F478558
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 321 | 740 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_0718787|Ga0501082_0718787_56_853 |
| Length | 265 |
| Sequence | MTLDPEIEARIEEPASADAVREARLSPSEAVEHMRIRLPDRGNRKLRRVLERANGDKELRGWWHVANVNAVVRLEINDHSWVHIQIVANIALKLLRQLTKNGVEPSLVRDYGMDGEDAEVVVVLAALTHCVGMSVHRKGHEDWSLFQAITSHRADGEPLSLEAGILRVADALDMAKGRSRIPFERGQVSMHSLSAAAVEEVVITDGDTKPVRIEIVMNNSSGLFQVDGLLRAKLRGSGLEPYVEVIAHIDTDAEKRLVSEYRLEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 11.22 |
| Rhizosphere | 88.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10011246 | 3300001989 | Unclassified | 3306 |
| 2 | JGI24743J22301_10001489 | 3300001991 | Bacteria | 3254 |
| 3 | JGI24738J21930_10004979 | 3300002075 | Unclassified | 3215 |
| 4 | JGI24738J21930_10018973 | 3300002075 | Archaea | 1436 |
| 5 | JGI24744J21845_10010350 | 3300002077 | Unclassified | 1911 |
| 6 | JGI24742J22300_10002099 | 3300002244 | Bacteria | 3170 |
| 7 | Ga0070658_10025121 | 3300005327 | Bacteria | 4776 |
| 8 | Ga0070658_10055976 | 3300005327 | Unclassified | 3205 |
| 9 | Ga0070658_10292219 | 3300005327 | Bacteria | 1389 |
| 10 | Ga0070676_10150902 | 3300005328 | Unclassified | 1488 |
| 11 | Ga0070683_100010645 | 3300005329 | Bacteria | 7906 |
| 12 | Ga0070683_100011274 | 3300005329 | Bacteria | 7717 |
| 13 | Ga0070683_100037548 | 3300005329 | Bacteria | 4435 |
| 14 | Ga0070683_100081876 | 3300005329 | Bacteria | 3022 |
| 15 | Ga0070683_100095282 | 3300005329 | Bacteria | 2798 |
| 16 | Ga0070683_100576225 | 3300005329 | Bacteria | 1076 |
| 17 | Ga0070690_100009736 | 3300005330 | Bacteria | 5574 |
| 18 | Ga0070670_100042356 | 3300005331 | Bacteria | 3913 |
| 19 | Ga0070670_100347975 | 3300005331 | Bacteria | 1301 |
| 20 | Ga0068869_100046017 | 3300005334 | Bacteria | 3144 |
| 21 | Ga0070680_100003864 | 3300005336 | Bacteria | 11196 |
| 22 | Ga0070680_100012290 | 3300005336 | Bacteria | 6648 |
| 23 | Ga0070680_100078877 | 3300005336 | Unclassified | 2713 |
| 24 | Ga0070682_100005389 | 3300005337 | Bacteria | 7119 |
| 25 | Ga0070682_100026934 | 3300005337 | Bacteria | 3445 |
| 26 | Ga0070682_100201417 | 3300005337 | Archaea | 1404 |
| 27 | Ga0068868_100023709 | 3300005338 | Bacteria | 4647 |
| 28 | Ga0068868_100079462 | 3300005338 | Bacteria | 2627 |
| 29 | Ga0070660_100425589 | 3300005339 | Bacteria | 1100 |
| 30 | Ga0070689_100010225 | 3300005340 | Bacteria | 6684 |
| 31 | Ga0070689_100060852 | 3300005340 | Unclassified | 2936 |
| 32 | Ga0070691_10011914 | 3300005341 | Unclassified | 3980 |
| 33 | Ga0070687_100074923 | 3300005343 | Archaea | 1829 |
| 34 | Ga0070661_100008413 | 3300005344 | Bacteria | 7132 |
| 35 | Ga0070661_100011485 | 3300005344 | Bacteria | 6168 |
| 36 | Ga0070692_10014221 | 3300005345 | Bacteria | 3731 |
| 37 | Ga0070692_10020404 | 3300005345 | Bacteria | 3213 |
| 38 | Ga0070668_100010845 | 3300005347 | Bacteria | 6780 |
| 39 | Ga0070668_100088306 | 3300005347 | Bacteria | 2440 |
| 40 | Ga0070668_100157338 | 3300005347 | Unclassified | 1841 |
| 41 | Ga0070669_100116514 | 3300005353 | Archaea | 2033 |
| 42 | Ga0070675_100082178 | 3300005354 | Unclassified | 2687 |
| 43 | Ga0070675_100125061 | 3300005354 | Archaea | 2187 |
| 44 | Ga0070671_100073534 | 3300005355 | Bacteria | 2855 |
| 45 | Ga0070671_100087563 | 3300005355 | Bacteria | 2606 |
| 46 | Ga0070674_100004917 | 3300005356 | Bacteria | 7656 |
| 47 | Ga0070674_100048705 | 3300005356 | Bacteria | 2909 |
| 48 | Ga0070674_100058022 | 3300005356 | Unclassified | 2689 |
| 49 | Ga0070674_100065278 | 3300005356 | Bacteria | 2554 |
| 50 | Ga0070673_100187733 | 3300005364 | Archaea | 1773 |
| 51 | Ga0070688_100017320 | 3300005365 | Bacteria | 4134 |
| 52 | Ga0070659_100047707 | 3300005366 | Unclassified | 3361 |
| 53 | Ga0070659_100090699 | 3300005366 | Bacteria | 2449 |
| 54 | Ga0070659_100164871 | 3300005366 | Unclassified | 1813 |
| 55 | Ga0070659_100168785 | 3300005366 | Unclassified | 1791 |
| 56 | Ga0070667_100145761 | 3300005367 | Archaea | 2076 |
| 57 | Ga0070703_10005780 | 3300005406 | Bacteria | 3466 |
| 58 | Ga0070709_10218951 | 3300005434 | Bacteria | 1357 |
| 59 | Ga0070709_10302454 | 3300005434 | Bacteria | 1169 |
| 60 | Ga0070710_10017974 | 3300005437 | Bacteria | 3630 |
| 61 | Ga0070701_10002028 | 3300005438 | Bacteria | 7679 |
| 62 | Ga0070701_10173381 | 3300005438 | Archaea | 1257 |
| 63 | Ga0070711_100000778 | 3300005439 | Bacteria | 16654 |
| 64 | Ga0070711_100050323 | 3300005439 | Bacteria | 2857 |
| 65 | Ga0070705_100012577 | 3300005440 | Bacteria | 4306 |
| 66 | Ga0070700_100004283 | 3300005441 | Bacteria | 7448 |
| 67 | Ga0070694_100055758 | 3300005444 | Bacteria | 2681 |
| 68 | Ga0070708_100056964 | 3300005445 | Bacteria | 3478 |
| 69 | Ga0070663_100038450 | 3300005455 | Bacteria | 3338 |
| 70 | Ga0070678_100010583 | 3300005456 | Bacteria | 5644 |
| 71 | Ga0070678_100120725 | 3300005456 | Bacteria | 2066 |
| 72 | Ga0070662_100005776 | 3300005457 | Bacteria | 7927 |
| 73 | Ga0070662_100097469 | 3300005457 | Bacteria | 2219 |
| 74 | Ga0070681_10003855 | 3300005458 | Bacteria | 14112 |
| 75 | Ga0070681_10045244 | 3300005458 | Bacteria | 4403 |
| 76 | Ga0070681_10087127 | 3300005458 | Bacteria | 3075 |
| 77 | Ga0068867_100026250 | 3300005459 | Bacteria | 4182 |
| 78 | Ga0068867_100363868 | 3300005459 | Archaea | 1210 |
| 79 | Ga0070685_10007351 | 3300005466 | Bacteria | 5632 |
| 80 | Ga0070685_10035833 | 3300005466 | Bacteria | 2802 |
| 81 | Ga0070707_100643592 | 3300005468 | Archaea | 1023 |
| 82 | Ga0070698_100005716 | 3300005471 | Bacteria | 13614 |
| 83 | Ga0070699_100078153 | 3300005518 | Bacteria | 2882 |
| 84 | Ga0070699_100127927 | 3300005518 | Bacteria | 2238 |
| 85 | Ga0070679_100042942 | 3300005530 | Bacteria | 4503 |
| 86 | Ga0070679_100084145 | 3300005530 | Bacteria | 3169 |
| 87 | Ga0070684_100012808 | 3300005535 | Bacteria | 6736 |
| 88 | Ga0070684_100120477 | 3300005535 | Bacteria | 2360 |
| 89 | Ga0070684_100194283 | 3300005535 | Bacteria | 1847 |
| 90 | Ga0068853_100009478 | 3300005539 | Bacteria | 7845 |
| 91 | Ga0068853_100178013 | 3300005539 | Bacteria | 1928 |
| 92 | Ga0068853_100263725 | 3300005539 | Archaea | 1584 |
| 93 | Ga0070672_100040145 | 3300005543 | Bacteria | 3589 |
| 94 | Ga0070696_100026401 | 3300005546 | Bacteria | 3951 |
| 95 | Ga0070693_100027437 | 3300005547 | Bacteria | 3086 |
| 96 | Ga0070693_100059705 | 3300005547 | Unclassified | 2211 |
| 97 | Ga0070693_100167509 | 3300005547 | Unclassified | 1404 |
| 98 | Ga0070665_100160278 | 3300005548 | Bacteria | 2251 |
| 99 | Ga0070704_100006800 | 3300005549 | Bacteria | 6771 |
| 100 | Ga0070704_100126301 | 3300005549 | Archaea | 1974 |
| 101 | Ga0068855_100112091 | 3300005563 | Bacteria | 3130 |
| 102 | Ga0068855_100153220 | 3300005563 | Bacteria | 2620 |
| 103 | Ga0070664_100001655 | 3300005564 | Bacteria | 17816 |
| 104 | Ga0070664_100076158 | 3300005564 | Unclassified | 2882 |
| 105 | Ga0070664_100175449 | 3300005564 | Bacteria | 1903 |
| 106 | Ga0070664_100397718 | 3300005564 | Bacteria | 1259 |
| 107 | Ga0068857_100207853 | 3300005577 | Unclassified | 1785 |
| 108 | Ga0068854_100221324 | 3300005578 | Archaea | 1498 |
| 109 | Ga0068856_100028879 | 3300005614 | Bacteria | 5419 |
| 110 | Ga0068856_100037505 | 3300005614 | Bacteria | 4755 |
| 111 | Ga0070702_100007827 | 3300005615 | Bacteria | 5138 |
| 112 | Ga0070702_100043566 | 3300005615 | Unclassified | 2529 |
| 113 | Ga0068852_100043332 | 3300005616 | Bacteria | 3816 |
| 114 | Ga0068852_100078184 | 3300005616 | Unclassified | 2926 |
| 115 | Ga0068852_100079567 | 3300005616 | Bacteria | 2903 |
| 116 | Ga0068852_100084050 | 3300005616 | Bacteria | 2832 |
| 117 | Ga0068852_100107007 | 3300005616 | Bacteria | 2536 |
| 118 | Ga0068859_100153008 | 3300005617 | Bacteria | 2383 |
| 119 | Ga0068864_100036679 | 3300005618 | Bacteria | 4180 |
| 120 | Ga0068864_100211124 | 3300005618 | Bacteria | 1787 |
| 121 | Ga0068861_100092806 | 3300005719 | Bacteria | 2385 |
| 122 | Ga0068861_100125460 | 3300005719 | Bacteria | 2076 |
| 123 | Ga0068861_100566068 | 3300005719 | Bacteria | 1038 |
| 124 | Ga0068851_10016932 | 3300005834 | Unclassified | 3494 |
| 125 | Ga0068870_10067545 | 3300005840 | Unclassified | 1940 |
| 126 | Ga0068863_100033487 | 3300005841 | Bacteria | 4895 |
| 127 | Ga0068860_100031873 | 3300005843 | Bacteria | 5067 |
| 128 | Ga0068860_100101724 | 3300005843 | Bacteria | 2742 |
| 129 | Ga0081455_10008516 | 3300005937 | Bacteria | 10653 |
| 130 | Ga0081455_10019638 | 3300005937 | Bacteria | 6384 |
| 131 | Ga0081455_10033510 | 3300005937 | Bacteria | 4615 |
| 132 | Ga0081539_10000712 | 3300005985 | Bacteria | 66647 |
| 133 | Ga0081539_10136213 | 3300005985 | Bacteria | 1199 |
| 134 | Ga0075364_10051124 | 3300006051 | Bacteria | 2698 |
| 135 | Ga0075432_10002694 | 3300006058 | Bacteria | 5939 |
| 136 | Ga0075432_10008665 | 3300006058 | Bacteria | 3471 |
| 137 | Ga0075432_10016054 | 3300006058 | Bacteria | 2557 |
| 138 | Ga0070715_10072860 | 3300006163 | Bacteria | 1539 |
| 139 | Ga0070715_10170560 | 3300006163 | Unclassified | 1083 |
| 140 | Ga0070716_100216923 | 3300006173 | Bacteria | 1283 |
| 141 | Ga0070712_100046450 | 3300006175 | Bacteria | 3002 |
| 142 | Ga0070712_100067562 | 3300006175 | Bacteria | 2544 |
| 143 | Ga0070712_100299083 | 3300006175 | Unclassified | 1302 |
| 144 | Ga0097621_100047946 | 3300006237 | Bacteria | 3463 |
| 145 | Ga0097621_100116997 | 3300006237 | Bacteria | 2258 |
| 146 | Ga0097621_100547817 | 3300006237 | Bacteria | 1053 |
| 147 | Ga0068871_100024236 | 3300006358 | Bacteria | 4702 |
| 148 | Ga0068871_100028513 | 3300006358 | Bacteria | 4377 |
| 149 | Ga0068871_100062935 | 3300006358 | Bacteria | 3033 |
| 150 | Ga0068871_100130492 | 3300006358 | Unclassified | 2130 |
| 151 | Ga0075428_100000942 | 3300006844 | Bacteria | 30775 |
| 152 | Ga0075431_100017672 | 3300006847 | Bacteria | 7251 |
| 153 | Ga0075433_10012982 | 3300006852 | Bacteria | 6753 |
| 154 | Ga0075434_100139867 | 3300006871 | Bacteria | 2440 |
| 155 | Ga0075429_100006563 | 3300006880 | Bacteria | 10074 |
| 156 | Ga0068865_100006538 | 3300006881 | Bacteria | 7122 |
| 157 | Ga0068865_100014818 | 3300006881 | Bacteria | 4960 |
| 158 | Ga0068865_100054806 | 3300006881 | Bacteria | 2772 |
| 159 | Ga0075436_100045219 | 3300006914 | Bacteria | 3036 |
| 160 | Ga0097620_100153009 | 3300006931 | Bacteria | 2383 |
| 161 | Ga0075435_100010187 | 3300007076 | Bacteria | 6867 |
| 162 | Ga0105240_10106750 | 3300009093 | Bacteria | 3396 |
| 163 | Ga0111539_10005668 | 3300009094 | Bacteria | 16155 |
| 164 | Ga0111539_10008986 | 3300009094 | Bacteria | 12650 |
| 165 | Ga0111539_10061471 | 3300009094 | Bacteria | 4450 |
| 166 | Ga0111539_10107842 | 3300009094 | Unclassified | 3268 |
| 167 | Ga0111539_10780055 | 3300009094 | Archaea | 1112 |
| 168 | Ga0105245_10002722 | 3300009098 | Bacteria | 15912 |
| 169 | Ga0105245_10003740 | 3300009098 | Bacteria | 13558 |
| 170 | Ga0105245_10011716 | 3300009098 | Bacteria | 7631 |
| 171 | Ga0105245_10030952 | 3300009098 | Bacteria | 4733 |
| 172 | Ga0105245_10086760 | 3300009098 | Bacteria | 2871 |
| 173 | Ga0105245_10123199 | 3300009098 | Bacteria | 2424 |
| 174 | Ga0114129_10006031 | 3300009147 | Bacteria | 17180 |
| 175 | Ga0114129_10006732 | 3300009147 | Bacteria | 16319 |
| 176 | Ga0114129_10231371 | 3300009147 | Bacteria | 2489 |
| 177 | Ga0105243_10019092 | 3300009148 | Bacteria | 5198 |
| 178 | Ga0105243_10022765 | 3300009148 | Bacteria | 4764 |
| 179 | Ga0105243_10029094 | 3300009148 | Bacteria | 4247 |
| 180 | Ga0105243_10035934 | 3300009148 | Bacteria | 3842 |
| 181 | Ga0105243_10381014 | 3300009148 | Bacteria | 1304 |
| 182 | Ga0105243_10426742 | 3300009148 | Archaea | 1238 |
| 183 | Ga0105242_10002896 | 3300009176 | Bacteria | 13426 |
| 184 | Ga0105242_10025238 | 3300009176 | Bacteria | 4701 |
| 185 | Ga0105242_10476757 | 3300009176 | Archaea | 1182 |
| 186 | Ga0105248_10007689 | 3300009177 | Bacteria | 11840 |
| 187 | Ga0105248_10147107 | 3300009177 | Bacteria | 2659 |
| 188 | Ga0105248_10147113 | 3300009177 | Bacteria | 2659 |
| 189 | Ga0105248_10305267 | 3300009177 | Unclassified | 1792 |
| 190 | Ga0105237_10247575 | 3300009545 | Unclassified | 1784 |
| 191 | Ga0105238_10037087 | 3300009551 | Bacteria | 4956 |
| 192 | Ga0105238_10375838 | 3300009551 | Unclassified | 1412 |
| 193 | Ga0105249_10004111 | 3300009553 | Bacteria | 12565 |
| 194 | Ga0105249_10157113 | 3300009553 | Bacteria | 2194 |
| 195 | Ga0105249_10414713 | 3300009553 | Bacteria | 1379 |
| 196 | Ga0105239_10004419 | 3300010375 | Bacteria | 16815 |
| 197 | Ga0105239_10033163 | 3300010375 | Bacteria | 5671 |
| 198 | Ga0105239_10055548 | 3300010375 | Unclassified | 4343 |
| 199 | Ga0105246_10005688 | 3300011119 | Bacteria | 7605 |
