F478627

General Info

Members Datasets Scaffolds Average Seq Length
742 260 1484 319

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100212111|Ga0068858_1002121112
Length 341
Sequence VRKESLFAVSAVSAVDVLLMAVALATFELTKDYSVGFWRKRPYRALERLTLDVRSGEVFGFLGPNGAGKTTTMKLLMQLVFPTSGRAEILGRPLGDLSVKRRIGYLPENPYFYDHLTAEELLVYFATLFGYDAAERRRRASRLLDEVGIGAERRLQLRKFSKGMLQRVGIAQALINDPELVIFDEPMSGLDPLGRRDVRSLILGLRDRGCTVFFSSHVLSDAEALCSRVAILARGRLVASGELTDMHAFKATGWELVIGGVDASAVPGVGARVRRVQRIGDRRFSLDLPLDPPPERLMAELTAAGAHVLSLNPIRTTLEDFFIEQVTAPDVMNAGRGLEQA

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 2.7
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100212111 3300005842 Bacteria 1833
2 JGI24746J21847_1001441 3300001977 Bacteria 3786
3 JGI24749J21850_1005041 3300002076 Bacteria 1853
4 JGI25406J46586_10004519 3300003203 Bacteria 6474
5 Ga0065712_10068107 3300005290 Bacteria 14636
6 Ga0065712_10087173 3300005290 Unclassified 2589
7 Ga0065715_10001239 3300005293 Bacteria 6694
8 Ga0065715_10001271 3300005293 Bacteria 7097
9 Ga0065715_10109291 3300005293 Bacteria 2675
10 Ga0070676_10003483 3300005328 Bacteria 8205
11 Ga0070676_10004553 3300005328 Bacteria 7306
12 Ga0070690_100012036 3300005330 Bacteria 5079
13 Ga0070670_100095910 3300005331 Bacteria 2551
14 Ga0070670_100219764 3300005331 Bacteria 1653
15 Ga0068869_100046439 3300005334 Bacteria 3132
16 Ga0068869_100070854 3300005334 Bacteria 2580
17 Ga0068869_100222109 3300005334 Bacteria 1498
18 Ga0070666_10007969 3300005335 Bacteria 6550
19 Ga0070680_100127504 3300005336 Bacteria 2127
20 Ga0068868_100084924 3300005338 Bacteria 2542
21 Ga0068868_100381547 3300005338 Bacteria 1213
22 Ga0068868_100507108 3300005338 Bacteria 1058
23 Ga0070660_100012048 3300005339 Bacteria 6169
24 Ga0070660_100179918 3300005339 Bacteria 1711
25 Ga0070689_100044255 3300005340 Bacteria 3424
26 Ga0070689_100194658 3300005340 Bacteria 1652
27 Ga0070691_10007542 3300005341 Bacteria 4988
28 Ga0070687_100032102 3300005343 Bacteria 2581
29 Ga0070687_100078170 3300005343 Bacteria 1798
30 Ga0070661_100168619 3300005344 Bacteria 1662
31 Ga0070668_100014186 3300005347 Bacteria 5952
32 Ga0070668_100014806 3300005347 Bacteria 5828
33 Ga0070668_100048659 3300005347 Bacteria 3261
34 Ga0070669_100001814 3300005353 Bacteria 15382
35 Ga0070669_100007593 3300005353 Bacteria 7756
36 Ga0070669_100039327 3300005353 Bacteria 3437
37 Ga0070669_100047800 3300005353 Bacteria 3122
38 Ga0070669_100084655 3300005353 Bacteria 2367
39 Ga0070669_100141160 3300005353 Bacteria 1857
40 Ga0070669_100200716 3300005353 Bacteria 1569
41 Ga0070675_100000056 3300005354 Bacteria 66985
42 Ga0070675_100004397 3300005354 Bacteria 10751
43 Ga0070675_100008477 3300005354 Bacteria 7978
44 Ga0070675_100015751 3300005354 Bacteria 5984
45 Ga0070675_100047729 3300005354 Bacteria 3510
46 Ga0070675_100057619 3300005354 Bacteria 3204
47 Ga0070675_100064050 3300005354 Bacteria 3039
48 Ga0070675_100348772 3300005354 Bacteria 1312
49 Ga0070671_100000810 3300005355 Bacteria 22616
50 Ga0070671_100115469 3300005355 Bacteria 2257
51 Ga0070674_100023506 3300005356 Bacteria 3991
52 Ga0070674_100088843 3300005356 Bacteria 2225
53 Ga0070673_100001027 3300005364 Bacteria 15809
54 Ga0070673_100003450 3300005364 Bacteria 9854
55 Ga0070673_100014229 3300005364 Bacteria 5533
56 Ga0070673_100030454 3300005364 Bacteria 4038
57 Ga0070673_100112424 3300005364 Bacteria 2261
58 Ga0070673_100184740 3300005364 Bacteria 1786
59 Ga0070673_100197025 3300005364 Bacteria 1733
60 Ga0070673_100461421 3300005364 Bacteria 1144
61 Ga0070688_100011886 3300005365 Bacteria 4859
62 Ga0070688_100012840 3300005365 Bacteria 4704
63 Ga0070688_100017836 3300005365 Bacteria 4081
64 Ga0070659_100045847 3300005366 Bacteria 3426
65 Ga0070659_100249468 3300005366 Bacteria 1471
66 Ga0070659_100262516 3300005366 Bacteria 1433
67 Ga0070667_100214554 3300005367 Bacteria 1711
68 Ga0070713_100006475 3300005436 Bacteria 8122
69 Ga0070701_10003379 3300005438 Bacteria 6303
70 Ga0070701_10030659 3300005438 Bacteria 2662
71 Ga0070701_10058487 3300005438 Bacteria 2023
72 Ga0070701_10105286 3300005438 Bacteria 1568
73 Ga0070705_100000356 3300005440 Bacteria 26959
74 Ga0070705_100015909 3300005440 Bacteria 3898
75 Ga0070700_100001645 3300005441 Bacteria 11179
76 Ga0070700_100010495 3300005441 Bacteria 5117
77 Ga0070694_100002876 3300005444 Bacteria 10228
78 Ga0070694_100005891 3300005444 Bacteria 7436
79 Ga0070694_100007762 3300005444 Bacteria 6545
80 Ga0070694_100009823 3300005444 Bacteria 5879
81 Ga0070694_100141508 3300005444 Bacteria 1748
82 Ga0070694_100167622 3300005444 Bacteria 1616
83 Ga0070708_100011057 3300005445 Bacteria 7333
84 Ga0070663_100019534 3300005455 Bacteria 4468
85 Ga0070663_100249573 3300005455 Bacteria 1404
86 Ga0070678_100406614 3300005456 Bacteria 1184
87 Ga0070662_100018159 3300005457 Bacteria 4754
88 Ga0070662_100065682 3300005457 Bacteria 2660
89 Ga0070681_10109836 3300005458 Bacteria 2697
90 Ga0070681_10190623 3300005458 Bacteria 1970
91 Ga0068867_100001427 3300005459 Bacteria 16553
92 Ga0068867_100012674 3300005459 Bacteria 5963
93 Ga0068867_100018327 3300005459 Bacteria 4976
94 Ga0068867_100075831 3300005459 Bacteria 2523
95 Ga0070685_10010761 3300005466 Bacteria 4763
96 Ga0070685_10059765 3300005466 Bacteria 2226
97 Ga0070685_10062649 3300005466 Bacteria 2181
98 Ga0070706_100052706 3300005467 Bacteria 3754
99 Ga0070707_100052259 3300005468 Bacteria 3917
100 Ga0070707_100075009 3300005468 Bacteria 3262
101 Ga0070707_100400412 3300005468 Bacteria 1333
102 Ga0070707_100415274 3300005468 Bacteria 1306
103 Ga0070707_100575018 3300005468 Bacteria 1089
104 Ga0070698_100025487 3300005471 Bacteria 6164
105 Ga0070698_100096222 3300005471 Bacteria 2938
106 Ga0070698_100144726 3300005471 Bacteria 2327
107 Ga0070698_100409280 3300005471 Bacteria 1290
108 Ga0070699_100010698 3300005518 Bacteria 7940
109 Ga0070679_100067992 3300005530 Bacteria 3554
110 Ga0070679_100130038 3300005530 Bacteria 2499
111 Ga0070679_100206248 3300005530 Bacteria 1930
112 Ga0070679_100236883 3300005530 Bacteria 1784
113 Ga0070684_100083662 3300005535 Bacteria 2828
114 Ga0070684_100158450 3300005535 Bacteria 2053
115 Ga0070684_100622521 3300005535 Bacteria 1004
116 Ga0070697_100109264 3300005536 Bacteria 2303
117 Ga0070672_100015730 3300005543 Bacteria 5402
118 Ga0070672_100376868 3300005543 Bacteria 1213
119 Ga0070686_100141611 3300005544 Bacteria 1674
120 Ga0070686_100292340 3300005544 Bacteria 1206
121 Ga0070695_100001273 3300005545 Bacteria 13886
122 Ga0070695_100043111 3300005545 Bacteria 2868
123 Ga0070695_100131189 3300005545 Bacteria 1727
124 Ga0070696_100000483 3300005546 Bacteria 25015
125 Ga0070696_100003682 3300005546 Bacteria 10222
126 Ga0070696_100012078 3300005546 Bacteria 5787
127 Ga0070696_100210822 3300005546 Bacteria 1454
128 Ga0070696_100288535 3300005546 Bacteria 1253
129 Ga0070665_100007118 3300005548 Bacteria 11371
130 Ga0070665_100017284 3300005548 Bacteria 7238
131 Ga0070665_100028080 3300005548 Bacteria 5667
