F478558

General Info

Members Datasets Scaffolds Average Seq Length
740 321 740 291

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0718787|Ga0501082_0718787_56_853
Length 265
Sequence MTLDPEIEARIEEPASADAVREARLSPSEAVEHMRIRLPDRGNRKLRRVLERANGDKELRGWWHVANVNAVVRLEINDHSWVHIQIVANIALKLLRQLTKNGVEPSLVRDYGMDGEDAEVVVVLAALTHCVGMSVHRKGHEDWSLFQAITSHRADGEPLSLEAGILRVADALDMAKGRSRIPFERGQVSMHSLSAAAVEEVVITDGDTKPVRIEIVMNNSSGLFQVDGLLRAKLRGSGLEPYVEVIAHIDTDAEKRLVSEYRLEI

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 11.22
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011246 3300001989 Unclassified 3306
2 JGI24743J22301_10001489 3300001991 Bacteria 3254
3 JGI24738J21930_10004979 3300002075 Unclassified 3215
4 JGI24738J21930_10018973 3300002075 Archaea 1436
5 JGI24744J21845_10010350 3300002077 Unclassified 1911
6 JGI24742J22300_10002099 3300002244 Bacteria 3170
7 Ga0070658_10025121 3300005327 Bacteria 4776
8 Ga0070658_10055976 3300005327 Unclassified 3205
9 Ga0070658_10292219 3300005327 Bacteria 1389
10 Ga0070676_10150902 3300005328 Unclassified 1488
11 Ga0070683_100010645 3300005329 Bacteria 7906
12 Ga0070683_100011274 3300005329 Bacteria 7717
13 Ga0070683_100037548 3300005329 Bacteria 4435
14 Ga0070683_100081876 3300005329 Bacteria 3022
15 Ga0070683_100095282 3300005329 Bacteria 2798
16 Ga0070683_100576225 3300005329 Bacteria 1076
17 Ga0070690_100009736 3300005330 Bacteria 5574
18 Ga0070670_100042356 3300005331 Bacteria 3913
19 Ga0070670_100347975 3300005331 Bacteria 1301
20 Ga0068869_100046017 3300005334 Bacteria 3144
21 Ga0070680_100003864 3300005336 Bacteria 11196
22 Ga0070680_100012290 3300005336 Bacteria 6648
23 Ga0070680_100078877 3300005336 Unclassified 2713
24 Ga0070682_100005389 3300005337 Bacteria 7119
25 Ga0070682_100026934 3300005337 Bacteria 3445
26 Ga0070682_100201417 3300005337 Archaea 1404
27 Ga0068868_100023709 3300005338 Bacteria 4647
28 Ga0068868_100079462 3300005338 Bacteria 2627
29 Ga0070660_100425589 3300005339 Bacteria 1100
30 Ga0070689_100010225 3300005340 Bacteria 6684
31 Ga0070689_100060852 3300005340 Unclassified 2936
32 Ga0070691_10011914 3300005341 Unclassified 3980
33 Ga0070687_100074923 3300005343 Archaea 1829
34 Ga0070661_100008413 3300005344 Bacteria 7132
35 Ga0070661_100011485 3300005344 Bacteria 6168
36 Ga0070692_10014221 3300005345 Bacteria 3731
37 Ga0070692_10020404 3300005345 Bacteria 3213
38 Ga0070668_100010845 3300005347 Bacteria 6780
39 Ga0070668_100088306 3300005347 Bacteria 2440
40 Ga0070668_100157338 3300005347 Unclassified 1841
41 Ga0070669_100116514 3300005353 Archaea 2033
42 Ga0070675_100082178 3300005354 Unclassified 2687
43 Ga0070675_100125061 3300005354 Archaea 2187
44 Ga0070671_100073534 3300005355 Bacteria 2855
45 Ga0070671_100087563 3300005355 Bacteria 2606
46 Ga0070674_100004917 3300005356 Bacteria 7656
47 Ga0070674_100048705 3300005356 Bacteria 2909
48 Ga0070674_100058022 3300005356 Unclassified 2689
49 Ga0070674_100065278 3300005356 Bacteria 2554
50 Ga0070673_100187733 3300005364 Archaea 1773
51 Ga0070688_100017320 3300005365 Bacteria 4134
52 Ga0070659_100047707 3300005366 Unclassified 3361
53 Ga0070659_100090699 3300005366 Bacteria 2449
54 Ga0070659_100164871 3300005366 Unclassified 1813
55 Ga0070659_100168785 3300005366 Unclassified 1791
56 Ga0070667_100145761 3300005367 Archaea 2076
57 Ga0070703_10005780 3300005406 Bacteria 3466
58 Ga0070709_10218951 3300005434 Bacteria 1357
59 Ga0070709_10302454 3300005434 Bacteria 1169
60 Ga0070710_10017974 3300005437 Bacteria 3630
61 Ga0070701_10002028 3300005438 Bacteria 7679
62 Ga0070701_10173381 3300005438 Archaea 1257
63 Ga0070711_100000778 3300005439 Bacteria 16654
64 Ga0070711_100050323 3300005439 Bacteria 2857
65 Ga0070705_100012577 3300005440 Bacteria 4306
66 Ga0070700_100004283 3300005441 Bacteria 7448
67 Ga0070694_100055758 3300005444 Bacteria 2681
68 Ga0070708_100056964 3300005445 Bacteria 3478
69 Ga0070663_100038450 3300005455 Bacteria 3338
70 Ga0070678_100010583 3300005456 Bacteria 5644
71 Ga0070678_100120725 3300005456 Bacteria 2066
72 Ga0070662_100005776 3300005457 Bacteria 7927
73 Ga0070662_100097469 3300005457 Bacteria 2219
74 Ga0070681_10003855 3300005458 Bacteria 14112
75 Ga0070681_10045244 3300005458 Bacteria 4403
76 Ga0070681_10087127 3300005458 Bacteria 3075
77 Ga0068867_100026250 3300005459 Bacteria 4182
78 Ga0068867_100363868 3300005459 Archaea 1210
79 Ga0070685_10007351 3300005466 Bacteria 5632
80 Ga0070685_10035833 3300005466 Bacteria 2802
81 Ga0070707_100643592 3300005468 Archaea 1023
82 Ga0070698_100005716 3300005471 Bacteria 13614
83 Ga0070699_100078153 3300005518 Bacteria 2882
84 Ga0070699_100127927 3300005518 Bacteria 2238
85 Ga0070679_100042942 3300005530 Bacteria 4503
86 Ga0070679_100084145 3300005530 Bacteria 3169
87 Ga0070684_100012808 3300005535 Bacteria 6736
88 Ga0070684_100120477 3300005535 Bacteria 2360
89 Ga0070684_100194283 3300005535 Bacteria 1847
90 Ga0068853_100009478 3300005539 Bacteria 7845
91 Ga0068853_100178013 3300005539 Bacteria 1928
92 Ga0068853_100263725 3300005539 Archaea 1584
93 Ga0070672_100040145 3300005543 Bacteria 3589
94 Ga0070696_100026401 3300005546 Bacteria 3951
95 Ga0070693_100027437 3300005547 Bacteria 3086
96 Ga0070693_100059705 3300005547 Unclassified 2211
97 Ga0070693_100167509 3300005547 Unclassified 1404
98 Ga0070665_100160278 3300005548 Bacteria 2251
99 Ga0070704_100006800 3300005549 Bacteria 6771
100 Ga0070704_100126301 3300005549 Archaea 1974
101 Ga0068855_100112091 3300005563 Bacteria 3130
102 Ga0068855_100153220 3300005563 Bacteria 2620
103 Ga0070664_100001655 3300005564 Bacteria 17816
104 Ga0070664_100076158 3300005564 Unclassified 2882
105 Ga0070664_100175449 3300005564 Bacteria 1903
106 Ga0070664_100397718 3300005564 Bacteria 1259
107 Ga0068857_100207853 3300005577 Unclassified 1785
108 Ga0068854_100221324 3300005578 Archaea 1498
109 Ga0068856_100028879 3300005614 Bacteria 5419
110 Ga0068856_100037505 3300005614 Bacteria 4755
111 Ga0070702_100007827 3300005615 Bacteria 5138
112 Ga0070702_100043566 3300005615 Unclassified 2529
113 Ga0068852_100043332 3300005616 Bacteria 3816
114 Ga0068852_100078184 3300005616 Unclassified 2926
115 Ga0068852_100079567 3300005616 Bacteria 2903
116 Ga0068852_100084050 3300005616 Bacteria 2832
117 Ga0068852_100107007 3300005616 Bacteria 2536
118 Ga0068859_100153008 3300005617 Bacteria 2383
119 Ga0068864_100036679 3300005618 Bacteria 4180
120 Ga0068864_100211124 3300005618 Bacteria 1787
121 Ga0068861_100092806 3300005719 Bacteria 2385
122 Ga0068861_100125460 3300005719 Bacteria 2076
123 Ga0068861_100566068 3300005719 Bacteria 1038
124 Ga0068851_10016932 3300005834 Unclassified 3494
125 Ga0068870_10067545 3300005840 Unclassified 1940
126 Ga0068863_100033487 3300005841 Bacteria 4895
127 Ga0068860_100031873 3300005843 Bacteria 5067
128 Ga0068860_100101724 3300005843 Bacteria 2742
129 Ga0081455_10008516 3300005937 Bacteria 10653
130 Ga0081455_10019638 3300005937 Bacteria 6384
131 Ga0081455_10033510 3300005937 Bacteria 4615
132 Ga0081539_10000712 3300005985 Bacteria 66647
133 Ga0081539_10136213 3300005985 Bacteria 1199
134 Ga0075364_10051124 3300006051 Bacteria 2698
135 Ga0075432_10002694 3300006058 Bacteria 5939
136 Ga0075432_10008665 3300006058 Bacteria 3471
137 Ga0075432_10016054 3300006058 Bacteria 2557
138 Ga0070715_10072860 3300006163 Bacteria 1539
139 Ga0070715_10170560 3300006163 Unclassified 1083
140 Ga0070716_100216923 3300006173 Bacteria 1283
141 Ga0070712_100046450 3300006175 Bacteria 3002
142 Ga0070712_100067562 3300006175 Bacteria 2544
143 Ga0070712_100299083 3300006175 Unclassified 1302
144 Ga0097621_100047946 3300006237 Bacteria 3463
145 Ga0097621_100116997 3300006237 Bacteria 2258
146 Ga0097621_100547817 3300006237 Bacteria 1053
147 Ga0068871_100024236 3300006358 Bacteria 4702
148 Ga0068871_100028513 3300006358 Bacteria 4377
149 Ga0068871_100062935 3300006358 Bacteria 3033
150 Ga0068871_100130492 3300006358 Unclassified 2130
151 Ga0075428_100000942 3300006844 Bacteria 30775
152 Ga0075431_100017672 3300006847 Bacteria 7251
153 Ga0075433_10012982 3300006852 Bacteria 6753
154 Ga0075434_100139867 3300006871 Bacteria 2440
155 Ga0075429_100006563 3300006880 Bacteria 10074
156 Ga0068865_100006538 3300006881 Bacteria 7122
157 Ga0068865_100014818 3300006881 Bacteria 4960
158 Ga0068865_100054806 3300006881 Bacteria 2772
159 Ga0075436_100045219 3300006914 Bacteria 3036
160 Ga0097620_100153009 3300006931 Bacteria 2383
161 Ga0075435_100010187 3300007076 Bacteria 6867
162 Ga0105240_10106750 3300009093 Bacteria 3396
163 Ga0111539_10005668 3300009094 Bacteria 16155
164 Ga0111539_10008986 3300009094 Bacteria 12650
165 Ga0111539_10061471 3300009094 Bacteria 4450
166 Ga0111539_10107842 3300009094 Unclassified 3268
167 Ga0111539_10780055 3300009094 Archaea 1112
168 Ga0105245_10002722 3300009098 Bacteria 15912
169 Ga0105245_10003740 3300009098 Bacteria 13558
170 Ga0105245_10011716 3300009098 Bacteria 7631
171 Ga0105245_10030952 3300009098 Bacteria 4733
172 Ga0105245_10086760 3300009098 Bacteria 2871
173 Ga0105245_10123199 3300009098 Bacteria 2424
174 Ga0114129_10006031 3300009147 Bacteria 17180
175 Ga0114129_10006732 3300009147 Bacteria 16319
176 Ga0114129_10231371 3300009147 Bacteria 2489
177 Ga0105243_10019092 3300009148 Bacteria 5198
178 Ga0105243_10022765 3300009148 Bacteria 4764
179 Ga0105243_10029094 3300009148 Bacteria 4247
180 Ga0105243_10035934 3300009148 Bacteria 3842
181 Ga0105243_10381014 3300009148 Bacteria 1304
182 Ga0105243_10426742 3300009148 Archaea 1238
183 Ga0105242_10002896 3300009176 Bacteria 13426
184 Ga0105242_10025238 3300009176 Bacteria 4701
185 Ga0105242_10476757 3300009176 Archaea 1182
186 Ga0105248_10007689 3300009177 Bacteria 11840
187 Ga0105248_10147107 3300009177 Bacteria 2659
188 Ga0105248_10147113 3300009177 Bacteria 2659
189 Ga0105248_10305267 3300009177 Unclassified 1792
190 Ga0105237_10247575 3300009545 Unclassified 1784
191 Ga0105238_10037087 3300009551 Bacteria 4956
192 Ga0105238_10375838 3300009551 Unclassified 1412
193 Ga0105249_10004111 3300009553 Bacteria 12565
194 Ga0105249_10157113 3300009553 Bacteria 2194
195 Ga0105249_10414713 3300009553 Bacteria 1379
196 Ga0105239_10004419 3300010375 Bacteria 16815
197 Ga0105239_10033163 3300010375 Bacteria 5671
198 Ga0105239_10055548 3300010375 Unclassified 4343
199 Ga0105246_10005688 3300011119 Bacteria 7605
200 Ga0105246_10085070 3300011119 Unclassified 2264
201 Ga0157373_10143881 3300013100 Unclassified 1677
202 Ga0157371_10010321 3300013102 Bacteria 7288
