501069_0041601 | 3300049585 | Bacteria | 2540 |
| 676 | Ga0501069_0099973 | 3300049585 | Bacteria | 1646 |
| 677 | Ga0501070_0007509 | 3300049586 | Bacteria | 9263 |
| 678 | Ga0501070_0009055 | 3300049586 | Bacteria | 8421 |
| 679 | Ga0501070_0018550 | 3300049586 | Bacteria | 5837 |
| 680 | Ga0501070_0026784 | 3300049586 | Bacteria | 4835 |
| 681 | Ga0501070_0053082 | 3300049586 | Bacteria | 3363 |
| 682 | Ga0501070_0150912 | 3300049586 | Bacteria | 1917 |
| 683 | Ga0501072_0007793 | 3300049588 | Bacteria | 8135 |
| 684 | Ga0501072_0019821 | 3300049588 | Bacteria | 5204 |
| 685 | Ga0501073_0010896 | 3300049589 | Bacteria | 6651 |
| 686 | Ga0501073_0031236 | 3300049589 | Bacteria | 3800 |
| 687 | Ga0501073_0090168 | 3300049589 | Bacteria | 2131 |
| 688 | Ga0501074_0013691 | 3300049590 | Bacteria | 5895 |
| 689 | Ga0501074_0014259 | 3300049590 | Bacteria | 5780 |
| 690 | Ga0501074_0015975 | 3300049590 | Bacteria | 5458 |
| 691 | Ga0501074_0032333 | 3300049590 | Bacteria | 3790 |
| 692 | Ga0501074_0068150 | 3300049590 | Bacteria | 2558 |
| 693 | Ga0501074_0167209 | 3300049590 | Bacteria | 1570 |
| 694 | Ga0501075_0010008 | 3300049591 | Bacteria | 6650 |
| 695 | Ga0501079_0013006 | 3300049741 | Bacteria | 6349 |
| 696 | Ga0501079_0055413 | 3300049741 | Bacteria | 3059 |
| 697 | Ga0501080_0000991 | 3300049742 | Bacteria | 23252 |
| 698 | Ga0501080_0006430 | 3300049742 | Bacteria | 10544 |
| 699 | Ga0501080_0042478 | 3300049742 | Bacteria | 4233 |
| 700 | Ga0501080_0080961 | 3300049742 | Bacteria | 3017 |
| 701 | Ga0501080_0275685 | 3300049742 | Bacteria | 1530 |
| 702 | Ga0501080_0332720 | 3300049742 | Bacteria | 1373 |
| 703 | Ga0501083_0004302 | 3300049744 | Bacteria | 10028 |
| 704 | Ga0501083_0025559 | 3300049744 | Bacteria | 4088 |
| 705 | Ga0501035_0024005 | 3300049822 | Bacteria | 5595 |
| 706 | nmdc:mga0yw44_160875_c1 | 3300050492 | Bacteria | 1470 |
| 707 | nmdc:mga05p37_147272_c1 | 3300050507 | Bacteria | 2882 |
| 708 | nmdc:mga05p37_21119_c1 | 3300050507 | Bacteria | 7881 |
| 709 | nmdc:mga05p37_29484_c1 | 3300050507 | Bacteria | 6696 |
| 710 | nmdc:mga05p37_38312_c1 | 3300050507 | Bacteria | 5880 |
| 711 | nmdc:mga05p37_542748_c1 | 3300050507 | Bacteria | 1325 |
| 712 | nmdc:mga05p37_75207_c1 | 3300050507 | Bacteria | 4157 |
| 713 | nmdc:mga09592_442661_c1 | 3300050508 | Bacteria | 1121 |
| 714 | nmdc:mga06r32_111554_c1 | 3300050510 | Bacteria | 2691 |
| 715 | nmdc:mga06r32_178490_c1 | 3300050510 | Bacteria | 2109 |
| 716 | nmdc:mga06r32_211709_c1 | 3300050510 | Bacteria | 1926 |
| 717 | nmdc:mga06r32_42991_c1 | 3300050510 | Bacteria | 4298 |
| 718 | nmdc:mga08y16_24059_c1 | 3300050511 | Bacteria | 6431 |
| 719 | nmdc:mga08y16_323944_c1 | 3300050511 | Bacteria | 1586 |
| 720 | nmdc:mga08y16_70521_c1 | 3300050511 | Bacteria | 3643 |
| 721 | nmdc:mga0n895_33547_c1 | 3300050512 | Bacteria | 4935 |
| 722 | nmdc:mga0n895_76950_c1 | 3300050512 | Bacteria | 3318 |
| 723 | nmdc:mga0rr50_42992_c1 | 3300050513 | Bacteria | 3303 |
| 724 | nmdc:mga08x19_23422_c1 | 3300050514 | Bacteria | 3831 |
| 725 | nmdc:mga0a205_26187_c1 | 3300050515 | Bacteria | 5558 |
| 726 | nmdc:mga0a205_5450_c1 | 3300050515 | Bacteria | 11464 |
| 727 | nmdc:mga0a205_96919_c1 | 3300050515 | Bacteria | 2849 |
| 728 | Ga0495601_0046474 | 3300053077 | Bacteria | 2733 |
| 729 | Ga0495612_0037591 | 3300053078 | Bacteria | 1967 |
| 730 | Ga0495612_0079909 | 3300053078 | Bacteria | 1373 |
| 731 | Ga0495655_0022592 | 3300053083 | Bacteria | 1439 |
| 732 | Ga0495595_0026718 | 3300053084 | Bacteria | 2566 |
| 733 | Ga0495619_0002974 | 3300053085 | Bacteria | 11004 |
| 734 | Ga0495619_0056252 | 3300053085 | Bacteria | 2607 |
| 735 | Ga0495619_0066794 | 3300053085 | Bacteria | 2400 |
| 736 | Ga0501084_0015219 | 3300054114 | Bacteria | 6378 |
| 737 | Ga0501084_0043896 | 3300054114 | Bacteria | 3741 |