132 Ga0070665_100055681 3300005548 Bacteria 3966
133 Ga0070704_100004260 3300005549 Bacteria 8267
134 Ga0070704_100018936 3300005549 Bacteria 4415
135 Ga0070704_100026719 3300005549 Bacteria 3820
136 Ga0070704_100050593 3300005549 Bacteria 2921
137 Ga0070704_100241248 3300005549 Bacteria 1479
138 Ga0070664_100002505 3300005564 Bacteria 14808
139 Ga0070664_100110390 3300005564 Bacteria 2400
140 Ga0070664_100160166 3300005564 Bacteria 1991
141 Ga0070664_100334184 3300005564 Bacteria 1375
142 Ga0068857_100056680 3300005577 Bacteria 3478
143 Ga0068857_100377941 3300005577 Bacteria 1315
144 Ga0068854_100259875 3300005578 Bacteria 1390
145 Ga0068854_100383450 3300005578 Bacteria 1159
146 Ga0070702_100007227 3300005615 Bacteria 5307
147 Ga0070702_100013183 3300005615 Bacteria 4167
148 Ga0070702_100192152 3300005615 Bacteria 1344
149 Ga0068852_100137289 3300005616 Bacteria 2259
150 Ga0068852_100383651 3300005616 Bacteria 1379
151 Ga0068852_100680734 3300005616 Unclassified 1038
152 Ga0068859_100002960 3300005617 Bacteria 17232
153 Ga0068859_100010943 3300005617 Bacteria 9132
154 Ga0068859_100042113 3300005617 Bacteria 4586
155 Ga0068859_100444924 3300005617 Bacteria 1392
156 Ga0068864_100024252 3300005618 Bacteria 5101
157 Ga0068864_100056830 3300005618 Bacteria 3381
158 Ga0068864_100091425 3300005618 Bacteria 2685
159 Ga0068864_100253197 3300005618 Bacteria 1636
160 Ga0068864_100486656 3300005618 Bacteria 1185
161 Ga0068864_100556068 3300005618 Bacteria 1110
162 Ga0068866_10088895 3300005718 Bacteria 1678
163 Ga0068861_100006731 3300005719 Bacteria 7854
164 Ga0068861_100008906 3300005719 Bacteria 6919
165 Ga0068861_100114469 3300005719 Bacteria 2166
166 Ga0068861_100186178 3300005719 Bacteria 1732
167 Ga0068870_10001969 3300005840 Bacteria 8490
168 Ga0068870_10044523 3300005840 Bacteria 2319
169 Ga0068870_10125491 3300005840 Bacteria 1484
170 Ga0068863_100002852 3300005841 Bacteria 17124
171 Ga0068863_100021919 3300005841 Bacteria 6096
172 Ga0068858_100001639 3300005842 Bacteria 22842
173 Ga0068858_100013409 3300005842 Bacteria 7736
174 Ga0068858_100051333 3300005842 Bacteria 3815
175 Ga0068858_100075714 3300005842 Bacteria 3126
176 Ga0068858_100102484 3300005842 Bacteria 2670
177 Ga0068858_100130999 3300005842 Bacteria 2351
178 Ga0068860_100082998 3300005843 Bacteria 3047
179 Ga0068860_100255923 3300005843 Bacteria 1706
180 Ga0068860_100335810 3300005843 Bacteria 1485
181 Ga0068862_100001092 3300005844 Bacteria 25835
182 Ga0068862_100007080 3300005844 Bacteria 9314
183 Ga0068862_100018210 3300005844 Bacteria 5847
184 Ga0068862_100018900 3300005844 Bacteria 5742
185 Ga0068862_100108322 3300005844 Bacteria 2436
186 Ga0068862_100158980 3300005844 Bacteria 2016
187 Ga0068862_100175978 3300005844 Bacteria 1918
188 Ga0081538_10060483 3300005981 Bacteria 2178
189 Ga0081539_10000215 3300005985 Bacteria 135054
190 Ga0070717_10356187 3300006028 Bacteria 1309
191 Ga0070715_10013240 3300006163 Bacteria 3024
192 Ga0070716_100059613 3300006173 Bacteria 2201
193 Ga0097621_100004345 3300006237 Bacteria 9853
194 Ga0097621_100021344 3300006237 Bacteria 5007
195 Ga0097621_100029027 3300006237 Bacteria 4366
196 Ga0097621_100041893 3300006237 Bacteria 3687
197 Ga0097621_100059420 3300006237 Bacteria 3130
198 Ga0097621_100119646 3300006237 Bacteria 2232
199 Ga0097621_100280312 3300006237 Bacteria 1467
200 Ga0068871_100002760 3300006358 Bacteria 11991
201 Ga0068871_100009212 3300006358 Bacteria 7140
202 Ga0068871_100012387 3300006358 Bacteria 6285
203 Ga0068871_100014512 3300006358 Bacteria 5878
204 Ga0068871_100134346 3300006358 Bacteria 2100
205 Ga0075428_100000009 3300006844 Bacteria 266370
206 Ga0075428_100001308 3300006844 Bacteria 26398
207 Ga0075428_100009617 3300006844 Bacteria 10733
208 Ga0075428_100011955 3300006844 Bacteria 9657
209 Ga0075428_100014461 3300006844 Bacteria 8766
210 Ga0075428_100038753 3300006844 Bacteria 5244
211 Ga0075428_100152598 3300006844 Bacteria 2509
212 Ga0075430_100001811 3300006846 Bacteria 17490
213 Ga0075430_100005120 3300006846 Bacteria 11034
214 Ga0075430_100025317 3300006846 Bacteria 5048
215 Ga0075431_100007393 3300006847 Bacteria 10934
216 Ga0075431_100067496 3300006847 Bacteria 3691
217 Ga0075431_100086187 3300006847 Bacteria 3241
218 Ga0075431_100094474 3300006847 Bacteria 3086
219 Ga0075431_100150918 3300006847 Bacteria 2393
220 Ga0075433_10004221 3300006852 Bacteria 11157
221 Ga0075433_10020473 3300006852 Bacteria 5532
222 Ga0075433_10054085 3300006852 Bacteria 3502
223 Ga0075433_10069172 3300006852 Bacteria 3100
224 Ga0075433_10074050 3300006852 Bacteria 2996
225 Ga0075433_10181976 3300006852 Bacteria 1870
226 Ga0075433_10338946 3300006852 Unclassified 1329
227 Ga0075433_10350036 3300006852 Bacteria 1305
228 Ga0075434_100000793 3300006871 Bacteria 24957
229 Ga0075434_100008810 3300006871 Bacteria 9392
230 Ga0075434_100012134 3300006871 Bacteria 8160
231 Ga0075434_100024126 3300006871 Bacteria 5942
232 Ga0075434_100031318 3300006871 Bacteria 5243
233 Ga0075434_100057372 3300006871 Bacteria 3870
234 Ga0075434_100093878 3300006871 Bacteria 3004
235 Ga0075434_100139383 3300006871 Bacteria 2445
236 Ga0075434_100215545 3300006871 Bacteria 1940
237 Ga0075434_100348739 3300006871 Bacteria 1501
238 Ga0075429_100029636 3300006880 Bacteria 4753
239 Ga0075429_100034621 3300006880 Bacteria 4389
240 Ga0068865_100039119 3300006881 Bacteria 3215
241 Ga0068865_100049014 3300006881 Bacteria 2909
242 Ga0068865_100050904 3300006881 Bacteria 2864
243 Ga0068865_100080317 3300006881 Bacteria 2338
244 Ga0075436_100019451 3300006914 Bacteria 4653
245 Ga0075436_100040566 3300006914 Bacteria 3212
246 Ga0075436_100138142 3300006914 Bacteria 1712
247 Ga0097620_100002960 3300006931 Bacteria 17232
248 Ga0097620_100010943 3300006931 Bacteria 9132
249 Ga0097620_100042117 3300006931 Bacteria 4586
250 Ga0097620_100444971 3300006931 Bacteria 1392
251 Ga0075435_100007280 3300007076 Bacteria 7877
252 Ga0075435_100028258 3300007076 Bacteria 4397
253 Ga0075435_100066979 3300007076 Bacteria 2923
254 Ga0075435_100083193 3300007076 Bacteria 2631
255 Ga0075435_100084215 3300007076 Bacteria 2616
256 Ga0075435_100249527 3300007076 Bacteria 1511
257 Ga0075435_100372724 3300007076 Bacteria 1226
258 Ga0105240_10005359 3300009093 Bacteria 19137
259 Ga0105240_10129716 3300009093 Bacteria 3025
260 Ga0111539_10000366 3300009094 Bacteria 55748
261 Ga0111539_10000566 3300009094 Bacteria 47366
262 Ga0111539_10001752 3300009094 Bacteria 28822
263 Ga0111539_10004494 3300009094 Bacteria 18240
264 Ga0111539_10008469 3300009094 Bacteria 13075
265 Ga0111539_10015909 3300009094 Bacteria 9342
266 Ga0111539_10018163 3300009094 Bacteria 8711
267 Ga0111539_10034919 3300009094 Bacteria 6090
268 Ga0111539_10061624 3300009094 Bacteria 4443
269 Ga0111539_10291012 3300009094 Bacteria 1901
270 Ga0111539_10362094 3300009094 Bacteria 1688
271 Ga0105245_10005435 3300009098 Bacteria 11192
272 Ga0105245_10224937 3300009098 Bacteria 1812
273 Ga0105245_10292765 3300009098 Bacteria 1595
274 Ga0105247_10039237 3300009101 Bacteria 2893