203 Ga0157371_10117162 3300013102 Bacteria 1893
204 Ga0157371_10138521 3300013102 Bacteria 1733
205 Ga0157370_10166912 3300013104 Unclassified 2047
206 Ga0157369_10031662 3300013105 Bacteria 5821
207 Ga0157369_10218605 3300013105 Unclassified 1995
208 Ga0157369_10426035 3300013105 Bacteria 1375
209 Ga0157374_10006575 3300013296 Bacteria 9870
210 Ga0163162_10039731 3300013306 Bacteria 4703
211 Ga0163162_10104233 3300013306 Bacteria 2931
212 Ga0163162_10159702 3300013306 Bacteria 2375
213 Ga0163162_10166169 3300013306 Bacteria 2330
214 Ga0157372_10006446 3300013307 Bacteria 12495
215 Ga0157372_10016007 3300013307 Bacteria 8045
216 Ga0157372_10227194 3300013307 Unclassified 2164
217 Ga0157372_10384281 3300013307 Bacteria 1636
218 Ga0157375_10023531 3300013308 Bacteria 5685
219 Ga0157375_10103461 3300013308 Bacteria 2934
220 Ga0157375_10169654 3300013308 Bacteria 2329
221 Ga0157375_10449341 3300013308 Bacteria 1454
222 Ga0157375_10945666 3300013308 Unclassified 1004
223 Ga0163163_10159741 3300014325 Bacteria 2299
224 Ga0163163_10445551 3300014325 Unclassified 1355
225 Ga0157380_10037797 3300014326 Bacteria 3743
226 Ga0157380_10050383 3300014326 Bacteria 3289
227 Ga0157380_10459036 3300014326 Archaea 1226
228 Ga0157377_10007022 3300014745 Bacteria 5408
229 Ga0157377_10013079 3300014745 Bacteria 4191
230 Ga0157377_10068137 3300014745 Bacteria 2050
231 Ga0157379_10067408 3300014968 Bacteria 3199
232 Ga0157376_10011146 3300014969 Bacteria 6614
233 Ga0157376_10034780 3300014969 Bacteria 4071
234 Ga0157376_10169969 3300014969 Bacteria 1984
235 Ga0157376_10345258 3300014969 Bacteria 1423
236 Ga0157376_10633535 3300014969 Bacteria 1068
237 Ga0163161_10087346 3300017792 Bacteria 2303
238 Ga0163161_10218883 3300017792 Bacteria 1474
239 Ga0206353_10640569 3300020082 Unclassified 1505
240 Ga0224712_10076538 3300022467 Unclassified 1371
241 Ga0207653_10007128 3300025885 Bacteria 3492
242 Ga0207692_10014959 3300025898 Bacteria 3403
243 Ga0207642_10017208 3300025899 Bacteria 2744
244 Ga0207688_10018141 3300025901 Bacteria 3830
245 Ga0207647_10055787 3300025904 Bacteria 2427
246 Ga0207699_10078398 3300025906 Bacteria 2040
247 Ga0207699_10109794 3300025906 Bacteria 1766
248 Ga0207645_10137393 3300025907 Unclassified 1592
249 Ga0207643_10015732 3300025908 Bacteria 4120
250 Ga0207643_10158919 3300025908 Bacteria 1359
251 Ga0207705_10099972 3300025909 Unclassified 2133
252 Ga0207705_10130681 3300025909 Unclassified 1869
253 Ga0207654_10171124 3300025911 Archaea 1410
254 Ga0207707_10020297 3300025912 Bacteria 5801
255 Ga0207695_10047042 3300025913 Bacteria 4569
256 Ga0207693_10010927 3300025915 Bacteria 7358
257 Ga0207693_10071413 3300025915 Bacteria 2717
258 Ga0207693_10085853 3300025915 Bacteria 2465
259 Ga0207693_10284094 3300025915 Bacteria 1297
260 Ga0207663_10026556 3300025916 Bacteria 3363
261 Ga0207660_10052625 3300025917 Unclassified 2899
262 Ga0207660_10190249 3300025917 Bacteria 1598
263 Ga0207662_10034397 3300025918 Bacteria 2957
264 Ga0207662_10117577 3300025918 Bacteria 1664
265 Ga0207657_10010086 3300025919 Bacteria 9445
266 Ga0207657_10053270 3300025919 Bacteria 3506
267 Ga0207657_10136263 3300025919 Bacteria 2009
268 Ga0207657_10369038 3300025919 Bacteria 1131
269 Ga0207649_10047442 3300025920 Unclassified 2644
270 Ga0207649_10298527 3300025920 Bacteria 1177
271 Ga0207652_10295645 3300025921 Bacteria 1461
272 Ga0207694_10099848 3300025924 Unclassified 2299
273 Ga0207659_10030066 3300025926 Unclassified 3708
274 Ga0207659_10286411 3300025926 Archaea 1349
275 Ga0207687_10050998 3300025927 Bacteria 2883
276 Ga0207687_10059790 3300025927 Bacteria 2686
277 Ga0207687_10106637 3300025927 Bacteria 2072
278 Ga0207687_10125509 3300025927 Bacteria 1926
279 Ga0207700_10170456 3300025928 Archaea 1816
280 Ga0207644_10062299 3300025931 Bacteria 2705
281 Ga0207644_10120843 3300025931 Archaea 1994
282 Ga0207690_10070781 3300025932 Bacteria 2403
283 Ga0207690_10099725 3300025932 Unclassified 2071
284 Ga0207690_10237437 3300025932 Archaea 1402
285 Ga0207706_10038276 3300025933 Bacteria 4255
286 Ga0207706_10048645 3300025933 Bacteria 3749
287 Ga0207706_10145350 3300025933 Bacteria 2086
288 Ga0207686_10007462 3300025934 Bacteria 5885
289 Ga0207686_10031563 3300025934 Bacteria 3147
290 Ga0207686_10068351 3300025934 Bacteria 2276
291 Ga0207709_10004231 3300025935 Bacteria 8321
292 Ga0207709_10034834 3300025935 Bacteria 2971
293 Ga0207709_10035388 3300025935 Unclassified 2952
294 Ga0207670_10138682 3300025936 Archaea 1791
295 Ga0207669_10014759 3300025937 Bacteria 3923
296 Ga0207669_10211339 3300025937 Bacteria 1416
297 Ga0207669_10402428 3300025937 Bacteria 1073
298 Ga0207704_10007862 3300025938 Bacteria 5062
299 Ga0207704_10078028 3300025938 Bacteria 2129
300 Ga0207704_10096155 3300025938 Bacteria 1961
301 Ga0207665_10011957 3300025939 Bacteria 5701
302 Ga0207665_10062245 3300025939 Bacteria 2531
303 Ga0207691_10009495 3300025940 Bacteria 9342
304 Ga0207691_10019977 3300025940 Bacteria 6337
305 Ga0207691_10104323 3300025940 Bacteria 2527
306 Ga0207691_10136579 3300025940 Bacteria 2162
307 Ga0207691_10423099 3300025940 Bacteria 1135
308 Ga0207711_10052951 3300025941 Bacteria 3480
309 Ga0207711_10121958 3300025941 Bacteria 2328
310 Ga0207711_10183204 3300025941 Unclassified 1905
311 Ga0207689_10124158 3300025942 Unclassified 2124
312 Ga0207661_10000273 3300025944 Bacteria 33324
313 Ga0207661_10030244 3300025944 Bacteria 4169
314 Ga0207661_10059962 3300025944 Bacteria 3068
315 Ga0207661_10083062 3300025944 Bacteria 2650
316 Ga0207679_10011244 3300025945 Bacteria 5785
317 Ga0207679_10082372 3300025945 Bacteria 2463
318 Ga0207679_10318358 3300025945 Bacteria 1346
319 Ga0207667_10122950 3300025949 Bacteria 2674
320 Ga0207667_10177122 3300025949 Unclassified 2190
321 Ga0207667_10426227 3300025949 Bacteria 1349
322 Ga0207651_10144877 3300025960 Archaea 1840
323 Ga0207712_10005182 3300025961 Bacteria 8251
324 Ga0207712_10128430 3300025961 Unclassified 1928
325 Ga0207668_10068533 3300025972 Bacteria 2523
326 Ga0207668_10132156 3300025972 Bacteria 1907
327 Ga0207640_10005036 3300025981 Bacteria 7188
328 Ga0207640_10059396 3300025981 Unclassified 2524
329 Ga0207658_10004151 3300025986 Bacteria 10096
330 Ga0207677_10015516 3300026023 Unclassified 4485
331 Ga0207677_10142865 3300026023 Bacteria 1835
332 Ga0207639_10041361 3300026041 Bacteria 3447
333 Ga0207678_10033959 3300026067 Unclassified 4443
334 Ga0207678_10047340 3300026067 Bacteria 3719
335 Ga0207708_10001826 3300026075 Bacteria 15704
336 Ga0207708_10029676 3300026075 Bacteria 4145
337 Ga0207708_10091870 3300026075 Bacteria 2341
338 Ga0207702_10028163 3300026078 Bacteria 4668
339 Ga0207641_10140396 3300026088 Archaea 2179
340 Ga0207648_10000504 3300026089 Bacteria 43569
341 Ga0207648_10133134 3300026089 Unclassified 2189
342 Ga0207648_10156463 3300026089 Bacteria 2012
343 Ga0207648_10193423 3300026089 Archaea 1804
344 Ga0207676_10184999 3300026095 Archaea 1827
345 Ga0207676_10194894 3300026095 Bacteria 1786
346 Ga0207674_10044028 3300026116 Bacteria 4600
347 Ga0207674_10136767 3300026116 Unclassified 2412
348 Ga0207675_100027437 3300026118 Bacteria 5304
349 Ga0207675_100038087 3300026118 Bacteria 4487
350 Ga0207675_100340004 3300026118 Bacteria 1469
351 Ga0207683_10001483 3300026121 Bacteria 21156
352 Ga0207683_10052152 3300026121 Bacteria 3584
353 Ga0207683_10072940 3300026121 Bacteria 3036
354 Ga0207683_10236265 3300026121 Archaea 1667
355 Ga0207698_10015478 3300026142 Bacteria 5107
356 Ga0207698_10104049 3300026142 Unclassified 2361
357 Ga0207698_10230143 3300026142 Unclassified 1682
358 Ga0207698_10563697 3300026142 Bacteria 1118
359 Ga0207428_10000222 3300027907 Bacteria 78747
360 Ga0207428_10010823 3300027907 Bacteria 8126
361 Ga0207428_10063181 3300027907 Bacteria 2926
362 Ga0268266_10210584 3300028379 Archaea 1782
363 Ga0268265_10260636 3300028380 Archaea 1541
364 Ga0268264_10126903 3300028381 Bacteria 2256
365 Ga0265337_1067712 3300028556 Unclassified 984
366 Ga0265319_1016801 3300028563 Bacteria 2800
367 Ga0265318_10022513 3300028577 Bacteria 2518
368 Ga0265338_10132985 3300028800 Bacteria 1961
369 Ga0265320_10036069 3300031240 Bacteria 2502
370 Ga0265327_10007879 3300031251 Bacteria 8076
371 Ga0307416_100005871 3300032002 Bacteria 7617
372 Ga0307416_100075003 3300032002 Bacteria 2829
373 Ga0307415_100007073 3300032126 Bacteria 6108
374 Ga0373958_0033953 3300034819 Archaea 1014
375 Ga0373926_0035641 3300035083 Bacteria 1766
376 Ga0373941_0042587 3300035115 Archaea 1410
377 Ga0373941_0055561 3300035115 Bacteria 1273
378 Ga0373943_0002579 3300035170 Bacteria 8251
379 Ga0373946_0014784 3300035171 Bacteria 2949
380 Ga0373961_0009431 3300035241 Bacteria 2388
381 Ga0373962_0008415 3300035242 Bacteria 2538
382 Ga0373931_0033478 3300035691 Bacteria 2663
383 Ga0373947_0019921 3300035725 Bacteria 3872
384 Ga0373925_0075236 3300037068 Bacteria 2558
385 Ga0395900_0015005 3300037418 Bacteria 7897
386 Ga0395900_0368717 3300037418 Bacteria 1406
387 Ga0395898_0016145 3300037466 Bacteria 7646
388 Ga0395898_0163407 3300037466 Bacteria 2130
389 Ga0395898_0231517 3300037466 Bacteria 1762
390 Ga0395898_0383501 3300037466 Unclassified 1340
391 Ga0395905_0177317 3300037471 Bacteria 2000
392 Ga0395905_0339521 3300037471 Bacteria 1393
393 Ga0395905_0484893 3300037471 Bacteria 1136
394 Ga0395901_0112921 3300038443 Bacteria 2853
395 Ga0395901_0244751 3300038443 Bacteria 1870
396 Ga0395901_0688630 3300038443 Archaea 1021
397 Ga0451807_1862518 3300041486 Bacteria 1042
398 Ga0439441_002460 3300042001 Bacteria 2614
399 Ga0439448_0055586 3300042005 Unclassified 1302
400 Ga0439449_0056392 3300042007 Unclassified 1451
401 Ga0439450_037602 3300042008 Unclassified 1113
402 Ga0439462_0000831 3300042015 Bacteria 6444
403 Ga0439446_0004313 3300042156 Bacteria 3599
404 Ga0439464_0069137 3300042439 Bacteria 1043
405 Ga0466966_0100587 3300044684 Bacteria 1788
406 Ga0466961_0139218 3300044693 Bacteria 1520
407 Ga0466967_0006293 3300045976 Bacteria 8375
408 Ga0466967_0237480 3300045976 Bacteria 1737
409 Ga0495592_0133474 3300046454 Bacteria 1734
410 Ga0495592_0210571 3300046454 Bacteria 1305
411 Ga0495603_0018540 3300046455 Bacteria 4209
412 Ga0495603_0150082 3300046455 Unclassified 1354
413 Ga0495603_0211385 3300046455 Bacteria 1120
414 Ga0495603_0307403 3300046455 Bacteria 911
415 Ga0495629_0001622 3300046459 Bacteria 17679
416 Ga0495629_0069147 3300046459 Bacteria 2464
417 Ga0495629_0176166 3300046459 Bacteria 1483