| 738 | Ga0466962_0000292 | 3300061719 | Bacteria | 21309 |
| 739 | Ga0466962_0046748 | 3300061719 | Bacteria | 2068 |
| 740 | Ga0530510_0029398 | 3300061734 | Bacteria | 3944 |
| 741 | Ga0530510_0041240 | 3300061734 | Bacteria | 3332 |
| 742 | Ga0530510_0144149 | 3300061734 | Bacteria | 1756 |
| 743 | Ga0395899_0032320 | |||
| 744 | JGI24742J22300_10014015 | |||
| 745 | JGI25407J50210_10000170 | |||
| 746 | JGI25407J50210_10020677 | |||
| 747 | JGI25407J50210_10022634 | |||
| 748 | Ga0070658_10021724 | |||
| 749 | Ga0070658_10040945 | |||
| 750 | Ga0070658_10049115 | |||
| 751 | Ga0070658_10072397 | |||
| 752 | Ga0070658_10203105 | |||
| 753 | Ga0070683_100001509 | |||
| 754 | Ga0070683_100022643 | |||
| 755 | Ga0070683_100031073 | |||
| 756 | Ga0070683_100066977 | |||
| 757 | Ga0070683_100096319 | |||
| 758 | Ga0070683_100165394 | |||
| 759 | Ga0070683_100186591 | |||
| 760 | Ga0070690_100049642 | |||
| 761 | Ga0070680_100005741 | |||
| 762 | Ga0070680_100026001 | |||
| 763 | Ga0070680_100191338 | |||
| 764 | Ga0070680_100285062 | |||
| 765 | Ga0070682_100008373 | |||
| 766 | Ga0070682_100127875 | |||
| 767 | Ga0070682_100147906 | |||
| 768 | Ga0068868_100108173 | |||
| 769 | Ga0068868_100364224 | |||
| 770 | Ga0070660_100000742 | |||
| 771 | Ga0070660_100007066 | |||
| 772 | Ga0070660_100009347 | |||
| 773 | Ga0070660_100010446 | |||
| 774 | Ga0070660_100017422 | |||
| 775 | Ga0070660_100138835 | |||
| 776 | Ga0070689_100022501 | |||
| 777 | Ga0070687_100058918 | |||
| 778 | Ga0070661_100015356 | |||
| 779 | Ga0070692_10182161 | |||
| 780 | Ga0070668_100115357 | |||
| 781 | Ga0070669_100194089 | |||
| 782 | Ga0070674_100002426 | |||
| 783 | Ga0070688_100027481 | |||
| 784 | Ga0070659_100023533 | |||
| 785 | Ga0070659_100023797 | |||
| 786 | Ga0070659_100030352 | |||
| 787 | Ga0070659_100238672 | |||
| 788 | Ga0070667_100235162 | |||
| 789 | Ga0070703_10009359 | |||
| 790 | Ga0070709_10015703 | |||
| 791 | Ga0070714_100060907 | |||
| 792 | Ga0070713_100018901 | |||
| 793 | Ga0070713_100024444 | |||
| 794 | Ga0070710_10023061 | |||
| 795 | Ga0070701_10094634 | |||
| 796 | Ga0070711_100005144 | |||
| 797 | Ga0070711_100014909 | |||
| 798 | Ga0070711_100016052 | |||
| 799 | Ga0070700_100001911 | |||
| 800 | Ga0070694_100009437 | |||
| 801 | Ga0070694_100066690 | |||
| 802 | Ga0070708_100218482 | |||
| 803 | Ga0070678_100009478 | |||
| 804 | Ga0070662_100229577 | |||
| 805 | Ga0070681_10017419 | |||
| 806 | Ga0070681_10020576 | |||
| 807 | Ga0070681_10036211 | |||
| 808 | Ga0070681_10060398 | |||
| 809 | Ga0070681_10087310 | |||
| 810 | Ga0070681_10292148 | |||
| 811 | Ga0068867_100021971 | |||
| 812 | Ga0070685_10039590 | |||
| 813 | Ga0070706_100059102 | |||
| 814 | Ga0070706_100258978 | |||
| 815 | Ga0070698_100005166 | |||
| 816 | Ga0070698_100039268 | |||
| 817 | Ga0070699_100003986 | |||
| 818 | Ga0070699_100062007 | |||
| 819 | Ga0070699_100072185 | |||
| 820 | Ga0070699_100108179 | |||
| 821 | Ga0070699_100176642 | |||
| 822 | Ga0070679_100013893 | |||
| 823 | Ga0070679_100070922 | |||
| 824 | Ga0070679_100091915 | |||
| 825 | Ga0070679_100093918 | |||
| 826 | Ga0070679_100127968 | |||
| 827 | Ga0070684_100000278 | |||
| 828 | Ga0070684_100044944 | |||
| 829 | Ga0070684_100053474 | |||
| 830 | Ga0070684_100086078 | |||
| 831 | Ga0070684_100328324 | |||
| 832 | Ga0070672_100040274 | |||
| 833 | Ga0070686_100004281 | |||
| 834 | Ga0070686_100045440 | |||
| 835 | Ga0070695_100117268 | |||
| 836 | Ga0070693_100030059 | |||
| 837 | Ga0070665_100044504 | |||
| 838 | Ga0070704_100030522 | |||
| 839 | Ga0070704_100312786 | |||
| 840 | Ga0068855_100011179 | |||
| 841 | Ga0068855_100025163 | |||
| 842 | Ga0068855_100043723 | |||
| 843 | Ga0068855_100044823 | |||
| 844 | Ga0068855_100060057 | |||
| 845 | Ga0068855_100097778 | |||