275 Ga0114129_10000282 3300009147 Bacteria 58440
276 Ga0114129_10003944 3300009147 Bacteria 20965
277 Ga0114129_10004539 3300009147 Bacteria 19600
278 Ga0114129_10006925 3300009147 Bacteria 16126
279 Ga0114129_10012189 3300009147 Bacteria 12231
280 Ga0114129_10025436 3300009147 Bacteria 8389
281 Ga0114129_10045558 3300009147 Bacteria 6165
282 Ga0114129_10086087 3300009147 Unclassified 4359
283 Ga0114129_10123596 3300009147 Bacteria 3559
284 Ga0114129_10169705 3300009147 Bacteria 2975
285 Ga0114129_10260009 3300009147 Bacteria 2327
286 Ga0114129_10389603 3300009147 Bacteria 1838
287 Ga0114129_10510590 3300009147 Bacteria 1568
288 Ga0105243_10012238 3300009148 Bacteria 6488
289 Ga0105243_10052921 3300009148 Bacteria 3218
290 Ga0105243_10092847 3300009148 Bacteria 2490
291 Ga0105243_10190695 3300009148 Bacteria 1790
292 Ga0105241_10157643 3300009174 Bacteria 1863
293 Ga0105242_10039955 3300009176 Bacteria 3779
294 Ga0105242_10051064 3300009176 Bacteria 3369
295 Ga0105242_10091311 3300009176 Bacteria 2563
296 Ga0105242_10091970 3300009176 Bacteria 2555
297 Ga0105242_10192110 3300009176 Bacteria 1808
298 Ga0105242_10211338 3300009176 Bacteria 1729
299 Ga0105242_10547222 3300009176 Bacteria 1109
300 Ga0105248_10047970 3300009177 Bacteria 4790
301 Ga0105248_10055032 3300009177 Bacteria 4462
302 Ga0105248_10094007 3300009177 Bacteria 3376
303 Ga0105248_10147040 3300009177 Bacteria 2659
304 Ga0105248_10167344 3300009177 Bacteria 2477
305 Ga0105248_10252837 3300009177 Unclassified 1983
306 Ga0105248_10726658 3300009177 Bacteria 1120
307 Ga0105238_10056429 3300009551 Bacteria 3940
308 Ga0105249_10000685 3300009553 Bacteria 30822
309 Ga0105249_10007794 3300009553 Bacteria 9329
310 Ga0105249_10009303 3300009553 Bacteria 8593
311 Ga0105249_10198930 3300009553 Bacteria 1960
312 Ga0105249_10634629 3300009553 Bacteria 1125
313 Ga0105246_10029525 3300011119 Bacteria 3612
314 Ga0105246_10041068 3300011119 Bacteria 3125
315 Ga0157374_10035297 3300013296 Bacteria 4574
316 Ga0157374_10048180 3300013296 Bacteria 3954
317 Ga0157374_10062264 3300013296 Bacteria 3496
318 Ga0157374_10138661 3300013296 Bacteria 2359
319 Ga0157378_10006671 3300013297 Bacteria 10085
320 Ga0157378_10255478 3300013297 Bacteria 1679
321 Ga0157378_10421988 3300013297 Bacteria 1318
322 Ga0163162_10083454 3300013306 Bacteria 3269
323 Ga0157375_10023122 3300013308 Bacteria 5730
324 Ga0157375_10085074 3300013308 Bacteria 3212
325 Ga0157375_10100860 3300013308 Bacteria 2969
326 Ga0157375_10129774 3300013308 Bacteria 2639
327 Ga0157375_10136702 3300013308 Bacteria 2575
328 Ga0157375_10224824 3300013308 Bacteria 2036
329 Ga0157375_10291681 3300013308 Bacteria 1794
330 Ga0163163_10108728 3300014325 Bacteria 2800
331 Ga0163163_10125395 3300014325 Bacteria 2605
332 Ga0157380_10005351 3300014326 Bacteria 8970
333 Ga0157380_10021164 3300014326 Bacteria 4875
334 Ga0157380_10045563 3300014326 Bacteria 3442
335 Ga0157380_10078095 3300014326 Bacteria 2699
336 Ga0157380_10127605 3300014326 Bacteria 2165
337 Ga0157380_10209305 3300014326 Bacteria 1736
338 Ga0157377_10004756 3300014745 Bacteria 6291
339 Ga0157377_10127202 3300014745 Unclassified 1551
340 Ga0157379_10008461 3300014968 Bacteria 8948
341 Ga0157379_10018554 3300014968 Bacteria 6135
342 Ga0157379_10024853 3300014968 Bacteria 5318
343 Ga0157379_10103525 3300014968 Bacteria 2555
344 Ga0157379_10158690 3300014968 Bacteria 2041
345 Ga0157379_10337724 3300014968 Bacteria 1377
346 Ga0157376_10017316 3300014969 Bacteria 5492
347 Ga0157376_10020216 3300014969 Bacteria 5147
348 Ga0157376_10090182 3300014969 Bacteria 2652
349 Ga0157376_10101226 3300014969 Bacteria 2517
350 Ga0163161_10048572 3300017792 Bacteria 3065
351 Ga0207673_1002326 3300025290 Bacteria 2158
352 Ga0207697_10001659 3300025315 Bacteria 12026
353 Ga0207697_10060978 3300025315 Bacteria 1569
354 Ga0207682_10019543 3300025893 Bacteria 2652
355 Ga0207682_10075436 3300025893 Bacteria 1435
356 Ga0207688_10006844 3300025901 Bacteria 6202
357 Ga0207688_10191554 3300025901 Bacteria 1223
358 Ga0207680_10169564 3300025903 Bacteria 1469
359 Ga0207680_10256167 3300025903 Bacteria 1210
360 Ga0207647_10155421 3300025904 Bacteria 1336
361 Ga0207645_10002080 3300025907 Bacteria 16015
362 Ga0207645_10007348 3300025907 Bacteria 7790
363 Ga0207645_10041489 3300025907 Bacteria 2945
364 Ga0207645_10062650 3300025907 Bacteria 2376
365 Ga0207643_10001558 3300025908 Bacteria 13040
366 Ga0207643_10020330 3300025908 Bacteria 3643
367 Ga0207643_10127109 3300025908 Bacteria 1514
368 Ga0207707_10100671 3300025912 Bacteria 2525
369 Ga0207707_10127375 3300025912 Bacteria 2227
370 Ga0207707_10182379 3300025912 Bacteria 1832
371 Ga0207695_10272347 3300025913 Bacteria 1588
372 Ga0207695_10293020 3300025913 Bacteria 1519
373 Ga0207695_10309091 3300025913 Bacteria 1471
374 Ga0207662_10000721 3300025918 Bacteria 15090
375 Ga0207662_10090274 3300025918 Bacteria 1883
376 Ga0207662_10186952 3300025918 Bacteria 1335
377 Ga0207657_10005894 3300025919 Bacteria 12758
378 Ga0207657_10093446 3300025919 Bacteria 2505
379 Ga0207657_10104997 3300025919 Bacteria 2340
380 Ga0207652_10242164 3300025921 Bacteria 1626
381 Ga0207646_10156286 3300025922 Bacteria 2057
382 Ga0207646_10321147 3300025922 Bacteria 1399
383 Ga0207681_10027821 3300025923 Bacteria 3659
384 Ga0207681_10036057 3300025923 Bacteria 3261
385 Ga0207681_10066495 3300025923 Bacteria 2495
386 Ga0207681_10075783 3300025923 Bacteria 2360
387 Ga0207681_10093105 3300025923 Bacteria 2156
388 Ga0207681_10161369 3300025923 Bacteria 1690
389 Ga0207681_10193369 3300025923 Bacteria 1558
390 Ga0207694_10011794 3300025924 Bacteria 6593
391 Ga0207650_10045121 3300025925 Bacteria 3243
392 Ga0207659_10000255 3300025926 Bacteria 32640
393 Ga0207659_10001496 3300025926 Bacteria 13924
394 Ga0207659_10002440 3300025926 Bacteria 11081
395 Ga0207659_10004875 3300025926 Bacteria 8133
396 Ga0207659_10058146 3300025926 Bacteria 2775
397 Ga0207659_10078410 3300025926 Bacteria 2434
398 Ga0207659_10171697 3300025926 Bacteria 1711
399 Ga0207659_10288870 3300025926 Bacteria 1343
400 Ga0207687_10200945 3300025927 Bacteria 1558
401 Ga0207700_10050502 3300025928 Bacteria 3100
402 Ga0207644_10022545 3300025931 Bacteria 4303
403 Ga0207644_10060748 3300025931 Bacteria 2735
404 Ga0207644_10147278 3300025931 Bacteria 1819
405 Ga0207706_10014496 3300025933 Bacteria 7145
406 Ga0207706_10202047 3300025933 Bacteria 1743
407 Ga0207686_10117928 3300025934 Bacteria 1802
408 Ga0207686_10122305 3300025934 Bacteria 1773
409 Ga0207686_10123776 3300025934 Bacteria 1764
410 Ga0207686_10135109 3300025934 Bacteria 1697
411 Ga0207709_10012266 3300025935 Bacteria 4723
412 Ga0207709_10146404 3300025935 Bacteria 1630
413 Ga0207670_10023846 3300025936 Bacteria 3815
414 Ga0207670_10061707 3300025936 Bacteria 2559
415 Ga0207670_10118490 3300025936 Bacteria 1920
416 Ga0207669_10000261 3300025937 Bacteria 23967
417 Ga0207669_10013686 3300025937 Bacteria 4041
418 Ga0207669_10035635 3300025937 Bacteria 2834