418 Ga0495641_0001841 3300046461 Bacteria 17419
419 Ga0495641_0043195 3300046461 Bacteria 2085
420 Ga0495641_0151683 3300046461 Bacteria 1036
421 Ga0495651_0018214 3300046462 Bacteria 5438
422 Ga0495651_0064146 3300046462 Bacteria 2807
423 Ga0495653_0011544 3300046463 Bacteria 7211
424 Ga0495653_0036570 3300046463 Bacteria 3866
425 Ga0495653_0092426 3300046463 Bacteria 2209
426 Ga0495653_0110420 3300046463 Bacteria 1977
427 Ga0495582_0000462 3300046473 Bacteria 22207
428 Ga0495582_0062724 3300046473 Archaea 2053
429 Ga0495582_0184382 3300046473 Unclassified 1190
430 Ga0495639_0005703 3300046475 Bacteria 5355
431 Ga0495639_0042675 3300046475 Bacteria 2047
432 Ga0495662_0004015 3300046476 Bacteria 7414
433 Ga0495664_0202267 3300046477 Bacteria 1203
434 Ga0495664_0204437 3300046477 Bacteria 1196
435 Ga0495594_0035267 3300046499 Bacteria 2725
436 Ga0495594_0053503 3300046499 Bacteria 2224
437 Ga0495594_0150479 3300046499 Archaea 1321
438 Ga0495596_0084159 3300046500 Bacteria 1235
439 Ga0495608_0039817 3300046511 Bacteria 3149
440 Ga0495608_0158081 3300046511 Bacteria 1442
441 Ga0495628_0084657 3300046516 Bacteria 2460
442 Ga0495628_0217698 3300046516 Archaea 1435
443 Ga0495630_0054489 3300046517 Bacteria 2996
444 Ga0495630_0057723 3300046517 Bacteria 2909
445 Ga0495663_0040333 3300046525 Archaea 1417
446 Ga0495666_0017424 3300046526 Bacteria 3578
447 Ga0495652_0085313 3300046529 Bacteria 2595
448 Ga0495665_0003126 3300046531 Bacteria 8953
449 Ga0495640_0004048 3300046533 Bacteria 11731
450 Ga0495640_0152438 3300046533 Bacteria 1484
451 Ga0495609_0114212 3300046538 Archaea 1164
452 Ga0495645_0085532 3300046543 Bacteria 2257
453 Ga0495667_0017056 3300046559 Bacteria 4904
454 Ga0495667_0040061 3300046559 Bacteria 3112
455 Ga0495656_0160861 3300046615 Bacteria 1091
456 Ga0495668_0131518 3300046616 Unclassified 1370
457 Ga0495668_0249142 3300046616 Archaea 973
458 Ga0495634_0030484 3300046642 Bacteria 3724
459 Ga0495634_0085694 3300046642 Bacteria 2053
460 Ga0495634_0098162 3300046642 Bacteria 1895
461 Ga0495635_0023025 3300046663 Bacteria 4342
462 Ga0495635_0031947 3300046663 Bacteria 3653
463 Ga0495659_0030922 3300046664 Archaea 1865
464 Ga0495588_0164601 3300046674 Bacteria 1173
465 Ga0495646_0030015 3300046680 Bacteria 3396
466 Ga0495646_0067604 3300046680 Bacteria 2112
467 Ga0495647_0009375 3300046681 Bacteria 3315
468 Ga0495647_0028537 3300046681 Bacteria 2058
469 Ga0495658_0001666 3300046683 Bacteria 11556
470 Ga0495613_0026261 3300046689 Bacteria 4339
471 Ga0495624_0099534 3300046690 Bacteria 1790
472 Ga0495589_0027915 3300046794 Bacteria 2853
473 Ga0495600_0035044 3300046809 Bacteria 3259
474 Ga0495600_0172318 3300046809 Bacteria 1397
475 Ga0495660_0069317 3300046810 Bacteria 1875
476 Ga0495581_0002858 3300047315 Bacteria 9862
477 Ga0495581_0019449 3300047315 Bacteria 3941
478 Ga0495604_0040214 3300047317 Bacteria 3672
479 Ga0495604_0055131 3300047317 Bacteria 3065
480 Ga0495604_0232939 3300047317 Bacteria 1262
481 Ga0495636_0056551 3300047318 Archaea 1652
482 Ga0495674_0005229 3300047319 Bacteria 12460
483 Ga0495674_0039532 3300047319 Bacteria 4227
484 Ga0495676_0005860 3300047321 Bacteria 11279
485 Ga0495676_0217889 3300047321 Unclassified 1317
486 Ga0495680_0002784 3300047322 Bacteria 17622
487 Ga0495680_0011900 3300047322 Bacteria 7678
488 Ga0495680_0029654 3300047322 Unclassified 4478
489 Ga0495680_0050977 3300047322 Bacteria 3234
490 Ga0495675_0046591 3300047444 Bacteria 2760
491 Ga0495685_067833 3300047447 Unclassified 1198
492 Ga0495684_0045963 3300047471 Bacteria 3340
493 Ga0495684_0135463 3300047471 Bacteria 1848
494 Ga0495593_0001385 3300047673 Bacteria 14192
495 Ga0495615_0048202 3300048090 Unclassified 1088
496 Ga0496100_0033934 3300048903 Bacteria 3197
497 Ga0496100_0041176 3300048903 Bacteria 2943
498 Ga0496100_0078972 3300048903 Bacteria 2216
499 Ga0496100_0151297 3300048903 Bacteria 1655
500 Ga0496101_0002328 3300048904 Bacteria 11634
501 Ga0496101_0017765 3300048904 Bacteria 4826
502 Ga0496101_0039255 3300048904 Bacteria 3366
503 Ga0496101_0068435 3300048904 Bacteria 2596
504 Ga0496101_0072977 3300048904 Unclassified 2520
505 Ga0496101_0112423 3300048904 Bacteria 2051
506 Ga0496101_0131225 3300048904 Unclassified 1903
507 Ga0496102_0005233 3300048905 Bacteria 11011
508 Ga0496102_0015201 3300048905 Bacteria 6700
509 Ga0496102_0029468 3300048905 Bacteria 4911
510 Ga0496102_0123284 3300048905 Bacteria 2421
511 Ga0496102_0331247 3300048905 Bacteria 1434
512 Ga0496103_0012557 3300048906 Bacteria 5023
513 Ga0496103_0012733 3300048906 Bacteria 4989
514 Ga0496103_0030047 3300048906 Bacteria 3305
515 Ga0496103_0074997 3300048906 Bacteria 2121
516 Ga0496103_0284131 3300048906 Archaea 1064
517 Ga0496104_0011721 3300048907 Bacteria 7864
518 Ga0496104_0071352 3300048907 Bacteria 3302
519 Ga0496104_0112972 3300048907 Bacteria 2605
520 Ga0496104_0179912 3300048907 Unclassified 2025
521 Ga0496104_0224622 3300048907 Bacteria 1790
522 Ga0496104_0241826 3300048907 Bacteria 1717
523 Ga0496104_0346175 3300048907 Bacteria 1399
524 Ga0496105_0012905 3300048908 Bacteria 6622
525 Ga0496105_0039714 3300048908 Bacteria 3880
526 Ga0496105_0042911 3300048908 Bacteria 3730
527 Ga0496105_0249752 3300048908 Bacteria 1437
528 Ga0496106_0006885 3300048909 Bacteria 8410
529 Ga0496106_0026307 3300048909 Bacteria 4332
530 Ga0496107_0022718 3300048910 Bacteria 4434
531 Ga0496107_0045062 3300048910 Bacteria 3172
532 Ga0496107_0157642 3300048910 Archaea 1681
533 Ga0496107_0173949 3300048910 Bacteria 1598
534 Ga0496107_0184352 3300048910 Unclassified 1550
535 Ga0496107_0209630 3300048910 Bacteria 1449
536 Ga0496108_0001049 3300048911 Bacteria 21529
537 Ga0496108_0004163 3300048911 Bacteria 11639
538 Ga0496108_0033737 3300048911 Bacteria 4251
539 Ga0496108_0195096 3300048911 Bacteria 1756
540 Ga0496108_0245195 3300048911 Bacteria 1558
541 Ga0496108_0252242 3300048911 Bacteria 1535
542 Ga0496108_0360308 3300048911 Bacteria 1269
543 Ga0496109_0001264 3300048912 Bacteria 21000
544 Ga0496109_0003075 3300048912 Bacteria 13918
545 Ga0496109_0063003 3300048912 Bacteria 3391
546 Ga0496109_0068855 3300048912 Bacteria 3244
547 Ga0496109_0172682 3300048912 Archaea 2028
548 Ga0496109_0201981 3300048912 Unclassified 1869
549 Ga0496109_0591421 3300048912 Bacteria 1046
550 Ga0496110_0002510 3300048913 Bacteria 13781
551 Ga0496110_0049426 3300048913 Bacteria 3689
552 Ga0496110_0058394 3300048913 Bacteria 3398
553 Ga0496111_0001623 3300048914 Bacteria 13021
554 Ga0496111_0020552 3300048914 Bacteria 4597
555 Ga0496111_0035925 3300048914 Bacteria 3543
556 Ga0496111_0055939 3300048914 Bacteria 2854
557 Ga0496111_0061099 3300048914 Bacteria 2732
558 Ga0496112_0001992 3300048915 Bacteria 16159
559 Ga0496112_0022811 3300048915 Bacteria 5973
560 Ga0496112_0324990 3300048915 Unclassified 1482
561 Ga0496113_0012195 3300048916 Bacteria 5769
562 Ga0496113_0036216 3300048916 Bacteria 3614
563 Ga0496113_0083201 3300048916 Bacteria 2455
564 Ga0496113_0491293 3300048916 Bacteria 986
565 Ga0496114_0001590 3300048917 Bacteria 17228
566 Ga0496114_0014614 3300048917 Bacteria 6307
567 Ga0496114_0017636 3300048917 Bacteria 5765
568 Ga0496114_0040087 3300048917 Bacteria 3876
569 Ga0496114_0057517 3300048917 Bacteria 3246
570 Ga0496114_0106978 3300048917 Bacteria 2393
571 Ga0496114_0176422 3300048917 Unclassified 1865
572 Ga0496114_0470532 3300048917 Archaea 1112
573 Ga0496115_0005423 3300048918 Bacteria 9276
574 Ga0496115_0015045 3300048918 Bacteria 5864
575 Ga0496115_0026933 3300048918 Bacteria 4493
576 Ga0496115_0118509 3300048918 Bacteria 2177
577 Ga0496115_0264178 3300048918 Archaea 1415
578 Ga0501031_0025535 3300049568 Bacteria 3852
579 Ga0501031_0025779 3300049568 Bacteria 3836
580 Ga0501031_0153847 3300049568 Bacteria 1503
581 Ga0501032_0036340 3300049569 Bacteria 3362
582 Ga0501033_0015832 3300049570 Bacteria 5714
583 Ga0501036_0011392 3300049572 Bacteria 7360
584 Ga0501036_0018025 3300049572 Bacteria 5911
585 Ga0501036_0028189 3300049572 Bacteria 4748
586 Ga0501036_0044029 3300049572 Bacteria 3780
587 Ga0501036_0099281 3300049572 Bacteria 2462
588 Ga0501037_0024173 3300049573 Bacteria 4493
589 Ga0501037_0028075 3300049573 Bacteria 4156
590 Ga0501038_0067656 3300049574 Bacteria 3038
591 Ga0501038_0103741 3300049574 Bacteria 2364
592 Ga0501038_0316630 3300049574 Bacteria 1221
593 Ga0501039_0010512 3300049575 Bacteria 7054
594 Ga0501039_0069176 3300049575 Bacteria 2741
595 Ga0501039_0087762 3300049575 Unclassified 2423
596 Ga0501040_0011602 3300049576 Bacteria 5768
597 Ga0501040_0015469 3300049576 Bacteria 5041
598 Ga0501040_0059725 3300049576 Bacteria 2620
599 Ga0501040_0072220 3300049576 Bacteria 2383
600 Ga0501040_0131593 3300049576 Unclassified 1759
601 Ga0501041_0006586 3300049577 Bacteria 6802
602 Ga0501041_0014412 3300049577 Unclassified 4694
603 Ga0501041_0036026 3300049577 Bacteria 2999
604 Ga0501041_0036418 3300049577 Bacteria 2981
605 Ga0501042_0021476 3300049578 Bacteria 4500
606 Ga0501042_0032225 3300049578 Bacteria 3710
607 Ga0501042_0151374 3300049578 Bacteria 1673
608 Ga0501042_0343288 3300049578 Bacteria 1079
609 Ga0501043_0023412 3300049579 Bacteria 4844
610 Ga0501043_0070958 3300049579 Bacteria 2736
611 Ga0501046_0021953 3300049580 Bacteria 5261
612 Ga0501046_0037142 3300049580 Bacteria 3915
613 Ga0501046_0114390 3300049580 Unclassified 2058
614 Ga0501046_0125177 3300049580 Bacteria 1953
615 Ga0501047_0042263 3300049581 Bacteria 4405
616 Ga0501047_0195124 3300049581 Unclassified 1887
617 Ga0501048_0006842 3300049582 Bacteria 8662
618 Ga0501048_0075034 3300049582 Bacteria 2385
619 Ga0501048_0145510 3300049582 Bacteria 1676
620 Ga0501048_0244283 3300049582 Unclassified 1274
621 Ga0501067_0099830 3300049583 Bacteria 1612
622 Ga0501068_0017671 3300049584 Bacteria 4126
623 Ga0501068_0064524 3300049584 Bacteria 2229
624 Ga0501068_0178460 3300049584 Unclassified 1342
625 Ga0501068_0295758 3300049584 Archaea 1036
626 Ga0501069_0003998 3300049585 Bacteria 7612
627 Ga0501069_0009267 3300049585 Bacteria 5195
628 Ga0501069_0048048 3300049585 Unclassified 2369
629 Ga0501069_0191228 3300049585 Unclassified 1184
630 Ga0501070_0000463 3300049586 Bacteria 36856
631 Ga0501070_0008965 3300049586 Bacteria 8461
632 Ga0501070_0037460 3300049586 Bacteria 4049
633 Ga0501070_0220077 3300049586 Bacteria 1557
634 Ga0501070_0279859 3300049586 Unclassified 1361
635 Ga0501071_0001633 3300049587 Bacteria 13170
636 Ga0501071_0005316 3300049587 Bacteria 8262