| 200 | Ga0105246_10085070 | 3300011119 | Unclassified | 2264 |
| 201 | Ga0157373_10143881 | 3300013100 | Unclassified | 1677 |
| 202 | Ga0157371_10010321 | 3300013102 | Bacteria | 7288 |
| 203 | Ga0157371_10117162 | 3300013102 | Bacteria | 1893 |
| 204 | Ga0157371_10138521 | 3300013102 | Bacteria | 1733 |
| 205 | Ga0157370_10166912 | 3300013104 | Unclassified | 2047 |
| 206 | Ga0157369_10031662 | 3300013105 | Bacteria | 5821 |
| 207 | Ga0157369_10218605 | 3300013105 | Unclassified | 1995 |
| 208 | Ga0157369_10426035 | 3300013105 | Bacteria | 1375 |
| 209 | Ga0157374_10006575 | 3300013296 | Bacteria | 9870 |
| 210 | Ga0163162_10039731 | 3300013306 | Bacteria | 4703 |
| 211 | Ga0163162_10104233 | 3300013306 | Bacteria | 2931 |
| 212 | Ga0163162_10159702 | 3300013306 | Bacteria | 2375 |
| 213 | Ga0163162_10166169 | 3300013306 | Bacteria | 2330 |
| 214 | Ga0157372_10006446 | 3300013307 | Bacteria | 12495 |
| 215 | Ga0157372_10016007 | 3300013307 | Bacteria | 8045 |
| 216 | Ga0157372_10227194 | 3300013307 | Unclassified | 2164 |
| 217 | Ga0157372_10384281 | 3300013307 | Bacteria | 1636 |
| 218 | Ga0157375_10023531 | 3300013308 | Bacteria | 5685 |
| 219 | Ga0157375_10103461 | 3300013308 | Bacteria | 2934 |
| 220 | Ga0157375_10169654 | 3300013308 | Bacteria | 2329 |
| 221 | Ga0157375_10449341 | 3300013308 | Bacteria | 1454 |
| 222 | Ga0157375_10945666 | 3300013308 | Unclassified | 1004 |
| 223 | Ga0163163_10159741 | 3300014325 | Bacteria | 2299 |
| 224 | Ga0163163_10445551 | 3300014325 | Unclassified | 1355 |
| 225 | Ga0157380_10037797 | 3300014326 | Bacteria | 3743 |
| 226 | Ga0157380_10050383 | 3300014326 | Bacteria | 3289 |
| 227 | Ga0157380_10459036 | 3300014326 | Archaea | 1226 |
| 228 | Ga0157377_10007022 | 3300014745 | Bacteria | 5408 |
| 229 | Ga0157377_10013079 | 3300014745 | Bacteria | 4191 |
| 230 | Ga0157377_10068137 | 3300014745 | Bacteria | 2050 |
| 231 | Ga0157379_10067408 | 3300014968 | Bacteria | 3199 |
| 232 | Ga0157376_10011146 | 3300014969 | Bacteria | 6614 |
| 233 | Ga0157376_10034780 | 3300014969 | Bacteria | 4071 |
| 234 | Ga0157376_10169969 | 3300014969 | Bacteria | 1984 |
| 235 | Ga0157376_10345258 | 3300014969 | Bacteria | 1423 |
| 236 | Ga0157376_10633535 | 3300014969 | Bacteria | 1068 |
| 237 | Ga0163161_10087346 | 3300017792 | Bacteria | 2303 |
| 238 | Ga0163161_10218883 | 3300017792 | Bacteria | 1474 |
| 239 | Ga0206353_10640569 | 3300020082 | Unclassified | 1505 |
| 240 | Ga0224712_10076538 | 3300022467 | Unclassified | 1371 |
| 241 | Ga0207653_10007128 | 3300025885 | Bacteria | 3492 |
| 242 | Ga0207692_10014959 | 3300025898 | Bacteria | 3403 |
| 243 | Ga0207642_10017208 | 3300025899 | Bacteria | 2744 |
| 244 | Ga0207688_10018141 | 3300025901 | Bacteria | 3830 |
| 245 | Ga0207647_10055787 | 3300025904 | Bacteria | 2427 |
| 246 | Ga0207699_10078398 | 3300025906 | Bacteria | 2040 |
| 247 | Ga0207699_10109794 | 3300025906 | Bacteria | 1766 |
| 248 | Ga0207645_10137393 | 3300025907 | Unclassified | 1592 |
| 249 | Ga0207643_10015732 | 3300025908 | Bacteria | 4120 |
| 250 | Ga0207643_10158919 | 3300025908 | Bacteria | 1359 |
| 251 | Ga0207705_10099972 | 3300025909 | Unclassified | 2133 |
| 252 | Ga0207705_10130681 | 3300025909 | Unclassified | 1869 |
| 253 | Ga0207654_10171124 | 3300025911 | Archaea | 1410 |
| 254 | Ga0207707_10020297 | 3300025912 | Bacteria | 5801 |
| 255 | Ga0207695_10047042 | 3300025913 | Bacteria | 4569 |
| 256 | Ga0207693_10010927 | 3300025915 | Bacteria | 7358 |
| 257 | Ga0207693_10071413 | 3300025915 | Bacteria | 2717 |
| 258 | Ga0207693_10085853 | 3300025915 | Bacteria | 2465 |
| 259 | Ga0207693_10284094 | 3300025915 | Bacteria | 1297 |
| 260 | Ga0207663_10026556 | 3300025916 | Bacteria | 3363 |
| 261 | Ga0207660_10052625 | 3300025917 | Unclassified | 2899 |
| 262 | Ga0207660_10190249 | 3300025917 | Bacteria | 1598 |
| 263 | Ga0207662_10034397 | 3300025918 | Bacteria | 2957 |
| 264 | Ga0207662_10117577 | 3300025918 | Bacteria | 1664 |
| 265 | Ga0207657_10010086 | 3300025919 | Bacteria | 9445 |
| 266 | Ga0207657_10053270 | 3300025919 | Bacteria | 3506 |
| 267 | Ga0207657_10136263 | 3300025919 | Bacteria | 2009 |
| 268 | Ga0207657_10369038 | 3300025919 | Bacteria | 1131 |
| 269 | Ga0207649_10047442 | 3300025920 | Unclassified | 2644 |
| 270 | Ga0207649_10298527 | 3300025920 | Bacteria | 1177 |
| 271 | Ga0207652_10295645 | 3300025921 | Bacteria | 1461 |
| 272 | Ga0207694_10099848 | 3300025924 | Unclassified | 2299 |
| 273 | Ga0207659_10030066 | 3300025926 | Unclassified | 3708 |
| 274 | Ga0207659_10286411 | 3300025926 | Archaea | 1349 |
| 275 | Ga0207687_10050998 | 3300025927 | Bacteria | 2883 |
| 276 | Ga0207687_10059790 | 3300025927 | Bacteria | 2686 |
| 277 | Ga0207687_10106637 | 3300025927 | Bacteria | 2072 |
| 278 | Ga0207687_10125509 | 3300025927 | Bacteria | 1926 |
| 279 | Ga0207700_10170456 | 3300025928 | Archaea | 1816 |
| 280 | Ga0207644_10062299 | 3300025931 | Bacteria | 2705 |
| 281 | Ga0207644_10120843 | 3300025931 | Archaea | 1994 |
| 282 | Ga0207690_10070781 | 3300025932 | Bacteria | 2403 |
| 283 | Ga0207690_10099725 | 3300025932 | Unclassified | 2071 |
| 284 | Ga0207690_10237437 | 3300025932 | Archaea | 1402 |
| 285 | Ga0207706_10038276 | 3300025933 | Bacteria | 4255 |
| 286 | Ga0207706_10048645 | 3300025933 | Bacteria | 3749 |
| 287 | Ga0207706_10145350 | 3300025933 | Bacteria | 2086 |
| 288 | Ga0207686_10007462 | 3300025934 | Bacteria | 5885 |
| 289 | Ga0207686_10031563 | 3300025934 | Bacteria | 3147 |
| 290 | Ga0207686_10068351 | 3300025934 | Bacteria | 2276 |
| 291 | Ga0207709_10004231 | 3300025935 | Bacteria | 8321 |
| 292 | Ga0207709_10034834 | 3300025935 | Bacteria | 2971 |
| 293 | Ga0207709_10035388 | 3300025935 | Unclassified | 2952 |
| 294 | Ga0207670_10138682 | 3300025936 | Archaea | 1791 |
| 295 | Ga0207669_10014759 | 3300025937 | Bacteria | 3923 |
| 296 | Ga0207669_10211339 | 3300025937 | Bacteria | 1416 |
| 297 | Ga0207669_10402428 | 3300025937 | Bacteria | 1073 |
| 298 | Ga0207704_10007862 | 3300025938 | Bacteria | 5062 |
| 299 | Ga0207704_10078028 | 3300025938 | Bacteria | 2129 |
| 300 | Ga0207704_10096155 | 3300025938 | Bacteria | 1961 |
| 301 | Ga0207665_10011957 | 3300025939 | Bacteria | 5701 |
| 302 | Ga0207665_10062245 | 3300025939 | Bacteria | 2531 |
| 303 | Ga0207691_10009495 | 3300025940 | Bacteria | 9342 |
| 304 | Ga0207691_10019977 | 3300025940 | Bacteria | 6337 |
| 305 | Ga0207691_10104323 | 3300025940 | Bacteria | 2527 |
| 306 | Ga0207691_10136579 | 3300025940 | Bacteria | 2162 |
| 307 | Ga0207691_10423099 | 3300025940 | Bacteria | 1135 |
| 308 | Ga0207711_10052951 | 3300025941 | Bacteria | 3480 |
| 309 | Ga0207711_10121958 | 3300025941 | Bacteria | 2328 |
| 310 | Ga0207711_10183204 | 3300025941 | Unclassified | 1905 |
| 311 | Ga0207689_10124158 | 3300025942 | Unclassified | 2124 |
| 312 | Ga0207661_10000273 | 3300025944 | Bacteria | 33324 |
| 313 | Ga0207661_10030244 | 3300025944 | Bacteria | 4169 |
| 314 | Ga0207661_10059962 | 3300025944 | Bacteria | 3068 |
| 315 | Ga0207661_10083062 | 3300025944 | Bacteria | 2650 |
| 316 | Ga0207679_10011244 | 3300025945 | Bacteria | 5785 |
| 317 | Ga0207679_10082372 | 3300025945 | Bacteria | 2463 |
| 318 | Ga0207679_10318358 | 3300025945 | Bacteria | 1346 |
| 319 | Ga0207667_10122950 | 3300025949 | Bacteria | 2674 |
| 320 | Ga0207667_10177122 | 3300025949 | Unclassified | 2190 |
| 321 | Ga0207667_10426227 | 3300025949 | Bacteria | 1349 |
| 322 | Ga0207651_10144877 | 3300025960 | Archaea | 1840 |
| 323 | Ga0207712_10005182 | 3300025961 | Bacteria | 8251 |
| 324 | Ga0207712_10128430 | 3300025961 | Unclassified | 1928 |
| 325 | Ga0207668_10068533 | 3300025972 | Bacteria | 2523 |
| 326 | Ga0207668_10132156 | 3300025972 | Bacteria | 1907 |
| 327 | Ga0207640_10005036 | 3300025981 | Bacteria | 7188 |
| 328 | Ga0207640_10059396 | 3300025981 | Unclassified | 2524 |
| 329 | Ga0207658_10004151 | 3300025986 | Bacteria | 10096 |
| 330 | Ga0207677_10015516 | 3300026023 | Unclassified | 4485 |
| 331 | Ga0207677_10142865 | 3300026023 | Bacteria | 1835 |
| 332 | Ga0207639_10041361 | 3300026041 | Bacteria | 3447 |
| 333 | Ga0207678_10033959 | 3300026067 | Unclassified | 4443 |
| 334 | Ga0207678_10047340 | 3300026067 | Bacteria | 3719 |
| 335 | Ga0207708_10001826 | 3300026075 | Bacteria | 15704 |
| 336 | Ga0207708_10029676 | 3300026075 | Bacteria | 4145 |
| 337 | Ga0207708_10091870 | 3300026075 | Bacteria | 2341 |
| 338 | Ga0207702_10028163 | 3300026078 | Bacteria | 4668 |
| 339 | Ga0207641_10140396 | 3300026088 | Archaea | 2179 |
| 340 | Ga0207648_10000504 | 3300026089 | Bacteria | 43569 |
| 341 | Ga0207648_10133134 | 3300026089 | Unclassified | 2189 |
| 342 | Ga0207648_10156463 | 3300026089 | Bacteria | 2012 |
| 343 | Ga0207648_10193423 | 3300026089 | Archaea | 1804 |
| 344 | Ga0207676_10184999 | 3300026095 | Archaea | 1827 |
| 345 | Ga0207676_10194894 | 3300026095 | Bacteria | 1786 |
| 346 | Ga0207674_10044028 | 3300026116 | Bacteria | 4600 |
| 347 | Ga0207674_10136767 | 3300026116 | Unclassified | 2412 |
| 348 | Ga0207675_100027437 | 3300026118 | Bacteria | 5304 |
| 349 | Ga0207675_100038087 | 3300026118 | Bacteria | 4487 |
| 350 | Ga0207675_100340004 | 3300026118 | Bacteria | 1469 |
| 351 | Ga0207683_10001483 | 3300026121 | Bacteria | 21156 |
| 352 | Ga0207683_10052152 | 3300026121 | Bacteria | 3584 |
| 353 | Ga0207683_10072940 | 3300026121 | Bacteria | 3036 |
| 354 | Ga0207683_10236265 | 3300026121 | Archaea | 1667 |
| 355 | Ga0207698_10015478 | 3300026142 | Bacteria | 5107 |
| 356 | Ga0207698_10104049 | 3300026142 | Unclassified | 2361 |
| 357 | Ga0207698_10230143 | 3300026142 | Unclassified | 1682 |
| 358 | Ga0207698_10563697 | 3300026142 | Bacteria | 1118 |
| 359 | Ga0207428_10000222 | 3300027907 | Bacteria | 78747 |
| 360 | Ga0207428_10010823 | 3300027907 | Bacteria | 8126 |
| 361 | Ga0207428_10063181 | 3300027907 | Bacteria | 2926 |
| 362 | Ga0268266_10210584 | 3300028379 | Archaea | 1782 |
| 363 | Ga0268265_10260636 | 3300028380 | Archaea | 1541 |
| 364 | Ga0268264_10126903 | 3300028381 | Bacteria | 2256 |
| 365 | Ga0265337_1067712 | 3300028556 | Unclassified | 984 |
| 366 | Ga0265319_1016801 | 3300028563 | Bacteria | 2800 |
| 367 | Ga0265318_10022513 | 3300028577 | Bacteria | 2518 |
| 368 | Ga0265338_10132985 | 3300028800 | Bacteria | 1961 |
| 369 | Ga0265320_10036069 | 3300031240 | Bacteria | 2502 |
| 370 | Ga0265327_10007879 | 3300031251 | Bacteria | 8076 |
| 371 | Ga0307416_100005871 | 3300032002 | Bacteria | 7617 |
| 372 | Ga0307416_100075003 | 3300032002 | Bacteria | 2829 |
| 373 | Ga0307415_100007073 | 3300032126 | Bacteria | 6108 |
| 374 | Ga0373958_0033953 | 3300034819 | Archaea | 1014 |
| 375 | Ga0373926_0035641 | 3300035083 | Bacteria | 1766 |
| 376 | Ga0373941_0042587 | 3300035115 | Archaea | 1410 |
| 377 | Ga0373941_0055561 | 3300035115 | Bacteria | 1273 |
| 378 | Ga0373943_0002579 | 3300035170 | Bacteria | 8251 |
| 379 | Ga0373946_0014784 | 3300035171 | Bacteria | 2949 |
| 380 | Ga0373961_0009431 | 3300035241 | Bacteria | 2388 |
| 381 | Ga0373962_0008415 | 3300035242 | Bacteria | 2538 |
| 382 | Ga0373931_0033478 | 3300035691 | Bacteria | 2663 |
| 383 | Ga0373947_0019921 | 3300035725 | Bacteria | 3872 |
| 384 | Ga0373925_0075236 | 3300037068 | Bacteria | 2558 |
| 385 | Ga0395900_0015005 | 3300037418 | Bacteria | 7897 |
| 386 | Ga0395900_0368717 | 3300037418 | Bacteria | 1406 |
| 387 | Ga0395898_0016145 | 3300037466 | Bacteria | 7646 |
| 388 | Ga0395898_0163407 | 3300037466 | Bacteria | 2130 |
| 389 | Ga0395898_0231517 | 3300037466 | Bacteria | 1762 |
| 390 | Ga0395898_0383501 | 3300037466 | Unclassified | 1340 |
| 391 | Ga0395905_0177317 | 3300037471 | Bacteria | 2000 |
| 392 | Ga0395905_0339521 | 3300037471 | Bacteria | 1393 |
| 393 | Ga0395905_0484893 | 3300037471 | Bacteria | 1136 |
| 394 | Ga0395901_0112921 | 3300038443 | Bacteria | 2853 |
| 395 | Ga0395901_0244751 | 3300038443 | Bacteria | 1870 |
| 396 | Ga0395901_0688630 | 3300038443 | Archaea | 1021 |
| 397 | Ga0451807_1862518 | 3300041486 | Bacteria | 1042 |
| 398 | Ga0439441_002460 | 3300042001 | Bacteria | 2614 |
| 399 | Ga0439448_0055586 | 3300042005 | Unclassified | 1302 |
| 400 | Ga0439449_0056392 | 3300042007 | Unclassified | 1451 |
| 401 | Ga0439450_037602 | 3300042008 | Unclassified | 1113 |
| 402 | Ga0439462_0000831 | 3300042015 | Bacteria | 6444 |
| 403 | Ga0439446_0004313 | 3300042156 | Bacteria | 3599 |
| 404 | Ga0439464_0069137 | 3300042439 | Bacteria | 1043 |
| 405 | Ga0466966_0100587 | 3300044684 | Bacteria | 1788 |
| 406 | Ga0466961_0139218 | 3300044693 | Bacteria | 1520 |
| 407 | Ga0466967_0006293 | 3300045976 | Bacteria | 8375 |
| 408 | Ga0466967_0237480 | 3300045976 | Bacteria | 1737 |