419 Ga0207669_10039970 3300025937 Bacteria 2717
420 Ga0207669_10088660 3300025937 Bacteria 2007
421 Ga0207704_10034282 3300025938 Bacteria 2895
422 Ga0207704_10278901 3300025938 Bacteria 1269
423 Ga0207665_10156701 3300025939 Bacteria 1635
424 Ga0207691_10023906 3300025940 Bacteria 5751
425 Ga0207691_10060939 3300025940 Bacteria 3428
426 Ga0207691_10063585 3300025940 Bacteria 3347
427 Ga0207691_10086405 3300025940 Bacteria 2814
428 Ga0207691_10087901 3300025940 Bacteria 2788
429 Ga0207691_10195080 3300025940 Bacteria 1765
430 Ga0207691_10339422 3300025940 Bacteria 1286
431 Ga0207711_10039151 3300025941 Bacteria 4032
432 Ga0207711_10105754 3300025941 Bacteria 2496
433 Ga0207711_10165923 3300025941 Unclassified 2002
434 Ga0207711_10208379 3300025941 Bacteria 1785
435 Ga0207711_10208480 3300025941 Bacteria 1785
436 Ga0207689_10000675 3300025942 Bacteria 32583
437 Ga0207689_10012354 3300025942 Bacteria 7305
438 Ga0207689_10043116 3300025942 Bacteria 3730
439 Ga0207689_10056691 3300025942 Bacteria 3225
440 Ga0207661_10157587 3300025944 Bacteria 1968
441 Ga0207661_10439538 3300025944 Bacteria 1187
442 Ga0207679_10005709 3300025945 Bacteria 7806
443 Ga0207679_10063429 3300025945 Bacteria 2758
444 Ga0207679_10248472 3300025945 Bacteria 1511
445 Ga0207667_10155741 3300025949 Bacteria 2351
446 Ga0207651_10012418 3300025960 Bacteria 4821
447 Ga0207651_10027979 3300025960 Bacteria 3549
448 Ga0207651_10155397 3300025960 Bacteria 1786
449 Ga0207651_10163719 3300025960 Bacteria 1746
450 Ga0207712_10008468 3300025961 Bacteria 6502
451 Ga0207712_10023384 3300025961 Bacteria 4077
452 Ga0207712_10037575 3300025961 Bacteria 3305
453 Ga0207668_10011983 3300025972 Bacteria 5292
454 Ga0207668_10043797 3300025972 Bacteria 3040
455 Ga0207668_10067816 3300025972 Bacteria 2534
456 Ga0207640_10139934 3300025981 Bacteria 1763
457 Ga0207658_10089583 3300025986 Bacteria 2382
458 Ga0207677_10078164 3300026023 Bacteria 2362
459 Ga0207677_10078177 3300026023 Bacteria 2362
460 Ga0207677_10121220 3300026023 Bacteria 1968
461 Ga0207677_10334615 3300026023 Bacteria 1263
462 Ga0207703_10045307 3300026035 Bacteria 3538
463 Ga0207703_10049587 3300026035 Bacteria 3394
464 Ga0207703_10058327 3300026035 Bacteria 3150
465 Ga0207703_10065219 3300026035 Bacteria 2992
466 Ga0207703_10073855 3300026035 Bacteria 2822
467 Ga0207703_10074702 3300026035 Bacteria 2808
468 Ga0207703_10074859 3300026035 Bacteria 2805
469 Ga0207703_10180901 3300026035 Bacteria 1861
470 Ga0207703_10222978 3300026035 Bacteria 1687
471 Ga0207678_10050719 3300026067 Bacteria 3585
472 Ga0207708_10002321 3300026075 Bacteria 13984
473 Ga0207708_10002401 3300026075 Bacteria 13749
474 Ga0207708_10006268 3300026075 Bacteria 8814
475 Ga0207708_10151381 3300026075 Bacteria 1827
476 Ga0207702_10280665 3300026078 Bacteria 1574
477 Ga0207641_10012330 3300026088 Bacteria 7012
478 Ga0207641_10037507 3300026088 Bacteria 4048
479 Ga0207641_10109454 3300026088 Bacteria 2447
480 Ga0207641_10432457 3300026088 Bacteria 1269
481 Ga0207641_10700057 3300026088 Bacteria 998
482 Ga0207648_10003340 3300026089 Bacteria 16859
483 Ga0207648_10005959 3300026089 Bacteria 12189
484 Ga0207648_10007328 3300026089 Bacteria 10866
485 Ga0207648_10009126 3300026089 Bacteria 9532
486 Ga0207648_10192230 3300026089 Bacteria 1809
487 Ga0207648_10316402 3300026089 Bacteria 1402
488 Ga0207676_10023587 3300026095 Bacteria 4542
489 Ga0207676_10028455 3300026095 Bacteria 4175
490 Ga0207676_10147923 3300026095 Bacteria 2019
491 Ga0207676_10179151 3300026095 Bacteria 1854
492 Ga0207674_10006186 3300026116 Bacteria 14115
493 Ga0207674_10131086 3300026116 Bacteria 2470
494 Ga0207675_100002131 3300026118 Bacteria 19628
495 Ga0207675_100014741 3300026118 Bacteria 7292
496 Ga0207675_100098359 3300026118 Bacteria 2755
497 Ga0207675_100266672 3300026118 Bacteria 1661
498 Ga0207675_100356558 3300026118 Bacteria 1434
499 Ga0207683_10009195 3300026121 Bacteria 8419
500 Ga0207683_10026037 3300026121 Bacteria 5051
501 Ga0207683_10043987 3300026121 Bacteria 3903
502 Ga0207683_10104540 3300026121 Bacteria 2531
503 Ga0207683_10109147 3300026121 Bacteria 2476
504 Ga0207698_10267686 3300026142 Bacteria 1573
505 Ga0209971_1014347 3300027682 Bacteria 1877
506 Ga0207428_10000294 3300027907 Bacteria 66640
507 Ga0207428_10000491 3300027907 Bacteria 47284
508 Ga0207428_10007768 3300027907 Bacteria 9760
509 Ga0207428_10009679 3300027907 Bacteria 8635
510 Ga0207428_10019702 3300027907 Bacteria 5749
511 Ga0207428_10021873 3300027907 Bacteria 5407
512 Ga0207428_10064766 3300027907 Bacteria 2885
513 Ga0268266_10035535 3300028379 Bacteria 4239
514 Ga0268266_10066767 3300028379 Bacteria 3112
515 Ga0268266_10661531 3300028379 Bacteria 1006
516 Ga0268265_10000772 3300028380 Bacteria 30842
517 Ga0268265_10015140 3300028380 Bacteria 5271
518 Ga0268265_10042143 3300028380 Bacteria 3384
519 Ga0268265_10200887 3300028380 Bacteria 1729
520 Ga0268265_10247824 3300028380 Archaea 1576
521 Ga0268264_10033386 3300028381 Bacteria 4227
522 Ga0268264_10069685 3300028381 Bacteria 2975
523 Ga0268264_10084214 3300028381 Bacteria 2726
524 Ga0268264_10148556 3300028381 Bacteria 2099
525 Ga0268264_10197661 3300028381 Bacteria 1837
526 Ga0307408_100100033 3300031548 Bacteria 2207
527 Ga0307408_100128633 3300031548 Bacteria 1973
528 Ga0265314_10031526 3300031711 Bacteria 3911
529 Ga0265314_10070623 3300031711 Bacteria 2339
530 Ga0307413_10002354 3300031824 Bacteria 7668
531 Ga0307413_10078094 3300031824 Bacteria 2111
532 Ga0307407_10020942 3300031903 Bacteria 3361
533 Ga0307407_10027253 3300031903 Bacteria 3037
534 Ga0307407_10028728 3300031903 Bacteria 2977
535 Ga0307412_10245915 3300031911 Bacteria 1386
536 Ga0307409_100023799 3300031995 Bacteria 4254
537 Ga0307409_100032117 3300031995 Bacteria 3801
538 Ga0307409_100064371 3300031995 Bacteria 2880
539 Ga0307409_100481608 3300031995 Bacteria 1204
540 Ga0307414_10001963 3300032004 Bacteria 10646
541 Ga0307411_10070242 3300032005 Bacteria 2369
542 Ga0307411_10359985 3300032005 Bacteria 1189
543 Ga0307415_100089240 3300032126 Bacteria 2226
544 Ga0373951_0014965 3300035091 Bacteria 1745
545 Ga0373952_0035779 3300035092 Bacteria 1125
546 Ga0373954_0040849 3300035118 Bacteria 2162
547 Ga0373946_0065615 3300035171 Bacteria 1555
548 Ga0373935_0038644 3300035692 Bacteria 2989
549 Ga0373927_0228940 3300035695 Bacteria 1221
550 Ga0373933_0063408 3300035724 Bacteria 2234
551 Ga0373933_0175041 3300035724 Bacteria 1367
552 Ga0373947_0041730 3300035725 Unclassified 2737
553 Ga0373937_0074864 3300036401 Bacteria 3125
554 Ga0373937_0119616 3300036401 Bacteria 2454
555 Ga0373937_0383641 3300036401 Bacteria 1333
556 Ga0373925_0021236 3300037068 Bacteria 4731
557 Ga0373925_0277111 3300037068 Bacteria 1350
558 Ga0451807_1763252 3300041486 Bacteria 1150
559 Ga0439441_021600 3300042001 Bacteria 1190
560 Ga0439450_002580 3300042008 Bacteria 2873
561 Ga0439435_0002150 3300042436 Bacteria 3843
562 Ga0439435_0005352 3300042436 Bacteria 2819
563 Ga0450916_003379 3300042530 Bacteria 1751