637 Ga0501071_0010776 3300049587 Bacteria 6131
638 Ga0501071_0015215 3300049587 Bacteria 5278
639 Ga0501071_0218536 3300049587 Bacteria 1434
640 Ga0501071_0326288 3300049587 Bacteria 1166
641 Ga0501072_0004430 3300049588 Bacteria 10672
642 Ga0501072_0012942 3300049588 Bacteria 6382
643 Ga0501072_0025240 3300049588 Bacteria 4629
644 Ga0501072_0064725 3300049588 Bacteria 2883
645 Ga0501072_0084774 3300049588 Bacteria 2512
646 Ga0501072_0102940 3300049588 Bacteria 2269
647 Ga0501072_0110372 3300049588 Bacteria 2189
648 Ga0501073_0023917 3300049589 Bacteria 4386
649 Ga0501074_0266465 3300049590 Bacteria 1217
650 Ga0501075_0013771 3300049591 Bacteria 5780
651 Ga0501075_0042726 3300049591 Unclassified 3399
652 Ga0501075_0064604 3300049591 Bacteria 2760
653 Ga0501075_0139400 3300049591 Bacteria 1848
654 Ga0501075_0290930 3300049591 Bacteria 1244
655 Ga0501075_0305132 3300049591 Unclassified 1213
656 Ga0501076_0001355 3300049592 Bacteria 16389
657 Ga0501076_0006095 3300049592 Bacteria 8721
658 Ga0501076_0030833 3300049592 Bacteria 4178
659 Ga0501076_0056359 3300049592 Bacteria 3119
660 Ga0501076_0057549 3300049592 Bacteria 3087
661 Ga0501076_0091582 3300049592 Bacteria 2445
662 Ga0501076_0174261 3300049592 Unclassified 1753
663 Ga0501076_0225087 3300049592 Unclassified 1533
664 Ga0501076_0358816 3300049592 Bacteria 1197
665 Ga0501077_0002034 3300049593 Bacteria 12210
666 Ga0501077_0008596 3300049593 Bacteria 6331
667 Ga0501077_0013622 3300049593 Bacteria 5098
668 Ga0501079_0010820 3300049741 Bacteria 6949
669 Ga0501079_0052703 3300049741 Bacteria 3139
670 Ga0501079_0299023 3300049741 Unclassified 1259
671 Ga0501080_0064086 3300049742 Bacteria 3419
672 Ga0501080_0421310 3300049742 Bacteria 1199
673 Ga0501081_0002437 3300049743 Bacteria 11743
674 Ga0501081_0008222 3300049743 Bacteria 6774
675 Ga0501081_0031038 3300049743 Bacteria 3620
676 Ga0501081_0031067 3300049743 Bacteria 3618
677 Ga0501081_0088525 3300049743 Bacteria 2175
678 Ga0501081_0124829 3300049743 Unclassified 1836
679 Ga0501081_0212005 3300049743 Unclassified 1407
680 Ga0501081_0511919 3300049743 Bacteria 895
681 Ga0501083_0024272 3300049744 Bacteria 4202
682 Ga0501083_0062537 3300049744 Bacteria 2483
683 Ga0501035_0050738 3300049822 Bacteria 3717
684 Ga0501035_0080211 3300049822 Bacteria 2882
685 Ga0501035_0081993 3300049822 Bacteria 2846
686 Ga0501035_0245121 3300049822 Unclassified 1523
687 Ga0501044_0068923 3300049823 Bacteria 3602
688 Ga0501045_0015818 3300049824 Bacteria 5351
689 Ga0501045_0036450 3300049824 Bacteria 3570
690 Ga0501045_0057120 3300049824 Bacteria 2855
691 Ga0501045_0067561 3300049824 Bacteria 2625
692 Ga0501045_0076612 3300049824 Bacteria 2464
693 Ga0501045_0363440 3300049824 Bacteria 1077
694 nmdc:mga00v17_111869_c1 3300050491 Bacteria 1733
695 nmdc:mga00v17_266165_c1 3300050491 Bacteria 1112
696 nmdc:mga0yw44_237102_c1 3300050492 Bacteria 1212
697 nmdc:mga05p37_31823_c1 3300050507 Bacteria 6447
698 nmdc:mga05p37_74528_c1 3300050507 Bacteria 4177
699 nmdc:mga09592_83896_c1 3300050508 Bacteria 2716
700 nmdc:mga06r32_59447_c1 3300050510 Bacteria 1918
701 nmdc:mga08y16_39199_c1 3300050511 Bacteria 4971
702 nmdc:mga08y16_466235_c1 3300050511 Bacteria 1287
703 nmdc:mga08y16_48388_c1 3300050511 Bacteria 4450
704 nmdc:mga08y16_7836_c1 3300050511 Bacteria 11188
705 nmdc:mga0n895_11353_c1 3300050512 Bacteria 7941
706 nmdc:mga0rr50_93717_c1 3300050513 Bacteria 2344
707 nmdc:mga08x19_39226_c1 3300050514 Bacteria 3011
708 nmdc:mga0a205_150221_c1 3300050515 Bacteria 2229
709 nmdc:mga0a205_1575_c1 3300050515 Bacteria 19553
710 nmdc:mga0a205_476264_c1 3300050515 Bacteria 1107
711 nmdc:mga0a205_508747_c1 3300050515 Archaea 1061
712 Ga0495601_0028198 3300053077 Unclassified 3476
713 Ga0495601_0077001 3300053077 Bacteria 2136
714 Ga0495601_0239896 3300053077 Unclassified 1183
715 Ga0495612_0060746 3300053078 Unclassified 1565
716 Ga0495595_0024189 3300053084 Bacteria 2681
717 Ga0495595_0111689 3300053084 Unclassified 1326
718 Ga0495595_0163120 3300053084 Bacteria 1100
719 Ga0495619_0011828 3300053085 Bacteria 5497
720 Ga0495619_0035078 3300053085 Bacteria 3262
721 Ga0495619_0098853 3300053085 Bacteria 1984
722 Ga0495619_0260536 3300053085 Bacteria 1202
723 Ga0501084_0011040 3300054114 Bacteria 7481
724 Ga0501084_0027535 3300054114 Bacteria 4749
725 Ga0501084_0027824 3300054114 Bacteria 4724
726 Ga0501084_0045971 3300054114 Bacteria 3655
727 Ga0501084_0052117 3300054114 Bacteria 3424
728 Ga0501084_0063873 3300054114 Bacteria 3082
729 Ga0590077_029614 3300059426 Bacteria 1191
730 Ga0501082_0015504 3300060353 Bacteria 6560
731 Ga0501082_0038247 3300060353 Bacteria 4139
732 Ga0501082_0065787 3300060353 Bacteria 3121
733 Ga0501082_0147240 3300060353 Bacteria 2044
734 Ga0501082_0210054 3300060353 Bacteria 1693
735 Ga0501082_0250663 3300060353 Bacteria 1541
736 Ga0501082_0718787 3300060353 Unclassified 874
737 Ga0530510_0056624 3300061734 Bacteria 2832
738 Ga0530510_0057140 3300061734 Bacteria 2819
739 Ga0530510_0065972 3300061734 Unclassified 2623
740 Ga0530510_0297989 3300061734 Unclassified 1206

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0080211 Ga0501035_0080211_31_765 244
2 3300005616 Ga0068852_100084050 Ga0068852_1000840502 259
3 3300006058 Ga0075432_10008665 Ga0075432_100086653 259
4 3300006844 Ga0075428_100000942 Ga0075428_1000009424 259
5 3300009094 Ga0111539_10780055 Ga0111539_107800551 259
6 3300026142 Ga0207698_10230143 Ga0207698_102301432 259
7 3300027907 Ga0207428_10000222 Ga0207428_1000022284 259
8 3300035242 Ga0373962_0008415 Ga0373962_0008415_1737_2516 259
9 3300041486 Ga0451807_1862518 Ga0451807_1862518_231_1010 259
10 3300042439 Ga0439464_0069137 Ga0439464_0069137_246_1025 259
11 3300045976 Ga0466967_0006293 Ga0466967_0006293_7581_8360 259
12 3300046455 Ga0495603_0307403 Ga0495603_0307403_14_793 259
13 3300049743 Ga0501081_0511919 Ga0501081_0511919_11_790 259
14 3300005564 Ga0070664_100397718 Ga0070664_1003977182 262
15 3300005577 Ga0068857_100207853 Ga0068857_1002078532 262
16 3300025945 Ga0207679_10318358 Ga0207679_103183582 262
17 3300048911 Ga0496108_0360308 Ga0496108_0360308_187_1065 262
18 3300048912 Ga0496109_0591421 Ga0496109_0591421_30_908 262
19 3300048916 Ga0496113_0491293 Ga0496113_0491293_90_968 262
20 3300050492 nmdc:mga0yw44_237102_c1 nmdc:mga0yw44_237102_c1_222_1100 262
21 3300005937 Ga0081455_10019638 Ga0081455_100196384 263
22 3300025944 Ga0207661_10083062 Ga0207661_100830622 263
23 3300026116 Ga0207674_10136767 Ga0207674_101367672 263
24 3300042005 Ga0439448_0055586 Ga0439448_0055586_276_1154 263
25 3300037466 Ga0395898_0383501 Ga0395898_0383501_346_1251 265
26 3300046463 Ga0495653_0110420 Ga0495653_0110420_30_935 265
27 3300047317 Ga0495604_0232939 Ga0495604_0232939_142_1047 265
28 3300047444 Ga0495675_0046591 Ga0495675_0046591_1448_2353 265
29 3300049572 Ga0501036_0028189 Ga0501036_0028189_948_1826 265
30 3300049575 Ga0501039_0087762 Ga0501039_0087762_1000_1878 265
31 3300049576 Ga0501040_0131593 Ga0501040_0131593_179_1057 265
32 3300049580 Ga0501046_0021953 Ga0501046_0021953_3541_4419 265
33 3300049584 Ga0501068_0178460 Ga0501068_0178460_245_1123 265
34 3300049585 Ga0501069_0191228 Ga0501069_0191228_127_1005 265
35 3300049586 Ga0501070_0279859 Ga0501070_0279859_439_1317 265
36 3300049587 Ga0501071_0005316 Ga0501071_0005316_2177_3055 265
37 3300049588 Ga0501072_0102940 Ga0501072_0102940_1361_2239 265
38 3300049591 Ga0501075_0064604 Ga0501075_0064604_523_1401 265
39 3300049592 Ga0501076_0056359 Ga0501076_0056359_104_982 265
40 3300049593 Ga0501077_0013622 Ga0501077_0013622_1901_2779 265
41 3300049743 Ga0501081_0031038 Ga0501081_0031038_1514_2392 265
42 3300049822 Ga0501035_0245121 Ga0501035_0245121_114_992 265
43 3300049824 Ga0501045_0057120 Ga0501045_0057120_1457_2335 265
44 3300054114 Ga0501084_0011040 Ga0501084_0011040_1242_2120 265
45 3300060353 Ga0501082_0038247 Ga0501082_0038247_1903_2781 265
46 3300060353 Ga0501082_0718787 Ga0501082_0718787_56_853 265
47 3300046516 Ga0495628_0217698 Ga0495628_0217698_269_1174 266
48 3300046680 Ga0495646_0067604 Ga0495646_0067604_725_1630 266
49 3300053077 Ga0495601_0028198 Ga0495601_0028198_41_946 266
50 3300053078 Ga0495612_0060746 Ga0495612_0060746_144_1049 266
51 3300037466 Ga0395898_0163407 Ga0395898_0163407_986_1795 269
52 3300049578 Ga0501042_0151374 Ga0501042_0151374_594_1472 270
53 3300049743 Ga0501081_0008222 Ga0501081_0008222_102_917 270
54 3300005985 Ga0081539_10000712 Ga0081539_1000071250 281
55 3300049576 Ga0501040_0059725 Ga0501040_0059725_353_1279 282
56 3300006163 Ga0070715_10170560 Ga0070715_101705601 285
57 3300006175 Ga0070712_100046450 Ga0070712_1000464502 285
58 3300009098 Ga0105245_10030952 Ga0105245_100309522 285
59 3300009148 Ga0105243_10381014 Ga0105243_103810142 285
60 3300009148 Ga0105243_10426742 Ga0105243_104267422 285
61 3300013306 Ga0163162_10166169 Ga0163162_101661691 285
62 3300025915 Ga0207693_10284094 Ga0207693_102840942 285
63 3300025939 Ga0207665_10062245 Ga0207665_100622452 285
64 3300026075 Ga0207708_10091870 Ga0207708_100918703 285
65 3300048903 Ga0496100_0033934 Ga0496100_0033934_998_1876 285
66 3300048904 Ga0496101_0112423 Ga0496101_0112423_18_896 285
67 3300048905 Ga0496102_0123284 Ga0496102_0123284_431_1309 285
68 3300048905 Ga0496102_0331247 Ga0496102_0331247_235_1113 285
69 3300048906 Ga0496103_0030047 Ga0496103_0030047_1936_2814 285
70 3300048908 Ga0496105_0249752 Ga0496105_0249752_482_1360 285
71 3300048910 Ga0496107_0045062 Ga0496107_0045062_1317_2195 285
72 3300048911 Ga0496108_0245195 Ga0496108_0245195_199_1077 285
73 3300048914 Ga0496111_0055939 Ga0496111_0055939_339_1217 285
74 3300048916 Ga0496113_0012195 Ga0496113_0012195_399_1277 285
75 3300048917 Ga0496114_0014614 Ga0496114_0014614_683_1561 285
76 3300048918 Ga0496115_0118509 Ga0496115_0118509_1178_2056 285
77 3300005434 Ga0070709_10218951 Ga0070709_102189512 289
78 3300005578 Ga0068854_100221324 Ga0068854_1002213242 289
79 3300006173 Ga0070716_100216923 Ga0070716_1002169232 289
80 3300025906 Ga0207699_10109794 Ga0207699_101097942 289
81 3300031251 Ga0265327_10007879 Ga0265327_100078797 289
82 3300035083 Ga0373926_0035641 Ga0373926_0035641_47_919 289
83 3300035170 Ga0373943_0002579 Ga0373943_0002579_990_1862 289
84 3300035171 Ga0373946_0014784 Ga0373946_0014784_635_1507 289
85 3300035725 Ga0373947_0019921 Ga0373947_0019921_182_1054 289
86 3300037068 Ga0373925_0075236 Ga0373925_0075236_833_1705 289
87 3300046455 Ga0495603_0211385 Ga0495603_0211385_181_1053 289