| 409 | Ga0495592_0133474 | 3300046454 | Bacteria | 1734 |
| 410 | Ga0495592_0210571 | 3300046454 | Bacteria | 1305 |
| 411 | Ga0495603_0018540 | 3300046455 | Bacteria | 4209 |
| 412 | Ga0495603_0150082 | 3300046455 | Unclassified | 1354 |
| 413 | Ga0495603_0211385 | 3300046455 | Bacteria | 1120 |
| 414 | Ga0495603_0307403 | 3300046455 | Bacteria | 911 |
| 415 | Ga0495629_0001622 | 3300046459 | Bacteria | 17679 |
| 416 | Ga0495629_0069147 | 3300046459 | Bacteria | 2464 |
| 417 | Ga0495629_0176166 | 3300046459 | Bacteria | 1483 |
| 418 | Ga0495641_0001841 | 3300046461 | Bacteria | 17419 |
| 419 | Ga0495641_0043195 | 3300046461 | Bacteria | 2085 |
| 420 | Ga0495641_0151683 | 3300046461 | Bacteria | 1036 |
| 421 | Ga0495651_0018214 | 3300046462 | Bacteria | 5438 |
| 422 | Ga0495651_0064146 | 3300046462 | Bacteria | 2807 |
| 423 | Ga0495653_0011544 | 3300046463 | Bacteria | 7211 |
| 424 | Ga0495653_0036570 | 3300046463 | Bacteria | 3866 |
| 425 | Ga0495653_0092426 | 3300046463 | Bacteria | 2209 |
| 426 | Ga0495653_0110420 | 3300046463 | Bacteria | 1977 |
| 427 | Ga0495582_0000462 | 3300046473 | Bacteria | 22207 |
| 428 | Ga0495582_0062724 | 3300046473 | Archaea | 2053 |
| 429 | Ga0495582_0184382 | 3300046473 | Unclassified | 1190 |
| 430 | Ga0495639_0005703 | 3300046475 | Bacteria | 5355 |
| 431 | Ga0495639_0042675 | 3300046475 | Bacteria | 2047 |
| 432 | Ga0495662_0004015 | 3300046476 | Bacteria | 7414 |
| 433 | Ga0495664_0202267 | 3300046477 | Bacteria | 1203 |
| 434 | Ga0495664_0204437 | 3300046477 | Bacteria | 1196 |
| 435 | Ga0495594_0035267 | 3300046499 | Bacteria | 2725 |
| 436 | Ga0495594_0053503 | 3300046499 | Bacteria | 2224 |
| 437 | Ga0495594_0150479 | 3300046499 | Archaea | 1321 |
| 438 | Ga0495596_0084159 | 3300046500 | Bacteria | 1235 |
| 439 | Ga0495608_0039817 | 3300046511 | Bacteria | 3149 |
| 440 | Ga0495608_0158081 | 3300046511 | Bacteria | 1442 |
| 441 | Ga0495628_0084657 | 3300046516 | Bacteria | 2460 |
| 442 | Ga0495628_0217698 | 3300046516 | Archaea | 1435 |
| 443 | Ga0495630_0054489 | 3300046517 | Bacteria | 2996 |
| 444 | Ga0495630_0057723 | 3300046517 | Bacteria | 2909 |
| 445 | Ga0495663_0040333 | 3300046525 | Archaea | 1417 |
| 446 | Ga0495666_0017424 | 3300046526 | Bacteria | 3578 |
| 447 | Ga0495652_0085313 | 3300046529 | Bacteria | 2595 |
| 448 | Ga0495665_0003126 | 3300046531 | Bacteria | 8953 |
| 449 | Ga0495640_0004048 | 3300046533 | Bacteria | 11731 |
| 450 | Ga0495640_0152438 | 3300046533 | Bacteria | 1484 |
| 451 | Ga0495609_0114212 | 3300046538 | Archaea | 1164 |
| 452 | Ga0495645_0085532 | 3300046543 | Bacteria | 2257 |
| 453 | Ga0495667_0017056 | 3300046559 | Bacteria | 4904 |
| 454 | Ga0495667_0040061 | 3300046559 | Bacteria | 3112 |
| 455 | Ga0495656_0160861 | 3300046615 | Bacteria | 1091 |
| 456 | Ga0495668_0131518 | 3300046616 | Unclassified | 1370 |
| 457 | Ga0495668_0249142 | 3300046616 | Archaea | 973 |
| 458 | Ga0495634_0030484 | 3300046642 | Bacteria | 3724 |
| 459 | Ga0495634_0085694 | 3300046642 | Bacteria | 2053 |
| 460 | Ga0495634_0098162 | 3300046642 | Bacteria | 1895 |
| 461 | Ga0495635_0023025 | 3300046663 | Bacteria | 4342 |
| 462 | Ga0495635_0031947 | 3300046663 | Bacteria | 3653 |
| 463 | Ga0495659_0030922 | 3300046664 | Archaea | 1865 |
| 464 | Ga0495588_0164601 | 3300046674 | Bacteria | 1173 |
| 465 | Ga0495646_0030015 | 3300046680 | Bacteria | 3396 |
| 466 | Ga0495646_0067604 | 3300046680 | Bacteria | 2112 |
| 467 | Ga0495647_0009375 | 3300046681 | Bacteria | 3315 |
| 468 | Ga0495647_0028537 | 3300046681 | Bacteria | 2058 |
| 469 | Ga0495658_0001666 | 3300046683 | Bacteria | 11556 |
| 470 | Ga0495613_0026261 | 3300046689 | Bacteria | 4339 |
| 471 | Ga0495624_0099534 | 3300046690 | Bacteria | 1790 |
| 472 | Ga0495589_0027915 | 3300046794 | Bacteria | 2853 |
| 473 | Ga0495600_0035044 | 3300046809 | Bacteria | 3259 |
| 474 | Ga0495600_0172318 | 3300046809 | Bacteria | 1397 |
| 475 | Ga0495660_0069317 | 3300046810 | Bacteria | 1875 |
| 476 | Ga0495581_0002858 | 3300047315 | Bacteria | 9862 |
| 477 | Ga0495581_0019449 | 3300047315 | Bacteria | 3941 |
| 478 | Ga0495604_0040214 | 3300047317 | Bacteria | 3672 |
| 479 | Ga0495604_0055131 | 3300047317 | Bacteria | 3065 |
| 480 | Ga0495604_0232939 | 3300047317 | Bacteria | 1262 |
| 481 | Ga0495636_0056551 | 3300047318 | Archaea | 1652 |
| 482 | Ga0495674_0005229 | 3300047319 | Bacteria | 12460 |
| 483 | Ga0495674_0039532 | 3300047319 | Bacteria | 4227 |
| 484 | Ga0495676_0005860 | 3300047321 | Bacteria | 11279 |
| 485 | Ga0495676_0217889 | 3300047321 | Unclassified | 1317 |
| 486 | Ga0495680_0002784 | 3300047322 | Bacteria | 17622 |
| 487 | Ga0495680_0011900 | 3300047322 | Bacteria | 7678 |
| 488 | Ga0495680_0029654 | 3300047322 | Unclassified | 4478 |
| 489 | Ga0495680_0050977 | 3300047322 | Bacteria | 3234 |
| 490 | Ga0495675_0046591 | 3300047444 | Bacteria | 2760 |
| 491 | Ga0495685_067833 | 3300047447 | Unclassified | 1198 |
| 492 | Ga0495684_0045963 | 3300047471 | Bacteria | 3340 |
| 493 | Ga0495684_0135463 | 3300047471 | Bacteria | 1848 |
| 494 | Ga0495593_0001385 | 3300047673 | Bacteria | 14192 |
| 495 | Ga0495615_0048202 | 3300048090 | Unclassified | 1088 |
| 496 | Ga0496100_0033934 | 3300048903 | Bacteria | 3197 |
| 497 | Ga0496100_0041176 | 3300048903 | Bacteria | 2943 |
| 498 | Ga0496100_0078972 | 3300048903 | Bacteria | 2216 |
| 499 | Ga0496100_0151297 | 3300048903 | Bacteria | 1655 |
| 500 | Ga0496101_0002328 | 3300048904 | Bacteria | 11634 |
| 501 | Ga0496101_0017765 | 3300048904 | Bacteria | 4826 |
| 502 | Ga0496101_0039255 | 3300048904 | Bacteria | 3366 |
| 503 | Ga0496101_0068435 | 3300048904 | Bacteria | 2596 |
| 504 | Ga0496101_0072977 | 3300048904 | Unclassified | 2520 |
| 505 | Ga0496101_0112423 | 3300048904 | Bacteria | 2051 |
| 506 | Ga0496101_0131225 | 3300048904 | Unclassified | 1903 |
| 507 | Ga0496102_0005233 | 3300048905 | Bacteria | 11011 |
| 508 | Ga0496102_0015201 | 3300048905 | Bacteria | 6700 |
| 509 | Ga0496102_0029468 | 3300048905 | Bacteria | 4911 |
| 510 | Ga0496102_0123284 | 3300048905 | Bacteria | 2421 |
| 511 | Ga0496102_0331247 | 3300048905 | Bacteria | 1434 |
| 512 | Ga0496103_0012557 | 3300048906 | Bacteria | 5023 |
| 513 | Ga0496103_0012733 | 3300048906 | Bacteria | 4989 |
| 514 | Ga0496103_0030047 | 3300048906 | Bacteria | 3305 |
| 515 | Ga0496103_0074997 | 3300048906 | Bacteria | 2121 |
| 516 | Ga0496103_0284131 | 3300048906 | Archaea | 1064 |
| 517 | Ga0496104_0011721 | 3300048907 | Bacteria | 7864 |
| 518 | Ga0496104_0071352 | 3300048907 | Bacteria | 3302 |
| 519 | Ga0496104_0112972 | 3300048907 | Bacteria | 2605 |
| 520 | Ga0496104_0179912 | 3300048907 | Unclassified | 2025 |
| 521 | Ga0496104_0224622 | 3300048907 | Bacteria | 1790 |
| 522 | Ga0496104_0241826 | 3300048907 | Bacteria | 1717 |
| 523 | Ga0496104_0346175 | 3300048907 | Bacteria | 1399 |
| 524 | Ga0496105_0012905 | 3300048908 | Bacteria | 6622 |
| 525 | Ga0496105_0039714 | 3300048908 | Bacteria | 3880 |
| 526 | Ga0496105_0042911 | 3300048908 | Bacteria | 3730 |
| 527 | Ga0496105_0249752 | 3300048908 | Bacteria | 1437 |
| 528 | Ga0496106_0006885 | 3300048909 | Bacteria | 8410 |
| 529 | Ga0496106_0026307 | 3300048909 | Bacteria | 4332 |
| 530 | Ga0496107_0022718 | 3300048910 | Bacteria | 4434 |
| 531 | Ga0496107_0045062 | 3300048910 | Bacteria | 3172 |
| 532 | Ga0496107_0157642 | 3300048910 | Archaea | 1681 |
| 533 | Ga0496107_0173949 | 3300048910 | Bacteria | 1598 |
| 534 | Ga0496107_0184352 | 3300048910 | Unclassified | 1550 |
| 535 | Ga0496107_0209630 | 3300048910 | Bacteria | 1449 |
| 536 | Ga0496108_0001049 | 3300048911 | Bacteria | 21529 |
| 537 | Ga0496108_0004163 | 3300048911 | Bacteria | 11639 |
| 538 | Ga0496108_0033737 | 3300048911 | Bacteria | 4251 |
| 539 | Ga0496108_0195096 | 3300048911 | Bacteria | 1756 |
| 540 | Ga0496108_0245195 | 3300048911 | Bacteria | 1558 |
| 541 | Ga0496108_0252242 | 3300048911 | Bacteria | 1535 |
| 542 | Ga0496108_0360308 | 3300048911 | Bacteria | 1269 |
| 543 | Ga0496109_0001264 | 3300048912 | Bacteria | 21000 |
| 544 | Ga0496109_0003075 | 3300048912 | Bacteria | 13918 |
| 545 | Ga0496109_0063003 | 3300048912 | Bacteria | 3391 |
| 546 | Ga0496109_0068855 | 3300048912 | Bacteria | 3244 |
| 547 | Ga0496109_0172682 | 3300048912 | Archaea | 2028 |
| 548 | Ga0496109_0201981 | 3300048912 | Unclassified | 1869 |
| 549 | Ga0496109_0591421 | 3300048912 | Bacteria | 1046 |
| 550 | Ga0496110_0002510 | 3300048913 | Bacteria | 13781 |
| 551 | Ga0496110_0049426 | 3300048913 | Bacteria | 3689 |
| 552 | Ga0496110_0058394 | 3300048913 | Bacteria | 3398 |
| 553 | Ga0496111_0001623 | 3300048914 | Bacteria | 13021 |
| 554 | Ga0496111_0020552 | 3300048914 | Bacteria | 4597 |
| 555 | Ga0496111_0035925 | 3300048914 | Bacteria | 3543 |
| 556 | Ga0496111_0055939 | 3300048914 | Bacteria | 2854 |
| 557 | Ga0496111_0061099 | 3300048914 | Bacteria | 2732 |
| 558 | Ga0496112_0001992 | 3300048915 | Bacteria | 16159 |
| 559 | Ga0496112_0022811 | 3300048915 | Bacteria | 5973 |
| 560 | Ga0496112_0324990 | 3300048915 | Unclassified | 1482 |
| 561 | Ga0496113_0012195 | 3300048916 | Bacteria | 5769 |
| 562 | Ga0496113_0036216 | 3300048916 | Bacteria | 3614 |
| 563 | Ga0496113_0083201 | 3300048916 | Bacteria | 2455 |
| 564 | Ga0496113_0491293 | 3300048916 | Bacteria | 986 |
| 565 | Ga0496114_0001590 | 3300048917 | Bacteria | 17228 |
| 566 | Ga0496114_0014614 | 3300048917 | Bacteria | 6307 |
| 567 | Ga0496114_0017636 | 3300048917 | Bacteria | 5765 |
| 568 | Ga0496114_0040087 | 3300048917 | Bacteria | 3876 |
| 569 | Ga0496114_0057517 | 3300048917 | Bacteria | 3246 |
| 570 | Ga0496114_0106978 | 3300048917 | Bacteria | 2393 |
| 571 | Ga0496114_0176422 | 3300048917 | Unclassified | 1865 |
| 572 | Ga0496114_0470532 | 3300048917 | Archaea | 1112 |
| 573 | Ga0496115_0005423 | 3300048918 | Bacteria | 9276 |
| 574 | Ga0496115_0015045 | 3300048918 | Bacteria | 5864 |
| 575 | Ga0496115_0026933 | 3300048918 | Bacteria | 4493 |
| 576 | Ga0496115_0118509 | 3300048918 | Bacteria | 2177 |
| 577 | Ga0496115_0264178 | 3300048918 | Archaea | 1415 |
| 578 | Ga0501031_0025535 | 3300049568 | Bacteria | 3852 |
| 579 | Ga0501031_0025779 | 3300049568 | Bacteria | 3836 |
| 580 | Ga0501031_0153847 | 3300049568 | Bacteria | 1503 |
| 581 | Ga0501032_0036340 | 3300049569 | Bacteria | 3362 |
| 582 | Ga0501033_0015832 | 3300049570 | Bacteria | 5714 |
| 583 | Ga0501036_0011392 | 3300049572 | Bacteria | 7360 |
| 584 | Ga0501036_0018025 | 3300049572 | Bacteria | 5911 |
| 585 | Ga0501036_0028189 | 3300049572 | Bacteria | 4748 |
| 586 | Ga0501036_0044029 | 3300049572 | Bacteria | 3780 |
| 587 | Ga0501036_0099281 | 3300049572 | Bacteria | 2462 |
| 588 | Ga0501037_0024173 | 3300049573 | Bacteria | 4493 |
| 589 | Ga0501037_0028075 | 3300049573 | Bacteria | 4156 |
| 590 | Ga0501038_0067656 | 3300049574 | Bacteria | 3038 |
| 591 | Ga0501038_0103741 | 3300049574 | Bacteria | 2364 |
| 592 | Ga0501038_0316630 | 3300049574 | Bacteria | 1221 |
| 593 | Ga0501039_0010512 | 3300049575 | Bacteria | 7054 |
| 594 | Ga0501039_0069176 | 3300049575 | Bacteria | 2741 |
| 595 | Ga0501039_0087762 | 3300049575 | Unclassified | 2423 |
| 596 | Ga0501040_0011602 | 3300049576 | Bacteria | 5768 |
| 597 | Ga0501040_0015469 | 3300049576 | Bacteria | 5041 |
| 598 | Ga0501040_0059725 | 3300049576 | Bacteria | 2620 |
| 599 | Ga0501040_0072220 | 3300049576 | Bacteria | 2383 |
| 600 | Ga0501040_0131593 | 3300049576 | Unclassified | 1759 |
| 601 | Ga0501041_0006586 | 3300049577 | Bacteria | 6802 |
| 602 | Ga0501041_0014412 | 3300049577 | Unclassified | 4694 |
| 603 | Ga0501041_0036026 | 3300049577 | Bacteria | 2999 |
| 604 | Ga0501041_0036418 | 3300049577 | Bacteria | 2981 |
| 605 | Ga0501042_0021476 | 3300049578 | Bacteria | 4500 |
| 606 | Ga0501042_0032225 | 3300049578 | Bacteria | 3710 |
| 607 | Ga0501042_0151374 | 3300049578 | Bacteria | 1673 |
| 608 | Ga0501042_0343288 | 3300049578 | Bacteria | 1079 |
| 609 | Ga0501043_0023412 | 3300049579 | Bacteria | 4844 |
| 610 | Ga0501043_0070958 | 3300049579 | Bacteria | 2736 |
| 611 | Ga0501046_0021953 | 3300049580 | Bacteria | 5261 |
| 612 | Ga0501046_0037142 | 3300049580 | Bacteria | 3915 |
| 613 | Ga0501046_0114390 | 3300049580 | Unclassified | 2058 |
| 614 | Ga0501046_0125177 | 3300049580 | Bacteria | 1953 |
| 615 | Ga0501047_0042263 | 3300049581 | Bacteria | 4405 |
| 616 | Ga0501047_0195124 | 3300049581 | Unclassified | 1887 |
| 617 | Ga0501048_0006842 | 3300049582 | Bacteria | 8662 |
| 618 | Ga0501048_0075034 | 3300049582 | Bacteria | 2385 |
| 619 | Ga0501048_0145510 | 3300049582 | Bacteria | 1676 |
| 620 | Ga0501048_0244283 | 3300049582 | Unclassified | 1274 |
| 621 | Ga0501067_0099830 | 3300049583 | Bacteria | 1612 |