564 Ga0451577_0066113 3300042876 Bacteria 3225
565 Ga0451577_0145756 3300042876 Bacteria 2129
566 Ga0439440_0020357 3300042993 Bacteria 1487
567 Ga0439440_0034584 3300042993 Bacteria 1209
568 Ga0453684_0097862 3300044712 Bacteria 3600
569 Ga0451576_0002764 3300045051 Bacteria 25371
570 Ga0451576_0007839 3300045051 Bacteria 12653
571 Ga0451576_0069178 3300045051 Bacteria 3673
572 Ga0466967_0521466 3300045976 Bacteria 1168
573 Ga0495592_0255762 3300046454 Bacteria 1156
574 Ga0495603_0138873 3300046455 Bacteria 1414
575 Ga0495629_0110345 3300046459 Bacteria 1918
576 Ga0495629_0255937 3300046459 Bacteria 1204
577 Ga0495629_0286779 3300046459 Bacteria 1129
578 Ga0495608_0003598 3300046511 Bacteria 11120
579 Ga0495608_0201523 3300046511 Bacteria 1254
580 Ga0495630_0099378 3300046517 Bacteria 2202
581 Ga0495643_0021339 3300046522 Bacteria 3717
582 Ga0495663_0006765 3300046525 Bacteria 3160
583 Ga0495642_0006117 3300046528 Bacteria 4622
584 Ga0495640_0019841 3300046533 Bacteria 4958
585 Ga0495640_0194165 3300046533 Bacteria 1289
586 Ga0495587_0031983 3300046536 Bacteria 3183
587 Ga0495645_0079577 3300046543 Bacteria 2354
588 Ga0495633_0122459 3300046558 Bacteria 1205
589 Ga0495659_0003741 3300046664 Bacteria 4837
590 Ga0495623_0079788 3300046679 Bacteria 2027
591 Ga0495647_0025637 3300046681 Bacteria 2156
592 Ga0495647_0035787 3300046681 Unclassified 1866
593 Ga0495658_0024794 3300046683 Bacteria 3200
594 Ga0495658_0112124 3300046683 Bacteria 1641
595 Ga0495658_0153527 3300046683 Bacteria 1416
596 Ga0495658_0163714 3300046683 Bacteria 1373
597 Ga0495669_0013733 3300046684 Bacteria 3457
598 Ga0495613_0005334 3300046689 Bacteria 9655
599 Ga0495604_0097102 3300047317 Bacteria 2173
600 Ga0495674_0084878 3300047319 Bacteria 2713
601 Ga0495674_0218277 3300047319 Bacteria 1577
602 Ga0495685_021667 3300047447 Bacteria 2212
603 Ga0495684_0000078 3300047471 Bacteria 66716
604 Ga0496101_0001289 3300048904 Bacteria 14971
605 Ga0496102_0248479 3300048905 Bacteria 1677
606 Ga0496102_0374011 3300048905 Bacteria 1341
607 Ga0496104_0074628 3300048907 Bacteria 3228
608 Ga0496104_0078842 3300048907 Bacteria 3139
609 Ga0496105_0056653 3300048908 Bacteria 3235
610 Ga0496106_0137957 3300048909 Bacteria 1917
611 Ga0496107_0020617 3300048910 Bacteria 4657
612 Ga0496108_0085405 3300048911 Bacteria 2679
613 Ga0496109_0031315 3300048912 Bacteria 4773
614 Ga0496109_0155188 3300048912 Bacteria 2144
615 Ga0496109_0190716 3300048912 Bacteria 1926
616 Ga0496109_0336237 3300048912 Bacteria 1426
617 Ga0496110_0137002 3300048913 Bacteria 2213
618 Ga0496111_0348067 3300048914 Bacteria 1097
619 Ga0496112_0064004 3300048915 Bacteria 3628
620 Ga0496114_0011700 3300048917 Bacteria 7016
621 Ga0496114_0023232 3300048917 Bacteria 5058
622 Ga0496115_0120467 3300048918 Bacteria 2159
623 Ga0501034_0172820 3300049571 Bacteria 2127
624 Ga0501036_0004187 3300049572 Bacteria 11621
625 Ga0501039_0026447 3300049575 Unclassified 4459
626 Ga0501039_0063853 3300049575 Bacteria 2853
627 Ga0501039_0128714 3300049575 Bacteria 1987
628 Ga0501040_0022229 3300049576 Bacteria 4244
629 Ga0501040_0068989 3300049576 Bacteria 2438
630 Ga0501040_0082243 3300049576 Bacteria 2232
631 Ga0501040_0286579 3300049576 Bacteria 1177
632 Ga0501041_0012234 3300049577 Bacteria 5083
633 Ga0501042_0018125 3300049578 Bacteria 4871
634 Ga0501042_0164194 3300049578 Bacteria 1602
635 Ga0501043_0098445 3300049579 Bacteria 2299
636 Ga0501043_0153750 3300049579 Bacteria 1800
637 Ga0501046_0022851 3300049580 Bacteria 5151
638 Ga0501047_0265544 3300049581 Bacteria 1563
639 Ga0501048_0065768 3300049582 Bacteria 2563
640 Ga0501048_0189545 3300049582 Bacteria 1457
641 Ga0501067_0050543 3300049583 Bacteria 2304
642 Ga0501071_0070437 3300049587 Bacteria 2547
643 Ga0501071_0102050 3300049587 Bacteria 2115
644 Ga0501071_0231494 3300049587 Bacteria 1392
645 Ga0501072_0124903 3300049588 Bacteria 2050
646 Ga0501072_0210316 3300049588 Bacteria 1550
647 Ga0501074_0328641 3300049590 Bacteria 1085
648 Ga0501075_0001434 3300049591 Bacteria 15504
649 Ga0501075_0010377 3300049591 Bacteria 6546
650 Ga0501075_0067865 3300049591 Bacteria 2693
651 Ga0501075_0316109 3300049591 Bacteria 1190
652 Ga0501076_0003167 3300049592 Bacteria 11473
653 Ga0501076_0021746 3300049592 Bacteria 4925
654 Ga0501076_0021791 3300049592 Bacteria 4919
655 Ga0501076_0024080 3300049592 Bacteria 4702
656 Ga0501076_0207656 3300049592 Bacteria 1600
657 Ga0501077_0034092 3300049593 Bacteria 3240
658 Ga0501077_0245124 3300049593 Bacteria 1139
659 Ga0501079_0005600 3300049741 Bacteria 9372
660 Ga0501081_0000734 3300049743 Bacteria 19101
661 Ga0501081_0039159 3300049743 Bacteria 3243
662 Ga0501081_0340088 3300049743 Bacteria 1105
663 Ga0501081_0400316 3300049743 Bacteria 1016
664 Ga0501035_0070499 3300049822 Bacteria 3096
665 Ga0501035_0321916 3300049822 Bacteria 1299
666 Ga0501045_0023791 3300049824 Bacteria 4395
667 Ga0501045_0076723 3300049824 Bacteria 2462
668 Ga0501045_0087578 3300049824 Bacteria 2300
669 nmdc:mga05p37_101674_c1 3300050507 Bacteria 3539
670 nmdc:mga05p37_122887_c1 3300050507 Bacteria 3189
671 nmdc:mga05p37_180840_c1 3300050507 Bacteria 2565
672 nmdc:mga05p37_184847_c1 3300050507 Bacteria 2534
673 nmdc:mga05p37_20670_c1 3300050507 Bacteria 7966
674 nmdc:mga05p37_20851_c1 3300050507 Bacteria 2733
675 nmdc:mga05p37_240875_c1 3300050507 Bacteria 2175
676 nmdc:mga05p37_260890_c1 3300050507 Bacteria 2074
677 nmdc:mga05p37_446631_c1 3300050507 Bacteria 1498
678 nmdc:mga05p37_52514_c1 3300050507 Bacteria 5012
679 nmdc:mga05p37_54090_c1 3300050507 Bacteria 4939
680 nmdc:mga05p37_5540_c1 3300050507 Bacteria 14833
681 nmdc:mga09592_38528_c2 3300050508 Bacteria 3649
682 nmdc:mga09592_52899_c1 3300050508 Bacteria 3427
683 nmdc:mga09592_58153_c1 3300050508 Bacteria 3269
684 nmdc:mga0qj67_116705_c1 3300050509 Bacteria 2157
685 nmdc:mga0qj67_37921_c1 3300050509 Unclassified 3779
686 nmdc:mga0qj67_58552_c1 3300050509 Bacteria 3054
687 nmdc:mga0qj67_78404_c1 3300050509 Bacteria 2644
688 nmdc:mga0qj67_8804_c2 3300050509 Bacteria 6829
689 nmdc:mga06r32_3488_c1 3300050510 Bacteria 14036
690 nmdc:mga06r32_3997_c1 3300050510 Bacteria 13212
691 nmdc:mga06r32_48032_c1 3300050510 Bacteria 4079
692 nmdc:mga06r32_66937_c1 3300050510 Bacteria 3467
693 nmdc:mga06r32_82760_c1 3300050510 Bacteria 3127
694 nmdc:mga08y16_1131_c1 3300050511 Bacteria 26255
695 nmdc:mga08y16_14171_c1 3300050511 Bacteria 8390
696 nmdc:mga08y16_45226_c1 3300050511 Bacteria 4613
697 nmdc:mga08y16_453270_c1 3300050511 Bacteria 1308
698 nmdc:mga08y16_4833_c1 3300050511 Bacteria 14058
699 nmdc:mga08y16_5119_c1 3300050511 Bacteria 13699
700 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
701 nmdc:mga0n895_125304_c1 3300050512 Bacteria 2592
702 nmdc:mga0n895_141906_c1 3300050512 Bacteria 2431
703 nmdc:mga0n895_142921_c1 3300050512 Bacteria 2422
704 nmdc:mga0n895_1577_c1 3300050512 Bacteria 17153
705 nmdc:mga0n895_158187_c1 3300050512 Bacteria 2297
706 nmdc:mga0n895_158430_c1 3300050512 Bacteria 2295
707 nmdc:mga0n895_22084_c1 3300050512 Bacteria 5964
708 nmdc:mga0n895_22440_c1 3300050512 Bacteria 5918
709 nmdc:mga0n895_260883_c1 3300050512 Bacteria 1758
710 nmdc:mga0n895_31802_c1 3300050512 Bacteria 5057
711 nmdc:mga0n895_415509_c1 3300050512 Bacteria 1360
712 nmdc:mga0n895_480669_c1 3300050512 Bacteria 1253
713 nmdc:mga0n895_89517_c1 3300050512 Bacteria 3079
714 nmdc:mga0rr50_123488_c1 3300050513 Bacteria 2064
715 nmdc:mga0rr50_145385_c1 3300050513 Bacteria 1911
716 nmdc:mga0rr50_21240_c1 3300050513 Bacteria 4428
717 nmdc:mga0rr50_3456_c2 3300050513 Bacteria 5186
718 nmdc:mga0rr50_39402_c1 3300050513 Bacteria 3427
719 nmdc:mga0rr50_50516_c1 3300050513 Bacteria 3082
720 nmdc:mga0rr50_69685_c1 3300050513 Bacteria 2677
721 nmdc:mga08x19_15291_c1 3300050514 Bacteria 4668
722 nmdc:mga0a205_11945_c1 3300050515 Bacteria 8019
723 nmdc:mga0a205_163043_c1 3300050515 Bacteria 2125
724 nmdc:mga0a205_202910_c1 3300050515 Bacteria 1873
725 nmdc:mga0a205_31047_c1 3300050515 Bacteria 5117
726 nmdc:mga0a205_36086_c1 3300050515 Bacteria 4750
727 nmdc:mga0a205_38990_c1 3300050515 Bacteria 4572
728 nmdc:mga0a205_41419_c1 3300050515 Bacteria 4435
729 nmdc:mga0a205_41735_c1 3300050515 Bacteria 4420
730 nmdc:mga0a205_44349_c1 3300050515 Bacteria 4286
731 nmdc:mga0a205_52349_c2 3300050515 Bacteria 3118
732 nmdc:mga0a205_60740_c1 3300050515 Bacteria 3650
733 nmdc:mga0a205_96917_c1 3300050515 Bacteria 2849
734 Ga0495595_0076701 3300053084 Bacteria 1587
735 Ga0495619_0007908 3300053085 Bacteria 6727
736 Ga0495619_0131427 3300053085 Bacteria 1720
737 Ga0500645_000077 3300053730 Bacteria 77326
738 Ga0501084_0009792 3300054114 Bacteria 7922
739 Ga0501082_0028649 3300060353 Bacteria 4797
740 Ga0501082_0466334 3300060353 Bacteria 1104
741 Ga0530510_0001640 3300061734 Bacteria 15129
742 Ga0530510_0002998 3300061734 Bacteria 11580
743 Ga0068858_100212111
744 JGI24746J21847_1001441
745 JGI24749J21850_1005041
746 JGI25406J46586_10004519
747 Ga0065712_10068107
748 Ga0065712_10087173
749 Ga0065715_10001239
750 Ga0065715_10001271
751 Ga0065715_10109291
752 Ga0070676_10003483
753 Ga0070676_10004553
754 Ga0070690_100012036
755 Ga0070670_100095910
756 Ga0070670_100219764
757 Ga0068869_100046439
758 Ga0068869_100070854
759 Ga0068869_100222109
760 Ga0070666_10007969
761 Ga0070680_100127504
762 Ga0068868_100084924
763 Ga0068868_100381547
764 Ga0068868_100507108
765 Ga0070660_100012048
766 Ga0070660_100179918
767 Ga0070689_100044255
768 Ga0070689_100194658
769 Ga0070691_10007542
770 Ga0070687_100032102
771 Ga0070687_100078170
772 Ga0070661_100168619
773 Ga0070668_100014186
774 Ga0070668_100014806
775 Ga0070668_100048659
776 Ga0070669_100001814
777 Ga0070669_100007593
778 Ga0070669_100039327
779 Ga0070669_100047800
780 Ga0070669_100084655
781 Ga0070669_100141160
782 Ga0070669_100200716
783 Ga0070675_100000056
784 Ga0070675_100004397
785 Ga0070675_100008477
786 Ga0070675_100015751
787 Ga0070675_100047729
788 Ga0070675_100057619
789 Ga0070675_100064050
790 Ga0070675_100348772
791 Ga0070671_100000810
792 Ga0070671_100115469
793 Ga0070674_100023506
794 Ga0070674_100088843
795 Ga0070673_100001027
796 Ga0070673_100003450
797 Ga0070673_100014229
798 Ga0070673_100030454
799 Ga0070673_100112424
800 Ga0070673_100184740
801 Ga0070673_100197025
802 Ga0070673_100461421
803 Ga0070688_100011886
804 Ga0070688_100012840
805 Ga0070688_100017836
806 Ga0070659_100045847
807 Ga0070659_100249468
808 Ga0070659_100262516
809 Ga0070667_100214554
810 Ga0070713_100006475
811 Ga0070701_10003379
812 Ga0070701_10030659
813 Ga0070701_10058487
814 Ga0070701_10105286
815 Ga0070705_100000356
816 Ga0070705_100015909
817 Ga0070700_100001645
818 Ga0070700_100010495
819 Ga0070694_100002876
820 Ga0070694_100005891
821 Ga0070694_100007762
822 Ga0070694_100009823
823 Ga0070694_100141508
824 Ga0070694_100167622
825 Ga0070708_100011057
826 Ga0070663_100019534
827 Ga0070663_100249573
828 Ga0070678_100406614
829 Ga0070662_100018159
830 Ga0070662_100065682
831 Ga0070681_10109836
832 Ga0070681_10190623
833 Ga0068867_100001427
834 Ga0068867_100012674
835 Ga0068867_100018327
836 Ga0068867_100075831
837 Ga0070685_10010761
838 Ga0070685_10059765
839 Ga0070685_10062649
840 Ga0070706_100052706
841 Ga0070707_100052259
842 Ga0070707_100075009
843 Ga0070707_100400412
844 Ga0070707_100415274
845 Ga0070707_100575018
846 Ga0070698_100025487
847 Ga0070698_100096222
848 Ga0070698_100144726
849 Ga0070698_100409280
850 Ga0070699_100010698
851 Ga0070679_100067992
852 Ga0070679_100130038
853 Ga0070679_100206248
854 Ga0070679_100236883
855 Ga0070684_100083662
856 Ga0070684_100158450
857 Ga0070684_100622521
858 Ga0070697_100109264
859 Ga0070672_100015730
860 Ga0070672_100376868
861 Ga0070686_100141611
862 Ga0070686_100292340
863 Ga0070695_100001273
864 Ga0070695_100043111
865 Ga0070695_100131189
866 Ga0070696_100000483
867 Ga0070696_100003682
868 Ga0070696_100012078
869 Ga0070696_100210822
870 Ga0070696_100288535
871 Ga0070665_100007118
872 Ga0070665_100017284
873 Ga0070665_100028080
874 Ga0070665_100055681
875 Ga0070704_100004260
876 Ga0070704_100018936
877 Ga0070704_100026719
878 Ga0070704_100050593
879 Ga0070704_100241248
880 Ga0070664_100002505
881 Ga0070664_100110390
882 Ga0070664_100160166
883 Ga0070664_100334184
884 Ga0068857_100056680
885 Ga0068857_100377941
886 Ga0068854_100259875
887 Ga0068854_100383450
888 Ga0070702_100007227
889 Ga0070702_100013183
890 Ga0070702_100192152
891 Ga0068852_100137289
892 Ga0068852_100383651
893 Ga0068852_100680734
894 Ga0068859_100002960
895 Ga0068859_100010943
896 Ga0068859_100042113
897 Ga0068859_100444924
898 Ga0068864_100024252
899 Ga0068864_100056830
900 Ga0068864_100091425
901 Ga0068864_100253197
902 Ga0068864_100486656
903 Ga0068864_100556068
904 Ga0068866_10088895
905 Ga0068861_100006731
906 Ga0068861_100008906
907 Ga0068861_100114469
908 Ga0068861_100186178
909 Ga0068870_10001969
910 Ga0068870_10044523
911 Ga0068870_10125491
912 Ga0068863_100002852
913 Ga0068863_100021919
914 Ga0068858_100001639
915 Ga0068858_100013409
916 Ga0068858_100051333
917 Ga0068858_100075714
918 Ga0068858_100102484
919 Ga0068858_100130999
920 Ga0068860_100082998
921 Ga0068860_100255923
922 Ga0068860_100335810
923 Ga0068862_100001092
924 Ga0068862_100007080
925 Ga0068862_100018210
926 Ga0068862_100018900
927 Ga0068862_100108322
928 Ga0068862_100158980
929 Ga0068862_100175978
930 Ga0081538_10060483
931 Ga0081539_10000215
932 Ga0070717_10356187
933 Ga0070715_10013240
934 Ga0070716_100059613
935 Ga0097621_100004345
936 Ga0097621_100021344
937 Ga0097621_100029027
938 Ga0097621_100041893
939 Ga0097621_100059420
940 Ga0097621_100119646
941 Ga0097621_100280312
942 Ga0068871_100002760
943 Ga0068871_100009212
944 Ga0068871_100012387
945 Ga0068871_100014512
946 Ga0068871_100134346
947 Ga0075428_100000009
948 Ga0075428_100001308
949 Ga0075428_100009617
950 Ga0075428_100011955
951 Ga0075428_100014461
952 Ga0075428_100038753
953 Ga0075428_100152598
954 Ga0075430_100001811
955 Ga0075430_100005120
956 Ga0075430_100025317
957 Ga0075431_100007393
958 Ga0075431_100067496