88 3300046459 Ga0495629_0001622 Ga0495629_0001622_7937_8809 289
89 3300046459 Ga0495629_0069147 Ga0495629_0069147_1469_2341 289
90 3300046461 Ga0495641_0001841 Ga0495641_0001841_11168_12040 289
91 3300046462 Ga0495651_0064146 Ga0495651_0064146_1923_2795 289
92 3300046463 Ga0495653_0011544 Ga0495653_0011544_2307_3179 289
93 3300046463 Ga0495653_0092426 Ga0495653_0092426_1193_2065 289
94 3300046473 Ga0495582_0000462 Ga0495582_0000462_2330_3202 289
95 3300046475 Ga0495639_0005703 Ga0495639_0005703_48_920 289
96 3300046476 Ga0495662_0004015 Ga0495662_0004015_3089_3961 289
97 3300046477 Ga0495664_0202267 Ga0495664_0202267_26_898 289
98 3300046516 Ga0495628_0084657 Ga0495628_0084657_1527_2399 289
99 3300046517 Ga0495630_0057723 Ga0495630_0057723_151_1023 289
100 3300046526 Ga0495666_0017424 Ga0495666_0017424_1672_2544 289
101 3300046529 Ga0495652_0085313 Ga0495652_0085313_145_1017 289
102 3300046531 Ga0495665_0003126 Ga0495665_0003126_2567_3439 289
103 3300046533 Ga0495640_0152438 Ga0495640_0152438_551_1423 289
104 3300046543 Ga0495645_0085532 Ga0495645_0085532_507_1379 289
105 3300046559 Ga0495667_0040061 Ga0495667_0040061_173_1045 289
106 3300046642 Ga0495634_0085694 Ga0495634_0085694_1055_1927 289
107 3300046642 Ga0495634_0098162 Ga0495634_0098162_451_1323 289
108 3300046663 Ga0495635_0023025 Ga0495635_0023025_2323_3195 289
109 3300046663 Ga0495635_0031947 Ga0495635_0031947_827_1699 289
110 3300046680 Ga0495646_0030015 Ga0495646_0030015_465_1337 289
111 3300046681 Ga0495647_0028537 Ga0495647_0028537_938_1810 289
112 3300046683 Ga0495658_0001666 Ga0495658_0001666_4866_5738 289
113 3300046689 Ga0495613_0026261 Ga0495613_0026261_1510_2382 289
114 3300046690 Ga0495624_0099534 Ga0495624_0099534_791_1663 289
115 3300046809 Ga0495600_0035044 Ga0495600_0035044_178_1050 289
116 3300047315 Ga0495581_0019449 Ga0495581_0019449_2204_3076 289
117 3300047317 Ga0495604_0040214 Ga0495604_0040214_1577_2449 289
118 3300047319 Ga0495674_0039532 Ga0495674_0039532_1023_1895 289
119 3300047321 Ga0495676_0005860 Ga0495676_0005860_10272_11144 289
120 3300047322 Ga0495680_0011900 Ga0495680_0011900_4808_5680 289
121 3300047322 Ga0495680_0050977 Ga0495680_0050977_2148_3020 289
122 3300047471 Ga0495684_0045963 Ga0495684_0045963_1492_2364 289
123 3300047471 Ga0495684_0135463 Ga0495684_0135463_34_906 289
124 3300047673 Ga0495593_0001385 Ga0495593_0001385_12638_13510 289
125 3300048903 Ga0496100_0078972 Ga0496100_0078972_303_1175 289
126 3300048904 Ga0496101_0039255 Ga0496101_0039255_1513_2385 289
127 3300048904 Ga0496101_0068435 Ga0496101_0068435_748_1620 289
128 3300048907 Ga0496104_0241826 Ga0496104_0241826_542_1414 289
129 3300048910 Ga0496107_0173949 Ga0496107_0173949_675_1547 289
130 3300048917 Ga0496114_0001590 Ga0496114_0001590_1084_1956 289
131 3300048917 Ga0496114_0017636 Ga0496114_0017636_2156_3028 289
132 3300048917 Ga0496114_0470532 Ga0496114_0470532_58_930 289
133 3300048918 Ga0496115_0005423 Ga0496115_0005423_8045_8917 289
134 3300053077 Ga0495601_0239896 Ga0495601_0239896_85_957 289
135 3300053084 Ga0495595_0024189 Ga0495595_0024189_144_1016 289
136 3300053085 Ga0495619_0011828 Ga0495619_0011828_3651_4523 289
137 3300046454 Ga0495592_0133474 Ga0495592_0133474_403_1281 290
138 3300046809 Ga0495600_0172318 Ga0495600_0172318_48_920 290
139 3300049581 Ga0501047_0042263 Ga0501047_0042263_486_1361 290
140 3300005327 Ga0070658_10292219 Ga0070658_102922192 291
141 3300005329 Ga0070683_100037548 Ga0070683_1000375481 291
142 3300005329 Ga0070683_100081876 Ga0070683_1000818763 291
143 3300005339 Ga0070660_100425589 Ga0070660_1004255891 291
144 3300005445 Ga0070708_100056964 Ga0070708_1000569644 291
145 3300006237 Ga0097621_100116997 Ga0097621_1001169973 291
146 3300006358 Ga0068871_100028513 Ga0068871_1000285135 291
147 3300009093 Ga0105240_10106750 Ga0105240_101067504 291
148 3300013105 Ga0157369_10031662 Ga0157369_100316628 291
149 3300013105 Ga0157369_10426035 Ga0157369_104260353 291
150 3300014969 Ga0157376_10345258 Ga0157376_103452583 291
151 3300020082 Ga0206353_10640569 Ga0206353_106405692 291
152 3300022467 Ga0224712_10076538 Ga0224712_100765382 291
153 3300025908 Ga0207643_10158919 Ga0207643_101589192 291
154 3300025913 Ga0207695_10047042 Ga0207695_100470423 291
155 3300025919 Ga0207657_10369038 Ga0207657_103690382 291
156 3300025920 Ga0207649_10298527 Ga0207649_102985272 291
157 3300025927 Ga0207687_10125509 Ga0207687_101255092 291
158 3300025944 Ga0207661_10059962 Ga0207661_100599621 291
159 3300025949 Ga0207667_10426227 Ga0207667_104262272 291
160 3300025986 Ga0207658_10004151 Ga0207658_100041512 291
161 3300028556 Ga0265337_1067712 Ga0265337_10677121 291
162 3300028563 Ga0265319_1016801 Ga0265319_10168012 291
163 3300028577 Ga0265318_10022513 Ga0265318_100225133 291
164 3300028800 Ga0265338_10132985 Ga0265338_101329852 291
165 3300031240 Ga0265320_10036069 Ga0265320_100360691 291
166 3300037418 Ga0395900_0368717 Ga0395900_0368717_178_1056 291
167 3300037466 Ga0395898_0231517 Ga0395898_0231517_620_1498 291
168 3300037471 Ga0395905_0339521 Ga0395905_0339521_242_1120 291
169 3300037471 Ga0395905_0484893 Ga0395905_0484893_136_1014 291
170 3300038443 Ga0395901_0688630 Ga0395901_0688630_122_1000 291
171 3300044684 Ga0466966_0100587 Ga0466966_0100587_37_915 291
172 3300044693 Ga0466961_0139218 Ga0466961_0139218_139_1017 291
173 3300045976 Ga0466967_0237480 Ga0466967_0237480_458_1336 291
174 3300046454 Ga0495592_0210571 Ga0495592_0210571_191_1069 291
175 3300046461 Ga0495641_0043195 Ga0495641_0043195_1078_1956 291
176 3300046462 Ga0495651_0018214 Ga0495651_0018214_3441_4319 291
177 3300046463 Ga0495653_0036570 Ga0495653_0036570_1508_2386 291
178 3300046477 Ga0495664_0204437 Ga0495664_0204437_132_1010 291
179 3300046499 Ga0495594_0053503 Ga0495594_0053503_295_1173 291
180 3300046511 Ga0495608_0039817 Ga0495608_0039817_551_1429 291
181 3300046517 Ga0495630_0054489 Ga0495630_0054489_83_961 291
182 3300046533 Ga0495640_0004048 Ga0495640_0004048_8046_8924 291
183 3300046559 Ga0495667_0017056 Ga0495667_0017056_439_1317 291
184 3300046642 Ga0495634_0030484 Ga0495634_0030484_1842_2720 291
185 3300047317 Ga0495604_0055131 Ga0495604_0055131_187_1065 291
186 3300047319 Ga0495674_0005229 Ga0495674_0005229_5569_6447 291
187 3300047322 Ga0495680_0002784 Ga0495680_0002784_13616_14494 291
188 3300048904 Ga0496101_0017765 Ga0496101_0017765_2396_3274 291
189 3300048907 Ga0496104_0346175 Ga0496104_0346175_131_1009 291
190 3300048908 Ga0496105_0012905 Ga0496105_0012905_1339_2217 291
191 3300048912 Ga0496109_0063003 Ga0496109_0063003_2065_2943 291
192 3300048918 Ga0496115_0264178 Ga0496115_0264178_94_972 291
193 3300049572 Ga0501036_0011392 Ga0501036_0011392_5049_5927 291
194 3300049574 Ga0501038_0103741 Ga0501038_0103741_1351_2229 291
195 3300049576 Ga0501040_0011602 Ga0501040_0011602_2593_3471 291
196 3300049577 Ga0501041_0014412 Ga0501041_0014412_2919_3797 291
197 3300049580 Ga0501046_0114390 Ga0501046_0114390_552_1430 291
198 3300049582 Ga0501048_0006842 Ga0501048_0006842_5792_6670 291
199 3300049586 Ga0501070_0000463 Ga0501070_0000463_3474_4352 291
200 3300049587 Ga0501071_0015215 Ga0501071_0015215_971_1849 291
201 3300049588 Ga0501072_0012942 Ga0501072_0012942_3317_4195 291
202 3300049591 Ga0501075_0042726 Ga0501075_0042726_317_1195 291
203 3300049824 Ga0501045_0067561 Ga0501045_0067561_1619_2497 291
204 3300053077 Ga0495601_0077001 Ga0495601_0077001_214_1092 291
205 3300053084 Ga0495595_0163120 Ga0495595_0163120_44_922 291
206 3300053085 Ga0495619_0035078 Ga0495619_0035078_381_1259 291
207 3300053085 Ga0495619_0260536 Ga0495619_0260536_274_1164 291
208 3300054114 Ga0501084_0045971 Ga0501084_0045971_1074_1952 291
209 3300060353 Ga0501082_0015504 Ga0501082_0015504_3061_3939 291
210 3300061734 Ga0530510_0056624 Ga0530510_0056624_414_1292 291
211 3300001989 JGI24739J22299_10011246 JGI24739J22299_100112463 292
212 3300001991 JGI24743J22301_10001489 JGI24743J22301_100014895 292
213 3300002075 JGI24738J21930_10004979 JGI24738J21930_100049791 292
214 3300002075 JGI24738J21930_10018973 JGI24738J21930_100189733 292
215 3300002077 JGI24744J21845_10010350 JGI24744J21845_100103503 292
216 3300002244 JGI24742J22300_10002099 JGI24742J22300_100020994 292
217 3300005327 Ga0070658_10025121 Ga0070658_100251215 292
218 3300005327 Ga0070658_10055976 Ga0070658_100559763 292
219 3300005328 Ga0070676_10150902 Ga0070676_101509022 292
220 3300005329 Ga0070683_100010645 Ga0070683_1000106455 292
221 3300005329 Ga0070683_100011274 Ga0070683_1000112748 292
222 3300005329 Ga0070683_100095282 Ga0070683_1000952822 292
223 3300005329 Ga0070683_100576225 Ga0070683_1005762252 292
224 3300005330 Ga0070690_100009736 Ga0070690_1000097363 292
225 3300005331 Ga0070670_100042356 Ga0070670_1000423564 292
226 3300005331 Ga0070670_100347975 Ga0070670_1003479752 292
227 3300005334 Ga0068869_100046017 Ga0068869_1000460172 292
228 3300005336 Ga0070680_100003864 Ga0070680_10000386410 292
229 3300005336 Ga0070680_100012290 Ga0070680_1000122906 292
230 3300005336 Ga0070680_100078877 Ga0070680_1000788772 292
231 3300005337 Ga0070682_100005389 Ga0070682_1000053894 292
232 3300005337 Ga0070682_100026934 Ga0070682_1000269342 292
233 3300005337 Ga0070682_100201417 Ga0070682_1002014172 292
234 3300005338 Ga0068868_100023709 Ga0068868_1000237095 292
235 3300005338 Ga0068868_100079462 Ga0068868_1000794625 292
236 3300005340 Ga0070689_100010225 Ga0070689_1000102252 292
237 3300005340 Ga0070689_100060852 Ga0070689_1000608523 292
238 3300005341 Ga0070691_10011914 Ga0070691_100119143 292
239 3300005343 Ga0070687_100074923 Ga0070687_1000749231 292
240 3300005344 Ga0070661_100008413 Ga0070661_1000084135 292
241 3300005344 Ga0070661_100011485 Ga0070661_1000114858 292
242 3300005345 Ga0070692_10014221 Ga0070692_100142215 292
243 3300005345 Ga0070692_10020404 Ga0070692_100204044 292
244 3300005347 Ga0070668_100010845 Ga0070668_1000108452 292
245 3300005347 Ga0070668_100088306 Ga0070668_1000883064 292
246 3300005347 Ga0070668_100157338 Ga0070668_1001573382 292
247 3300005353 Ga0070669_100116514 Ga0070669_1001165143 292
248 3300005354 Ga0070675_100082178 Ga0070675_1000821782 292
249 3300005354 Ga0070675_100125061 Ga0070675_1001250612 292
250 3300005355 Ga0070671_100073534 Ga0070671_1000735346 292
251 3300005355 Ga0070671_100087563 Ga0070671_1000875632 292
252 3300005356 Ga0070674_100004917 Ga0070674_1000049175 292
253 3300005356 Ga0070674_100048705 Ga0070674_1000487055 292
254 3300005356 Ga0070674_100058022 Ga0070674_1000580224 292