| 622 | Ga0501068_0017671 | 3300049584 | Bacteria | 4126 |
| 623 | Ga0501068_0064524 | 3300049584 | Bacteria | 2229 |
| 624 | Ga0501068_0178460 | 3300049584 | Unclassified | 1342 |
| 625 | Ga0501068_0295758 | 3300049584 | Archaea | 1036 |
| 626 | Ga0501069_0003998 | 3300049585 | Bacteria | 7612 |
| 627 | Ga0501069_0009267 | 3300049585 | Bacteria | 5195 |
| 628 | Ga0501069_0048048 | 3300049585 | Unclassified | 2369 |
| 629 | Ga0501069_0191228 | 3300049585 | Unclassified | 1184 |
| 630 | Ga0501070_0000463 | 3300049586 | Bacteria | 36856 |
| 631 | Ga0501070_0008965 | 3300049586 | Bacteria | 8461 |
| 632 | Ga0501070_0037460 | 3300049586 | Bacteria | 4049 |
| 633 | Ga0501070_0220077 | 3300049586 | Bacteria | 1557 |
| 634 | Ga0501070_0279859 | 3300049586 | Unclassified | 1361 |
| 635 | Ga0501071_0001633 | 3300049587 | Bacteria | 13170 |
| 636 | Ga0501071_0005316 | 3300049587 | Bacteria | 8262 |
| 637 | Ga0501071_0010776 | 3300049587 | Bacteria | 6131 |
| 638 | Ga0501071_0015215 | 3300049587 | Bacteria | 5278 |
| 639 | Ga0501071_0218536 | 3300049587 | Bacteria | 1434 |
| 640 | Ga0501071_0326288 | 3300049587 | Bacteria | 1166 |
| 641 | Ga0501072_0004430 | 3300049588 | Bacteria | 10672 |
| 642 | Ga0501072_0012942 | 3300049588 | Bacteria | 6382 |
| 643 | Ga0501072_0025240 | 3300049588 | Bacteria | 4629 |
| 644 | Ga0501072_0064725 | 3300049588 | Bacteria | 2883 |
| 645 | Ga0501072_0084774 | 3300049588 | Bacteria | 2512 |
| 646 | Ga0501072_0102940 | 3300049588 | Bacteria | 2269 |
| 647 | Ga0501072_0110372 | 3300049588 | Bacteria | 2189 |
| 648 | Ga0501073_0023917 | 3300049589 | Bacteria | 4386 |
| 649 | Ga0501074_0266465 | 3300049590 | Bacteria | 1217 |
| 650 | Ga0501075_0013771 | 3300049591 | Bacteria | 5780 |
| 651 | Ga0501075_0042726 | 3300049591 | Unclassified | 3399 |
| 652 | Ga0501075_0064604 | 3300049591 | Bacteria | 2760 |
| 653 | Ga0501075_0139400 | 3300049591 | Bacteria | 1848 |
| 654 | Ga0501075_0290930 | 3300049591 | Bacteria | 1244 |
| 655 | Ga0501075_0305132 | 3300049591 | Unclassified | 1213 |
| 656 | Ga0501076_0001355 | 3300049592 | Bacteria | 16389 |
| 657 | Ga0501076_0006095 | 3300049592 | Bacteria | 8721 |
| 658 | Ga0501076_0030833 | 3300049592 | Bacteria | 4178 |
| 659 | Ga0501076_0056359 | 3300049592 | Bacteria | 3119 |
| 660 | Ga0501076_0057549 | 3300049592 | Bacteria | 3087 |
| 661 | Ga0501076_0091582 | 3300049592 | Bacteria | 2445 |
| 662 | Ga0501076_0174261 | 3300049592 | Unclassified | 1753 |
| 663 | Ga0501076_0225087 | 3300049592 | Unclassified | 1533 |
| 664 | Ga0501076_0358816 | 3300049592 | Bacteria | 1197 |
| 665 | Ga0501077_0002034 | 3300049593 | Bacteria | 12210 |
| 666 | Ga0501077_0008596 | 3300049593 | Bacteria | 6331 |
| 667 | Ga0501077_0013622 | 3300049593 | Bacteria | 5098 |
| 668 | Ga0501079_0010820 | 3300049741 | Bacteria | 6949 |
| 669 | Ga0501079_0052703 | 3300049741 | Bacteria | 3139 |
| 670 | Ga0501079_0299023 | 3300049741 | Unclassified | 1259 |
| 671 | Ga0501080_0064086 | 3300049742 | Bacteria | 3419 |
| 672 | Ga0501080_0421310 | 3300049742 | Bacteria | 1199 |
| 673 | Ga0501081_0002437 | 3300049743 | Bacteria | 11743 |
| 674 | Ga0501081_0008222 | 3300049743 | Bacteria | 6774 |
| 675 | Ga0501081_0031038 | 3300049743 | Bacteria | 3620 |
| 676 | Ga0501081_0031067 | 3300049743 | Bacteria | 3618 |
| 677 | Ga0501081_0088525 | 3300049743 | Bacteria | 2175 |
| 678 | Ga0501081_0124829 | 3300049743 | Unclassified | 1836 |
| 679 | Ga0501081_0212005 | 3300049743 | Unclassified | 1407 |
| 680 | Ga0501081_0511919 | 3300049743 | Bacteria | 895 |
| 681 | Ga0501083_0024272 | 3300049744 | Bacteria | 4202 |
| 682 | Ga0501083_0062537 | 3300049744 | Bacteria | 2483 |
| 683 | Ga0501035_0050738 | 3300049822 | Bacteria | 3717 |
| 684 | Ga0501035_0080211 | 3300049822 | Bacteria | 2882 |
| 685 | Ga0501035_0081993 | 3300049822 | Bacteria | 2846 |
| 686 | Ga0501035_0245121 | 3300049822 | Unclassified | 1523 |
| 687 | Ga0501044_0068923 | 3300049823 | Bacteria | 3602 |
| 688 | Ga0501045_0015818 | 3300049824 | Bacteria | 5351 |
| 689 | Ga0501045_0036450 | 3300049824 | Bacteria | 3570 |
| 690 | Ga0501045_0057120 | 3300049824 | Bacteria | 2855 |
| 691 | Ga0501045_0067561 | 3300049824 | Bacteria | 2625 |
| 692 | Ga0501045_0076612 | 3300049824 | Bacteria | 2464 |
| 693 | Ga0501045_0363440 | 3300049824 | Bacteria | 1077 |
| 694 | nmdc:mga00v17_111869_c1 | 3300050491 | Bacteria | 1733 |
| 695 | nmdc:mga00v17_266165_c1 | 3300050491 | Bacteria | 1112 |
| 696 | nmdc:mga0yw44_237102_c1 | 3300050492 | Bacteria | 1212 |
| 697 | nmdc:mga05p37_31823_c1 | 3300050507 | Bacteria | 6447 |
| 698 | nmdc:mga05p37_74528_c1 | 3300050507 | Bacteria | 4177 |
| 699 | nmdc:mga09592_83896_c1 | 3300050508 | Bacteria | 2716 |
| 700 | nmdc:mga06r32_59447_c1 | 3300050510 | Bacteria | 1918 |
| 701 | nmdc:mga08y16_39199_c1 | 3300050511 | Bacteria | 4971 |
| 702 | nmdc:mga08y16_466235_c1 | 3300050511 | Bacteria | 1287 |
| 703 | nmdc:mga08y16_48388_c1 | 3300050511 | Bacteria | 4450 |
| 704 | nmdc:mga08y16_7836_c1 | 3300050511 | Bacteria | 11188 |
| 705 | nmdc:mga0n895_11353_c1 | 3300050512 | Bacteria | 7941 |
| 706 | nmdc:mga0rr50_93717_c1 | 3300050513 | Bacteria | 2344 |
| 707 | nmdc:mga08x19_39226_c1 | 3300050514 | Bacteria | 3011 |
| 708 | nmdc:mga0a205_150221_c1 | 3300050515 | Bacteria | 2229 |
| 709 | nmdc:mga0a205_1575_c1 | 3300050515 | Bacteria | 19553 |
| 710 | nmdc:mga0a205_476264_c1 | 3300050515 | Bacteria | 1107 |
| 711 | nmdc:mga0a205_508747_c1 | 3300050515 | Archaea | 1061 |
| 712 | Ga0495601_0028198 | 3300053077 | Unclassified | 3476 |
| 713 | Ga0495601_0077001 | 3300053077 | Bacteria | 2136 |
| 714 | Ga0495601_0239896 | 3300053077 | Unclassified | 1183 |
| 715 | Ga0495612_0060746 | 3300053078 | Unclassified | 1565 |
| 716 | Ga0495595_0024189 | 3300053084 | Bacteria | 2681 |
| 717 | Ga0495595_0111689 | 3300053084 | Unclassified | 1326 |
| 718 | Ga0495595_0163120 | 3300053084 | Bacteria | 1100 |
| 719 | Ga0495619_0011828 | 3300053085 | Bacteria | 5497 |
| 720 | Ga0495619_0035078 | 3300053085 | Bacteria | 3262 |
| 721 | Ga0495619_0098853 | 3300053085 | Bacteria | 1984 |
| 722 | Ga0495619_0260536 | 3300053085 | Bacteria | 1202 |
| 723 | Ga0501084_0011040 | 3300054114 | Bacteria | 7481 |
| 724 | Ga0501084_0027535 | 3300054114 | Bacteria | 4749 |
| 725 | Ga0501084_0027824 | 3300054114 | Bacteria | 4724 |
| 726 | Ga0501084_0045971 | 3300054114 | Bacteria | 3655 |
| 727 | Ga0501084_0052117 | 3300054114 | Bacteria | 3424 |
| 728 | Ga0501084_0063873 | 3300054114 | Bacteria | 3082 |
| 729 | Ga0590077_029614 | 3300059426 | Bacteria | 1191 |
| 730 | Ga0501082_0015504 | 3300060353 | Bacteria | 6560 |
| 731 | Ga0501082_0038247 | 3300060353 | Bacteria | 4139 |
| 732 | Ga0501082_0065787 | 3300060353 | Bacteria | 3121 |
| 733 | Ga0501082_0147240 | 3300060353 | Bacteria | 2044 |
| 734 | Ga0501082_0210054 | 3300060353 | Bacteria | 1693 |
| 735 | Ga0501082_0250663 | 3300060353 | Bacteria | 1541 |
| 736 | Ga0501082_0718787 | 3300060353 | Unclassified | 874 |
| 737 | Ga0530510_0056624 | 3300061734 | Bacteria | 2832 |
| 738 | Ga0530510_0057140 | 3300061734 | Bacteria | 2819 |
| 739 | Ga0530510_0065972 | 3300061734 | Unclassified | 2623 |
| 740 | Ga0530510_0297989 | 3300061734 | Unclassified | 1206 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0080211 | Ga0501035_0080211_31_765 | 244 |
| 2 | 3300005616 | Ga0068852_100084050 | Ga0068852_1000840502 | 259 |
| 3 | 3300006058 | Ga0075432_10008665 | Ga0075432_100086653 | 259 |
| 4 | 3300006844 | Ga0075428_100000942 | Ga0075428_1000009424 | 259 |
| 5 | 3300009094 | Ga0111539_10780055 | Ga0111539_107800551 | 259 |
| 6 | 3300026142 | Ga0207698_10230143 | Ga0207698_102301432 | 259 |
| 7 | 3300027907 | Ga0207428_10000222 | Ga0207428_1000022284 | 259 |
| 8 | 3300035242 | Ga0373962_0008415 | Ga0373962_0008415_1737_2516 | 259 |
| 9 | 3300041486 | Ga0451807_1862518 | Ga0451807_1862518_231_1010 | 259 |
| 10 | 3300042439 | Ga0439464_0069137 | Ga0439464_0069137_246_1025 | 259 |
| 11 | 3300045976 | Ga0466967_0006293 | Ga0466967_0006293_7581_8360 | 259 |
| 12 | 3300046455 | Ga0495603_0307403 | Ga0495603_0307403_14_793 | 259 |
| 13 | 3300049743 | Ga0501081_0511919 | Ga0501081_0511919_11_790 | 259 |
| 14 | 3300005564 | Ga0070664_100397718 | Ga0070664_1003977182 | 262 |
| 15 | 3300005577 | Ga0068857_100207853 | Ga0068857_1002078532 | 262 |
| 16 | 3300025945 | Ga0207679_10318358 | Ga0207679_103183582 | 262 |
| 17 | 3300048911 | Ga0496108_0360308 | Ga0496108_0360308_187_1065 | 262 |
| 18 | 3300048912 | Ga0496109_0591421 | Ga0496109_0591421_30_908 | 262 |
| 19 | 3300048916 | Ga0496113_0491293 | Ga0496113_0491293_90_968 | 262 |
| 20 | 3300050492 | nmdc:mga0yw44_237102_c1 | nmdc:mga0yw44_237102_c1_222_1100 | 262 |
| 21 | 3300005937 | Ga0081455_10019638 | Ga0081455_100196384 | 263 |
| 22 | 3300025944 | Ga0207661_10083062 | Ga0207661_100830622 | 263 |
| 23 | 3300026116 | Ga0207674_10136767 | Ga0207674_101367672 | 263 |
| 24 | 3300042005 | Ga0439448_0055586 | Ga0439448_0055586_276_1154 | 263 |
| 25 | 3300037466 | Ga0395898_0383501 | Ga0395898_0383501_346_1251 | 265 |
| 26 | 3300046463 | Ga0495653_0110420 | Ga0495653_0110420_30_935 | 265 |
| 27 | 3300047317 | Ga0495604_0232939 | Ga0495604_0232939_142_1047 | 265 |
| 28 | 3300047444 | Ga0495675_0046591 | Ga0495675_0046591_1448_2353 | 265 |
| 29 | 3300049572 | Ga0501036_0028189 | Ga0501036_0028189_948_1826 | 265 |
| 30 | 3300049575 | Ga0501039_0087762 | Ga0501039_0087762_1000_1878 | 265 |
| 31 | 3300049576 | Ga0501040_0131593 | Ga0501040_0131593_179_1057 | 265 |
| 32 | 3300049580 | Ga0501046_0021953 | Ga0501046_0021953_3541_4419 | 265 |
| 33 | 3300049584 | Ga0501068_0178460 | Ga0501068_0178460_245_1123 | 265 |
| 34 | 3300049585 | Ga0501069_0191228 | Ga0501069_0191228_127_1005 | 265 |
| 35 | 3300049586 | Ga0501070_0279859 | Ga0501070_0279859_439_1317 | 265 |
| 36 | 3300049587 | Ga0501071_0005316 | Ga0501071_0005316_2177_3055 | 265 |
| 37 | 3300049588 | Ga0501072_0102940 | Ga0501072_0102940_1361_2239 | 265 |
| 38 | 3300049591 | Ga0501075_0064604 | Ga0501075_0064604_523_1401 | 265 |
| 39 | 3300049592 | Ga0501076_0056359 | Ga0501076_0056359_104_982 | 265 |
| 40 | 3300049593 | Ga0501077_0013622 | Ga0501077_0013622_1901_2779 | 265 |
| 41 | 3300049743 | Ga0501081_0031038 | Ga0501081_0031038_1514_2392 | 265 |
| 42 | 3300049822 | Ga0501035_0245121 | Ga0501035_0245121_114_992 | 265 |
| 43 | 3300049824 | Ga0501045_0057120 | Ga0501045_0057120_1457_2335 | 265 |
| 44 | 3300054114 | Ga0501084_0011040 | Ga0501084_0011040_1242_2120 | 265 |
| 45 | 3300060353 | Ga0501082_0038247 | Ga0501082_0038247_1903_2781 | 265 |
| 46 | 3300060353 | Ga0501082_0718787 | Ga0501082_0718787_56_853 | 265 |
| 47 | 3300046516 | Ga0495628_0217698 | Ga0495628_0217698_269_1174 | 266 |
| 48 | 3300046680 | Ga0495646_0067604 | Ga0495646_0067604_725_1630 | 266 |
| 49 | 3300053077 | Ga0495601_0028198 | Ga0495601_0028198_41_946 | 266 |
| 50 | 3300053078 | Ga0495612_0060746 | Ga0495612_0060746_144_1049 | 266 |
| 51 | 3300037466 | Ga0395898_0163407 | Ga0395898_0163407_986_1795 | 269 |
| 52 | 3300049578 | Ga0501042_0151374 | Ga0501042_0151374_594_1472 | 270 |
| 53 | 3300049743 | Ga0501081_0008222 | Ga0501081_0008222_102_917 | 270 |
| 54 | 3300005985 | Ga0081539_10000712 | Ga0081539_1000071250 | 281 |
| 55 | 3300049576 | Ga0501040_0059725 | Ga0501040_0059725_353_1279 | 282 |
| 56 | 3300006163 | Ga0070715_10170560 | Ga0070715_101705601 | 285 |
| 57 | 3300006175 | Ga0070712_100046450 | Ga0070712_1000464502 | 285 |
| 58 | 3300009098 | Ga0105245_10030952 | Ga0105245_100309522 | 285 |
| 59 | 3300009148 | Ga0105243_10381014 | Ga0105243_103810142 | 285 |
| 60 | 3300009148 | Ga0105243_10426742 | Ga0105243_104267422 | 285 |
| 61 | 3300013306 | Ga0163162_10166169 | Ga0163162_101661691 | 285 |
| 62 | 3300025915 | Ga0207693_10284094 | Ga0207693_102840942 | 285 |
| 63 | 3300025939 | Ga0207665_10062245 | Ga0207665_100622452 | 285 |
| 64 | 3300026075 | Ga0207708_10091870 | Ga0207708_100918703 | 285 |
| 65 | 3300048903 | Ga0496100_0033934 | Ga0496100_0033934_998_1876 | 285 |
| 66 | 3300048904 | Ga0496101_0112423 | Ga0496101_0112423_18_896 | 285 |
| 67 | 3300048905 | Ga0496102_0123284 | Ga0496102_0123284_431_1309 | 285 |
| 68 | 3300048905 | Ga0496102_0331247 | Ga0496102_0331247_235_1113 | 285 |
| 69 | 3300048906 | Ga0496103_0030047 | Ga0496103_0030047_1936_2814 | 285 |
| 70 | 3300048908 | Ga0496105_0249752 | Ga0496105_0249752_482_1360 | 285 |
| 71 | 3300048910 | Ga0496107_0045062 | Ga0496107_0045062_1317_2195 | 285 |
| 72 | 3300048911 | Ga0496108_0245195 | Ga0496108_0245195_199_1077 | 285 |
| 73 | 3300048914 | Ga0496111_0055939 | Ga0496111_0055939_339_1217 | 285 |
| 74 | 3300048916 | Ga0496113_0012195 | Ga0496113_0012195_399_1277 | 285 |
| 75 | 3300048917 | Ga0496114_0014614 | Ga0496114_0014614_683_1561 | 285 |