| 846 | Ga0068855_100214696 | |||
| 847 | Ga0068855_100250789 | |||
| 848 | Ga0068855_100296241 | |||
| 849 | Ga0070664_100363046 | |||
| 850 | Ga0068857_100004024 | |||
| 851 | Ga0068857_100114854 | |||
| 852 | Ga0068854_100019060 | |||
| 853 | Ga0068856_100016239 | |||
| 854 | Ga0068856_100102507 | |||
| 855 | Ga0068856_100202897 | |||
| 856 | Ga0070702_100006516 | |||
| 857 | Ga0068852_100016126 | |||
| 858 | Ga0068859_100423426 | |||
| 859 | Ga0068866_10005110 | |||
| 860 | Ga0068861_100034636 | |||
| 861 | Ga0068860_100055059 | |||
| 862 | Ga0081455_10026010 | |||
| 863 | Ga0081455_10093278 | |||
| 864 | Ga0081538_10000492 | |||
| 865 | Ga0081538_10001664 | |||
| 866 | Ga0081538_10002218 | |||
| 867 | Ga0081540_1001344 | |||
| 868 | Ga0081539_10000427 | |||
| 869 | Ga0081539_10007917 | |||
| 870 | Ga0070717_10157149 | |||
| 871 | Ga0075364_10002132 | |||
| 872 | Ga0070716_100183350 | |||
| 873 | Ga0070712_100161600 | |||
| 874 | Ga0070712_100193808 | |||
| 875 | Ga0075362_10028257 | |||
| 876 | Ga0097621_100030779 | |||
| 877 | Ga0097621_100331360 | |||
| 878 | Ga0068871_100015752 | |||
| 879 | Ga0075428_100099719 | |||
| 880 | Ga0075428_100301066 | |||
| 881 | Ga0075430_100197191 | |||
| 882 | Ga0075431_100050987 | |||
| 883 | Ga0075431_100060443 | |||
| 884 | Ga0075431_100099732 | |||
| 885 | Ga0075431_100133052 | |||
| 886 | Ga0075433_10003194 | |||
| 887 | Ga0075433_10004851 | |||
| 888 | Ga0075433_10037537 | |||
| 889 | Ga0075433_10081697 | |||
| 890 | Ga0075434_100003439 | |||
| 891 | Ga0075434_100003491 | |||
| 892 | Ga0075434_100045719 | |||
| 893 | Ga0075434_100286207 | |||
| 894 | Ga0068865_100001311 | |||
| 895 | Ga0068865_100043278 | |||
| 896 | Ga0075436_100002304 | |||
| 897 | Ga0075436_100049376 | |||
| 898 | Ga0097620_100423410 | |||
| 899 | Ga0075435_100005413 | |||
| 900 | Ga0075435_100005887 | |||
| 901 | Ga0075435_100011438 | |||
| 902 | Ga0105240_10026395 | |||
| 903 | Ga0105240_10096505 | |||
| 904 | Ga0111539_10015143 | |||
| 905 | Ga0111539_10015626 | |||
| 906 | Ga0111539_10023141 | |||
| 907 | Ga0111539_10095724 | |||
| 908 | Ga0111539_10282162 | |||
| 909 | Ga0111539_10617970 | |||
| 910 | Ga0111539_10727044 | |||
| 911 | Ga0105245_10038628 | |||
| 912 | Ga0105245_10116272 | |||
| 913 | Ga0105245_10120016 | |||
| 914 | Ga0105245_10473098 | |||
| 915 | Ga0114129_10001381 | |||
| 916 | Ga0114129_10006178 | |||
| 917 | Ga0114129_10019128 | |||
| 918 | Ga0114129_10029149 | |||
| 919 | Ga0114129_10038724 | |||
| 920 | Ga0114129_10193025 | |||
| 921 | Ga0114129_10224783 | |||
| 922 | Ga0114129_10382467 | |||
| 923 | Ga0105243_10015194 | |||
| 924 | Ga0105243_10054333 | |||
| 925 | Ga0105241_10107904 | |||
| 926 | Ga0105242_10016564 | |||
| 927 | Ga0105242_10065304 | |||
| 928 | Ga0105248_10025473 | |||
| 929 | Ga0105248_10278921 | |||
| 930 | Ga0105248_10300097 | |||
| 931 | Ga0105237_10206194 | |||
| 932 | Ga0105238_10103870 | |||
| 933 | Ga0105249_10004393 | |||
| 934 | Ga0105249_10013589 | |||
| 935 | Ga0105239_10050473 | |||
| 936 | Ga0105239_10082616 | |||
| 937 | Ga0105239_10457836 | |||
| 938 | Ga0157373_10065948 | |||
| 939 | Ga0157371_10101022 | |||
| 940 | Ga0157370_10012124 | |||
| 941 | Ga0157370_10033841 | |||
| 942 | Ga0157370_10085305 | |||
| 943 | Ga0157370_10117652 | |||
| 944 | Ga0157369_10003011 | |||
| 945 | Ga0157369_10122917 | |||
| 946 | Ga0157369_10142706 | |||
| 947 | Ga0157374_10036355 | |||
| 948 | Ga0157378_10317636 | |||
| 949 | Ga0163162_10019155 | |||
| 950 | Ga0157372_10346954 | |||
| 951 | Ga0157375_10290386 | |||
| 952 | Ga0157375_10335832 | |||
| 953 | Ga0163163_10483274 | |||
| 954 | Ga0157380_10023630 | |||
| 955 | Ga0157380_10086700 | |||
| 956 | Ga0182008_10005314 | |||
| 957 | Ga0157377_10096344 | |||
| 958 | Ga0157376_10082408 | |||
| 959 | Ga0157376_10231779 | |||
| 960 | Ga0182006_1025671 | |||