255 3300005356 Ga0070674_100065278 Ga0070674_1000652783 292
256 3300005364 Ga0070673_100187733 Ga0070673_1001877331 292
257 3300005365 Ga0070688_100017320 Ga0070688_1000173204 292
258 3300005366 Ga0070659_100047707 Ga0070659_1000477073 292
259 3300005366 Ga0070659_100090699 Ga0070659_1000906994 292
260 3300005366 Ga0070659_100164871 Ga0070659_1001648712 292
261 3300005366 Ga0070659_100168785 Ga0070659_1001687852 292
262 3300005367 Ga0070667_100145761 Ga0070667_1001457612 292
263 3300005406 Ga0070703_10005780 Ga0070703_100057801 292
264 3300005434 Ga0070709_10302454 Ga0070709_103024542 292
265 3300005437 Ga0070710_10017974 Ga0070710_100179742 292
266 3300005438 Ga0070701_10002028 Ga0070701_100020282 292
267 3300005438 Ga0070701_10173381 Ga0070701_101733811 292
268 3300005439 Ga0070711_100000778 Ga0070711_10000077822 292
269 3300005439 Ga0070711_100050323 Ga0070711_1000503232 292
270 3300005440 Ga0070705_100012577 Ga0070705_1000125772 292
271 3300005441 Ga0070700_100004283 Ga0070700_1000042838 292
272 3300005444 Ga0070694_100055758 Ga0070694_1000557582 292
273 3300005455 Ga0070663_100038450 Ga0070663_1000384505 292
274 3300005456 Ga0070678_100010583 Ga0070678_1000105834 292
275 3300005456 Ga0070678_100120725 Ga0070678_1001207252 292
276 3300005457 Ga0070662_100005776 Ga0070662_1000057768 292
277 3300005457 Ga0070662_100097469 Ga0070662_1000974693 292
278 3300005458 Ga0070681_10003855 Ga0070681_1000385512 292
279 3300005458 Ga0070681_10045244 Ga0070681_100452446 292
280 3300005458 Ga0070681_10087127 Ga0070681_100871273 292
281 3300005459 Ga0068867_100026250 Ga0068867_1000262503 292
282 3300005459 Ga0068867_100363868 Ga0068867_1003638682 292
283 3300005466 Ga0070685_10007351 Ga0070685_100073513 292
284 3300005466 Ga0070685_10035833 Ga0070685_100358334 292
285 3300005468 Ga0070707_100643592 Ga0070707_1006435921 292
286 3300005471 Ga0070698_100005716 Ga0070698_10000571612 292
287 3300005518 Ga0070699_100078153 Ga0070699_1000781532 292
288 3300005518 Ga0070699_100127927 Ga0070699_1001279274 292
289 3300005530 Ga0070679_100042942 Ga0070679_1000429426 292
290 3300005530 Ga0070679_100084145 Ga0070679_1000841453 292
291 3300005535 Ga0070684_100012808 Ga0070684_1000128084 292
292 3300005535 Ga0070684_100120477 Ga0070684_1001204773 292
293 3300005535 Ga0070684_100194283 Ga0070684_1001942831 292
294 3300005539 Ga0068853_100009478 Ga0068853_1000094783 292
295 3300005539 Ga0068853_100178013 Ga0068853_1001780132 292
296 3300005539 Ga0068853_100263725 Ga0068853_1002637251 292
297 3300005543 Ga0070672_100040145 Ga0070672_1000401453 292
298 3300005546 Ga0070696_100026401 Ga0070696_1000264014 292
299 3300005547 Ga0070693_100027437 Ga0070693_1000274373 292
300 3300005547 Ga0070693_100059705 Ga0070693_1000597052 292
301 3300005547 Ga0070693_100167509 Ga0070693_1001675092 292
302 3300005548 Ga0070665_100160278 Ga0070665_1001602782 292
303 3300005549 Ga0070704_100006800 Ga0070704_1000068004 292
304 3300005549 Ga0070704_100126301 Ga0070704_1001263012 292
305 3300005563 Ga0068855_100112091 Ga0068855_1001120915 292
306 3300005563 Ga0068855_100153220 Ga0068855_1001532203 292
307 3300005564 Ga0070664_100001655 Ga0070664_10000165511 292
308 3300005564 Ga0070664_100076158 Ga0070664_1000761583 292
309 3300005564 Ga0070664_100175449 Ga0070664_1001754493 292
310 3300005614 Ga0068856_100028879 Ga0068856_1000288797 292
311 3300005614 Ga0068856_100037505 Ga0068856_1000375053 292
312 3300005615 Ga0070702_100007827 Ga0070702_1000078272 292
313 3300005615 Ga0070702_100043566 Ga0070702_1000435662 292
314 3300005616 Ga0068852_100043332 Ga0068852_1000433328 292
315 3300005616 Ga0068852_100078184 Ga0068852_1000781845 292
316 3300005616 Ga0068852_100079567 Ga0068852_1000795674 292
317 3300005616 Ga0068852_100107007 Ga0068852_1001070074 292
318 3300005617 Ga0068859_100153008 Ga0068859_1001530084 292
319 3300005618 Ga0068864_100036679 Ga0068864_1000366795 292
320 3300005618 Ga0068864_100211124 Ga0068864_1002111242 292
321 3300005719 Ga0068861_100092806 Ga0068861_1000928064 292
322 3300005719 Ga0068861_100125460 Ga0068861_1001254602 292
323 3300005719 Ga0068861_100566068 Ga0068861_1005660682 292
324 3300005834 Ga0068851_10016932 Ga0068851_100169323 292
325 3300005840 Ga0068870_10067545 Ga0068870_100675452 292
326 3300005841 Ga0068863_100033487 Ga0068863_1000334876 292
327 3300005843 Ga0068860_100031873 Ga0068860_1000318737 292
328 3300005843 Ga0068860_100101724 Ga0068860_1001017244 292
329 3300005937 Ga0081455_10008516 Ga0081455_1000851611 292
330 3300005937 Ga0081455_10033510 Ga0081455_100335103 292
331 3300005985 Ga0081539_10136213 Ga0081539_101362131 292
332 3300006051 Ga0075364_10051124 Ga0075364_100511243 292
333 3300006058 Ga0075432_10002694 Ga0075432_100026944 292
334 3300006058 Ga0075432_10016054 Ga0075432_100160543 292
335 3300006163 Ga0070715_10072860 Ga0070715_100728601 292
336 3300006175 Ga0070712_100067562 Ga0070712_1000675622 292
337 3300006175 Ga0070712_100299083 Ga0070712_1002990831 292
338 3300006237 Ga0097621_100047946 Ga0097621_1000479464 292
339 3300006237 Ga0097621_100547817 Ga0097621_1005478172 292
340 3300006358 Ga0068871_100024236 Ga0068871_1000242362 292
341 3300006358 Ga0068871_100062935 Ga0068871_1000629353 292
342 3300006358 Ga0068871_100130492 Ga0068871_1001304922 292
343 3300006847 Ga0075431_100017672 Ga0075431_1000176728 292
344 3300006852 Ga0075433_10012982 Ga0075433_100129827 292
345 3300006871 Ga0075434_100139867 Ga0075434_1001398673 292
346 3300006880 Ga0075429_100006563 Ga0075429_1000065633 292
347 3300006881 Ga0068865_100006538 Ga0068865_1000065382 292
348 3300006881 Ga0068865_100014818 Ga0068865_1000148187 292
349 3300006881 Ga0068865_100054806 Ga0068865_1000548064 292
350 3300006914 Ga0075436_100045219 Ga0075436_1000452194 292
351 3300006931 Ga0097620_100153009 Ga0097620_1001530094 292
352 3300007076 Ga0075435_100010187 Ga0075435_1000101877 292
353 3300009094 Ga0111539_10005668 Ga0111539_100056688 292
354 3300009094 Ga0111539_10008986 Ga0111539_1000898619 292
355 3300009094 Ga0111539_10061471 Ga0111539_100614715 292
356 3300009094 Ga0111539_10107842 Ga0111539_101078425 292
357 3300009098 Ga0105245_10002722 Ga0105245_1000272217 292
358 3300009098 Ga0105245_10003740 Ga0105245_1000374020 292
359 3300009098 Ga0105245_10011716 Ga0105245_100117168 292
360 3300009098 Ga0105245_10086760 Ga0105245_100867603 292
361 3300009098 Ga0105245_10123199 Ga0105245_101231992 292
362 3300009147 Ga0114129_10006031 Ga0114129_1000603123 292
363 3300009147 Ga0114129_10006732 Ga0114129_1000673211 292
364 3300009147 Ga0114129_10231371 Ga0114129_102313713 292
365 3300009148 Ga0105243_10019092 Ga0105243_100190925 292
366 3300009148 Ga0105243_10022765 Ga0105243_100227652 292
367 3300009148 Ga0105243_10029094 Ga0105243_100290944 292
368 3300009148 Ga0105243_10035934 Ga0105243_100359345 292
369 3300009176 Ga0105242_10002896 Ga0105242_100028963 292
370 3300009176 Ga0105242_10025238 Ga0105242_100252384 292
371 3300009176 Ga0105242_10476757 Ga0105242_104767572 292
372 3300009177 Ga0105248_10007689 Ga0105248_100076892 292
373 3300009177 Ga0105248_10147107 Ga0105248_101471075 292
374 3300009177 Ga0105248_10147113 Ga0105248_101471133 292
375 3300009177 Ga0105248_10305267 Ga0105248_103052672 292
376 3300009545 Ga0105237_10247575 Ga0105237_102475753 292
377 3300009551 Ga0105238_10037087 Ga0105238_100370875 292
378 3300009551 Ga0105238_10375838 Ga0105238_103758382 292
379 3300009553 Ga0105249_10004111 Ga0105249_100041112 292
380 3300009553 Ga0105249_10157113 Ga0105249_101571132 292
381 3300009553 Ga0105249_10414713 Ga0105249_104147132 292
382 3300010375 Ga0105239_10004419 Ga0105239_1000441912 292
383 3300010375 Ga0105239_10033163 Ga0105239_100331633 292
384 3300010375 Ga0105239_10055548 Ga0105239_100555485 292
385 3300011119 Ga0105246_10005688 Ga0105246_100056888 292
386 3300011119 Ga0105246_10085070 Ga0105246_100850702 292
387 3300013100 Ga0157373_10143881 Ga0157373_101438813 292
388 3300013102 Ga0157371_10010321 Ga0157371_100103218 292
389 3300013102 Ga0157371_10117162 Ga0157371_101171623 292
390 3300013102 Ga0157371_10138521 Ga0157371_101385213 292
391 3300013104 Ga0157370_10166912 Ga0157370_101669123 292
392 3300013105 Ga0157369_10218605 Ga0157369_102186053 292
393 3300013296 Ga0157374_10006575 Ga0157374_100065753 292
394 3300013306 Ga0163162_10039731 Ga0163162_100397313 292
395 3300013306 Ga0163162_10104233 Ga0163162_101042334 292
396 3300013306 Ga0163162_10159702 Ga0163162_101597022 292
397 3300013307 Ga0157372_10006446 Ga0157372_1000644613 292
398 3300013307 Ga0157372_10016007 Ga0157372_100160077 292
399 3300013307 Ga0157372_10227194 Ga0157372_102271941 292
400 3300013307 Ga0157372_10384281 Ga0157372_103842812 292
401 3300013308 Ga0157375_10023531 Ga0157375_100235315 292
402 3300013308 Ga0157375_10103461 Ga0157375_101034612 292
403 3300013308 Ga0157375_10169654 Ga0157375_101696542 292
404 3300013308 Ga0157375_10449341 Ga0157375_104493413 292
405 3300013308 Ga0157375_10945666 Ga0157375_109456662 292
406 3300014325 Ga0163163_10159741 Ga0163163_101597415 292
407 3300014325 Ga0163163_10445551 Ga0163163_104455512 292
408 3300014326 Ga0157380_10037797 Ga0157380_100377974 292
409 3300014326 Ga0157380_10050383 Ga0157380_100503832 292
410 3300014326 Ga0157380_10459036 Ga0157380_104590362 292
411 3300014745 Ga0157377_10007022 Ga0157377_100070226 292
412 3300014745 Ga0157377_10013079 Ga0157377_100130797 292
413 3300014745 Ga0157377_10068137 Ga0157377_100681373 292
414 3300014968 Ga0157379_10067408 Ga0157379_100674086 292
415 3300014969 Ga0157376_10011146 Ga0157376_100111466 292
416 3300014969 Ga0157376_10034780 Ga0157376_100347804 292
417 3300014969 Ga0157376_10169969 Ga0157376_101699693 292
418 3300014969 Ga0157376_10633535 Ga0157376_106335351 292
419 3300017792 Ga0163161_10087346 Ga0163161_100873462 292
420 3300017792 Ga0163161_10218883 Ga0163161_102188832 292
421 3300025885 Ga0207653_10007128 Ga0207653_100071282 292
422 3300025898 Ga0207692_10014959 Ga0207692_100149593 292
423 3300025899 Ga0207642_10017208 Ga0207642_100172082 292
424 3300025901 Ga0207688_10018141 Ga0207688_100181413 292
425 3300025904 Ga0207647_10055787 Ga0207647_100557872 292
426 3300025906 Ga0207699_10078398 Ga0207699_100783982 292
427 3300025907 Ga0207645_10137393 Ga0207645_101373932 292
428 3300025908 Ga0207643_10015732 Ga0207643_100157324 292
429 3300025909 Ga0207705_10099972 Ga0207705_100999723 292
430 3300025909 Ga0207705_10130681 Ga0207705_101306812 292
431 3300025911 Ga0207654_10171124 Ga0207654_101711242 292