| 76 | 3300048918 | Ga0496115_0118509 | Ga0496115_0118509_1178_2056 | 285 |
| 77 | 3300005434 | Ga0070709_10218951 | Ga0070709_102189512 | 289 |
| 78 | 3300005578 | Ga0068854_100221324 | Ga0068854_1002213242 | 289 |
| 79 | 3300006173 | Ga0070716_100216923 | Ga0070716_1002169232 | 289 |
| 80 | 3300025906 | Ga0207699_10109794 | Ga0207699_101097942 | 289 |
| 81 | 3300031251 | Ga0265327_10007879 | Ga0265327_100078797 | 289 |
| 82 | 3300035083 | Ga0373926_0035641 | Ga0373926_0035641_47_919 | 289 |
| 83 | 3300035170 | Ga0373943_0002579 | Ga0373943_0002579_990_1862 | 289 |
| 84 | 3300035171 | Ga0373946_0014784 | Ga0373946_0014784_635_1507 | 289 |
| 85 | 3300035725 | Ga0373947_0019921 | Ga0373947_0019921_182_1054 | 289 |
| 86 | 3300037068 | Ga0373925_0075236 | Ga0373925_0075236_833_1705 | 289 |
| 87 | 3300046455 | Ga0495603_0211385 | Ga0495603_0211385_181_1053 | 289 |
| 88 | 3300046459 | Ga0495629_0001622 | Ga0495629_0001622_7937_8809 | 289 |
| 89 | 3300046459 | Ga0495629_0069147 | Ga0495629_0069147_1469_2341 | 289 |
| 90 | 3300046461 | Ga0495641_0001841 | Ga0495641_0001841_11168_12040 | 289 |
| 91 | 3300046462 | Ga0495651_0064146 | Ga0495651_0064146_1923_2795 | 289 |
| 92 | 3300046463 | Ga0495653_0011544 | Ga0495653_0011544_2307_3179 | 289 |
| 93 | 3300046463 | Ga0495653_0092426 | Ga0495653_0092426_1193_2065 | 289 |
| 94 | 3300046473 | Ga0495582_0000462 | Ga0495582_0000462_2330_3202 | 289 |
| 95 | 3300046475 | Ga0495639_0005703 | Ga0495639_0005703_48_920 | 289 |
| 96 | 3300046476 | Ga0495662_0004015 | Ga0495662_0004015_3089_3961 | 289 |
| 97 | 3300046477 | Ga0495664_0202267 | Ga0495664_0202267_26_898 | 289 |
| 98 | 3300046516 | Ga0495628_0084657 | Ga0495628_0084657_1527_2399 | 289 |
| 99 | 3300046517 | Ga0495630_0057723 | Ga0495630_0057723_151_1023 | 289 |
| 100 | 3300046526 | Ga0495666_0017424 | Ga0495666_0017424_1672_2544 | 289 |
| 101 | 3300046529 | Ga0495652_0085313 | Ga0495652_0085313_145_1017 | 289 |
| 102 | 3300046531 | Ga0495665_0003126 | Ga0495665_0003126_2567_3439 | 289 |
| 103 | 3300046533 | Ga0495640_0152438 | Ga0495640_0152438_551_1423 | 289 |
| 104 | 3300046543 | Ga0495645_0085532 | Ga0495645_0085532_507_1379 | 289 |
| 105 | 3300046559 | Ga0495667_0040061 | Ga0495667_0040061_173_1045 | 289 |
| 106 | 3300046642 | Ga0495634_0085694 | Ga0495634_0085694_1055_1927 | 289 |
| 107 | 3300046642 | Ga0495634_0098162 | Ga0495634_0098162_451_1323 | 289 |
| 108 | 3300046663 | Ga0495635_0023025 | Ga0495635_0023025_2323_3195 | 289 |
| 109 | 3300046663 | Ga0495635_0031947 | Ga0495635_0031947_827_1699 | 289 |
| 110 | 3300046680 | Ga0495646_0030015 | Ga0495646_0030015_465_1337 | 289 |
| 111 | 3300046681 | Ga0495647_0028537 | Ga0495647_0028537_938_1810 | 289 |
| 112 | 3300046683 | Ga0495658_0001666 | Ga0495658_0001666_4866_5738 | 289 |
| 113 | 3300046689 | Ga0495613_0026261 | Ga0495613_0026261_1510_2382 | 289 |
| 114 | 3300046690 | Ga0495624_0099534 | Ga0495624_0099534_791_1663 | 289 |
| 115 | 3300046809 | Ga0495600_0035044 | Ga0495600_0035044_178_1050 | 289 |
| 116 | 3300047315 | Ga0495581_0019449 | Ga0495581_0019449_2204_3076 | 289 |
| 117 | 3300047317 | Ga0495604_0040214 | Ga0495604_0040214_1577_2449 | 289 |
| 118 | 3300047319 | Ga0495674_0039532 | Ga0495674_0039532_1023_1895 | 289 |
| 119 | 3300047321 | Ga0495676_0005860 | Ga0495676_0005860_10272_11144 | 289 |
| 120 | 3300047322 | Ga0495680_0011900 | Ga0495680_0011900_4808_5680 | 289 |
| 121 | 3300047322 | Ga0495680_0050977 | Ga0495680_0050977_2148_3020 | 289 |
| 122 | 3300047471 | Ga0495684_0045963 | Ga0495684_0045963_1492_2364 | 289 |
| 123 | 3300047471 | Ga0495684_0135463 | Ga0495684_0135463_34_906 | 289 |
| 124 | 3300047673 | Ga0495593_0001385 | Ga0495593_0001385_12638_13510 | 289 |
| 125 | 3300048903 | Ga0496100_0078972 | Ga0496100_0078972_303_1175 | 289 |
| 126 | 3300048904 | Ga0496101_0039255 | Ga0496101_0039255_1513_2385 | 289 |
| 127 | 3300048904 | Ga0496101_0068435 | Ga0496101_0068435_748_1620 | 289 |
| 128 | 3300048907 | Ga0496104_0241826 | Ga0496104_0241826_542_1414 | 289 |
| 129 | 3300048910 | Ga0496107_0173949 | Ga0496107_0173949_675_1547 | 289 |
| 130 | 3300048917 | Ga0496114_0001590 | Ga0496114_0001590_1084_1956 | 289 |
| 131 | 3300048917 | Ga0496114_0017636 | Ga0496114_0017636_2156_3028 | 289 |
| 132 | 3300048917 | Ga0496114_0470532 | Ga0496114_0470532_58_930 | 289 |
| 133 | 3300048918 | Ga0496115_0005423 | Ga0496115_0005423_8045_8917 | 289 |
| 134 | 3300053077 | Ga0495601_0239896 | Ga0495601_0239896_85_957 | 289 |
| 135 | 3300053084 | Ga0495595_0024189 | Ga0495595_0024189_144_1016 | 289 |
| 136 | 3300053085 | Ga0495619_0011828 | Ga0495619_0011828_3651_4523 | 289 |
| 137 | 3300046454 | Ga0495592_0133474 | Ga0495592_0133474_403_1281 | 290 |
| 138 | 3300046809 | Ga0495600_0172318 | Ga0495600_0172318_48_920 | 290 |
| 139 | 3300049581 | Ga0501047_0042263 | Ga0501047_0042263_486_1361 | 290 |
| 140 | 3300005327 | Ga0070658_10292219 | Ga0070658_102922192 | 291 |
| 141 | 3300005329 | Ga0070683_100037548 | Ga0070683_1000375481 | 291 |
| 142 | 3300005329 | Ga0070683_100081876 | Ga0070683_1000818763 | 291 |
| 143 | 3300005339 | Ga0070660_100425589 | Ga0070660_1004255891 | 291 |
| 144 | 3300005445 | Ga0070708_100056964 | Ga0070708_1000569644 | 291 |
| 145 | 3300006237 | Ga0097621_100116997 | Ga0097621_1001169973 | 291 |
| 146 | 3300006358 | Ga0068871_100028513 | Ga0068871_1000285135 | 291 |
| 147 | 3300009093 | Ga0105240_10106750 | Ga0105240_101067504 | 291 |
| 148 | 3300013105 | Ga0157369_10031662 | Ga0157369_100316628 | 291 |
| 149 | 3300013105 | Ga0157369_10426035 | Ga0157369_104260353 | 291 |
| 150 | 3300014969 | Ga0157376_10345258 | Ga0157376_103452583 | 291 |
| 151 | 3300020082 | Ga0206353_10640569 | Ga0206353_106405692 | 291 |
| 152 | 3300022467 | Ga0224712_10076538 | Ga0224712_100765382 | 291 |
| 153 | 3300025908 | Ga0207643_10158919 | Ga0207643_101589192 | 291 |
| 154 | 3300025913 | Ga0207695_10047042 | Ga0207695_100470423 | 291 |
| 155 | 3300025919 | Ga0207657_10369038 | Ga0207657_103690382 | 291 |
| 156 | 3300025920 | Ga0207649_10298527 | Ga0207649_102985272 | 291 |
| 157 | 3300025927 | Ga0207687_10125509 | Ga0207687_101255092 | 291 |
| 158 | 3300025944 | Ga0207661_10059962 | Ga0207661_100599621 | 291 |
| 159 | 3300025949 | Ga0207667_10426227 | Ga0207667_104262272 | 291 |
| 160 | 3300025986 | Ga0207658_10004151 | Ga0207658_100041512 | 291 |
| 161 | 3300028556 | Ga0265337_1067712 | Ga0265337_10677121 | 291 |
| 162 | 3300028563 | Ga0265319_1016801 | Ga0265319_10168012 | 291 |
| 163 | 3300028577 | Ga0265318_10022513 | Ga0265318_100225133 | 291 |
| 164 | 3300028800 | Ga0265338_10132985 | Ga0265338_101329852 | 291 |
| 165 | 3300031240 | Ga0265320_10036069 | Ga0265320_100360691 | 291 |
| 166 | 3300037418 | Ga0395900_0368717 | Ga0395900_0368717_178_1056 | 291 |
| 167 | 3300037466 | Ga0395898_0231517 | Ga0395898_0231517_620_1498 | 291 |
| 168 | 3300037471 | Ga0395905_0339521 | Ga0395905_0339521_242_1120 | 291 |
| 169 | 3300037471 | Ga0395905_0484893 | Ga0395905_0484893_136_1014 | 291 |
| 170 | 3300038443 | Ga0395901_0688630 | Ga0395901_0688630_122_1000 | 291 |
| 171 | 3300044684 | Ga0466966_0100587 | Ga0466966_0100587_37_915 | 291 |
| 172 | 3300044693 | Ga0466961_0139218 | Ga0466961_0139218_139_1017 | 291 |
| 173 | 3300045976 | Ga0466967_0237480 | Ga0466967_0237480_458_1336 | 291 |
| 174 | 3300046454 | Ga0495592_0210571 | Ga0495592_0210571_191_1069 | 291 |
| 175 | 3300046461 | Ga0495641_0043195 | Ga0495641_0043195_1078_1956 | 291 |
| 176 | 3300046462 | Ga0495651_0018214 | Ga0495651_0018214_3441_4319 | 291 |
| 177 | 3300046463 | Ga0495653_0036570 | Ga0495653_0036570_1508_2386 | 291 |
| 178 | 3300046477 | Ga0495664_0204437 | Ga0495664_0204437_132_1010 | 291 |
| 179 | 3300046499 | Ga0495594_0053503 | Ga0495594_0053503_295_1173 | 291 |
| 180 | 3300046511 | Ga0495608_0039817 | Ga0495608_0039817_551_1429 | 291 |
| 181 | 3300046517 | Ga0495630_0054489 | Ga0495630_0054489_83_961 | 291 |
| 182 | 3300046533 | Ga0495640_0004048 | Ga0495640_0004048_8046_8924 | 291 |
| 183 | 3300046559 | Ga0495667_0017056 | Ga0495667_0017056_439_1317 | 291 |
| 184 | 3300046642 | Ga0495634_0030484 | Ga0495634_0030484_1842_2720 | 291 |
| 185 | 3300047317 | Ga0495604_0055131 | Ga0495604_0055131_187_1065 | 291 |
| 186 | 3300047319 | Ga0495674_0005229 | Ga0495674_0005229_5569_6447 | 291 |
| 187 | 3300047322 | Ga0495680_0002784 | Ga0495680_0002784_13616_14494 | 291 |
| 188 | 3300048904 | Ga0496101_0017765 | Ga0496101_0017765_2396_3274 | 291 |
| 189 | 3300048907 | Ga0496104_0346175 | Ga0496104_0346175_131_1009 | 291 |
| 190 | 3300048908 | Ga0496105_0012905 | Ga0496105_0012905_1339_2217 | 291 |
| 191 | 3300048912 | Ga0496109_0063003 | Ga0496109_0063003_2065_2943 | 291 |
| 192 | 3300048918 | Ga0496115_0264178 | Ga0496115_0264178_94_972 | 291 |
| 193 | 3300049572 | Ga0501036_0011392 | Ga0501036_0011392_5049_5927 | 291 |
| 194 | 3300049574 | Ga0501038_0103741 | Ga0501038_0103741_1351_2229 | 291 |
| 195 | 3300049576 | Ga0501040_0011602 | Ga0501040_0011602_2593_3471 | 291 |
| 196 | 3300049577 | Ga0501041_0014412 | Ga0501041_0014412_2919_3797 | 291 |
| 197 | 3300049580 | Ga0501046_0114390 | Ga0501046_0114390_552_1430 | 291 |
| 198 | 3300049582 | Ga0501048_0006842 | Ga0501048_0006842_5792_6670 | 291 |
| 199 | 3300049586 | Ga0501070_0000463 | Ga0501070_0000463_3474_4352 | 291 |
| 200 | 3300049587 | Ga0501071_0015215 | Ga0501071_0015215_971_1849 | 291 |
| 201 | 3300049588 | Ga0501072_0012942 | Ga0501072_0012942_3317_4195 | 291 |
| 202 | 3300049591 | Ga0501075_0042726 | Ga0501075_0042726_317_1195 | 291 |
| 203 | 3300049824 | Ga0501045_0067561 | Ga0501045_0067561_1619_2497 | 291 |
| 204 | 3300053077 | Ga0495601_0077001 | Ga0495601_0077001_214_1092 | 291 |
| 205 | 3300053084 | Ga0495595_0163120 | Ga0495595_0163120_44_922 | 291 |
| 206 | 3300053085 | Ga0495619_0035078 | Ga0495619_0035078_381_1259 | 291 |
| 207 | 3300053085 | Ga0495619_0260536 | Ga0495619_0260536_274_1164 | 291 |
| 208 | 3300054114 | Ga0501084_0045971 | Ga0501084_0045971_1074_1952 | 291 |
| 209 | 3300060353 | Ga0501082_0015504 | Ga0501082_0015504_3061_3939 | 291 |
| 210 | 3300061734 | Ga0530510_0056624 | Ga0530510_0056624_414_1292 | 291 |
| 211 | 3300001989 | JGI24739J22299_10011246 | JGI24739J22299_100112463 | 292 |
| 212 | 3300001991 | JGI24743J22301_10001489 | JGI24743J22301_100014895 | 292 |
| 213 | 3300002075 | JGI24738J21930_10004979 | JGI24738J21930_100049791 | 292 |
| 214 | 3300002075 | JGI24738J21930_10018973 | JGI24738J21930_100189733 | 292 |
| 215 | 3300002077 | JGI24744J21845_10010350 | JGI24744J21845_100103503 | 292 |
| 216 | 3300002244 | JGI24742J22300_10002099 | JGI24742J22300_100020994 | 292 |
| 217 | 3300005327 | Ga0070658_10025121 | Ga0070658_100251215 | 292 |
| 218 | 3300005327 | Ga0070658_10055976 | Ga0070658_100559763 | 292 |
| 219 | 3300005328 | Ga0070676_10150902 | Ga0070676_101509022 | 292 |
| 220 | 3300005329 | Ga0070683_100010645 | Ga0070683_1000106455 | 292 |
| 221 | 3300005329 | Ga0070683_100011274 | Ga0070683_1000112748 | 292 |
| 222 | 3300005329 | Ga0070683_100095282 | Ga0070683_1000952822 | 292 |
| 223 | 3300005329 | Ga0070683_100576225 | Ga0070683_1005762252 | 292 |
| 224 | 3300005330 | Ga0070690_100009736 | Ga0070690_1000097363 | 292 |
| 225 | 3300005331 | Ga0070670_100042356 | Ga0070670_1000423564 | 292 |
| 226 | 3300005331 | Ga0070670_100347975 | Ga0070670_1003479752 | 292 |
| 227 | 3300005334 | Ga0068869_100046017 | Ga0068869_1000460172 | 292 |
| 228 | 3300005336 | Ga0070680_100003864 | Ga0070680_10000386410 | 292 |
| 229 | 3300005336 | Ga0070680_100012290 | Ga0070680_1000122906 | 292 |
| 230 | 3300005336 | Ga0070680_100078877 | Ga0070680_1000788772 | 292 |
| 231 | 3300005337 | Ga0070682_100005389 | Ga0070682_1000053894 | 292 |
| 232 | 3300005337 | Ga0070682_100026934 | Ga0070682_1000269342 | 292 |
| 233 | 3300005337 | Ga0070682_100201417 | Ga0070682_1002014172 | 292 |
| 234 | 3300005338 | Ga0068868_100023709 | Ga0068868_1000237095 | 292 |
| 235 | 3300005338 | Ga0068868_100079462 | Ga0068868_1000794625 | 292 |
| 236 | 3300005340 | Ga0070689_100010225 | Ga0070689_1000102252 | 292 |
| 237 | 3300005340 | Ga0070689_100060852 | Ga0070689_1000608523 | 292 |
| 238 | 3300005341 | Ga0070691_10011914 | Ga0070691_100119143 | 292 |
| 239 | 3300005343 | Ga0070687_100074923 | Ga0070687_1000749231 | 292 |
| 240 | 3300005344 | Ga0070661_100008413 | Ga0070661_1000084135 | 292 |
| 241 | 3300005344 | Ga0070661_100011485 | Ga0070661_1000114858 | 292 |
| 242 | 3300005345 | Ga0070692_10014221 | Ga0070692_100142215 | 292 |
| 243 | 3300005345 | Ga0070692_10020404 | Ga0070692_100204044 | 292 |
| 244 | 3300005347 | Ga0070668_100010845 | Ga0070668_1000108452 | 292 |
| 245 | 3300005347 | Ga0070668_100088306 | Ga0070668_1000883064 | 292 |