| 961 | Ga0163161_10047861 | |||
| 962 | Ga0206356_11599872 | |||
| 963 | Ga0206353_10421368 | |||
| 964 | Ga0206353_11575940 | |||
| 965 | Ga0206353_11621997 | |||
| 966 | Ga0207653_10021654 | |||
| 967 | Ga0207642_10065073 | |||
| 968 | Ga0207699_10060890 | |||
| 969 | Ga0207699_10305299 | |||
| 970 | Ga0207705_10069424 | |||
| 971 | Ga0207705_10072066 | |||
| 972 | Ga0207705_10375190 | |||
| 973 | Ga0207707_10032607 | |||
| 974 | Ga0207707_10033240 | |||
| 975 | Ga0207707_10067376 | |||
| 976 | Ga0207707_10090501 | |||
| 977 | Ga0207707_10335261 | |||
| 978 | Ga0207695_10060005 | |||
| 979 | Ga0207693_10001537 | |||
| 980 | Ga0207693_10178139 | |||
| 981 | Ga0207663_10009584 | |||
| 982 | Ga0207663_10055932 | |||
| 983 | Ga0207660_10006990 | |||
| 984 | Ga0207660_10008142 | |||
| 985 | Ga0207660_10031984 | |||
| 986 | Ga0207660_10178166 | |||
| 987 | Ga0207662_10017739 | |||
| 988 | Ga0207662_10090990 | |||
| 989 | Ga0207657_10000150 | |||
| 990 | Ga0207657_10001085 | |||
| 991 | Ga0207657_10002795 | |||
| 992 | Ga0207657_10014969 | |||
| 993 | Ga0207657_10017118 | |||
| 994 | Ga0207657_10020811 | |||
| 995 | Ga0207657_10021272 | |||
| 996 | Ga0207657_10045537 | |||
| 997 | Ga0207657_10052406 | |||
| 998 | Ga0207657_10073012 | |||
| 999 | Ga0207657_10133245 | |||
| 1000 | Ga0207652_10051617 | |||
| 1001 | Ga0207652_10052173 | |||
| 1002 | Ga0207652_10078178 | |||
| 1003 | Ga0207652_10166382 | |||
| 1004 | Ga0207652_10189081 | |||
| 1005 | Ga0207652_10374483 | |||
| 1006 | Ga0207659_10344031 | |||
| 1007 | Ga0207687_10006594 | |||
| 1008 | Ga0207687_10049029 | |||
| 1009 | Ga0207700_10000021 | |||
| 1010 | Ga0207700_10286053 | |||
| 1011 | Ga0207664_10036757 | |||
| 1012 | Ga0207690_10013075 | |||
| 1013 | Ga0207706_10084349 | |||
| 1014 | Ga0207686_10007141 | |||
| 1015 | Ga0207686_10033014 | |||
| 1016 | Ga0207686_10072979 | |||
| 1017 | Ga0207709_10002924 | |||
| 1018 | Ga0207670_10020461 | |||
| 1019 | Ga0207669_10010478 | |||
| 1020 | Ga0207704_10005826 | |||
| 1021 | Ga0207665_10014902 | |||
| 1022 | Ga0207665_10146862 | |||
| 1023 | Ga0207691_10035082 | |||
| 1024 | Ga0207711_10226916 | |||
| 1025 | Ga0207661_10012236 | |||
| 1026 | Ga0207661_10022256 | |||
| 1027 | Ga0207661_10062350 | |||
| 1028 | Ga0207661_10069766 | |||
| 1029 | Ga0207661_10110434 | |||
| 1030 | Ga0207661_10408389 | |||
| 1031 | Ga0207667_10035948 | |||
| 1032 | Ga0207667_10046219 | |||
| 1033 | Ga0207667_10185637 | |||
| 1034 | Ga0207667_10342298 | |||
| 1035 | Ga0207667_10616215 | |||
| 1036 | Ga0207712_10030896 | |||
| 1037 | Ga0207677_10274179 | |||
| 1038 | Ga0207677_10280650 | |||
| 1039 | Ga0207639_10095151 | |||
| 1040 | Ga0207678_10011184 | |||
| 1041 | Ga0207678_10266835 | |||
| 1042 | Ga0207708_10000447 | |||
| 1043 | Ga0207708_10041076 | |||
| 1044 | Ga0207702_10158957 | |||
| 1045 | Ga0207641_10216257 | |||
| 1046 | Ga0207648_10001449 | |||
| 1047 | Ga0207674_10000863 | |||
| 1048 | Ga0207674_10027030 | |||
| 1049 | Ga0207674_10093597 | |||
| 1050 | Ga0207674_10163396 | |||
| 1051 | Ga0207675_100013590 | |||
| 1052 | Ga0207675_100033310 | |||
| 1053 | Ga0207683_10008535 | |||
| 1054 | Ga0207698_10078710 | |||
| 1055 | Ga0207698_10112247 | |||
| 1056 | Ga0207698_10343113 | |||
| 1057 | Ga0207428_10034955 | |||
| 1058 | Ga0207428_10039813 | |||
| 1059 | Ga0268264_10115972 | |||
| 1060 | Ga0268264_10299949 | |||
| 1061 | Ga0265326_10008864 | |||
| 1062 | Ga0265325_10010492 | |||
| 1063 | Ga0265327_10012208 | |||
| 1064 | Ga0307408_100281543 | |||
| 1065 | Ga0265314_10011624 | |||
| 1066 | Ga0265342_10006813 | |||
| 1067 | Ga0307416_100033055 | |||
| 1068 | Ga0373926_0035321 | |||
| 1069 | Ga0373944_0044311 | |||
| 1070 | Ga0373945_0009438 | |||
| 1071 | Ga0373943_0003300 | |||
| 1072 | Ga0373943_0004089 | |||
| 1073 | Ga0373943_0026317 | |||