432 3300025912 Ga0207707_10020297 Ga0207707_100202973 292
433 3300025915 Ga0207693_10010927 Ga0207693_100109279 292
434 3300025915 Ga0207693_10071413 Ga0207693_100714133 292
435 3300025915 Ga0207693_10085853 Ga0207693_100858531 292
436 3300025916 Ga0207663_10026556 Ga0207663_100265563 292
437 3300025917 Ga0207660_10052625 Ga0207660_100526253 292
438 3300025917 Ga0207660_10190249 Ga0207660_101902492 292
439 3300025918 Ga0207662_10034397 Ga0207662_100343973 292
440 3300025918 Ga0207662_10117577 Ga0207662_101175772 292
441 3300025919 Ga0207657_10010086 Ga0207657_100100865 292
442 3300025919 Ga0207657_10053270 Ga0207657_100532703 292
443 3300025919 Ga0207657_10136263 Ga0207657_101362632 292
444 3300025920 Ga0207649_10047442 Ga0207649_100474423 292
445 3300025921 Ga0207652_10295645 Ga0207652_102956452 292
446 3300025924 Ga0207694_10099848 Ga0207694_100998483 292
447 3300025926 Ga0207659_10030066 Ga0207659_100300663 292
448 3300025926 Ga0207659_10286411 Ga0207659_102864112 292
449 3300025927 Ga0207687_10050998 Ga0207687_100509985 292
450 3300025927 Ga0207687_10059790 Ga0207687_100597902 292
451 3300025927 Ga0207687_10106637 Ga0207687_101066373 292
452 3300025928 Ga0207700_10170456 Ga0207700_101704562 292
453 3300025931 Ga0207644_10062299 Ga0207644_100622991 292
454 3300025931 Ga0207644_10120843 Ga0207644_101208432 292
455 3300025932 Ga0207690_10070781 Ga0207690_100707812 292
456 3300025932 Ga0207690_10099725 Ga0207690_100997252 292
457 3300025932 Ga0207690_10237437 Ga0207690_102374372 292
458 3300025933 Ga0207706_10038276 Ga0207706_100382764 292
459 3300025933 Ga0207706_10048645 Ga0207706_100486455 292
460 3300025933 Ga0207706_10145350 Ga0207706_101453503 292
461 3300025934 Ga0207686_10007462 Ga0207686_100074624 292
462 3300025934 Ga0207686_10031563 Ga0207686_100315633 292
463 3300025934 Ga0207686_10068351 Ga0207686_100683515 292
464 3300025935 Ga0207709_10004231 Ga0207709_100042312 292
465 3300025935 Ga0207709_10034834 Ga0207709_100348342 292
466 3300025935 Ga0207709_10035388 Ga0207709_100353884 292
467 3300025936 Ga0207670_10138682 Ga0207670_101386823 292
468 3300025937 Ga0207669_10014759 Ga0207669_100147595 292
469 3300025937 Ga0207669_10211339 Ga0207669_102113391 292
470 3300025937 Ga0207669_10402428 Ga0207669_104024281 292
471 3300025938 Ga0207704_10007862 Ga0207704_100078624 292
472 3300025938 Ga0207704_10078028 Ga0207704_100780282 292
473 3300025938 Ga0207704_10096155 Ga0207704_100961553 292
474 3300025939 Ga0207665_10011957 Ga0207665_100119574 292
475 3300025940 Ga0207691_10009495 Ga0207691_100094959 292
476 3300025940 Ga0207691_10019977 Ga0207691_100199774 292
477 3300025940 Ga0207691_10104323 Ga0207691_101043232 292
478 3300025940 Ga0207691_10136579 Ga0207691_101365793 292
479 3300025940 Ga0207691_10423099 Ga0207691_104230992 292
480 3300025941 Ga0207711_10052951 Ga0207711_100529515 292
481 3300025941 Ga0207711_10121958 Ga0207711_101219583 292
482 3300025941 Ga0207711_10183204 Ga0207711_101832043 292
483 3300025942 Ga0207689_10124158 Ga0207689_101241582 292
484 3300025944 Ga0207661_10000273 Ga0207661_1000027312 292
485 3300025944 Ga0207661_10030244 Ga0207661_100302443 292
486 3300025945 Ga0207679_10011244 Ga0207679_100112443 292
487 3300025945 Ga0207679_10082372 Ga0207679_100823725 292
488 3300025949 Ga0207667_10122950 Ga0207667_101229504 292
489 3300025949 Ga0207667_10177122 Ga0207667_101771222 292
490 3300025960 Ga0207651_10144877 Ga0207651_101448773 292
491 3300025961 Ga0207712_10005182 Ga0207712_100051826 292
492 3300025961 Ga0207712_10128430 Ga0207712_101284302 292
493 3300025972 Ga0207668_10068533 Ga0207668_100685332 292
494 3300025972 Ga0207668_10132156 Ga0207668_101321561 292
495 3300025981 Ga0207640_10005036 Ga0207640_100050363 292
496 3300025981 Ga0207640_10059396 Ga0207640_100593962 292
497 3300026023 Ga0207677_10015516 Ga0207677_100155165 292
498 3300026023 Ga0207677_10142865 Ga0207677_101428653 292
499 3300026041 Ga0207639_10041361 Ga0207639_100413612 292
500 3300026067 Ga0207678_10033959 Ga0207678_100339593 292
501 3300026067 Ga0207678_10047340 Ga0207678_100473404 292
502 3300026075 Ga0207708_10001826 Ga0207708_1000182610 292
503 3300026075 Ga0207708_10029676 Ga0207708_100296764 292
504 3300026078 Ga0207702_10028163 Ga0207702_100281633 292
505 3300026088 Ga0207641_10140396 Ga0207641_101403963 292
506 3300026089 Ga0207648_10000504 Ga0207648_100005044 292
507 3300026089 Ga0207648_10133134 Ga0207648_101331342 292
508 3300026089 Ga0207648_10156463 Ga0207648_101564634 292
509 3300026089 Ga0207648_10193423 Ga0207648_101934232 292
510 3300026095 Ga0207676_10184999 Ga0207676_101849992 292
511 3300026095 Ga0207676_10194894 Ga0207676_101948942 292
512 3300026116 Ga0207674_10044028 Ga0207674_100440285 292
513 3300026118 Ga0207675_100027437 Ga0207675_1000274374 292
514 3300026118 Ga0207675_100038087 Ga0207675_1000380874 292
515 3300026118 Ga0207675_100340004 Ga0207675_1003400042 292
516 3300026121 Ga0207683_10001483 Ga0207683_1000148315 292
517 3300026121 Ga0207683_10052152 Ga0207683_100521525 292
518 3300026121 Ga0207683_10072940 Ga0207683_100729403 292
519 3300026121 Ga0207683_10236265 Ga0207683_102362652 292
520 3300026142 Ga0207698_10015478 Ga0207698_1001547810 292
521 3300026142 Ga0207698_10104049 Ga0207698_101040493 292
522 3300026142 Ga0207698_10563697 Ga0207698_105636972 292
523 3300027907 Ga0207428_10010823 Ga0207428_100108235 292
524 3300027907 Ga0207428_10063181 Ga0207428_100631813 292
525 3300028379 Ga0268266_10210584 Ga0268266_102105841 292
526 3300028380 Ga0268265_10260636 Ga0268265_102606363 292
527 3300028381 Ga0268264_10126903 Ga0268264_101269032 292
528 3300032002 Ga0307416_100005871 Ga0307416_10000587110 292
529 3300032002 Ga0307416_100075003 Ga0307416_1000750033 292
530 3300032126 Ga0307415_100007073 Ga0307415_1000070737 292
531 3300034819 Ga0373958_0033953 Ga0373958_0033953_91_978 292
532 3300035115 Ga0373941_0042587 Ga0373941_0042587_358_1245 292
533 3300035115 Ga0373941_0055561 Ga0373941_0055561_133_1011 292
534 3300035241 Ga0373961_0009431 Ga0373961_0009431_541_1428 292
535 3300035691 Ga0373931_0033478 Ga0373931_0033478_1307_2194 292
536 3300037418 Ga0395900_0015005 Ga0395900_0015005_741_1619 292
537 3300037466 Ga0395898_0016145 Ga0395898_0016145_5721_6599 292
538 3300037471 Ga0395905_0177317 Ga0395905_0177317_251_1129 292
539 3300038443 Ga0395901_0112921 Ga0395901_0112921_205_1083 292
540 3300038443 Ga0395901_0244751 Ga0395901_0244751_629_1507 292
541 3300042001 Ga0439441_002460 Ga0439441_002460_857_1735 292
542 3300042007 Ga0439449_0056392 Ga0439449_0056392_420_1319 292
543 3300042008 Ga0439450_037602 Ga0439450_037602_110_991 292
544 3300042015 Ga0439462_0000831 Ga0439462_0000831_5000_5899 292
545 3300042156 Ga0439446_0004313 Ga0439446_0004313_292_1173 292
546 3300046455 Ga0495603_0018540 Ga0495603_0018540_1035_1913 292
547 3300046455 Ga0495603_0150082 Ga0495603_0150082_84_1049 292
548 3300046459 Ga0495629_0176166 Ga0495629_0176166_382_1296 292
549 3300046461 Ga0495641_0151683 Ga0495641_0151683_74_982 292
550 3300046473 Ga0495582_0062724 Ga0495582_0062724_171_1049 292
551 3300046473 Ga0495582_0184382 Ga0495582_0184382_27_920 292
552 3300046475 Ga0495639_0042675 Ga0495639_0042675_586_1464 292
553 3300046499 Ga0495594_0035267 Ga0495594_0035267_573_1451 292
554 3300046499 Ga0495594_0150479 Ga0495594_0150479_11_889 292
555 3300046500 Ga0495596_0084159 Ga0495596_0084159_63_944 292
556 3300046511 Ga0495608_0158081 Ga0495608_0158081_139_1053 292
557 3300046525 Ga0495663_0040333 Ga0495663_0040333_173_1051 292
558 3300046538 Ga0495609_0114212 Ga0495609_0114212_58_936 292
559 3300046615 Ga0495656_0160861 Ga0495656_0160861_79_960 292
560 3300046616 Ga0495668_0131518 Ga0495668_0131518_204_1085 292
561 3300046616 Ga0495668_0249142 Ga0495668_0249142_73_951 292
562 3300046664 Ga0495659_0030922 Ga0495659_0030922_282_1160 292
563 3300046674 Ga0495588_0164601 Ga0495588_0164601_23_901 292
564 3300046681 Ga0495647_0009375 Ga0495647_0009375_782_1660 292
565 3300046794 Ga0495589_0027915 Ga0495589_0027915_1324_2202 292
566 3300046810 Ga0495660_0069317 Ga0495660_0069317_400_1278 292
567 3300047315 Ga0495581_0002858 Ga0495581_0002858_7600_8478 292
568 3300047318 Ga0495636_0056551 Ga0495636_0056551_56_934 292
569 3300047321 Ga0495676_0217889 Ga0495676_0217889_248_1213 292
570 3300047322 Ga0495680_0029654 Ga0495680_0029654_1540_2454 292
571 3300047447 Ga0495685_067833 Ga0495685_067833_260_1150 292
572 3300048090 Ga0495615_0048202 Ga0495615_0048202_95_976 292
573 3300048903 Ga0496100_0041176 Ga0496100_0041176_1322_2209 292
574 3300048903 Ga0496100_0151297 Ga0496100_0151297_393_1271 292
575 3300048904 Ga0496101_0002328 Ga0496101_0002328_3293_4171 292
576 3300048904 Ga0496101_0072977 Ga0496101_0072977_1055_1933 292
577 3300048904 Ga0496101_0131225 Ga0496101_0131225_165_1130 292
578 3300048905 Ga0496102_0005233 Ga0496102_0005233_8033_8911 292
579 3300048905 Ga0496102_0015201 Ga0496102_0015201_3874_4752 292
580 3300048905 Ga0496102_0029468 Ga0496102_0029468_3206_4084 292
581 3300048906 Ga0496103_0012557 Ga0496103_0012557_989_1867 292
582 3300048906 Ga0496103_0012733 Ga0496103_0012733_367_1245 292
583 3300048906 Ga0496103_0074997 Ga0496103_0074997_1189_2085 292
584 3300048906 Ga0496103_0284131 Ga0496103_0284131_115_1002 292
585 3300048907 Ga0496104_0011721 Ga0496104_0011721_4334_5212 292
586 3300048907 Ga0496104_0071352 Ga0496104_0071352_1027_1905 292
587 3300048907 Ga0496104_0112972 Ga0496104_0112972_272_1159 292
588 3300048907 Ga0496104_0179912 Ga0496104_0179912_106_984 292
589 3300048907 Ga0496104_0224622 Ga0496104_0224622_393_1271 292
590 3300048908 Ga0496105_0039714 Ga0496105_0039714_534_1412 292
591 3300048908 Ga0496105_0042911 Ga0496105_0042911_1174_2061 292
592 3300048909 Ga0496106_0006885 Ga0496106_0006885_2414_3292 292
593 3300048909 Ga0496106_0026307 Ga0496106_0026307_2622_3509 292
594 3300048910 Ga0496107_0022718 Ga0496107_0022718_2228_3106 292
595 3300048910 Ga0496107_0157642 Ga0496107_0157642_271_1149 292
596 3300048910 Ga0496107_0184352 Ga0496107_0184352_544_1422 292
597 3300048910 Ga0496107_0209630 Ga0496107_0209630_377_1255 292
598 3300048911 Ga0496108_0001049 Ga0496108_0001049_10508_11386 292
599 3300048911 Ga0496108_0004163 Ga0496108_0004163_4692_5570 292
600 3300048911 Ga0496108_0033737 Ga0496108_0033737_1804_2691 292
601 3300048911 Ga0496108_0195096 Ga0496108_0195096_661_1539 292
602 3300048911 Ga0496108_0252242 Ga0496108_0252242_17_895 292
603 3300048912 Ga0496109_0001264 Ga0496109_0001264_4287_5165 292