| 246 | 3300005347 | Ga0070668_100157338 | Ga0070668_1001573382 | 292 |
| 247 | 3300005353 | Ga0070669_100116514 | Ga0070669_1001165143 | 292 |
| 248 | 3300005354 | Ga0070675_100082178 | Ga0070675_1000821782 | 292 |
| 249 | 3300005354 | Ga0070675_100125061 | Ga0070675_1001250612 | 292 |
| 250 | 3300005355 | Ga0070671_100073534 | Ga0070671_1000735346 | 292 |
| 251 | 3300005355 | Ga0070671_100087563 | Ga0070671_1000875632 | 292 |
| 252 | 3300005356 | Ga0070674_100004917 | Ga0070674_1000049175 | 292 |
| 253 | 3300005356 | Ga0070674_100048705 | Ga0070674_1000487055 | 292 |
| 254 | 3300005356 | Ga0070674_100058022 | Ga0070674_1000580224 | 292 |
| 255 | 3300005356 | Ga0070674_100065278 | Ga0070674_1000652783 | 292 |
| 256 | 3300005364 | Ga0070673_100187733 | Ga0070673_1001877331 | 292 |
| 257 | 3300005365 | Ga0070688_100017320 | Ga0070688_1000173204 | 292 |
| 258 | 3300005366 | Ga0070659_100047707 | Ga0070659_1000477073 | 292 |
| 259 | 3300005366 | Ga0070659_100090699 | Ga0070659_1000906994 | 292 |
| 260 | 3300005366 | Ga0070659_100164871 | Ga0070659_1001648712 | 292 |
| 261 | 3300005366 | Ga0070659_100168785 | Ga0070659_1001687852 | 292 |
| 262 | 3300005367 | Ga0070667_100145761 | Ga0070667_1001457612 | 292 |
| 263 | 3300005406 | Ga0070703_10005780 | Ga0070703_100057801 | 292 |
| 264 | 3300005434 | Ga0070709_10302454 | Ga0070709_103024542 | 292 |
| 265 | 3300005437 | Ga0070710_10017974 | Ga0070710_100179742 | 292 |
| 266 | 3300005438 | Ga0070701_10002028 | Ga0070701_100020282 | 292 |
| 267 | 3300005438 | Ga0070701_10173381 | Ga0070701_101733811 | 292 |
| 268 | 3300005439 | Ga0070711_100000778 | Ga0070711_10000077822 | 292 |
| 269 | 3300005439 | Ga0070711_100050323 | Ga0070711_1000503232 | 292 |
| 270 | 3300005440 | Ga0070705_100012577 | Ga0070705_1000125772 | 292 |
| 271 | 3300005441 | Ga0070700_100004283 | Ga0070700_1000042838 | 292 |
| 272 | 3300005444 | Ga0070694_100055758 | Ga0070694_1000557582 | 292 |
| 273 | 3300005455 | Ga0070663_100038450 | Ga0070663_1000384505 | 292 |
| 274 | 3300005456 | Ga0070678_100010583 | Ga0070678_1000105834 | 292 |
| 275 | 3300005456 | Ga0070678_100120725 | Ga0070678_1001207252 | 292 |
| 276 | 3300005457 | Ga0070662_100005776 | Ga0070662_1000057768 | 292 |
| 277 | 3300005457 | Ga0070662_100097469 | Ga0070662_1000974693 | 292 |
| 278 | 3300005458 | Ga0070681_10003855 | Ga0070681_1000385512 | 292 |
| 279 | 3300005458 | Ga0070681_10045244 | Ga0070681_100452446 | 292 |
| 280 | 3300005458 | Ga0070681_10087127 | Ga0070681_100871273 | 292 |
| 281 | 3300005459 | Ga0068867_100026250 | Ga0068867_1000262503 | 292 |
| 282 | 3300005459 | Ga0068867_100363868 | Ga0068867_1003638682 | 292 |
| 283 | 3300005466 | Ga0070685_10007351 | Ga0070685_100073513 | 292 |
| 284 | 3300005466 | Ga0070685_10035833 | Ga0070685_100358334 | 292 |
| 285 | 3300005468 | Ga0070707_100643592 | Ga0070707_1006435921 | 292 |
| 286 | 3300005471 | Ga0070698_100005716 | Ga0070698_10000571612 | 292 |
| 287 | 3300005518 | Ga0070699_100078153 | Ga0070699_1000781532 | 292 |
| 288 | 3300005518 | Ga0070699_100127927 | Ga0070699_1001279274 | 292 |
| 289 | 3300005530 | Ga0070679_100042942 | Ga0070679_1000429426 | 292 |
| 290 | 3300005530 | Ga0070679_100084145 | Ga0070679_1000841453 | 292 |
| 291 | 3300005535 | Ga0070684_100012808 | Ga0070684_1000128084 | 292 |
| 292 | 3300005535 | Ga0070684_100120477 | Ga0070684_1001204773 | 292 |
| 293 | 3300005535 | Ga0070684_100194283 | Ga0070684_1001942831 | 292 |
| 294 | 3300005539 | Ga0068853_100009478 | Ga0068853_1000094783 | 292 |
| 295 | 3300005539 | Ga0068853_100178013 | Ga0068853_1001780132 | 292 |
| 296 | 3300005539 | Ga0068853_100263725 | Ga0068853_1002637251 | 292 |
| 297 | 3300005543 | Ga0070672_100040145 | Ga0070672_1000401453 | 292 |
| 298 | 3300005546 | Ga0070696_100026401 | Ga0070696_1000264014 | 292 |
| 299 | 3300005547 | Ga0070693_100027437 | Ga0070693_1000274373 | 292 |
| 300 | 3300005547 | Ga0070693_100059705 | Ga0070693_1000597052 | 292 |
| 301 | 3300005547 | Ga0070693_100167509 | Ga0070693_1001675092 | 292 |
| 302 | 3300005548 | Ga0070665_100160278 | Ga0070665_1001602782 | 292 |
| 303 | 3300005549 | Ga0070704_100006800 | Ga0070704_1000068004 | 292 |
| 304 | 3300005549 | Ga0070704_100126301 | Ga0070704_1001263012 | 292 |
| 305 | 3300005563 | Ga0068855_100112091 | Ga0068855_1001120915 | 292 |
| 306 | 3300005563 | Ga0068855_100153220 | Ga0068855_1001532203 | 292 |
| 307 | 3300005564 | Ga0070664_100001655 | Ga0070664_10000165511 | 292 |
| 308 | 3300005564 | Ga0070664_100076158 | Ga0070664_1000761583 | 292 |
| 309 | 3300005564 | Ga0070664_100175449 | Ga0070664_1001754493 | 292 |
| 310 | 3300005614 | Ga0068856_100028879 | Ga0068856_1000288797 | 292 |
| 311 | 3300005614 | Ga0068856_100037505 | Ga0068856_1000375053 | 292 |
| 312 | 3300005615 | Ga0070702_100007827 | Ga0070702_1000078272 | 292 |
| 313 | 3300005615 | Ga0070702_100043566 | Ga0070702_1000435662 | 292 |
| 314 | 3300005616 | Ga0068852_100043332 | Ga0068852_1000433328 | 292 |
| 315 | 3300005616 | Ga0068852_100078184 | Ga0068852_1000781845 | 292 |
| 316 | 3300005616 | Ga0068852_100079567 | Ga0068852_1000795674 | 292 |
| 317 | 3300005616 | Ga0068852_100107007 | Ga0068852_1001070074 | 292 |
| 318 | 3300005617 | Ga0068859_100153008 | Ga0068859_1001530084 | 292 |
| 319 | 3300005618 | Ga0068864_100036679 | Ga0068864_1000366795 | 292 |
| 320 | 3300005618 | Ga0068864_100211124 | Ga0068864_1002111242 | 292 |
| 321 | 3300005719 | Ga0068861_100092806 | Ga0068861_1000928064 | 292 |
| 322 | 3300005719 | Ga0068861_100125460 | Ga0068861_1001254602 | 292 |
| 323 | 3300005719 | Ga0068861_100566068 | Ga0068861_1005660682 | 292 |
| 324 | 3300005834 | Ga0068851_10016932 | Ga0068851_100169323 | 292 |
| 325 | 3300005840 | Ga0068870_10067545 | Ga0068870_100675452 | 292 |
| 326 | 3300005841 | Ga0068863_100033487 | Ga0068863_1000334876 | 292 |
| 327 | 3300005843 | Ga0068860_100031873 | Ga0068860_1000318737 | 292 |
| 328 | 3300005843 | Ga0068860_100101724 | Ga0068860_1001017244 | 292 |
| 329 | 3300005937 | Ga0081455_10008516 | Ga0081455_1000851611 | 292 |
| 330 | 3300005937 | Ga0081455_10033510 | Ga0081455_100335103 | 292 |
| 331 | 3300005985 | Ga0081539_10136213 | Ga0081539_101362131 | 292 |
| 332 | 3300006051 | Ga0075364_10051124 | Ga0075364_100511243 | 292 |
| 333 | 3300006058 | Ga0075432_10002694 | Ga0075432_100026944 | 292 |
| 334 | 3300006058 | Ga0075432_10016054 | Ga0075432_100160543 | 292 |
| 335 | 3300006163 | Ga0070715_10072860 | Ga0070715_100728601 | 292 |
| 336 | 3300006175 | Ga0070712_100067562 | Ga0070712_1000675622 | 292 |
| 337 | 3300006175 | Ga0070712_100299083 | Ga0070712_1002990831 | 292 |
| 338 | 3300006237 | Ga0097621_100047946 | Ga0097621_1000479464 | 292 |
| 339 | 3300006237 | Ga0097621_100547817 | Ga0097621_1005478172 | 292 |
| 340 | 3300006358 | Ga0068871_100024236 | Ga0068871_1000242362 | 292 |
| 341 | 3300006358 | Ga0068871_100062935 | Ga0068871_1000629353 | 292 |
| 342 | 3300006358 | Ga0068871_100130492 | Ga0068871_1001304922 | 292 |
| 343 | 3300006847 | Ga0075431_100017672 | Ga0075431_1000176728 | 292 |
| 344 | 3300006852 | Ga0075433_10012982 | Ga0075433_100129827 | 292 |
| 345 | 3300006871 | Ga0075434_100139867 | Ga0075434_1001398673 | 292 |
| 346 | 3300006880 | Ga0075429_100006563 | Ga0075429_1000065633 | 292 |
| 347 | 3300006881 | Ga0068865_100006538 | Ga0068865_1000065382 | 292 |
| 348 | 3300006881 | Ga0068865_100014818 | Ga0068865_1000148187 | 292 |
| 349 | 3300006881 | Ga0068865_100054806 | Ga0068865_1000548064 | 292 |
| 350 | 3300006914 | Ga0075436_100045219 | Ga0075436_1000452194 | 292 |
| 351 | 3300006931 | Ga0097620_100153009 | Ga0097620_1001530094 | 292 |
| 352 | 3300007076 | Ga0075435_100010187 | Ga0075435_1000101877 | 292 |
| 353 | 3300009094 | Ga0111539_10005668 | Ga0111539_100056688 | 292 |
| 354 | 3300009094 | Ga0111539_10008986 | Ga0111539_1000898619 | 292 |
| 355 | 3300009094 | Ga0111539_10061471 | Ga0111539_100614715 | 292 |
| 356 | 3300009094 | Ga0111539_10107842 | Ga0111539_101078425 | 292 |
| 357 | 3300009098 | Ga0105245_10002722 | Ga0105245_1000272217 | 292 |
| 358 | 3300009098 | Ga0105245_10003740 | Ga0105245_1000374020 | 292 |
| 359 | 3300009098 | Ga0105245_10011716 | Ga0105245_100117168 | 292 |
| 360 | 3300009098 | Ga0105245_10086760 | Ga0105245_100867603 | 292 |
| 361 | 3300009098 | Ga0105245_10123199 | Ga0105245_101231992 | 292 |
| 362 | 3300009147 | Ga0114129_10006031 | Ga0114129_1000603123 | 292 |
| 363 | 3300009147 | Ga0114129_10006732 | Ga0114129_1000673211 | 292 |
| 364 | 3300009147 | Ga0114129_10231371 | Ga0114129_102313713 | 292 |
| 365 | 3300009148 | Ga0105243_10019092 | Ga0105243_100190925 | 292 |
| 366 | 3300009148 | Ga0105243_10022765 | Ga0105243_100227652 | 292 |
| 367 | 3300009148 | Ga0105243_10029094 | Ga0105243_100290944 | 292 |
| 368 | 3300009148 | Ga0105243_10035934 | Ga0105243_100359345 | 292 |
| 369 | 3300009176 | Ga0105242_10002896 | Ga0105242_100028963 | 292 |
| 370 | 3300009176 | Ga0105242_10025238 | Ga0105242_100252384 | 292 |
| 371 | 3300009176 | Ga0105242_10476757 | Ga0105242_104767572 | 292 |
| 372 | 3300009177 | Ga0105248_10007689 | Ga0105248_100076892 | 292 |
| 373 | 3300009177 | Ga0105248_10147107 | Ga0105248_101471075 | 292 |
| 374 | 3300009177 | Ga0105248_10147113 | Ga0105248_101471133 | 292 |
| 375 | 3300009177 | Ga0105248_10305267 | Ga0105248_103052672 | 292 |
| 376 | 3300009545 | Ga0105237_10247575 | Ga0105237_102475753 | 292 |
| 377 | 3300009551 | Ga0105238_10037087 | Ga0105238_100370875 | 292 |
| 378 | 3300009551 | Ga0105238_10375838 | Ga0105238_103758382 | 292 |
| 379 | 3300009553 | Ga0105249_10004111 | Ga0105249_100041112 | 292 |
| 380 | 3300009553 | Ga0105249_10157113 | Ga0105249_101571132 | 292 |
| 381 | 3300009553 | Ga0105249_10414713 | Ga0105249_104147132 | 292 |
| 382 | 3300010375 | Ga0105239_10004419 | Ga0105239_1000441912 | 292 |
| 383 | 3300010375 | Ga0105239_10033163 | Ga0105239_100331633 | 292 |
| 384 | 3300010375 | Ga0105239_10055548 | Ga0105239_100555485 | 292 |
| 385 | 3300011119 | Ga0105246_10005688 | Ga0105246_100056888 | 292 |
| 386 | 3300011119 | Ga0105246_10085070 | Ga0105246_100850702 | 292 |
| 387 | 3300013100 | Ga0157373_10143881 | Ga0157373_101438813 | 292 |
| 388 | 3300013102 | Ga0157371_10010321 | Ga0157371_100103218 | 292 |
| 389 | 3300013102 | Ga0157371_10117162 | Ga0157371_101171623 | 292 |
| 390 | 3300013102 | Ga0157371_10138521 | Ga0157371_101385213 | 292 |
| 391 | 3300013104 | Ga0157370_10166912 | Ga0157370_101669123 | 292 |
| 392 | 3300013105 | Ga0157369_10218605 | Ga0157369_102186053 | 292 |
| 393 | 3300013296 | Ga0157374_10006575 | Ga0157374_100065753 | 292 |
| 394 | 3300013306 | Ga0163162_10039731 | Ga0163162_100397313 | 292 |
| 395 | 3300013306 | Ga0163162_10104233 | Ga0163162_101042334 | 292 |
| 396 | 3300013306 | Ga0163162_10159702 | Ga0163162_101597022 | 292 |
| 397 | 3300013307 | Ga0157372_10006446 | Ga0157372_1000644613 | 292 |
| 398 | 3300013307 | Ga0157372_10016007 | Ga0157372_100160077 | 292 |
| 399 | 3300013307 | Ga0157372_10227194 | Ga0157372_102271941 | 292 |
| 400 | 3300013307 | Ga0157372_10384281 | Ga0157372_103842812 | 292 |
| 401 | 3300013308 | Ga0157375_10023531 | Ga0157375_100235315 | 292 |
| 402 | 3300013308 | Ga0157375_10103461 | Ga0157375_101034612 | 292 |
| 403 | 3300013308 | Ga0157375_10169654 | Ga0157375_101696542 | 292 |
| 404 | 3300013308 | Ga0157375_10449341 | Ga0157375_104493413 | 292 |
| 405 | 3300013308 | Ga0157375_10945666 | Ga0157375_109456662 | 292 |
| 406 | 3300014325 | Ga0163163_10159741 | Ga0163163_101597415 | 292 |
| 407 | 3300014325 | Ga0163163_10445551 | Ga0163163_104455512 | 292 |
| 408 | 3300014326 | Ga0157380_10037797 | Ga0157380_100377974 | 292 |
| 409 | 3300014326 | Ga0157380_10050383 | Ga0157380_100503832 | 292 |
| 410 | 3300014326 | Ga0157380_10459036 | Ga0157380_104590362 | 292 |
| 411 | 3300014745 | Ga0157377_10007022 | Ga0157377_100070226 | 292 |
| 412 | 3300014745 | Ga0157377_10013079 | Ga0157377_100130797 | 292 |
| 413 | 3300014745 | Ga0157377_10068137 | Ga0157377_100681373 | 292 |
| 414 | 3300014968 | Ga0157379_10067408 | Ga0157379_100674086 | 292 |
| 415 | 3300014969 | Ga0157376_10011146 | Ga0157376_100111466 | 292 |
| 416 | 3300014969 | Ga0157376_10034780 | Ga0157376_100347804 | 292 |
| 417 | 3300014969 | Ga0157376_10169969 | Ga0157376_101699693 | 292 |
| 418 | 3300014969 | Ga0157376_10633535 | Ga0157376_106335351 | 292 |
| 419 | 3300017792 | Ga0163161_10087346 | Ga0163161_100873462 | 292 |
| 420 | 3300017792 | Ga0163161_10218883 | Ga0163161_102188832 | 292 |
| 421 | 3300025885 | Ga0207653_10007128 | Ga0207653_100071282 | 292 |
| 422 | 3300025898 | Ga0207692_10014959 | Ga0207692_100149593 | 292 |
| 423 | 3300025899 | Ga0207642_10017208 | Ga0207642_100172082 | 292 |