| 1074 | Ga0373946_0006834 | |||
| 1075 | Ga0373924_0028689 | |||
| 1076 | Ga0373927_0277886 | |||
| 1077 | Ga0373947_0002021 | |||
| 1078 | Ga0373947_0033040 | |||
| 1079 | Ga0373937_0141210 | |||
| 1080 | Ga0373937_0176816 | |||
| 1081 | Ga0373925_0007843 | |||
| 1082 | Ga0373925_0043112 | |||
| 1083 | Ga0373925_0135891 | |||
| 1084 | Ga0395899_0000921 | |||
| 1085 | Ga0395899_0004606 | |||
| 1086 | Ga0395899_0012501 | |||
| 1087 | Ga0395899_0047090 | |||
| 1088 | Ga0395899_0069478 | |||
| 1089 | Ga0395899_0088216 | |||
| 1090 | Ga0395899_0105194 | |||
| 1091 | Ga0395899_0172039 | |||
| 1092 | Ga0395900_0002725 | |||
| 1093 | Ga0395900_0004525 | |||
| 1094 | Ga0395900_0007949 | |||
| 1095 | Ga0395900_0009949 | |||
| 1096 | Ga0395900_0009967 | |||
| 1097 | Ga0395900_0011306 | |||
| 1098 | Ga0395900_0020230 | |||
| 1099 | Ga0395900_0021258 | |||
| 1100 | Ga0395900_0035747 | |||
| 1101 | Ga0395900_0039528 | |||
| 1102 | Ga0395900_0055214 | |||
| 1103 | Ga0395900_0073366 | |||
| 1104 | Ga0395900_0084843 | |||
| 1105 | Ga0395900_0106004 | |||
| 1106 | Ga0395900_0107855 | |||
| 1107 | Ga0395900_0124754 | |||
| 1108 | Ga0395898_0001403 | |||
| 1109 | Ga0395898_0002309 | |||
| 1110 | Ga0395898_0003108 | |||
| 1111 | Ga0395898_0004586 | |||
| 1112 | Ga0395898_0006398 | |||
| 1113 | Ga0395898_0006592 | |||
| 1114 | Ga0395898_0011120 | |||
| 1115 | Ga0395898_0017311 | |||
| 1116 | Ga0395898_0019283 | |||
| 1117 | Ga0395898_0020119 | |||
| 1118 | Ga0395898_0025158 | |||
| 1119 | Ga0395898_0033779 | |||
| 1120 | Ga0395898_0044814 | |||
| 1121 | Ga0395898_0045365 | |||
| 1122 | Ga0395898_0062885 | |||
| 1123 | Ga0395898_0087872 | |||
| 1124 | Ga0395898_0098421 | |||
| 1125 | Ga0395898_0099297 | |||
| 1126 | Ga0395898_0107948 | |||
| 1127 | Ga0395898_0189841 | |||
| 1128 | Ga0395898_0332617 | |||
| 1129 | Ga0395898_0411008 | |||
| 1130 | Ga0395905_0001294 | |||
| 1131 | Ga0395905_0003029 | |||
| 1132 | Ga0395905_0003158 | |||
| 1133 | Ga0395905_0008964 | |||
| 1134 | Ga0395905_0010383 | |||
| 1135 | Ga0395905_0010714 | |||
| 1136 | Ga0395905_0021031 | |||
| 1137 | Ga0395905_0036646 | |||
| 1138 | Ga0395905_0049871 | |||
| 1139 | Ga0395905_0069786 | |||
| 1140 | Ga0395905_0140287 | |||
| 1141 | Ga0395905_0154089 | |||
| 1142 | Ga0395905_0225670 | |||
| 1143 | Ga0395905_0304029 | |||
| 1144 | Ga0395905_0458306 | |||
| 1145 | Ga0395905_0500231 | |||
| 1146 | Ga0395905_0523199 | |||
| 1147 | Ga0395901_0000478 | |||
| 1148 | Ga0395901_0002362 | |||
| 1149 | Ga0395901_0004338 | |||
| 1150 | Ga0395901_0005627 | |||
| 1151 | Ga0395901_0007489 | |||
| 1152 | Ga0395901_0021451 | |||
| 1153 | Ga0395901_0028223 | |||
| 1154 | Ga0395901_0036835 | |||
| 1155 | Ga0395901_0041519 | |||
| 1156 | Ga0395901_0041653 | |||
| 1157 | Ga0395901_0042964 | |||
| 1158 | Ga0395901_0045398 | |||
| 1159 | Ga0395901_0067658 | |||
| 1160 | Ga0395901_0071554 | |||
| 1161 | Ga0395901_0087361 | |||
| 1162 | Ga0395901_0103160 | |||
| 1163 | Ga0395901_0106288 | |||
| 1164 | Ga0395901_0122156 | |||
| 1165 | Ga0395901_0174525 | |||
| 1166 | Ga0395901_0191097 | |||
| 1167 | Ga0395901_0193020 | |||
| 1168 | Ga0395901_0250949 | |||
| 1169 | Ga0395901_0315833 | |||
| 1170 | Ga0451789_1063148 | |||
| 1171 | Ga0451793_0231043 | |||
| 1172 | Ga0451795_0821794 | |||
| 1173 | Ga0451802_0438937 | |||
| 1174 | Ga0451849_0309738 | |||
| 1175 | Ga0451853_1008775 | |||
| 1176 | Ga0439454_002115 | |||
| 1177 | Ga0450920_010048 | |||
| 1178 | Ga0439446_0011133 | |||
| 1179 | Ga0466961_0014856 | |||
| 1180 | Ga0466961_0213057 | |||
| 1181 | Ga0466963_0001590 | |||
| 1182 | Ga0466963_0007079 | |||
| 1183 | Ga0466963_0013998 | |||
| 1184 | Ga0466963_0016808 | |||
| 1185 | Ga0466963_0029024 | |||
| 1186 | Ga0466963_0047655 | |||
| 1187 | Ga0466963_0081709 | |||
| 1188 | Ga0466963_0091081 | |||
| 1189 | Ga0466963_0105746 | |||