604 3300048912 Ga0496109_0003075 Ga0496109_0003075_11638_12516 292
605 3300048912 Ga0496109_0068855 Ga0496109_0068855_2215_3093 292
606 3300048912 Ga0496109_0172682 Ga0496109_0172682_545_1432 292
607 3300048912 Ga0496109_0201981 Ga0496109_0201981_861_1739 292
608 3300048913 Ga0496110_0002510 Ga0496110_0002510_4445_5323 292
609 3300048913 Ga0496110_0049426 Ga0496110_0049426_209_1087 292
610 3300048913 Ga0496110_0058394 Ga0496110_0058394_1566_2453 292
611 3300048914 Ga0496111_0001623 Ga0496111_0001623_1623_2501 292
612 3300048914 Ga0496111_0020552 Ga0496111_0020552_1870_2748 292
613 3300048914 Ga0496111_0035925 Ga0496111_0035925_2573_3451 292
614 3300048914 Ga0496111_0061099 Ga0496111_0061099_1071_1949 292
615 3300048915 Ga0496112_0001992 Ga0496112_0001992_9721_10599 292
616 3300048915 Ga0496112_0022811 Ga0496112_0022811_2951_3829 292
617 3300048915 Ga0496112_0324990 Ga0496112_0324990_475_1353 292
618 3300048916 Ga0496113_0036216 Ga0496113_0036216_1406_2284 292
619 3300048916 Ga0496113_0083201 Ga0496113_0083201_1399_2286 292
620 3300048917 Ga0496114_0040087 Ga0496114_0040087_2190_3068 292
621 3300048917 Ga0496114_0057517 Ga0496114_0057517_1352_2230 292
622 3300048917 Ga0496114_0106978 Ga0496114_0106978_26_913 292
623 3300048917 Ga0496114_0176422 Ga0496114_0176422_841_1719 292
624 3300048918 Ga0496115_0015045 Ga0496115_0015045_2021_2899 292
625 3300048918 Ga0496115_0026933 Ga0496115_0026933_2220_3098 292
626 3300049568 Ga0501031_0025535 Ga0501031_0025535_1018_1896 292
627 3300049568 Ga0501031_0025779 Ga0501031_0025779_1541_2419 292
628 3300049568 Ga0501031_0153847 Ga0501031_0153847_424_1326 292
629 3300049569 Ga0501032_0036340 Ga0501032_0036340_1449_2327 292
630 3300049570 Ga0501033_0015832 Ga0501033_0015832_2361_3239 292
631 3300049572 Ga0501036_0018025 Ga0501036_0018025_1290_2168 292
632 3300049572 Ga0501036_0044029 Ga0501036_0044029_392_1270 292
633 3300049572 Ga0501036_0099281 Ga0501036_0099281_493_1371 292
634 3300049573 Ga0501037_0024173 Ga0501037_0024173_2899_3777 292
635 3300049573 Ga0501037_0028075 Ga0501037_0028075_2727_3605 292
636 3300049574 Ga0501038_0067656 Ga0501038_0067656_565_1443 292
637 3300049574 Ga0501038_0316630 Ga0501038_0316630_283_1161 292
638 3300049575 Ga0501039_0010512 Ga0501039_0010512_121_999 292
639 3300049575 Ga0501039_0069176 Ga0501039_0069176_1548_2426 292
640 3300049576 Ga0501040_0015469 Ga0501040_0015469_1275_2153 292
641 3300049576 Ga0501040_0072220 Ga0501040_0072220_1376_2254 292
642 3300049577 Ga0501041_0006586 Ga0501041_0006586_83_961 292
643 3300049577 Ga0501041_0036026 Ga0501041_0036026_97_975 292
644 3300049577 Ga0501041_0036418 Ga0501041_0036418_349_1227 292
645 3300049578 Ga0501042_0021476 Ga0501042_0021476_587_1489 292
646 3300049578 Ga0501042_0032225 Ga0501042_0032225_1097_1975 292
647 3300049578 Ga0501042_0343288 Ga0501042_0343288_69_947 292
648 3300049579 Ga0501043_0023412 Ga0501043_0023412_1292_2170 292
649 3300049579 Ga0501043_0070958 Ga0501043_0070958_756_1634 292
650 3300049580 Ga0501046_0037142 Ga0501046_0037142_2907_3785 292
651 3300049580 Ga0501046_0125177 Ga0501046_0125177_586_1464 292
652 3300049581 Ga0501047_0195124 Ga0501047_0195124_777_1655 292
653 3300049582 Ga0501048_0075034 Ga0501048_0075034_1156_2034 292
654 3300049582 Ga0501048_0145510 Ga0501048_0145510_279_1181 292
655 3300049582 Ga0501048_0244283 Ga0501048_0244283_317_1198 292
656 3300049583 Ga0501067_0099830 Ga0501067_0099830_594_1472 292
657 3300049584 Ga0501068_0017671 Ga0501068_0017671_1080_1958 292
658 3300049584 Ga0501068_0064524 Ga0501068_0064524_132_1010 292
659 3300049584 Ga0501068_0295758 Ga0501068_0295758_97_975 292
660 3300049585 Ga0501069_0003998 Ga0501069_0003998_3150_4028 292
661 3300049585 Ga0501069_0009267 Ga0501069_0009267_2225_3127 292
662 3300049585 Ga0501069_0048048 Ga0501069_0048048_184_1062 292
663 3300049586 Ga0501070_0008965 Ga0501070_0008965_1482_2360 292
664 3300049586 Ga0501070_0037460 Ga0501070_0037460_817_1695 292
665 3300049586 Ga0501070_0220077 Ga0501070_0220077_39_917 292
666 3300049587 Ga0501071_0001633 Ga0501071_0001633_6404_7282 292
667 3300049587 Ga0501071_0010776 Ga0501071_0010776_1702_2580 292
668 3300049587 Ga0501071_0218536 Ga0501071_0218536_412_1290 292
669 3300049587 Ga0501071_0326288 Ga0501071_0326288_160_1038 292
670 3300049588 Ga0501072_0004430 Ga0501072_0004430_853_1731 292
671 3300049588 Ga0501072_0025240 Ga0501072_0025240_3206_4084 292
672 3300049588 Ga0501072_0064725 Ga0501072_0064725_130_1026 292
673 3300049588 Ga0501072_0084774 Ga0501072_0084774_1140_2018 292
674 3300049588 Ga0501072_0110372 Ga0501072_0110372_1207_2085 292
675 3300049589 Ga0501073_0023917 Ga0501073_0023917_1057_1935 292
676 3300049590 Ga0501074_0266465 Ga0501074_0266465_107_985 292
677 3300049591 Ga0501075_0013771 Ga0501075_0013771_1028_1906 292
678 3300049591 Ga0501075_0139400 Ga0501075_0139400_816_1694 292
679 3300049591 Ga0501075_0290930 Ga0501075_0290930_282_1160 292
680 3300049591 Ga0501075_0305132 Ga0501075_0305132_198_1079 292
681 3300049592 Ga0501076_0001355 Ga0501076_0001355_3798_4676 292
682 3300049592 Ga0501076_0006095 Ga0501076_0006095_5723_6601 292
683 3300049592 Ga0501076_0030833 Ga0501076_0030833_1647_2525 292
684 3300049592 Ga0501076_0057549 Ga0501076_0057549_1267_2145 292
685 3300049592 Ga0501076_0091582 Ga0501076_0091582_671_1549 292
686 3300049592 Ga0501076_0174261 Ga0501076_0174261_552_1430 292
687 3300049592 Ga0501076_0225087 Ga0501076_0225087_461_1342 292
688 3300049592 Ga0501076_0358816 Ga0501076_0358816_196_1098 292
689 3300049593 Ga0501077_0002034 Ga0501077_0002034_10956_11834 292
690 3300049593 Ga0501077_0008596 Ga0501077_0008596_1419_2297 292
691 3300049741 Ga0501079_0010820 Ga0501079_0010820_5976_6854 292
692 3300049741 Ga0501079_0052703 Ga0501079_0052703_1627_2505 292
693 3300049741 Ga0501079_0299023 Ga0501079_0299023_288_1166 292
694 3300049742 Ga0501080_0064086 Ga0501080_0064086_2379_3257 292
695 3300049742 Ga0501080_0421310 Ga0501080_0421310_132_1010 292
696 3300049743 Ga0501081_0002437 Ga0501081_0002437_10802_11680 292
697 3300049743 Ga0501081_0031067 Ga0501081_0031067_1581_2459 292
698 3300049743 Ga0501081_0088525 Ga0501081_0088525_1286_2164 292
699 3300049743 Ga0501081_0124829 Ga0501081_0124829_161_1039 292
700 3300049743 Ga0501081_0212005 Ga0501081_0212005_111_989 292
701 3300049744 Ga0501083_0024272 Ga0501083_0024272_1081_1959 292
702 3300049744 Ga0501083_0062537 Ga0501083_0062537_997_1875 292
703 3300049822 Ga0501035_0050738 Ga0501035_0050738_100_978 292
704 3300049822 Ga0501035_0081993 Ga0501035_0081993_878_1756 292
705 3300049823 Ga0501044_0068923 Ga0501044_0068923_1570_2448 292
706 3300049824 Ga0501045_0015818 Ga0501045_0015818_3665_4543 292
707 3300049824 Ga0501045_0036450 Ga0501045_0036450_2198_3076 292
708 3300049824 Ga0501045_0076612 Ga0501045_0076612_1517_2395 292
709 3300049824 Ga0501045_0363440 Ga0501045_0363440_70_948 292
710 3300050491 nmdc:mga00v17_111869_c1 nmdc:mga00v17_111869_c1_330_1208 292
711 3300050491 nmdc:mga00v17_266165_c1 nmdc:mga00v17_266165_c1_88_996 292
712 3300050507 nmdc:mga05p37_31823_c1 nmdc:mga05p37_31823_c1_4790_5668 292
713 3300050507 nmdc:mga05p37_74528_c1 nmdc:mga05p37_74528_c1_1352_2230 292
714 3300050508 nmdc:mga09592_83896_c1 nmdc:mga09592_83896_c1_1627_2505 292
715 3300050510 nmdc:mga06r32_59447_c1 nmdc:mga06r32_59447_c1_125_1003 292
716 3300050511 nmdc:mga08y16_39199_c1 nmdc:mga08y16_39199_c1_1795_2673 292
717 3300050511 nmdc:mga08y16_466235_c1 nmdc:mga08y16_466235_c1_75_962 292
718 3300050511 nmdc:mga08y16_48388_c1 nmdc:mga08y16_48388_c1_561_1439 292
719 3300050511 nmdc:mga08y16_7836_c1 nmdc:mga08y16_7836_c1_8582_9460 292
720 3300050512 nmdc:mga0n895_11353_c1 nmdc:mga0n895_11353_c1_5846_6724 292
721 3300050513 nmdc:mga0rr50_93717_c1 nmdc:mga0rr50_93717_c1_1082_1960 292
722 3300050514 nmdc:mga08x19_39226_c1 nmdc:mga08x19_39226_c1_1208_2086 292
723 3300050515 nmdc:mga0a205_150221_c1 nmdc:mga0a205_150221_c1_295_1191 292
724 3300050515 nmdc:mga0a205_1575_c1 nmdc:mga0a205_1575_c1_12702_13580 292
725 3300050515 nmdc:mga0a205_476264_c1 nmdc:mga0a205_476264_c1_89_967 292
726 3300050515 nmdc:mga0a205_508747_c1 nmdc:mga0a205_508747_c1_163_1050 292
727 3300053084 Ga0495595_0111689 Ga0495595_0111689_380_1261 292
728 3300053085 Ga0495619_0098853 Ga0495619_0098853_323_1237 292
729 3300054114 Ga0501084_0027535 Ga0501084_0027535_133_1011 292
730 3300054114 Ga0501084_0027824 Ga0501084_0027824_3681_4559 292
731 3300054114 Ga0501084_0052117 Ga0501084_0052117_1018_1896 292
732 3300054114 Ga0501084_0063873 Ga0501084_0063873_115_993 292
733 3300059426 Ga0590077_029614 Ga0590077_029614_151_1032 292
734 3300060353 Ga0501082_0065787 Ga0501082_0065787_1868_2746 292
735 3300060353 Ga0501082_0147240 Ga0501082_0147240_911_1789 292
736 3300060353 Ga0501082_0210054 Ga0501082_0210054_193_1071 292
737 3300060353 Ga0501082_0250663 Ga0501082_0250663_461_1339 292
738 3300061734 Ga0530510_0057140 Ga0530510_0057140_1269_2147 292
739 3300061734 Ga0530510_0065972 Ga0530510_0065972_912_1814 292
740 3300061734 Ga0530510_0297989 Ga0530510_0297989_258_1136 292

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pc1-assembly2.cif.gz_D crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.6102 82 272
6pc0-assembly1.cif.gz_B crystal structure of helicobacter pylori ppx/gppa 0.6094 83 272
2pq7-assembly1.cif.gz_A-2 crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution 0.5728 25 202
6pc1-assembly2.cif.gz_C crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.5614 64 272
5yim-assembly1.cif.gz_A structure of a legionella effector 0.5382 53 203
ID Description Score Start End Superfamily
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9422 58 216 1.10.3210.10
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9254 58 216 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5779 41 247 1.10.3210.10
af_Q59066_3_118_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.565 118 219 1.10.3210.10
af_Q59066_3_118_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5074 118 219 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9751 34 179 GO:0016787
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9686 34 179 GO:0016787
AF-A0A3D4FYF8-F1-model_v4 Phosphohydrolase 0.959 39 209 GO:0016787
AF-A0A497N2Z9-F1-model_v4 HD domain-containing protein 0.9487 42 182
AF-X0VKY6-F1-model_v4 HD/PDEase domain-containing protein 0.9482 34 272

Feature Viewer

pLDDT pTM Quality
85.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map