| 424 | 3300025901 | Ga0207688_10018141 | Ga0207688_100181413 | 292 |
| 425 | 3300025904 | Ga0207647_10055787 | Ga0207647_100557872 | 292 |
| 426 | 3300025906 | Ga0207699_10078398 | Ga0207699_100783982 | 292 |
| 427 | 3300025907 | Ga0207645_10137393 | Ga0207645_101373932 | 292 |
| 428 | 3300025908 | Ga0207643_10015732 | Ga0207643_100157324 | 292 |
| 429 | 3300025909 | Ga0207705_10099972 | Ga0207705_100999723 | 292 |
| 430 | 3300025909 | Ga0207705_10130681 | Ga0207705_101306812 | 292 |
| 431 | 3300025911 | Ga0207654_10171124 | Ga0207654_101711242 | 292 |
| 432 | 3300025912 | Ga0207707_10020297 | Ga0207707_100202973 | 292 |
| 433 | 3300025915 | Ga0207693_10010927 | Ga0207693_100109279 | 292 |
| 434 | 3300025915 | Ga0207693_10071413 | Ga0207693_100714133 | 292 |
| 435 | 3300025915 | Ga0207693_10085853 | Ga0207693_100858531 | 292 |
| 436 | 3300025916 | Ga0207663_10026556 | Ga0207663_100265563 | 292 |
| 437 | 3300025917 | Ga0207660_10052625 | Ga0207660_100526253 | 292 |
| 438 | 3300025917 | Ga0207660_10190249 | Ga0207660_101902492 | 292 |
| 439 | 3300025918 | Ga0207662_10034397 | Ga0207662_100343973 | 292 |
| 440 | 3300025918 | Ga0207662_10117577 | Ga0207662_101175772 | 292 |
| 441 | 3300025919 | Ga0207657_10010086 | Ga0207657_100100865 | 292 |
| 442 | 3300025919 | Ga0207657_10053270 | Ga0207657_100532703 | 292 |
| 443 | 3300025919 | Ga0207657_10136263 | Ga0207657_101362632 | 292 |
| 444 | 3300025920 | Ga0207649_10047442 | Ga0207649_100474423 | 292 |
| 445 | 3300025921 | Ga0207652_10295645 | Ga0207652_102956452 | 292 |
| 446 | 3300025924 | Ga0207694_10099848 | Ga0207694_100998483 | 292 |
| 447 | 3300025926 | Ga0207659_10030066 | Ga0207659_100300663 | 292 |
| 448 | 3300025926 | Ga0207659_10286411 | Ga0207659_102864112 | 292 |
| 449 | 3300025927 | Ga0207687_10050998 | Ga0207687_100509985 | 292 |
| 450 | 3300025927 | Ga0207687_10059790 | Ga0207687_100597902 | 292 |
| 451 | 3300025927 | Ga0207687_10106637 | Ga0207687_101066373 | 292 |
| 452 | 3300025928 | Ga0207700_10170456 | Ga0207700_101704562 | 292 |
| 453 | 3300025931 | Ga0207644_10062299 | Ga0207644_100622991 | 292 |
| 454 | 3300025931 | Ga0207644_10120843 | Ga0207644_101208432 | 292 |
| 455 | 3300025932 | Ga0207690_10070781 | Ga0207690_100707812 | 292 |
| 456 | 3300025932 | Ga0207690_10099725 | Ga0207690_100997252 | 292 |
| 457 | 3300025932 | Ga0207690_10237437 | Ga0207690_102374372 | 292 |
| 458 | 3300025933 | Ga0207706_10038276 | Ga0207706_100382764 | 292 |
| 459 | 3300025933 | Ga0207706_10048645 | Ga0207706_100486455 | 292 |
| 460 | 3300025933 | Ga0207706_10145350 | Ga0207706_101453503 | 292 |
| 461 | 3300025934 | Ga0207686_10007462 | Ga0207686_100074624 | 292 |
| 462 | 3300025934 | Ga0207686_10031563 | Ga0207686_100315633 | 292 |
| 463 | 3300025934 | Ga0207686_10068351 | Ga0207686_100683515 | 292 |
| 464 | 3300025935 | Ga0207709_10004231 | Ga0207709_100042312 | 292 |
| 465 | 3300025935 | Ga0207709_10034834 | Ga0207709_100348342 | 292 |
| 466 | 3300025935 | Ga0207709_10035388 | Ga0207709_100353884 | 292 |
| 467 | 3300025936 | Ga0207670_10138682 | Ga0207670_101386823 | 292 |
| 468 | 3300025937 | Ga0207669_10014759 | Ga0207669_100147595 | 292 |
| 469 | 3300025937 | Ga0207669_10211339 | Ga0207669_102113391 | 292 |
| 470 | 3300025937 | Ga0207669_10402428 | Ga0207669_104024281 | 292 |
| 471 | 3300025938 | Ga0207704_10007862 | Ga0207704_100078624 | 292 |
| 472 | 3300025938 | Ga0207704_10078028 | Ga0207704_100780282 | 292 |
| 473 | 3300025938 | Ga0207704_10096155 | Ga0207704_100961553 | 292 |
| 474 | 3300025939 | Ga0207665_10011957 | Ga0207665_100119574 | 292 |
| 475 | 3300025940 | Ga0207691_10009495 | Ga0207691_100094959 | 292 |
| 476 | 3300025940 | Ga0207691_10019977 | Ga0207691_100199774 | 292 |
| 477 | 3300025940 | Ga0207691_10104323 | Ga0207691_101043232 | 292 |
| 478 | 3300025940 | Ga0207691_10136579 | Ga0207691_101365793 | 292 |
| 479 | 3300025940 | Ga0207691_10423099 | Ga0207691_104230992 | 292 |
| 480 | 3300025941 | Ga0207711_10052951 | Ga0207711_100529515 | 292 |
| 481 | 3300025941 | Ga0207711_10121958 | Ga0207711_101219583 | 292 |
| 482 | 3300025941 | Ga0207711_10183204 | Ga0207711_101832043 | 292 |
| 483 | 3300025942 | Ga0207689_10124158 | Ga0207689_101241582 | 292 |
| 484 | 3300025944 | Ga0207661_10000273 | Ga0207661_1000027312 | 292 |
| 485 | 3300025944 | Ga0207661_10030244 | Ga0207661_100302443 | 292 |
| 486 | 3300025945 | Ga0207679_10011244 | Ga0207679_100112443 | 292 |
| 487 | 3300025945 | Ga0207679_10082372 | Ga0207679_100823725 | 292 |
| 488 | 3300025949 | Ga0207667_10122950 | Ga0207667_101229504 | 292 |
| 489 | 3300025949 | Ga0207667_10177122 | Ga0207667_101771222 | 292 |
| 490 | 3300025960 | Ga0207651_10144877 | Ga0207651_101448773 | 292 |
| 491 | 3300025961 | Ga0207712_10005182 | Ga0207712_100051826 | 292 |
| 492 | 3300025961 | Ga0207712_10128430 | Ga0207712_101284302 | 292 |
| 493 | 3300025972 | Ga0207668_10068533 | Ga0207668_100685332 | 292 |
| 494 | 3300025972 | Ga0207668_10132156 | Ga0207668_101321561 | 292 |
| 495 | 3300025981 | Ga0207640_10005036 | Ga0207640_100050363 | 292 |
| 496 | 3300025981 | Ga0207640_10059396 | Ga0207640_100593962 | 292 |
| 497 | 3300026023 | Ga0207677_10015516 | Ga0207677_100155165 | 292 |
| 498 | 3300026023 | Ga0207677_10142865 | Ga0207677_101428653 | 292 |
| 499 | 3300026041 | Ga0207639_10041361 | Ga0207639_100413612 | 292 |
| 500 | 3300026067 | Ga0207678_10033959 | Ga0207678_100339593 | 292 |
| 501 | 3300026067 | Ga0207678_10047340 | Ga0207678_100473404 | 292 |
| 502 | 3300026075 | Ga0207708_10001826 | Ga0207708_1000182610 | 292 |
| 503 | 3300026075 | Ga0207708_10029676 | Ga0207708_100296764 | 292 |
| 504 | 3300026078 | Ga0207702_10028163 | Ga0207702_100281633 | 292 |
| 505 | 3300026088 | Ga0207641_10140396 | Ga0207641_101403963 | 292 |
| 506 | 3300026089 | Ga0207648_10000504 | Ga0207648_100005044 | 292 |
| 507 | 3300026089 | Ga0207648_10133134 | Ga0207648_101331342 | 292 |
| 508 | 3300026089 | Ga0207648_10156463 | Ga0207648_101564634 | 292 |
| 509 | 3300026089 | Ga0207648_10193423 | Ga0207648_101934232 | 292 |
| 510 | 3300026095 | Ga0207676_10184999 | Ga0207676_101849992 | 292 |
| 511 | 3300026095 | Ga0207676_10194894 | Ga0207676_101948942 | 292 |
| 512 | 3300026116 | Ga0207674_10044028 | Ga0207674_100440285 | 292 |
| 513 | 3300026118 | Ga0207675_100027437 | Ga0207675_1000274374 | 292 |
| 514 | 3300026118 | Ga0207675_100038087 | Ga0207675_1000380874 | 292 |
| 515 | 3300026118 | Ga0207675_100340004 | Ga0207675_1003400042 | 292 |
| 516 | 3300026121 | Ga0207683_10001483 | Ga0207683_1000148315 | 292 |
| 517 | 3300026121 | Ga0207683_10052152 | Ga0207683_100521525 | 292 |
| 518 | 3300026121 | Ga0207683_10072940 | Ga0207683_100729403 | 292 |
| 519 | 3300026121 | Ga0207683_10236265 | Ga0207683_102362652 | 292 |
| 520 | 3300026142 | Ga0207698_10015478 | Ga0207698_1001547810 | 292 |
| 521 | 3300026142 | Ga0207698_10104049 | Ga0207698_101040493 | 292 |
| 522 | 3300026142 | Ga0207698_10563697 | Ga0207698_105636972 | 292 |
| 523 | 3300027907 | Ga0207428_10010823 | Ga0207428_100108235 | 292 |
| 524 | 3300027907 | Ga0207428_10063181 | Ga0207428_100631813 | 292 |
| 525 | 3300028379 | Ga0268266_10210584 | Ga0268266_102105841 | 292 |
| 526 | 3300028380 | Ga0268265_10260636 | Ga0268265_102606363 | 292 |
| 527 | 3300028381 | Ga0268264_10126903 | Ga0268264_101269032 | 292 |
| 528 | 3300032002 | Ga0307416_100005871 | Ga0307416_10000587110 | 292 |
| 529 | 3300032002 | Ga0307416_100075003 | Ga0307416_1000750033 | 292 |
| 530 | 3300032126 | Ga0307415_100007073 | Ga0307415_1000070737 | 292 |
| 531 | 3300034819 | Ga0373958_0033953 | Ga0373958_0033953_91_978 | 292 |
| 532 | 3300035115 | Ga0373941_0042587 | Ga0373941_0042587_358_1245 | 292 |
| 533 | 3300035115 | Ga0373941_0055561 | Ga0373941_0055561_133_1011 | 292 |
| 534 | 3300035241 | Ga0373961_0009431 | Ga0373961_0009431_541_1428 | 292 |
| 535 | 3300035691 | Ga0373931_0033478 | Ga0373931_0033478_1307_2194 | 292 |
| 536 | 3300037418 | Ga0395900_0015005 | Ga0395900_0015005_741_1619 | 292 |
| 537 | 3300037466 | Ga0395898_0016145 | Ga0395898_0016145_5721_6599 | 292 |
| 538 | 3300037471 | Ga0395905_0177317 | Ga0395905_0177317_251_1129 | 292 |
| 539 | 3300038443 | Ga0395901_0112921 | Ga0395901_0112921_205_1083 | 292 |
| 540 | 3300038443 | Ga0395901_0244751 | Ga0395901_0244751_629_1507 | 292 |
| 541 | 3300042001 | Ga0439441_002460 | Ga0439441_002460_857_1735 | 292 |
| 542 | 3300042007 | Ga0439449_0056392 | Ga0439449_0056392_420_1319 | 292 |
| 543 | 3300042008 | Ga0439450_037602 | Ga0439450_037602_110_991 | 292 |
| 544 | 3300042015 | Ga0439462_0000831 | Ga0439462_0000831_5000_5899 | 292 |
| 545 | 3300042156 | Ga0439446_0004313 | Ga0439446_0004313_292_1173 | 292 |
| 546 | 3300046455 | Ga0495603_0018540 | Ga0495603_0018540_1035_1913 | 292 |
| 547 | 3300046455 | Ga0495603_0150082 | Ga0495603_0150082_84_1049 | 292 |
| 548 | 3300046459 | Ga0495629_0176166 | Ga0495629_0176166_382_1296 | 292 |
| 549 | 3300046461 | Ga0495641_0151683 | Ga0495641_0151683_74_982 | 292 |
| 550 | 3300046473 | Ga0495582_0062724 | Ga0495582_0062724_171_1049 | 292 |
| 551 | 3300046473 | Ga0495582_0184382 | Ga0495582_0184382_27_920 | 292 |
| 552 | 3300046475 | Ga0495639_0042675 | Ga0495639_0042675_586_1464 | 292 |
| 553 | 3300046499 | Ga0495594_0035267 | Ga0495594_0035267_573_1451 | 292 |
| 554 | 3300046499 | Ga0495594_0150479 | Ga0495594_0150479_11_889 | 292 |
| 555 | 3300046500 | Ga0495596_0084159 | Ga0495596_0084159_63_944 | 292 |
| 556 | 3300046511 | Ga0495608_0158081 | Ga0495608_0158081_139_1053 | 292 |
| 557 | 3300046525 | Ga0495663_0040333 | Ga0495663_0040333_173_1051 | 292 |
| 558 | 3300046538 | Ga0495609_0114212 | Ga0495609_0114212_58_936 | 292 |
| 559 | 3300046615 | Ga0495656_0160861 | Ga0495656_0160861_79_960 | 292 |
| 560 | 3300046616 | Ga0495668_0131518 | Ga0495668_0131518_204_1085 | 292 |
| 561 | 3300046616 | Ga0495668_0249142 | Ga0495668_0249142_73_951 | 292 |
| 562 | 3300046664 | Ga0495659_0030922 | Ga0495659_0030922_282_1160 | 292 |
| 563 | 3300046674 | Ga0495588_0164601 | Ga0495588_0164601_23_901 | 292 |
| 564 | 3300046681 | Ga0495647_0009375 | Ga0495647_0009375_782_1660 | 292 |
| 565 | 3300046794 | Ga0495589_0027915 | Ga0495589_0027915_1324_2202 | 292 |
| 566 | 3300046810 | Ga0495660_0069317 | Ga0495660_0069317_400_1278 | 292 |
| 567 | 3300047315 | Ga0495581_0002858 | Ga0495581_0002858_7600_8478 | 292 |
| 568 | 3300047318 | Ga0495636_0056551 | Ga0495636_0056551_56_934 | 292 |
| 569 | 3300047321 | Ga0495676_0217889 | Ga0495676_0217889_248_1213 | 292 |
| 570 | 3300047322 | Ga0495680_0029654 | Ga0495680_0029654_1540_2454 | 292 |
| 571 | 3300047447 | Ga0495685_067833 | Ga0495685_067833_260_1150 | 292 |
| 572 | 3300048090 | Ga0495615_0048202 | Ga0495615_0048202_95_976 | 292 |
| 573 | 3300048903 | Ga0496100_0041176 | Ga0496100_0041176_1322_2209 | 292 |
| 574 | 3300048903 | Ga0496100_0151297 | Ga0496100_0151297_393_1271 | 292 |
| 575 | 3300048904 | Ga0496101_0002328 | Ga0496101_0002328_3293_4171 | 292 |
| 576 | 3300048904 | Ga0496101_0072977 | Ga0496101_0072977_1055_1933 | 292 |
| 577 | 3300048904 | Ga0496101_0131225 | Ga0496101_0131225_165_1130 | 292 |
| 578 | 3300048905 | Ga0496102_0005233 | Ga0496102_0005233_8033_8911 | 292 |
| 579 | 3300048905 | Ga0496102_0015201 | Ga0496102_0015201_3874_4752 | 292 |
| 580 | 3300048905 | Ga0496102_0029468 | Ga0496102_0029468_3206_4084 | 292 |
| 581 | 3300048906 | Ga0496103_0012557 | Ga0496103_0012557_989_1867 | 292 |
| 582 | 3300048906 | Ga0496103_0012733 | Ga0496103_0012733_367_1245 | 292 |
| 583 | 3300048906 | Ga0496103_0074997 | Ga0496103_0074997_1189_2085 | 292 |
| 584 | 3300048906 | Ga0496103_0284131 | Ga0496103_0284131_115_1002 | 292 |
| 585 | 3300048907 | Ga0496104_0011721 | Ga0496104_0011721_4334_5212 | 292 |
| 586 | 3300048907 | Ga0496104_0071352 | Ga0496104_0071352_1027_1905 | 292 |
| 587 | 3300048907 | Ga0496104_0112972 | Ga0496104_0112972_272_1159 | 292 |
| 588 | 3300048907 | Ga0496104_0179912 | Ga0496104_0179912_106_984 | 292 |
| 589 | 3300048907 | Ga0496104_0224622 | Ga0496104_0224622_393_1271 | 292 |
| 590 | 3300048908 | Ga0496105_0039714 | Ga0496105_0039714_534_1412 | 292 |
| 591 | 3300048908 | Ga0496105_0042911 | Ga0496105_0042911_1174_2061 | 292 |
| 592 | 3300048909 | Ga0496106_0006885 | Ga0496106_0006885_2414_3292 | 292 |
| 593 | 3300048909 | Ga0496106_0026307 | Ga0496106_0026307_2622_3509 | 292 |
| 594 | 3300048910 | Ga0496107_0022718 | Ga0496107_0022718_2228_3106 | 292 |
| 595 | 3300048910 | Ga0496107_0157642 | Ga0496107_0157642_271_1149 | 292 |
| 596 | 3300048910 | Ga0496107_0184352 | Ga0496107_0184352_544_1422 | 292 |
| 597 | 3300048910 | Ga0496107_0209630 | Ga0496107_0209630_377_1255 | 292 |
| 598 | 3300048911 | Ga0496108_0001049 | Ga0496108_0001049_10508_11386 | 292 |