| 1190 | Ga0466964_0018549 | |||
| 1191 | Ga0466964_0121521 | |||
| 1192 | Ga0466971_0000857 | |||
| 1193 | Ga0466971_0036052 | |||
| 1194 | Ga0466970_0024467 | |||
| 1195 | Ga0466957_0002804 | |||
| 1196 | Ga0466957_0216610 | |||
| 1197 | Ga0466960_0004520 | |||
| 1198 | Ga0466960_0014520 | |||
| 1199 | Ga0466959_0002573 | |||
| 1200 | Ga0466959_0007757 | |||
| 1201 | Ga0466959_0036292 | |||
| 1202 | Ga0466959_0045365 | |||
| 1203 | Ga0466959_0145341 | |||
| 1204 | Ga0466959_0330357 | |||
| 1205 | Ga0466958_0034458 | |||
| 1206 | Ga0466958_0049167 | |||
| 1207 | Ga0466958_0082909 | |||
| 1208 | Ga0466958_0088482 | |||
| 1209 | Ga0466958_0182520 | |||
| 1210 | Ga0466967_0001695 | |||
| 1211 | Ga0466967_0002600 | |||
| 1212 | Ga0466967_0005994 | |||
| 1213 | Ga0466967_0008574 | |||
| 1214 | Ga0466967_0010023 | |||
| 1215 | Ga0466967_0012459 | |||
| 1216 | Ga0466967_0016091 | |||
| 1217 | Ga0466967_0064610 | |||
| 1218 | Ga0466967_0090020 | |||
| 1219 | Ga0466967_0126122 | |||
| 1220 | Ga0466967_0136464 | |||
| 1221 | Ga0466967_0154936 | |||
| 1222 | Ga0466967_0238246 | |||
| 1223 | Ga0466967_0372912 | |||
| 1224 | Ga0466967_0399901 | |||
| 1225 | Ga0466967_0524471 | |||
| 1226 | Ga0495603_0022300 | |||
| 1227 | Ga0495603_0043589 | |||
| 1228 | Ga0495629_0010392 | |||
| 1229 | Ga0495641_0000951 | |||
| 1230 | Ga0495641_0078809 | |||
| 1231 | Ga0495651_0024380 | |||
| 1232 | Ga0495651_0071779 | |||
| 1233 | Ga0495653_0020948 | |||
| 1234 | Ga0495653_0055422 | |||
| 1235 | Ga0495653_0230234 | |||
| 1236 | Ga0495580_0258069 | |||
| 1237 | Ga0495582_0000477 | |||
| 1238 | Ga0495639_0006991 | |||
| 1239 | Ga0495662_0000844 | |||
| 1240 | Ga0495664_0057190 | |||
| 1241 | Ga0495584_0044724 | |||
| 1242 | Ga0495594_0090928 | |||
| 1243 | Ga0495608_0039599 | |||
| 1244 | Ga0495608_0073221 | |||
| 1245 | Ga0495618_0068696 | |||
| 1246 | Ga0495618_0133112 | |||
| 1247 | Ga0495630_0025223 | |||
| 1248 | Ga0495630_0079299 | |||
| 1249 | Ga0495630_0300220 | |||
| 1250 | Ga0495631_0062152 | |||
| 1251 | Ga0495663_0036087 | |||
| 1252 | Ga0495666_0036583 | |||
| 1253 | Ga0495642_0050357 | |||
| 1254 | Ga0495642_0052946 | |||
| 1255 | Ga0495652_0105441 | |||
| 1256 | Ga0495665_0001760 | |||
| 1257 | Ga0495665_0100352 | |||
| 1258 | Ga0495665_0122083 | |||
| 1259 | Ga0495640_0169049 | |||
| 1260 | Ga0495587_0045310 | |||
| 1261 | Ga0495667_0011724 | |||
| 1262 | Ga0495667_0175460 | |||
| 1263 | Ga0495656_0019016 | |||
| 1264 | Ga0495656_0059980 | |||
| 1265 | Ga0495634_0014790 | |||
| 1266 | Ga0495634_0095685 | |||
| 1267 | Ga0495635_0033941 | |||
| 1268 | Ga0495657_0024737 | |||
| 1269 | Ga0495657_0071086 | |||
| 1270 | Ga0495657_0109124 | |||
| 1271 | Ga0495599_0073771 | |||
| 1272 | Ga0495623_0022902 | |||
| 1273 | Ga0495623_0115196 | |||
| 1274 | Ga0495658_0001285 | |||
| 1275 | Ga0495658_0007429 | |||
| 1276 | Ga0495658_0054509 | |||
| 1277 | Ga0495613_0001535 | |||
| 1278 | Ga0495613_0068033 | |||
| 1279 | Ga0495624_0008969 | |||
| 1280 | Ga0495624_0138221 | |||
| 1281 | Ga0495600_0012129 | |||
| 1282 | Ga0495581_0001739 | |||
| 1283 | Ga0495581_0002855 | |||
| 1284 | Ga0495604_0046745 | |||
| 1285 | Ga0495604_0066407 | |||
| 1286 | Ga0495604_0071564 | |||
| 1287 | Ga0495674_0001113 | |||
| 1288 | Ga0495674_0069542 | |||
| 1289 | Ga0495674_0277978 | |||
| 1290 | Ga0495676_0003749 | |||
| 1291 | Ga0495676_0006243 | |||
| 1292 | Ga0495676_0198265 | |||
| 1293 | Ga0495676_0246594 | |||
| 1294 | Ga0495680_0000451 | |||
| 1295 | Ga0495680_0006850 | |||
| 1296 | Ga0495680_0030465 | |||
| 1297 | Ga0495680_0042195 | |||
| 1298 | Ga0495684_0013902 | |||
| 1299 | Ga0495684_0027149 | |||
| 1300 | Ga0495684_0182486 | |||
| 1301 | Ga0495684_0211828 | |||
| 1302 | Ga0495593_0005695 | |||
| 1303 | Ga0495593_0114345 | |||
| 1304 | Ga0495602_0016438 | |||
| 1305 | Ga0495602_0044949 | |||
| 1306 | Ga0495602_0071751 | |||
| 1307 | Ga0496100_0005266 | |||
| 1308 | Ga0496100_0008696 | |||
| 1309 | Ga0496100_0011825 | |||
| 1310 | Ga0496100_0018554 | |||
| 1311 | Ga0496100_0057478 | |||
| 1312 | Ga0496100_0061115 | |||
| 1313 | Ga0496100_0113016 | |||
| 1314 | Ga0496101_0000460 | |||
| 1315 | Ga0496101_0010491 | |||
| 1316 | Ga0496101_0020347 | |||
| 1317 | Ga0496101_0076231 | |||
| 1318 | Ga0496102_0013660 | |||
| 1319 | Ga0496102_0030684 | |||
| 1320 | Ga0496102_0115060 | |||
| 1321 | Ga0496102_0428958 | |||
| 1322 | Ga0496103_0007951 | |||
| 1323 | Ga0496103_0025030 | |||
| 1324 | Ga0496103_0055182 | |||
| 1325 | Ga0496103_0075065 | |||
| 1326 | Ga0496103_0102729 | |||
| 1327 | Ga0496104_0001177 | |||
| 1328 | Ga0496104_0010088 | |||
| 1329 | Ga0496104_0012857 | |||
| 1330 | Ga0496104_0043205 | |||
| 1331 | Ga0496104_0071991 | |||
| 1332 | Ga0496104_0218370 | |||
| 1333 | Ga0496104_0288718 | |||
| 1334 | Ga0496105_0000509 | |||
| 1335 | Ga0496105_0012076 | |||
| 1336 | Ga0496105_0056339 | |||
| 1337 | Ga0496105_0074921 | |||
| 1338 | Ga0496105_0115847 | |||
| 1339 | Ga0496106_0000764 | |||
| 1340 | Ga0496106_0005209 | |||
| 1341 | Ga0496106_0011630 | |||
| 1342 | Ga0496106_0012315 | |||
| 1343 | Ga0496107_0010708 | |||
| 1344 | Ga0496107_0024338 | |||
| 1345 | Ga0496107_0284518 | |||
| 1346 | Ga0496108_0003345 | |||
| 1347 | Ga0496108_0004025 | |||
| 1348 | Ga0496108_0050162 | |||
| 1349 | Ga0496108_0058738 | |||
| 1350 | Ga0496108_0061807 | |||
| 1351 | Ga0496108_0384352 | |||
| 1352 | Ga0496109_0002080 | |||
| 1353 | Ga0496109_0004246 | |||
| 1354 | Ga0496109_0024336 | |||
| 1355 | Ga0496109_0029251 | |||
| 1356 | Ga0496109_0122093 | |||
| 1357 | Ga0496110_0005214 | |||
| 1358 | Ga0496110_0013464 | |||
| 1359 | Ga0496110_0043163 | |||
| 1360 | Ga0496110_0058309 | |||
| 1361 | Ga0496110_0133539 | |||
| 1362 | Ga0496111_0000239 | |||
| 1363 | Ga0496111_0025694 | |||
| 1364 | Ga0496111_0049332 | |||
| 1365 | Ga0496111_0098067 | |||
| 1366 | Ga0496111_0151494 | |||
| 1367 | Ga0496111_0178376 | |||
| 1368 | Ga0496111_0190079 | |||
| 1369 | Ga0496112_0003889 | |||
| 1370 | Ga0496112_0009134 | |||
| 1371 | Ga0496112_0027162 | |||
| 1372 | Ga0496112_0030674 | |||
| 1373 | Ga0496112_0049846 | |||
| 1374 | Ga0496112_0134024 | |||
| 1375 | Ga0496112_0135424 | |||
| 1376 | Ga0496112_0269003 | |||
| 1377 | Ga0496112_0293617 | |||
| 1378 | Ga0496112_0477874 | |||
| 1379 | Ga0496113_0419778 | |||
| 1380 | Ga0496114_0010787 | |||
| 1381 | Ga0496114_0014457 | |||
| 1382 | Ga0496114_0023791 | |||
| 1383 | Ga0496114_0043467 | |||
| 1384 | Ga0496114_0056263 | |||
| 1385 | Ga0496114_0078968 | |||
| 1386 | Ga0496114_0106909 | |||
| 1387 | Ga0496114_0180011 | |||
| 1388 | Ga0496115_0002569 | |||
| 1389 | Ga0496115_0009438 | |||
| 1390 | Ga0496115_0013585 | |||
| 1391 | Ga0496115_0063751 | |||
| 1392 | Ga0496115_0063936 | |||
| 1393 | Ga0496115_0085179 | |||
| 1394 | Ga0496115_0241913 | |||
| 1395 | Ga0501031_0018633 | |||
| 1396 | Ga0501031_0225572 | |||
| 1397 | Ga0501034_0014370 | |||
| 1398 | Ga0501034_0241977 | |||
| 1399 | Ga0501036_0008950 | |||
| 1400 | Ga0501036_0327545 | |||
| 1401 | Ga0501037_0014663 | |||
| 1402 | Ga0501038_0011208 | |||
| 1403 | Ga0501039_0010479 | |||
| 1404 | Ga0501040_0012318 | |||
| 1405 | Ga0501041_0052366 | |||
| 1406 | Ga0501042_0002586 | |||
| 1407 | Ga0501046_0014344 | |||
| 1408 | Ga0501047_0025549 | |||
| 1409 | Ga0501047_0056454 | |||
| 1410 | Ga0501047_0165183 | |||
| 1411 | Ga0501047_0267237 | |||
| 1412 | Ga0501067_0015473 | |||
| 1413 | Ga0501067_0045049 | |||
| 1414 | Ga0501067_0104356 | |||
| 1415 | Ga0501068_0008628 | |||
| 1416 | Ga0501069_0027868 | |||
| 1417 | Ga0501069_0041601 | |||
| 1418 | Ga0501069_0099973 | |||
| 1419 | Ga0501070_0007509 | |||
| 1420 | Ga0501070_0009055 | |||
| 1421 | Ga0501070_0018550 | |||
| 1422 | Ga0501070_0026784 | |||
| 1423 | Ga0501070_0053082 | |||
| 1424 | Ga0501070_0150912 | |||
| 1425 | Ga0501072_0007793 | |||
| 1426 | Ga0501072_0019821 | |||
| 1427 | Ga0501073_0010896 | |||
| 1428 | Ga0501073_0031236 | |||
| 1429 | Ga0501073_0090168 | |||
| 1430 | Ga0501074_0013691 | |||
| 1431 | Ga0501074_0014259 | |||
| 1432 | Ga0501074_0015975 | |||
| 1433 | Ga0501074_0032333 | |||
| 1434 | Ga0501074_0068150 | |||
| 1435 | Ga0501074_0167209 | |||
| 1436 | Ga0501075_0010008 | |||
| 1437 | Ga0501079_0013006 | |||
| 1438 | Ga0501079_0055413 | |||
| 1439 | Ga0501080_0000991 | |||
| 1440 | Ga0501080_0006430 | |||
| 1441 | Ga0501080_0042478 | |||
| 1442 | Ga0501080_0080961 | |||
| 1443 | Ga0501080_0275685 | |||
| 1444 | Ga0501080_0332720 | |||
| 1445 | Ga0501083_0004302 | |||
| 1446 | Ga0501083_0025559 | |||
| 1447 | Ga0501035_0024005 | |||
| 1448 | nmdc:mga0yw44_160875_c1 | |||
| 1449 | nmdc:mga05p37_147272_c1 | |||
| 1450 | nmdc:mga05p37_21119_c1 | |||
| 1451 | nmdc:mga05p37_29484_c1 | |||
| 1452 | nmdc:mga05p37_38312_c1 | |||
| 1453 | nmdc:mga05p37_542748_c1 | |||
| 1454 | nmdc:mga05p37_75207_c1 | |||
| 1455 | nmdc:mga09592_442661_c1 | |||
| 1456 | nmdc:mga06r32_111554_c1 | |||
| 1457 | nmdc:mga06r32_178490_c1 | |||
| 1458 | nmdc:mga06r32_211709_c1 | |||
| 1459 | nmdc:mga06r32_42991_c1 | |||
| 1460 | nmdc:mga08y16_24059_c1 | |||
| 1461 | nmdc:mga08y16_323944_c1 | |||
| 1462 | nmdc:mga08y16_70521_c1 | |||
| 1463 | nmdc:mga0n895_33547_c1 | |||
| 1464 | nmdc:mga0n895_76950_c1 | |||
| 1465 | nmdc:mga0rr50_42992_c1 | |||
| 1466 | nmdc:mga08x19_23422_c1 | |||
| 1467 | nmdc:mga0a205_26187_c1 | |||
| 1468 | nmdc:mga0a205_5450_c1 | |||
| 1469 | nmdc:mga0a205_96919_c1 | |||
| 1470 | Ga0495601_0046474 | |||
| 1471 | Ga0495612_0037591 | |||
| 1472 | Ga0495612_0079909 | |||
| 1473 | Ga0495655_0022592 | |||
| 1474 | Ga0495595_0026718 | |||
| 1475 | Ga0495619_0002974 | |||
| 1476 | Ga0495619_0056252 | |||
| 1477 | Ga0495619_0066794 | |||
| 1478 | Ga0501084_0015219 | |||
| 1479 | Ga0501084_0043896 | |||
| 1480 | Ga0466962_0000292 | |||
| 1481 | Ga0466962_0046748 | |||
| 1482 | Ga0530510_0029398 | |||
| 1483 | Ga0530510_0041240 | |||
| 1484 | Ga0530510_0144149 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3syk-assembly1.cif.gz_A | crystal structure of the aaa+ protein cbbx, selenomethionine structure | 0.8317 | 50 | 324 |
| 1in6-assembly1.cif.gz_A | thermotoga maritima ruvb k64r mutant | 0.806 | 56 | 331 |
| 1in5-assembly1.cif.gz_A | thermogota maritima ruvb a156s mutant | 0.8005 | 56 | 331 |
| 3syl-assembly1.cif.gz_B | crystal structure of the aaa+ protein cbbx, native structure | 0.789 | 50 | 324 |
| 3pfi-assembly1.cif.gz_B | 2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate | 0.7822 | 57 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPH9_276_464_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9686 | 50 | 228 | 3.40.50.300 |
| af_P9WPI1_291_487_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.954 | 46 | 228 | 3.40.50.300 |
| 3sykB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9432 | 50 | 228 | 3.40.50.300 |
| af_P9WPH7_335_510_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9197 | 62 | 231 | 3.40.50.300 |
| 3sykA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9161 | 229 | 320 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353LYX3-F1-model_v4 | Stage V sporulation protein K | 0.9797 | 50 | 260 |
GO:0005524
GO:0016887 |
| AF-A0A163T728-F1-model_v4 | Stage V sporulation protein K | 0.9783 | 98 | 315 |
GO:0005524
GO:0016887 |
| AF-V7KP52-F1-model_v4 | deleted | 0.978 | 50 | 259 |
|
| AF-A0A7W0T676-F1-model_v4 | AAA family ATPase | 0.9758 | 44 | 316 |
GO:0005524
GO:0016887 |
| AF-A0A7V9GGE4-F1-model_v4 | AAA family ATPase | 0.9749 | 49 | 315 |
GO:0005524
GO:0016887 |