959 Ga0075431_100086187
960 Ga0075431_100094474
961 Ga0075431_100150918
962 Ga0075433_10004221
963 Ga0075433_10020473
964 Ga0075433_10054085
965 Ga0075433_10069172
966 Ga0075433_10074050
967 Ga0075433_10181976
968 Ga0075433_10338946
969 Ga0075433_10350036
970 Ga0075434_100000793
971 Ga0075434_100008810
972 Ga0075434_100012134
973 Ga0075434_100024126
974 Ga0075434_100031318
975 Ga0075434_100057372
976 Ga0075434_100093878
977 Ga0075434_100139383
978 Ga0075434_100215545
979 Ga0075434_100348739
980 Ga0075429_100029636
981 Ga0075429_100034621
982 Ga0068865_100039119
983 Ga0068865_100049014
984 Ga0068865_100050904
985 Ga0068865_100080317
986 Ga0075436_100019451
987 Ga0075436_100040566
988 Ga0075436_100138142
989 Ga0097620_100002960
990 Ga0097620_100010943
991 Ga0097620_100042117
992 Ga0097620_100444971
993 Ga0075435_100007280
994 Ga0075435_100028258
995 Ga0075435_100066979
996 Ga0075435_100083193
997 Ga0075435_100084215
998 Ga0075435_100249527
999 Ga0075435_100372724
1000 Ga0105240_10005359
1001 Ga0105240_10129716
1002 Ga0111539_10000366
1003 Ga0111539_10000566
1004 Ga0111539_10001752
1005 Ga0111539_10004494
1006 Ga0111539_10008469
1007 Ga0111539_10015909
1008 Ga0111539_10018163
1009 Ga0111539_10034919
1010 Ga0111539_10061624
1011 Ga0111539_10291012
1012 Ga0111539_10362094
1013 Ga0105245_10005435
1014 Ga0105245_10224937
1015 Ga0105245_10292765
1016 Ga0105247_10039237
1017 Ga0114129_10000282
1018 Ga0114129_10003944
1019 Ga0114129_10004539
1020 Ga0114129_10006925
1021 Ga0114129_10012189
1022 Ga0114129_10025436
1023 Ga0114129_10045558
1024 Ga0114129_10086087
1025 Ga0114129_10123596
1026 Ga0114129_10169705
1027 Ga0114129_10260009
1028 Ga0114129_10389603
1029 Ga0114129_10510590
1030 Ga0105243_10012238
1031 Ga0105243_10052921
1032 Ga0105243_10092847
1033 Ga0105243_10190695
1034 Ga0105241_10157643
1035 Ga0105242_10039955
1036 Ga0105242_10051064
1037 Ga0105242_10091311
1038 Ga0105242_10091970
1039 Ga0105242_10192110
1040 Ga0105242_10211338
1041 Ga0105242_10547222
1042 Ga0105248_10047970
1043 Ga0105248_10055032
1044 Ga0105248_10094007
1045 Ga0105248_10147040
1046 Ga0105248_10167344
1047 Ga0105248_10252837
1048 Ga0105248_10726658
1049 Ga0105238_10056429
1050 Ga0105249_10000685
1051 Ga0105249_10007794
1052 Ga0105249_10009303
1053 Ga0105249_10198930
1054 Ga0105249_10634629
1055 Ga0105246_10029525
1056 Ga0105246_10041068
1057 Ga0157374_10035297
1058 Ga0157374_10048180
1059 Ga0157374_10062264
1060 Ga0157374_10138661
1061 Ga0157378_10006671
1062 Ga0157378_10255478
1063 Ga0157378_10421988
1064 Ga0163162_10083454
1065 Ga0157375_10023122
1066 Ga0157375_10085074
1067 Ga0157375_10100860
1068 Ga0157375_10129774
1069 Ga0157375_10136702
1070 Ga0157375_10224824
1071 Ga0157375_10291681
1072 Ga0163163_10108728
1073 Ga0163163_10125395
1074 Ga0157380_10005351
1075 Ga0157380_10021164
1076 Ga0157380_10045563
1077 Ga0157380_10078095
1078 Ga0157380_10127605
1079 Ga0157380_10209305
1080 Ga0157377_10004756
1081 Ga0157377_10127202
1082 Ga0157379_10008461
1083 Ga0157379_10018554
1084 Ga0157379_10024853
1085 Ga0157379_10103525
1086 Ga0157379_10158690
1087 Ga0157379_10337724
1088 Ga0157376_10017316
1089 Ga0157376_10020216
1090 Ga0157376_10090182
1091 Ga0157376_10101226
1092 Ga0163161_10048572
1093 Ga0207673_1002326
1094 Ga0207697_10001659
1095 Ga0207697_10060978
1096 Ga0207682_10019543
1097 Ga0207682_10075436
1098 Ga0207688_10006844
1099 Ga0207688_10191554
1100 Ga0207680_10169564
1101 Ga0207680_10256167
1102 Ga0207647_10155421
1103 Ga0207645_10002080
1104 Ga0207645_10007348
1105 Ga0207645_10041489
1106 Ga0207645_10062650
1107 Ga0207643_10001558
1108 Ga0207643_10020330
1109 Ga0207643_10127109
1110 Ga0207707_10100671
1111 Ga0207707_10127375
1112 Ga0207707_10182379
1113 Ga0207695_10272347
1114 Ga0207695_10293020
1115 Ga0207695_10309091
1116 Ga0207662_10000721
1117 Ga0207662_10090274
1118 Ga0207662_10186952
1119 Ga0207657_10005894
1120 Ga0207657_10093446
1121 Ga0207657_10104997
1122 Ga0207652_10242164
1123 Ga0207646_10156286
1124 Ga0207646_10321147
1125 Ga0207681_10027821
1126 Ga0207681_10036057
1127 Ga0207681_10066495
1128 Ga0207681_10075783
1129 Ga0207681_10093105
1130 Ga0207681_10161369
1131 Ga0207681_10193369
1132 Ga0207694_10011794
1133 Ga0207650_10045121
1134 Ga0207659_10000255
1135 Ga0207659_10001496
1136 Ga0207659_10002440
1137 Ga0207659_10004875
1138 Ga0207659_10058146
1139 Ga0207659_10078410
1140 Ga0207659_10171697
1141 Ga0207659_10288870
1142 Ga0207687_10200945
1143 Ga0207700_10050502
1144 Ga0207644_10022545
1145 Ga0207644_10060748
1146 Ga0207644_10147278
1147 Ga0207706_10014496
1148 Ga0207706_10202047
1149 Ga0207686_10117928
1150 Ga0207686_10122305
1151 Ga0207686_10123776
1152 Ga0207686_10135109
1153 Ga0207709_10012266
1154 Ga0207709_10146404
1155 Ga0207670_10023846
1156 Ga0207670_10061707
1157 Ga0207670_10118490
1158 Ga0207669_10000261
1159 Ga0207669_10013686
1160 Ga0207669_10035635
1161 Ga0207669_10039970
1162 Ga0207669_10088660
1163 Ga0207704_10034282
1164 Ga0207704_10278901
1165 Ga0207665_10156701
1166 Ga0207691_10023906
1167 Ga0207691_10060939
1168 Ga0207691_10063585
1169 Ga0207691_10086405
1170 Ga0207691_10087901
1171 Ga0207691_10195080
1172 Ga0207691_10339422
1173 Ga0207711_10039151
1174 Ga0207711_10105754
1175 Ga0207711_10165923
1176 Ga0207711_10208379
1177 Ga0207711_10208480
1178 Ga0207689_10000675
1179 Ga0207689_10012354
1180 Ga0207689_10043116
1181 Ga0207689_10056691
1182 Ga0207661_10157587
1183 Ga0207661_10439538
1184 Ga0207679_10005709
1185 Ga0207679_10063429
1186 Ga0207679_10248472
1187 Ga0207667_10155741
1188 Ga0207651_10012418
1189 Ga0207651_10027979
1190 Ga0207651_10155397
1191 Ga0207651_10163719
1192 Ga0207712_10008468
1193 Ga0207712_10023384
1194 Ga0207712_10037575
1195 Ga0207668_10011983
1196 Ga0207668_10043797
1197 Ga0207668_10067816
1198 Ga0207640_10139934
1199 Ga0207658_10089583
1200 Ga0207677_10078164
1201 Ga0207677_10078177
1202 Ga0207677_10121220
1203 Ga0207677_10334615
1204 Ga0207703_10045307
1205 Ga0207703_10049587
1206 Ga0207703_10058327
1207 Ga0207703_10065219
1208 Ga0207703_10073855
1209 Ga0207703_10074702
1210 Ga0207703_10074859
1211 Ga0207703_10180901
1212 Ga0207703_10222978
1213 Ga0207678_10050719
1214 Ga0207708_10002321
1215 Ga0207708_10002401
1216 Ga0207708_10006268
1217 Ga0207708_10151381
1218 Ga0207702_10280665
1219 Ga0207641_10012330
1220 Ga0207641_10037507
1221 Ga0207641_10109454
1222 Ga0207641_10432457
1223 Ga0207641_10700057
1224 Ga0207648_10003340
1225 Ga0207648_10005959
1226 Ga0207648_10007328
1227 Ga0207648_10009126
1228 Ga0207648_10192230
1229 Ga0207648_10316402
1230 Ga0207676_10023587
1231 Ga0207676_10028455
1232 Ga0207676_10147923
1233 Ga0207676_10179151
1234 Ga0207674_10006186
1235 Ga0207674_10131086
1236 Ga0207675_100002131
1237 Ga0207675_100014741
1238 Ga0207675_100098359
1239 Ga0207675_100266672
1240 Ga0207675_100356558
1241 Ga0207683_10009195
1242 Ga0207683_10026037
1243 Ga0207683_10043987
1244 Ga0207683_10104540
1245 Ga0207683_10109147
1246 Ga0207698_10267686
1247 Ga0209971_1014347
1248 Ga0207428_10000294
1249 Ga0207428_10000491
1250 Ga0207428_10007768
1251 Ga0207428_10009679
1252 Ga0207428_10019702
1253 Ga0207428_10021873
1254 Ga0207428_10064766
1255 Ga0268266_10035535
1256 Ga0268266_10066767
1257 Ga0268266_10661531
1258 Ga0268265_10000772
1259 Ga0268265_10015140
1260 Ga0268265_10042143
1261 Ga0268265_10200887
1262 Ga0268265_10247824
1263 Ga0268264_10033386
1264 Ga0268264_10069685
1265 Ga0268264_10084214
1266 Ga0268264_10148556
1267 Ga0268264_10197661
1268 Ga0307408_100100033
1269 Ga0307408_100128633
1270 Ga0265314_10031526
1271 Ga0265314_10070623
1272 Ga0307413_10002354
1273 Ga0307413_10078094
1274 Ga0307407_10020942
1275 Ga0307407_10027253
1276 Ga0307407_10028728
1277 Ga0307412_10245915
1278 Ga0307409_100023799
1279 Ga0307409_100032117
1280 Ga0307409_100064371
1281 Ga0307409_100481608
1282 Ga0307414_10001963
1283 Ga0307411_10070242
1284 Ga0307411_10359985
1285 Ga0307415_100089240
1286 Ga0373951_0014965
1287 Ga0373952_0035779
1288 Ga0373954_0040849
1289 Ga0373946_0065615
1290 Ga0373935_0038644
1291 Ga0373927_0228940
1292 Ga0373933_0063408
1293 Ga0373933_0175041
1294 Ga0373947_0041730
1295 Ga0373937_0074864
1296 Ga0373937_0119616
1297 Ga0373937_0383641
1298 Ga0373925_0021236
1299 Ga0373925_0277111
1300 Ga0451807_1763252
1301 Ga0439441_021600
1302 Ga0439450_002580
1303 Ga0439435_0002150
1304 Ga0439435_0005352
1305 Ga0450916_003379
1306 Ga0451577_0066113
1307 Ga0451577_0145756
1308 Ga0439440_0020357
1309 Ga0439440_0034584
1310 Ga0453684_0097862
1311 Ga0451576_0002764
1312 Ga0451576_0007839
1313 Ga0451576_0069178
1314 Ga0466967_0521466
1315 Ga0495592_0255762
1316 Ga0495603_0138873
1317 Ga0495629_0110345
1318 Ga0495629_0255937
1319 Ga0495629_0286779
1320 Ga0495608_0003598
1321 Ga0495608_0201523
1322 Ga0495630_0099378
1323 Ga0495643_0021339
1324 Ga0495663_0006765
1325 Ga0495642_0006117
1326 Ga0495640_0019841
1327 Ga0495640_0194165
1328 Ga0495587_0031983
1329 Ga0495645_0079577
1330 Ga0495633_0122459
1331 Ga0495659_0003741
1332 Ga0495623_0079788
1333 Ga0495647_0025637
1334 Ga0495647_0035787
1335 Ga0495658_0024794
1336 Ga0495658_0112124
1337 Ga0495658_0153527
1338 Ga0495658_0163714
1339 Ga0495669_0013733
1340 Ga0495613_0005334
1341 Ga0495604_0097102
1342 Ga0495674_0084878
1343 Ga0495674_0218277
1344 Ga0495685_021667
1345 Ga0495684_0000078
1346 Ga0496101_0001289
1347 Ga0496102_0248479
1348 Ga0496102_0374011
1349 Ga0496104_0074628
1350 Ga0496104_0078842
1351 Ga0496105_0056653
1352 Ga0496106_0137957
1353 Ga0496107_0020617
1354 Ga0496108_0085405
1355 Ga0496109_0031315
1356 Ga0496109_0155188
1357 Ga0496109_0190716
1358 Ga0496109_0336237
1359 Ga0496110_0137002
1360 Ga0496111_0348067
1361 Ga0496112_0064004
1362 Ga0496114_0011700
1363 Ga0496114_0023232
1364 Ga0496115_0120467
1365 Ga0501034_0172820
1366 Ga0501036_0004187
1367 Ga0501039_0026447
1368 Ga0501039_0063853
1369 Ga0501039_0128714
1370 Ga0501040_0022229
1371 Ga0501040_0068989
1372 Ga0501040_0082243
1373 Ga0501040_0286579
1374 Ga0501041_0012234
1375 Ga0501042_0018125
1376 Ga0501042_0164194
1377 Ga0501043_0098445
1378 Ga0501043_0153750
1379 Ga0501046_0022851
1380 Ga0501047_0265544
1381 Ga0501048_0065768
1382 Ga0501048_0189545
1383 Ga0501067_0050543
1384 Ga0501071_0070437
1385 Ga0501071_0102050
1386 Ga0501071_0231494
1387 Ga0501072_0124903
1388 Ga0501072_0210316
1389 Ga0501074_0328641
1390 Ga0501075_0001434
1391 Ga0501075_0010377
1392 Ga0501075_0067865
1393 Ga0501075_0316109
1394 Ga0501076_0003167
1395 Ga0501076_0021746
1396 Ga0501076_0021791
1397 Ga0501076_0024080
1398 Ga0501076_0207656
1399 Ga0501077_0034092
1400 Ga0501077_0245124
1401 Ga0501079_0005600
1402 Ga0501081_0000734
1403 Ga0501081_0039159
1404 Ga0501081_0340088
1405 Ga0501081_0400316
1406 Ga0501035_0070499
1407 Ga0501035_0321916
1408 Ga0501045_0023791
1409 Ga0501045_0076723
1410 Ga0501045_0087578
1411 nmdc:mga05p37_101674_c1
1412 nmdc:mga05p37_122887_c1
1413 nmdc:mga05p37_180840_c1
1414 nmdc:mga05p37_184847_c1
1415 nmdc:mga05p37_20670_c1
1416 nmdc:mga05p37_20851_c1
1417 nmdc:mga05p37_240875_c1
1418 nmdc:mga05p37_260890_c1
1419 nmdc:mga05p37_446631_c1
1420 nmdc:mga05p37_52514_c1
1421 nmdc:mga05p37_54090_c1
1422 nmdc:mga05p37_5540_c1
1423 nmdc:mga09592_38528_c2
1424 nmdc:mga09592_52899_c1
1425 nmdc:mga09592_58153_c1
1426 nmdc:mga0qj67_116705_c1
1427 nmdc:mga0qj67_37921_c1
1428 nmdc:mga0qj67_58552_c1
1429 nmdc:mga0qj67_78404_c1
1430 nmdc:mga0qj67_8804_c2
1431 nmdc:mga06r32_3488_c1
1432 nmdc:mga06r32_3997_c1
1433 nmdc:mga06r32_48032_c1
1434 nmdc:mga06r32_66937_c1
1435 nmdc:mga06r32_82760_c1
1436 nmdc:mga08y16_1131_c1
1437 nmdc:mga08y16_14171_c1
1438 nmdc:mga08y16_45226_c1
1439 nmdc:mga08y16_453270_c1
1440 nmdc:mga08y16_4833_c1
1441 nmdc:mga08y16_5119_c1
1442 nmdc:mga08y16_6_c1
1443 nmdc:mga0n895_125304_c1
1444 nmdc:mga0n895_141906_c1
1445 nmdc:mga0n895_142921_c1
1446 nmdc:mga0n895_1577_c1
1447 nmdc:mga0n895_158187_c1
1448 nmdc:mga0n895_158430_c1
1449 nmdc:mga0n895_22084_c1
1450 nmdc:mga0n895_22440_c1
1451 nmdc:mga0n895_260883_c1
1452 nmdc:mga0n895_31802_c1
1453 nmdc:mga0n895_415509_c1
1454 nmdc:mga0n895_480669_c1
1455 nmdc:mga0n895_89517_c1
1456 nmdc:mga0rr50_123488_c1
1457 nmdc:mga0rr50_145385_c1
1458 nmdc:mga0rr50_21240_c1
1459 nmdc:mga0rr50_3456_c2
1460 nmdc:mga0rr50_39402_c1
1461 nmdc:mga0rr50_50516_c1
1462 nmdc:mga0rr50_69685_c1
1463 nmdc:mga08x19_15291_c1
1464 nmdc:mga0a205_11945_c1
1465 nmdc:mga0a205_163043_c1
1466 nmdc:mga0a205_202910_c1
1467 nmdc:mga0a205_31047_c1
1468 nmdc:mga0a205_36086_c1
1469 nmdc:mga0a205_38990_c1
1470 nmdc:mga0a205_41419_c1
1471 nmdc:mga0a205_41735_c1
1472 nmdc:mga0a205_44349_c1
1473 nmdc:mga0a205_52349_c2
1474 nmdc:mga0a205_60740_c1
1475 nmdc:mga0a205_96917_c1
1476 Ga0495595_0076701
1477 Ga0495619_0007908
1478 Ga0495619_0131427
1479 Ga0500645_000077
1480 Ga0501084_0009792
1481 Ga0501082_0028649
1482 Ga0501082_0466334
1483 Ga0530510_0001640
1484 Ga0530510_0002998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9328 14 237
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9276 15 234
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9266 13 234
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.9252 15 234
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9246 12 233
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9564 13 236 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.954 13 239 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9523 13 239 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 12 239 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 13 239 3.40.50.300
ID Description Score Start End GO Terms
AF-W1WLP2-F1-model_v4 ABC transporter domain-containing protein 0.9827 102 239 GO:0005524
GO:0016887
AF-A0A7Z9SEN7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9725 15 239 GO:0005524
GO:0016887
AF-A0A7T9E6U4-F1-model_v4 deleted 0.9656 12 239
AF-A0A170S8R2-F1-model_v4 ABC transporter ATP-binding protein (Daunorubicin resistance ATP-binding protein) 0.9633 12 239 GO:0005524
GO:0016887
AF-A0A3R8QGP8-F1-model_v4 ABC transporter domain-containing protein 0.961 88 239 GO:0005524
GO:0016887

Map