| 599 | 3300048911 | Ga0496108_0004163 | Ga0496108_0004163_4692_5570 | 292 |
| 600 | 3300048911 | Ga0496108_0033737 | Ga0496108_0033737_1804_2691 | 292 |
| 601 | 3300048911 | Ga0496108_0195096 | Ga0496108_0195096_661_1539 | 292 |
| 602 | 3300048911 | Ga0496108_0252242 | Ga0496108_0252242_17_895 | 292 |
| 603 | 3300048912 | Ga0496109_0001264 | Ga0496109_0001264_4287_5165 | 292 |
| 604 | 3300048912 | Ga0496109_0003075 | Ga0496109_0003075_11638_12516 | 292 |
| 605 | 3300048912 | Ga0496109_0068855 | Ga0496109_0068855_2215_3093 | 292 |
| 606 | 3300048912 | Ga0496109_0172682 | Ga0496109_0172682_545_1432 | 292 |
| 607 | 3300048912 | Ga0496109_0201981 | Ga0496109_0201981_861_1739 | 292 |
| 608 | 3300048913 | Ga0496110_0002510 | Ga0496110_0002510_4445_5323 | 292 |
| 609 | 3300048913 | Ga0496110_0049426 | Ga0496110_0049426_209_1087 | 292 |
| 610 | 3300048913 | Ga0496110_0058394 | Ga0496110_0058394_1566_2453 | 292 |
| 611 | 3300048914 | Ga0496111_0001623 | Ga0496111_0001623_1623_2501 | 292 |
| 612 | 3300048914 | Ga0496111_0020552 | Ga0496111_0020552_1870_2748 | 292 |
| 613 | 3300048914 | Ga0496111_0035925 | Ga0496111_0035925_2573_3451 | 292 |
| 614 | 3300048914 | Ga0496111_0061099 | Ga0496111_0061099_1071_1949 | 292 |
| 615 | 3300048915 | Ga0496112_0001992 | Ga0496112_0001992_9721_10599 | 292 |
| 616 | 3300048915 | Ga0496112_0022811 | Ga0496112_0022811_2951_3829 | 292 |
| 617 | 3300048915 | Ga0496112_0324990 | Ga0496112_0324990_475_1353 | 292 |
| 618 | 3300048916 | Ga0496113_0036216 | Ga0496113_0036216_1406_2284 | 292 |
| 619 | 3300048916 | Ga0496113_0083201 | Ga0496113_0083201_1399_2286 | 292 |
| 620 | 3300048917 | Ga0496114_0040087 | Ga0496114_0040087_2190_3068 | 292 |
| 621 | 3300048917 | Ga0496114_0057517 | Ga0496114_0057517_1352_2230 | 292 |
| 622 | 3300048917 | Ga0496114_0106978 | Ga0496114_0106978_26_913 | 292 |
| 623 | 3300048917 | Ga0496114_0176422 | Ga0496114_0176422_841_1719 | 292 |
| 624 | 3300048918 | Ga0496115_0015045 | Ga0496115_0015045_2021_2899 | 292 |
| 625 | 3300048918 | Ga0496115_0026933 | Ga0496115_0026933_2220_3098 | 292 |
| 626 | 3300049568 | Ga0501031_0025535 | Ga0501031_0025535_1018_1896 | 292 |
| 627 | 3300049568 | Ga0501031_0025779 | Ga0501031_0025779_1541_2419 | 292 |
| 628 | 3300049568 | Ga0501031_0153847 | Ga0501031_0153847_424_1326 | 292 |
| 629 | 3300049569 | Ga0501032_0036340 | Ga0501032_0036340_1449_2327 | 292 |
| 630 | 3300049570 | Ga0501033_0015832 | Ga0501033_0015832_2361_3239 | 292 |
| 631 | 3300049572 | Ga0501036_0018025 | Ga0501036_0018025_1290_2168 | 292 |
| 632 | 3300049572 | Ga0501036_0044029 | Ga0501036_0044029_392_1270 | 292 |
| 633 | 3300049572 | Ga0501036_0099281 | Ga0501036_0099281_493_1371 | 292 |
| 634 | 3300049573 | Ga0501037_0024173 | Ga0501037_0024173_2899_3777 | 292 |
| 635 | 3300049573 | Ga0501037_0028075 | Ga0501037_0028075_2727_3605 | 292 |
| 636 | 3300049574 | Ga0501038_0067656 | Ga0501038_0067656_565_1443 | 292 |
| 637 | 3300049574 | Ga0501038_0316630 | Ga0501038_0316630_283_1161 | 292 |
| 638 | 3300049575 | Ga0501039_0010512 | Ga0501039_0010512_121_999 | 292 |
| 639 | 3300049575 | Ga0501039_0069176 | Ga0501039_0069176_1548_2426 | 292 |
| 640 | 3300049576 | Ga0501040_0015469 | Ga0501040_0015469_1275_2153 | 292 |
| 641 | 3300049576 | Ga0501040_0072220 | Ga0501040_0072220_1376_2254 | 292 |
| 642 | 3300049577 | Ga0501041_0006586 | Ga0501041_0006586_83_961 | 292 |
| 643 | 3300049577 | Ga0501041_0036026 | Ga0501041_0036026_97_975 | 292 |
| 644 | 3300049577 | Ga0501041_0036418 | Ga0501041_0036418_349_1227 | 292 |
| 645 | 3300049578 | Ga0501042_0021476 | Ga0501042_0021476_587_1489 | 292 |
| 646 | 3300049578 | Ga0501042_0032225 | Ga0501042_0032225_1097_1975 | 292 |
| 647 | 3300049578 | Ga0501042_0343288 | Ga0501042_0343288_69_947 | 292 |
| 648 | 3300049579 | Ga0501043_0023412 | Ga0501043_0023412_1292_2170 | 292 |
| 649 | 3300049579 | Ga0501043_0070958 | Ga0501043_0070958_756_1634 | 292 |
| 650 | 3300049580 | Ga0501046_0037142 | Ga0501046_0037142_2907_3785 | 292 |
| 651 | 3300049580 | Ga0501046_0125177 | Ga0501046_0125177_586_1464 | 292 |
| 652 | 3300049581 | Ga0501047_0195124 | Ga0501047_0195124_777_1655 | 292 |
| 653 | 3300049582 | Ga0501048_0075034 | Ga0501048_0075034_1156_2034 | 292 |
| 654 | 3300049582 | Ga0501048_0145510 | Ga0501048_0145510_279_1181 | 292 |
| 655 | 3300049582 | Ga0501048_0244283 | Ga0501048_0244283_317_1198 | 292 |
| 656 | 3300049583 | Ga0501067_0099830 | Ga0501067_0099830_594_1472 | 292 |
| 657 | 3300049584 | Ga0501068_0017671 | Ga0501068_0017671_1080_1958 | 292 |
| 658 | 3300049584 | Ga0501068_0064524 | Ga0501068_0064524_132_1010 | 292 |
| 659 | 3300049584 | Ga0501068_0295758 | Ga0501068_0295758_97_975 | 292 |
| 660 | 3300049585 | Ga0501069_0003998 | Ga0501069_0003998_3150_4028 | 292 |
| 661 | 3300049585 | Ga0501069_0009267 | Ga0501069_0009267_2225_3127 | 292 |
| 662 | 3300049585 | Ga0501069_0048048 | Ga0501069_0048048_184_1062 | 292 |
| 663 | 3300049586 | Ga0501070_0008965 | Ga0501070_0008965_1482_2360 | 292 |
| 664 | 3300049586 | Ga0501070_0037460 | Ga0501070_0037460_817_1695 | 292 |
| 665 | 3300049586 | Ga0501070_0220077 | Ga0501070_0220077_39_917 | 292 |
| 666 | 3300049587 | Ga0501071_0001633 | Ga0501071_0001633_6404_7282 | 292 |
| 667 | 3300049587 | Ga0501071_0010776 | Ga0501071_0010776_1702_2580 | 292 |
| 668 | 3300049587 | Ga0501071_0218536 | Ga0501071_0218536_412_1290 | 292 |
| 669 | 3300049587 | Ga0501071_0326288 | Ga0501071_0326288_160_1038 | 292 |
| 670 | 3300049588 | Ga0501072_0004430 | Ga0501072_0004430_853_1731 | 292 |
| 671 | 3300049588 | Ga0501072_0025240 | Ga0501072_0025240_3206_4084 | 292 |
| 672 | 3300049588 | Ga0501072_0064725 | Ga0501072_0064725_130_1026 | 292 |
| 673 | 3300049588 | Ga0501072_0084774 | Ga0501072_0084774_1140_2018 | 292 |
| 674 | 3300049588 | Ga0501072_0110372 | Ga0501072_0110372_1207_2085 | 292 |
| 675 | 3300049589 | Ga0501073_0023917 | Ga0501073_0023917_1057_1935 | 292 |
| 676 | 3300049590 | Ga0501074_0266465 | Ga0501074_0266465_107_985 | 292 |
| 677 | 3300049591 | Ga0501075_0013771 | Ga0501075_0013771_1028_1906 | 292 |
| 678 | 3300049591 | Ga0501075_0139400 | Ga0501075_0139400_816_1694 | 292 |
| 679 | 3300049591 | Ga0501075_0290930 | Ga0501075_0290930_282_1160 | 292 |
| 680 | 3300049591 | Ga0501075_0305132 | Ga0501075_0305132_198_1079 | 292 |
| 681 | 3300049592 | Ga0501076_0001355 | Ga0501076_0001355_3798_4676 | 292 |
| 682 | 3300049592 | Ga0501076_0006095 | Ga0501076_0006095_5723_6601 | 292 |
| 683 | 3300049592 | Ga0501076_0030833 | Ga0501076_0030833_1647_2525 | 292 |
| 684 | 3300049592 | Ga0501076_0057549 | Ga0501076_0057549_1267_2145 | 292 |
| 685 | 3300049592 | Ga0501076_0091582 | Ga0501076_0091582_671_1549 | 292 |
| 686 | 3300049592 | Ga0501076_0174261 | Ga0501076_0174261_552_1430 | 292 |
| 687 | 3300049592 | Ga0501076_0225087 | Ga0501076_0225087_461_1342 | 292 |
| 688 | 3300049592 | Ga0501076_0358816 | Ga0501076_0358816_196_1098 | 292 |
| 689 | 3300049593 | Ga0501077_0002034 | Ga0501077_0002034_10956_11834 | 292 |
| 690 | 3300049593 | Ga0501077_0008596 | Ga0501077_0008596_1419_2297 | 292 |
| 691 | 3300049741 | Ga0501079_0010820 | Ga0501079_0010820_5976_6854 | 292 |
| 692 | 3300049741 | Ga0501079_0052703 | Ga0501079_0052703_1627_2505 | 292 |
| 693 | 3300049741 | Ga0501079_0299023 | Ga0501079_0299023_288_1166 | 292 |
| 694 | 3300049742 | Ga0501080_0064086 | Ga0501080_0064086_2379_3257 | 292 |
| 695 | 3300049742 | Ga0501080_0421310 | Ga0501080_0421310_132_1010 | 292 |
| 696 | 3300049743 | Ga0501081_0002437 | Ga0501081_0002437_10802_11680 | 292 |
| 697 | 3300049743 | Ga0501081_0031067 | Ga0501081_0031067_1581_2459 | 292 |
| 698 | 3300049743 | Ga0501081_0088525 | Ga0501081_0088525_1286_2164 | 292 |
| 699 | 3300049743 | Ga0501081_0124829 | Ga0501081_0124829_161_1039 | 292 |
| 700 | 3300049743 | Ga0501081_0212005 | Ga0501081_0212005_111_989 | 292 |
| 701 | 3300049744 | Ga0501083_0024272 | Ga0501083_0024272_1081_1959 | 292 |
| 702 | 3300049744 | Ga0501083_0062537 | Ga0501083_0062537_997_1875 | 292 |
| 703 | 3300049822 | Ga0501035_0050738 | Ga0501035_0050738_100_978 | 292 |
| 704 | 3300049822 | Ga0501035_0081993 | Ga0501035_0081993_878_1756 | 292 |
| 705 | 3300049823 | Ga0501044_0068923 | Ga0501044_0068923_1570_2448 | 292 |
| 706 | 3300049824 | Ga0501045_0015818 | Ga0501045_0015818_3665_4543 | 292 |
| 707 | 3300049824 | Ga0501045_0036450 | Ga0501045_0036450_2198_3076 | 292 |
| 708 | 3300049824 | Ga0501045_0076612 | Ga0501045_0076612_1517_2395 | 292 |
| 709 | 3300049824 | Ga0501045_0363440 | Ga0501045_0363440_70_948 | 292 |
| 710 | 3300050491 | nmdc:mga00v17_111869_c1 | nmdc:mga00v17_111869_c1_330_1208 | 292 |
| 711 | 3300050491 | nmdc:mga00v17_266165_c1 | nmdc:mga00v17_266165_c1_88_996 | 292 |
| 712 | 3300050507 | nmdc:mga05p37_31823_c1 | nmdc:mga05p37_31823_c1_4790_5668 | 292 |
| 713 | 3300050507 | nmdc:mga05p37_74528_c1 | nmdc:mga05p37_74528_c1_1352_2230 | 292 |
| 714 | 3300050508 | nmdc:mga09592_83896_c1 | nmdc:mga09592_83896_c1_1627_2505 | 292 |
| 715 | 3300050510 | nmdc:mga06r32_59447_c1 | nmdc:mga06r32_59447_c1_125_1003 | 292 |
| 716 | 3300050511 | nmdc:mga08y16_39199_c1 | nmdc:mga08y16_39199_c1_1795_2673 | 292 |
| 717 | 3300050511 | nmdc:mga08y16_466235_c1 | nmdc:mga08y16_466235_c1_75_962 | 292 |
| 718 | 3300050511 | nmdc:mga08y16_48388_c1 | nmdc:mga08y16_48388_c1_561_1439 | 292 |
| 719 | 3300050511 | nmdc:mga08y16_7836_c1 | nmdc:mga08y16_7836_c1_8582_9460 | 292 |
| 720 | 3300050512 | nmdc:mga0n895_11353_c1 | nmdc:mga0n895_11353_c1_5846_6724 | 292 |
| 721 | 3300050513 | nmdc:mga0rr50_93717_c1 | nmdc:mga0rr50_93717_c1_1082_1960 | 292 |
| 722 | 3300050514 | nmdc:mga08x19_39226_c1 | nmdc:mga08x19_39226_c1_1208_2086 | 292 |
| 723 | 3300050515 | nmdc:mga0a205_150221_c1 | nmdc:mga0a205_150221_c1_295_1191 | 292 |
| 724 | 3300050515 | nmdc:mga0a205_1575_c1 | nmdc:mga0a205_1575_c1_12702_13580 | 292 |
| 725 | 3300050515 | nmdc:mga0a205_476264_c1 | nmdc:mga0a205_476264_c1_89_967 | 292 |
| 726 | 3300050515 | nmdc:mga0a205_508747_c1 | nmdc:mga0a205_508747_c1_163_1050 | 292 |
| 727 | 3300053084 | Ga0495595_0111689 | Ga0495595_0111689_380_1261 | 292 |
| 728 | 3300053085 | Ga0495619_0098853 | Ga0495619_0098853_323_1237 | 292 |
| 729 | 3300054114 | Ga0501084_0027535 | Ga0501084_0027535_133_1011 | 292 |
| 730 | 3300054114 | Ga0501084_0027824 | Ga0501084_0027824_3681_4559 | 292 |
| 731 | 3300054114 | Ga0501084_0052117 | Ga0501084_0052117_1018_1896 | 292 |
| 732 | 3300054114 | Ga0501084_0063873 | Ga0501084_0063873_115_993 | 292 |
| 733 | 3300059426 | Ga0590077_029614 | Ga0590077_029614_151_1032 | 292 |
| 734 | 3300060353 | Ga0501082_0065787 | Ga0501082_0065787_1868_2746 | 292 |
| 735 | 3300060353 | Ga0501082_0147240 | Ga0501082_0147240_911_1789 | 292 |
| 736 | 3300060353 | Ga0501082_0210054 | Ga0501082_0210054_193_1071 | 292 |
| 737 | 3300060353 | Ga0501082_0250663 | Ga0501082_0250663_461_1339 | 292 |
| 738 | 3300061734 | Ga0530510_0057140 | Ga0530510_0057140_1269_2147 | 292 |
| 739 | 3300061734 | Ga0530510_0065972 | Ga0530510_0065972_912_1814 | 292 |
| 740 | 3300061734 | Ga0530510_0297989 | Ga0530510_0297989_258_1136 | 292 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pc1-assembly2.cif.gz_D | crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp | 0.6102 | 82 | 272 |
| 6pc0-assembly1.cif.gz_B | crystal structure of helicobacter pylori ppx/gppa | 0.6094 | 83 | 272 |
| 2pq7-assembly1.cif.gz_A-2 | crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution | 0.5728 | 25 | 202 |
| 6pc1-assembly2.cif.gz_C | crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp | 0.5614 | 64 | 272 |
| 5yim-assembly1.cif.gz_A | structure of a legionella effector | 0.5382 | 53 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58426_28_188_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9422 | 58 | 216 | 1.10.3210.10 |
| af_Q58426_28_188_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9254 | 58 | 216 | 1.10.3210.10 |
| af_F4HZF4_333_543_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5779 | 41 | 247 | 1.10.3210.10 |
| af_Q59066_3_118_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.565 | 118 | 219 | 1.10.3210.10 |
| af_Q59066_3_118_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5074 | 118 | 219 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H9NVM2-F1-model_v4 | Phosphohydrolase | 0.9751 | 34 | 179 |
GO:0016787
|
| AF-A0A2H9NVM2-F1-model_v4 | Phosphohydrolase | 0.9686 | 34 | 179 |
GO:0016787
|
| AF-A0A3D4FYF8-F1-model_v4 | Phosphohydrolase | 0.959 | 39 | 209 |
GO:0016787
|
| AF-A0A497N2Z9-F1-model_v4 | HD domain-containing protein | 0.9487 | 42 | 182 |
|
| AF-X0VKY6-F1-model_v4 | HD/PDEase domain-containing protein | 0.9482 | 34 | 272 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar