F478453

General Info

Members Datasets Scaffolds Average Seq Length
739 351 1478 142

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100640513|Ga0075428_1006405132
Length 162
Sequence MAGGLDSGGDELSEHHEINVTPFIDVMLVLLIIFMVAAPLSTVDVAVELPVSTAKPQPRPDRPVFLTIKADHTLALGNDPIAPGRLAEAIEAATKADRQQRVFLRADKSVPYGELMQVMNLLRRAGYLKVALVGLEGGDGPGEAPPTRDEPPRTEPAPAATK

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
337 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
344 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
345 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
346 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
347 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
348 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
349 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
350 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
351 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0.41
Rhizoplane 5.55
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100640513 3300006844 Bacteria 1134
2 Ga0065712_10465855 3300005290 Bacteria 674
3 Ga0070690_100178396 3300005330 Bacteria 1466
4 Ga0070690_100282369 3300005330 Bacteria 1185
5 Ga0070670_100004154 3300005331 Bacteria 12108
6 Ga0070670_100110950 3300005331 Bacteria 2363
7 Ga0070670_100118390 3300005331 Bacteria 2284
8 Ga0070677_10028823 3300005333 Bacteria 2100
9 Ga0070677_10765877 3300005333 Bacteria 549
10 Ga0070666_10068430 3300005335 Bacteria 2413
11 Ga0070680_100121873 3300005336 Bacteria 2177
12 Ga0070680_100216398 3300005336 Bacteria 1617
13 Ga0070680_100723480 3300005336 Bacteria 857
14 Ga0070682_100819420 3300005337 Bacteria 758
15 Ga0068868_100873867 3300005338 Bacteria 815
16 Ga0070689_100017828 3300005340 Bacteria 5220
17 Ga0070689_100164566 3300005340 Bacteria 1795
18 Ga0070691_10314211 3300005341 Bacteria 860
19 Ga0070661_100256152 3300005344 Bacteria 1352
20 Ga0070661_100299850 3300005344 Bacteria 1251
21 Ga0070668_100351960 3300005347 Bacteria 1247
22 Ga0070669_100271106 3300005353 Bacteria 1357
23 Ga0070675_100037042 3300005354 Bacteria 3972
24 Ga0070671_100010117 3300005355 Bacteria 7577
25 Ga0070671_100659636 3300005355 Bacteria 906
26 Ga0070671_100966183 3300005355 Bacteria 745
27 Ga0070674_100084807 3300005356 Bacteria 2272
28 Ga0070673_100003980 3300005364 Bacteria 9298
29 Ga0070673_100304029 3300005364 Bacteria 1405
30 Ga0070688_100094232 3300005365 Bacteria 1963
31 Ga0070688_100132676 3300005365 Bacteria 1683
32 Ga0070659_100911596 3300005366 Bacteria 768
33 Ga0070667_100061229 3300005367 Bacteria 3186
34 Ga0070667_100181996 3300005367 Bacteria 1859
35 Ga0070709_10103036 3300005434 Bacteria 1905
36 Ga0070709_10103623 3300005434 Bacteria 1900
37 Ga0070714_100219473 3300005435 Bacteria 1747
38 Ga0070714_100249839 3300005435 Bacteria 1639
39 Ga0070714_100558301 3300005435 Bacteria 1097
40 Ga0070714_100664716 3300005435 Bacteria 1004
41 Ga0070714_101135089 3300005435 Bacteria 762
42 Ga0070714_101528765 3300005435 Bacteria 652
43 Ga0070713_100612748 3300005436 Bacteria 1035
44 Ga0070713_102290210 3300005436 Bacteria 523
45 Ga0070701_10119350 3300005438 Bacteria 1484
46 Ga0070701_10671823 3300005438 Bacteria 694
47 Ga0070711_100081560 3300005439 Bacteria 2306
48 Ga0070711_100097473 3300005439 Bacteria 2132
49 Ga0070711_100603721 3300005439 Bacteria 916
50 Ga0070711_101408591 3300005439 Bacteria 607
51 Ga0070705_100465045 3300005440 Bacteria 952
52 Ga0070700_100552470 3300005441 Bacteria 895
53 Ga0070708_101319580 3300005445 Bacteria 674
54 Ga0070678_100030678 3300005456 Bacteria 3698
55 Ga0070678_100066809 3300005456 Bacteria 2674
56 Ga0070678_100830633 3300005456 Bacteria 841
57 Ga0070678_101231921 3300005456 Bacteria 695
58 Ga0070662_100064212 3300005457 Bacteria 2688
59 Ga0070662_100162439 3300005457 Bacteria 1748
60 Ga0070662_100277272 3300005457 Bacteria 1356
61 Ga0070681_10001866 3300005458 Bacteria 19023
62 Ga0070681_10537094 3300005458 Bacteria 1083
63 Ga0070681_11344042 3300005458 Bacteria 638
64 Ga0068867_100839015 3300005459 Bacteria 822
65 Ga0070685_10036199 3300005466 Bacteria 2789
66 Ga0070707_100394379 3300005468 Bacteria 1344
67 Ga0070699_101872161 3300005518 Bacteria 549
68 Ga0070679_100022623 3300005530 Bacteria 6145
69 Ga0070679_100198483 3300005530 Bacteria 1973
70 Ga0070679_100449101 3300005530 Bacteria 1234
71 Ga0070679_100983205 3300005530 Bacteria 788
72 Ga0070684_101463022 3300005535 Bacteria 644
73 Ga0070672_100185812 3300005543 Bacteria 1733
74 Ga0070672_100338990 3300005543 Bacteria 1280
75 Ga0070686_100074621 3300005544 Bacteria 2229
76 Ga0070696_100068052 3300005546 Bacteria 2499
77 Ga0070665_100031957 3300005548 Bacteria 5299
78 Ga0070665_100588403 3300005548 Bacteria 1126
79 Ga0070704_100036346 3300005549 Bacteria 3356
80 Ga0070664_100108938 3300005564 Bacteria 2416
81 Ga0070664_100539972 3300005564 Bacteria 1077
82 Ga0068857_100159460 3300005577 Bacteria 2046
83 Ga0068854_100032491 3300005578 Bacteria 3632
84 Ga0068854_101480961 3300005578 Bacteria 616
85 Ga0068856_100453624 3300005614 Bacteria 1303
86 Ga0068856_100605075 3300005614 Bacteria 1117
87 Ga0070702_100164111 3300005615 Bacteria 1439
88 Ga0068852_100678059 3300005616 Bacteria 1040
89 Ga0068852_102019195 3300005616 Bacteria 599
90 Ga0068864_101596240 3300005618 Bacteria 656
91 Ga0068870_10358626 3300005840 Bacteria 938
92 Ga0068863_100006027 3300005841 Bacteria 11892
93 Ga0068858_100426413 3300005842 Bacteria 1276
94 Ga0068860_102226030 3300005843 Bacteria 569
95 Ga0081455_10311237 3300005937 Bacteria 1126
96 Ga0081455_10363670 3300005937 Bacteria 1016
97 Ga0081540_1017189 3300005983 Bacteria 4486
98 Ga0081540_1030048 3300005983 Bacteria 3016
99 Ga0081540_1096363 3300005983 Bacteria 1287
100 Ga0070717_10409094 3300006028 Bacteria 1219
101 Ga0070717_10443959 3300006028 Bacteria 1169
102 Ga0075363_100674739 3300006048 Bacteria 623
103 Ga0075432_10010949 3300006058 Bacteria 3081
104 Ga0070712_100226111 3300006175 Bacteria 1484
105 Ga0070712_100483489 3300006175 Bacteria 1036
106 Ga0070712_100896929 3300006175 Bacteria 764
107 Ga0070712_100898069 3300006175 Bacteria 764
108 Ga0075367_10722653 3300006178 Bacteria 634
109 Ga0075370_10253756 3300006353 Bacteria 1042
110 Ga0075428_100005390 3300006844 Bacteria 14222
111 Ga0075428_100093594 3300006844 Bacteria 3276
112 Ga0075430_100000011 3300006846 Bacteria 99671
113 Ga0075430_100000140 3300006846 Bacteria 46272
114 Ga0075431_100001318 3300006847 Bacteria 22699
115 Ga0075431_100005327 3300006847 Bacteria 12685
116 Ga0075433_10000050 3300006852 Bacteria 50089
117 Ga0075433_10111247 3300006852 Bacteria 2430
118 Ga0075433_10127826 3300006852 Bacteria 2257
119 Ga0075434_100000179 3300006871 Bacteria 41085
120 Ga0075434_100041752 3300006871 Bacteria 4544
121 Ga0075434_100112829 3300006871 Bacteria 2730
122 Ga0075434_100141071 3300006871 Bacteria 2430
123 Ga0075434_100350551 3300006871 Bacteria 1497
124 Ga0075434_100593478 3300006871 Bacteria 1127
125 Ga0075429_100001170 3300006880 Bacteria 21187
126 Ga0075429_100028970 3300006880 Bacteria 4810
127 Ga0068865_100244356 3300006881 Bacteria 1414
128 Ga0075436_100071264 3300006914 Bacteria 2403
129 Ga0075436_100244408 3300006914 Bacteria 1277
130 Ga0097620_101178329 3300006931 Bacteria 844
131 Ga0075435_100001211 3300007076 Bacteria 16537
132 Ga0075435_100028045 3300007076 Bacteria 4413
133 Ga0075435_100042977 3300007076 Bacteria 3617
134 Ga0099794_10078577 3300007265 Bacteria 1625
135 Ga0105240_10129473 3300009093 Bacteria 3029
136 Ga0111539_10000565 3300009094 Bacteria 47399
137 Ga0111539_10029962 3300009094 Bacteria 6619
138 Ga0111539_10127143 3300009094 Bacteria 2985
139 Ga0111539_10270454 3300009094 Bacteria 1978
140 Ga0111539_10300427 3300009094 Bacteria 1868
141 Ga0111539_10446378 3300009094 Bacteria 1506
142 Ga0105245_10366061 3300009098 Bacteria 1432
143 Ga0105247_10197811 3300009101 Bacteria 1349
144 Ga0105247_10636421 3300009101 Bacteria 795
145 Ga0114129_10003182 3300009147 Bacteria 23025
146 Ga0114129_10008234 3300009147 Bacteria 14864
147 Ga0114129_10168072 3300009147 Bacteria 2992
148 Ga0114129_12290611 3300009147 Bacteria 648
149 Ga0105243_10297954 3300009148 Bacteria 1460
150 Ga0105241_10156276 3300009174 Bacteria 1870
151 Ga0105242_10485119 3300009176 Bacteria 1172
152 Ga0105242_10756166 3300009176 Bacteria 957
153 Ga0105242_11357763 3300009176 Bacteria 736
154 Ga0105242_12021859 3300009176 Bacteria 619
155 Ga0105248_10067186 3300009177 Bacteria 4025
156 Ga0105248_10884456 3300009177 Bacteria 1009
157 Ga0105238_10774178 3300009551 Bacteria 974
158 Ga0105249_11168731 3300009553 Bacteria 840
159 Ga0099796_10083781 3300010159 Bacteria 1174
160 Ga0105239_10106392 3300010375 Bacteria 3107
161 Ga0105246_10107390 3300011119 Bacteria 2044
162 Ga0157373_10044552 3300013100 Bacteria 3167
163 Ga0157371_10205152 3300013102 Bacteria 1414
164 Ga0157370_10002750 3300013104 Bacteria 21019
165 Ga0157370_10015559 3300013104 Bacteria 7734
166 Ga0157370_10015745 3300013104 Bacteria 7676
167 Ga0157370_11536439 3300013104 Bacteria 598
168 Ga0157374_11311813 3300013296 Bacteria 746
169 Ga0157374_11742170 3300013296 Bacteria 648
170 Ga0163162_10817852 3300013306 Bacteria 1048
171 Ga0163162_12015624 3300013306 Bacteria 661
172 Ga0157372_11067942 3300013307 Bacteria 934
173 Ga0157375_10066562 3300013308 Bacteria 3598
174 Ga0163163_10100252 3300014325 Bacteria 2918
175 Ga0163163_10507542 3300014325 Bacteria 1268
176 Ga0163163_10961228 3300014325 Bacteria 917
177 Ga0163163_11184231 3300014325 Bacteria 827
178 Ga0157380_10503205 3300014326 Bacteria 1177
179 Ga0157380_11350443 3300014326 Bacteria 762
180 Ga0182008_10000473 3300014497 Bacteria 30750
181 Ga0157379_10132717 3300014968 Bacteria 2242
182 Ga0157379_10613249 3300014968 Bacteria 1016
183 Ga0157379_11106614 3300014968 Bacteria 759
184 Ga0157376_10429539 3300014969 Bacteria 1284
185 Ga0157376_12357768 3300014969 Bacteria 572
186 Ga0163161_10000891 3300017792 Bacteria 23193
187 Ga0163161_11319616 3300017792 Bacteria 628
188 Ga0213876_10108342 3300021384 Bacteria 1474
189 Ga0213876_10225995 3300021384 Bacteria 995
190 Ga0213876_10262259 3300021384 Bacteria 918
191 Ga0224572_1019374 3300024225 Bacteria 1308
192 Ga0228598_1007383 3300024227 Bacteria 2240
193 Ga0209148_1000936 3300025254 Bacteria 19232
194 Ga0209233_1059475 3300025261 Bacteria 743
195 Ga0209455_1002182 3300025272 Bacteria 7756
196 Ga0207697_10420704 3300025315 Bacteria 593
197 Ga0207682_10012188 3300025893 Bacteria 3357
198 Ga0207682_10267857 3300025893 Bacteria 797
199 Ga0207692_10174873 3300025898 Bacteria 1247
200 Ga0207688_10041134 3300025901 Bacteria 2570
201 Ga0207680_10139278 3300025903 Bacteria 1607
202 Ga0207685_10135416 3300025905 Bacteria 1098
203 Ga0207685_10259798 3300025905 Bacteria 843
204 Ga0207699_10169885 3300025906 Bacteria 1458
205 Ga0207645_10155367 3300025907 Bacteria 1495
206 Ga0207643_10073018 3300025908 Bacteria 1977
207 Ga0207707_10013190 3300025912 Bacteria 7205
208 Ga0207707_10286046 3300025912 Bacteria 1427
209 Ga0207707_11018646 3300025912 Bacteria 679
210 Ga0207695_10280602 3300025913 Bacteria 1560
211 Ga0207693_10051704 3300025915 Bacteria 3224
212 Ga0207693_10359643 3300025915 Bacteria 1139
213 Ga0207693_10504074 3300025915 Bacteria 945
214 Ga0207693_10569468 3300025915 Bacteria 883
215 Ga0207663_10094403 3300025916 Bacteria 1993
216 Ga0207663_10112522 3300025916 Bacteria 1849
217 Ga0207663_10231095 3300025916 Bacteria 1351
218 Ga0207663_10233431 3300025916 Bacteria 1345
219 Ga0207663_10385484 3300025916 Bacteria 1068
220 Ga0207663_10519325 3300025916 Bacteria 927
221 Ga0207660_10012065 3300025917 Bacteria 5646
222 Ga0207660_10040311 3300025917 Bacteria 3269
223 Ga0207649_10547395 3300025920 Bacteria 885
224 Ga0207649_10910321 3300025920 Bacteria 690
225 Ga0207652_10023091 3300025921 Bacteria 5152
226 Ga0207652_10165606 3300025921 Bacteria 1982
227 Ga0207652_10281592 3300025921 Bacteria 1500
228 Ga0207652_10402433 3300025921 Bacteria 1235
229 Ga0207681_10274309 3300025923 Bacteria 1325
230 Ga0207650_10069814 3300025925 Bacteria 2640
231 Ga0207650_10092991 3300025925 Bacteria 2308
232 Ga0207659_10028445 3300025926 Bacteria 3799
233 Ga0207659_10509027 3300025926 Bacteria 1020
234 Ga0207700_10066087 3300025928 Bacteria 2763
235 Ga0207700_10073994 3300025928 Bacteria 2633
236 Ga0207700_11533669 3300025928 Bacteria 591
237 Ga0207664_10085367 3300025929 Bacteria 2576
238 Ga0207644_10012492 3300025931 Bacteria 5643
239 Ga0207644_10171038 3300025931 Bacteria 1696
240 Ga0207690_10380996 3300025932 Bacteria 1121
241 Ga0207706_10027864 3300025933 Bacteria 5049
242 Ga0207686_10536804 3300025934 Bacteria 913
243 Ga0207709_10757221 3300025935 Bacteria 781
244 Ga0207670_10019225 3300025936 Bacteria 4168
245 Ga0207670_10113234 3300025936 Bacteria 1959
246 Ga0207670_11560066 3300025936 Bacteria 562
247 Ga0207669_10011290 3300025937 Bacteria 4340
248 Ga0207665_10103268 3300025939 Bacteria 1993
249 Ga0207665_11223764 3300025939 Bacteria 599
250 Ga0207691_10069119 3300025940 Bacteria 3191
251 Ga0207691_10127241 3300025940 Bacteria 2253
252 Ga0207691_10252006 3300025940 Bacteria 1524
253 Ga0207711_10177508 3300025941 Bacteria 1935
254 Ga0207711_10810576 3300025941 Bacteria 872
255 Ga0207689_10032408 3300025942 Bacteria 4348
256 Ga0207679_10086267 3300025945 Bacteria 2414
257 Ga0207679_10792102 3300025945 Bacteria 864
258 Ga0207667_12137823 3300025949 Bacteria 518
259 Ga0207651_10392028 3300025960 Bacteria 1179
260 Ga0207651_10425234 3300025960 Bacteria 1135
261 Ga0207640_10060955 3300025981 Bacteria 2497
262 Ga0207658_10131984 3300025986 Bacteria 2008
263 Ga0207677_10731338 3300026023 Bacteria 880
264 Ga0207703_10391473 3300026035 Bacteria 1287
265 Ga0207639_10462955 3300026041 Bacteria 1153
266 Ga0207702_10475829 3300026078 Bacteria 1215
267 Ga0207641_10099058 3300026088 Bacteria 2564
268 Ga0207648_10094883 3300026089 Bacteria 2609
269 Ga0207648_10519141 3300026089 Bacteria 1091
270 Ga0207683_10003960 3300026121 Bacteria 12853
271 Ga0207683_10562154 3300026121 Bacteria 1055
272 Ga0207683_10897426 3300026121 Bacteria 823
273 Ga0207698_10724131 3300026142 Bacteria 992
274 Ga0209996_1077273 3300027395 Bacteria 521
275 Ga0209968_1071050 3300027526 Bacteria 620
276 Ga0209982_1030442 3300027552 Bacteria 848
277 Ga0207428_10000485 3300027907 Bacteria 47761
278 Ga0207428_10159271 3300027907 Bacteria 1715
279 Ga0268266_10054564 3300028379 Bacteria 3434
280 Ga0268266_10309099 3300028379 Bacteria 1477
281 Ga0268266_12291204 3300028379 Bacteria 511
282 Ga0265322_10140594 3300028654 Bacteria 689
283 Ga0265325_10000036 3300031241 Bacteria 96858
284 Ga0265325_10100833 3300031241 Bacteria 1413
285 Ga0265339_10014580 3300031249 Bacteria 4736
286 Ga0265331_10001145 3300031250 Bacteria 20222
287 Ga0265331_10033980 3300031250 Bacteria 2518
288 Ga0307513_10767019 3300031456 Bacteria 670
289 Ga0265313_10005960 3300031595 Bacteria 8806
290 Ga0265313_10007840 3300031595 Bacteria 7203
291 Ga0307508_10000213 3300031616 Bacteria 70156
292 Ga0265314_10001675 3300031711 Bacteria 24139
293 Ga0265314_10066800 3300031711 Bacteria 2424
294 Ga0307406_11205262 3300031901 Bacteria 657
295 Ga0373926_0047473 3300035083 Bacteria 1542
296 Ga0373934_0218364 3300035086 Bacteria 786
297 Ga0373944_0052845 3300035089 Bacteria 1285
298 Ga0373923_0054356 3300035111 Bacteria 1685
299 Ga0373923_0068907 3300035111 Bacteria 1516
300 Ga0373932_0340332 3300035112 Bacteria 568
301 Ga0373936_0004494 3300035113 Bacteria 5276
302 Ga0373936_0070911 3300035113 Bacteria 1436
303 Ga0373936_0159399 3300035113 Bacteria 982
304 Ga0373945_0066646 3300035116 Bacteria 1354
305 Ga0373945_0181995 3300035116 Bacteria 865
306 Ga0373954_0124946 3300035118 Bacteria 1250
307 Ga0373954_0296614 3300035118 Bacteria 797
308 Ga0373954_0297577 3300035118 Bacteria 796
309 Ga0373954_0333578 3300035118 Bacteria 749
310 Ga0373956_0044698 3300035119 Bacteria 1975
311 Ga0373956_0171820 3300035119 Bacteria 1023
312 Ga0373957_0188810 3300035120 Bacteria 856
313 Ga0373957_0222856 3300035120 Bacteria 790
314 Ga0373960_0017784 3300035121 Bacteria 1846
315 Ga0373943_0090327 3300035170 Bacteria 1585
316 Ga0373943_0341696 3300035170 Bacteria 856
317 Ga0373943_0602824 3300035170 Bacteria 647
318 Ga0373946_0008754 3300035171 Bacteria 3715
319 Ga0373946_0154620 3300035171 Bacteria 1072
320 Ga0373955_0041213 3300035172 Bacteria 2474
321 Ga0373955_0090571 3300035172 Bacteria 1742
322 Ga0373955_0217283 3300035172 Bacteria 1141
323 Ga0373955_0309398 3300035172 Bacteria 953
324 Ga0373924_0021858 3300035410 Bacteria 2497
325 Ga0373924_0025384 3300035410 Bacteria 2343
326 Ga0373924_0080527 3300035410 Bacteria 1385
327 Ga0373924_0106689 3300035410 Bacteria 1208
328 Ga0373924_0110448 3300035410 Bacteria 1188
329 Ga0373931_0009154 3300035691 Bacteria 4728
330 Ga0373935_0025909 3300035692 Bacteria 3614
331 Ga0373935_0057546 3300035692 Bacteria 2480
332 Ga0373935_0350453 3300035692 Bacteria 1052
333 Ga0373935_0704006 3300035692 Bacteria 743
334 Ga0373935_0911567 3300035692 Bacteria 651
335 Ga0373927_0009130 3300035695 Bacteria 6655
336 Ga0373927_0021146 3300035695 Bacteria 4263
337 Ga0373927_0025712 3300035695 Bacteria 3848
338 Ga0373927_0082727 3300035695 Bacteria 2081
339 Ga0373933_0019813 3300035724 Bacteria 3807
340 Ga0373933_0080573 3300035724 Bacteria 1996
341 Ga0373933_0223150 3300035724 Bacteria 1209
342 Ga0373933_0335736 3300035724 Bacteria 981
343 Ga0373933_0475258 3300035724 Bacteria 818
344 Ga0373947_0026591 3300035725 Bacteria 3384
345 Ga0373947_0075547 3300035725 Bacteria 2075
346 Ga0373947_0083107 3300035725 Bacteria 1985
347 Ga0373937_0017778 3300036401 Bacteria 6343
348 Ga0373937_0332805 3300036401 Bacteria 1437
349 Ga0373937_0439312 3300036401 Bacteria 1239
350 Ga0373937_1317919 3300036401 Bacteria 670
351 Ga0373937_1431048 3300036401 Bacteria 639
352 Ga0373925_0046031 3300037068 Bacteria 3242
353 Ga0373925_0086153 3300037068 Bacteria 2396
354 Ga0373925_0122071 3300037068 Bacteria 2023
355 Ga0373925_0180127 3300037068 Bacteria 1672
356 Ga0373925_0372197 3300037068 Bacteria 1162
357 Ga0373925_0381923 3300037068 Bacteria 1147
358 Ga0436364_0425880 3300037853 Bacteria 4082
359 Ga0436364_0800479 3300037853 Bacteria 1651
360 Ga0436365_0146471 3300039437 Bacteria 3106
361 Ga0436365_0359684 3300039437 Bacteria 1686
362 Ga0436365_0839417 3300039437 Bacteria 1115
363 Ga0436365_1527269 3300039437 Bacteria 7894
364 Ga0436361_0451205 3300039447 Bacteria 971
365 Ga0436363_0051780 3300039450 Bacteria 1936
366 Ga0436363_0098895 3300039450 Bacteria 1224
367 Ga0439448_0037267 3300042005 Bacteria 1562
368 Ga0439450_002616 3300042008 Bacteria 2856
369 Ga0439455_0169293 3300042012 Bacteria 627
370 Ga0495627_013334 3300046453 Bacteria 2893
371 Ga0495592_0027186 3300046454 Bacteria 4337
372 Ga0495592_0399182 3300046454 Bacteria 871
373 Ga0495603_0060470 3300046455 Bacteria 2238
374 Ga0495603_0576606 3300046455 Bacteria 644
375 Ga0495629_0028510 3300046459 Bacteria 3964
376 Ga0495629_0100028 3300046459 Bacteria 2023
377 Ga0495638_0000904 3300046460 Bacteria 30331
378 Ga0495638_0062195 3300046460 Bacteria 2305
379 Ga0495638_0322039 3300046460 Bacteria 826
380 Ga0495641_0014778 3300046461 Bacteria 4209
381 Ga0495651_0005894 3300046462 Bacteria 9347
382 Ga0495651_0355374 3300046462 Bacteria 967
383 Ga0495651_0396545 3300046462 Bacteria 902
384 Ga0495651_0721775 3300046462 Bacteria 620
385 Ga0495653_0002617 3300046463 Bacteria 14317
386 Ga0495653_0145179 3300046463 Bacteria 1664
387 Ga0495653_0476311 3300046463 Bacteria 781
388 Ga0495653_0661058 3300046463 Bacteria 637
389 Ga0495580_0048169 3300046472 Bacteria 3019
390 Ga0495580_0268794 3300046472 Bacteria 1165
391 Ga0495580_0317007 3300046472 Bacteria 1060
392 Ga0495582_0025385 3300046473 Bacteria 3245
393 Ga0495582_0241483 3300046473 Bacteria 1035
394 Ga0495639_0002862 3300046475 Bacteria 7508
395 Ga0495639_0030792 3300046475 Bacteria 2386
396 Ga0495662_0002617 3300046476 Bacteria 9103
397 Ga0495662_0007696 3300046476 Bacteria 5308
398 Ga0495662_0069009 3300046476 Bacteria 1712
399 Ga0495662_0144361 3300046476 Bacteria 1172
400 Ga0495664_0002556 3300046477 Bacteria 9787
401 Ga0495664_0050669 3300046477 Bacteria 2465
402 Ga0495584_0173220 3300046491 Bacteria 1097
403 Ga0495594_0014698 3300046499 Bacteria 4107
404 Ga0495594_0168524 3300046499 Bacteria 1246
405 Ga0495607_0009728 3300046501 Bacteria 6490
406 Ga0495608_0024386 3300046511 Bacteria 4137
407 Ga0495608_0138063 3300046511 Bacteria 1557
408 Ga0495610_0022421 3300046512 Bacteria 3455
409 Ga0495616_0087015 3300046513 Bacteria 1485
410 Ga0495618_0066697 3300046514 Bacteria 2288
411 Ga0495620_0149223 3300046515 Bacteria 912
412 Ga0495628_0007753 3300046516 Bacteria 9256
413 Ga0495628_0227626 3300046516 Bacteria 1398
414 Ga0495628_0807185 3300046516 Bacteria 656
415 Ga0495630_0080450 3300046517 Bacteria 2458
416 Ga0495630_0109612 3300046517 Bacteria 2091
417 Ga0495630_0355257 3300046517 Bacteria 1121
418 Ga0495637_0063378 3300046520 Bacteria 1511
419 Ga0495663_0003803 3300046525 Bacteria 4308
420 Ga0495666_0428708 3300046526 Bacteria 593
421 Ga0495652_0015920 3300046529 Bacteria 6730
422 Ga0495652_0099829 3300046529 Bacteria 2356
423 Ga0495652_0112830 3300046529 Bacteria 2183
424 Ga0495652_0185014 3300046529 Bacteria 1595
425 Ga0495652_0277673 3300046529 Bacteria 1228
426 Ga0495652_0463947 3300046529 Bacteria 884
427 Ga0495665_0002284 3300046531 Bacteria 10356
428 Ga0495665_0127956 3300046531 Bacteria 1330
429 Ga0495665_0200777 3300046531 Bacteria 1034
430 Ga0495665_0282381 3300046531 Bacteria 851
431 Ga0495640_0035356 3300046533 Bacteria 3536
432 Ga0495640_0087288 3300046533 Bacteria 2063
433 Ga0495640_0106159 3300046533 Bacteria 1839
434 Ga0495640_0182744 3300046533 Bacteria 1336
435 Ga0495640_0194874 3300046533 Bacteria 1286
436 Ga0495587_0010972 3300046536 Bacteria 5747
437 Ga0495587_0087714 3300046536 Bacteria 1800
438 Ga0495587_0278376 3300046536 Bacteria 938
439 Ga0495598_0002282 3300046537 Bacteria 3950
440 Ga0495598_0120500 3300046537 Bacteria 889
441 Ga0495609_0073223 3300046538 Bacteria 1503
442 Ga0495621_0016954 3300046539 Bacteria 2346
443 Ga0495645_0040519 3300046543 Bacteria 3398
444 Ga0495645_0043632 3300046543 Bacteria 3271
445 Ga0495645_0738769 3300046543 Bacteria 595
446 Ga0495622_0008078 3300046557 Bacteria 4879
447 Ga0495622_0121176 3300046557 Bacteria 1194
448 Ga0495633_0013142 3300046558 Bacteria 4376
449 Ga0495633_0039608 3300046558 Bacteria 2249
450 Ga0495633_0171668 3300046558 Bacteria 999
451 Ga0495633_0460749 3300046558 Bacteria 574
452 Ga0495667_0061515 3300046559 Bacteria 2462
453 Ga0495667_0061880 3300046559 Bacteria 2453
454 Ga0495667_0160158 3300046559 Bacteria 1448
455 Ga0495667_0160218 3300046559 Bacteria 1447
456 Ga0495667_0206472 3300046559 Bacteria 1256
457 Ga0495656_0001097 3300046615 Bacteria 8777
458 Ga0495656_0024890 3300046615 Bacteria 2369
459 Ga0495634_0028566 3300046642 Bacteria 3870
460 Ga0495634_0047658 3300046642 Bacteria 2886
461 Ga0495634_0199213 3300046642 Bacteria 1244
462 Ga0495635_0018733 3300046663 Bacteria 4829
463 Ga0495635_0041501 3300046663 Bacteria 3177
464 Ga0495635_0101294 3300046663 Bacteria 1968
465 Ga0495659_0037068 3300046664 Bacteria 1726
466 Ga0495659_0377327 3300046664 Bacteria 609
467 Ga0495661_0495736 3300046665 Bacteria 583
468 Ga0495588_0002233 3300046674 Bacteria 8290
469 Ga0495588_0218589 3300046674 Bacteria 1006
470 Ga0495657_0082523 3300046675 Bacteria 2077
471 Ga0495599_0062398 3300046678 Bacteria 2328
472 Ga0495599_0068921 3300046678 Bacteria 2208
473 Ga0495646_0025191 3300046680 Bacteria 3743
474 Ga0495646_0110983 3300046680 Bacteria 1562
475 Ga0495646_0292382 3300046680 Bacteria 863
476 Ga0495646_0351297 3300046680 Bacteria 772
477 Ga0495647_0209649 3300046681 Bacteria 857
478 Ga0495647_0242806 3300046681 Bacteria 800
479 Ga0495658_0003902 3300046683 Bacteria 7376
480 Ga0495658_0008767 3300046683 Bacteria 5023
481 Ga0495658_0082211 3300046683 Bacteria 1892
482 Ga0495658_0280933 3300046683 Bacteria 1051
483 Ga0495613_0036851 3300046689 Bacteria 3626
484 Ga0495613_0134762 3300046689 Bacteria 1767
485 Ga0495613_0197777 3300046689 Bacteria 1418
486 Ga0495624_0004671 3300046690 Bacteria 9974
487 Ga0495624_0149608 3300046690 Bacteria 1428
488 Ga0495670_0162647 3300046691 Bacteria 1173
489 Ga0495649_0411569 3300046694 Bacteria 678
490 Ga0495600_0008687 3300046809 Bacteria 6250
491 Ga0495600_0081796 3300046809 Bacteria 2108
492 Ga0495600_0088859 3300046809 Bacteria 2015
493 Ga0495600_0550580 3300046809 Bacteria 705
494 Ga0495660_0473445 3300046810 Bacteria 539
495 Ga0495581_0071690 3300047315 Bacteria 2004
496 Ga0495581_0458735 3300047315 Bacteria 742
497 Ga0495604_0004875 3300047317 Bacteria 10629
498 Ga0495604_0021033 3300047317 Bacteria 5206
499 Ga0495604_0250359 3300047317 Bacteria 1208
500 Ga0495636_0197922 3300047318 Bacteria 917
501 Ga0495674_0222344 3300047319 Bacteria 1560
502 Ga0495674_0335431 3300047319 Bacteria 1229
503 Ga0495674_0393547 3300047319 Bacteria 1119
504 Ga0495672_0187195 3300047320 Bacteria 1044
505 Ga0495676_0014436 3300047321 Bacteria 7066
506 Ga0495680_0056602 3300047322 Bacteria 3035
507 Ga0495680_0561780 3300047322 Bacteria 767
508 Ga0495680_0709949 3300047322 Bacteria 663
509 Ga0495675_0228028 3300047444 Bacteria 1125
510 Ga0495685_147832 3300047447 Bacteria 764
511 Ga0495681_0033638 3300047470 Bacteria 2564
512 Ga0495684_0014026 3300047471 Bacteria 6164
513 Ga0495684_0063911 3300047471 Bacteria 2797
514 Ga0495593_0209225 3300047673 Bacteria 979
515 Ga0495602_0042613 3300048088 Bacteria 4133
516 Ga0495602_0222458 3300048088 Bacteria 1424
517 Ga0495614_0015002 3300048089 Bacteria 3382
518 Ga0495615_0077487 3300048090 Bacteria 906
519 Ga0496100_0033153 3300048903 Bacteria 3230
520 Ga0496100_0674325 3300048903 Bacteria 806
521 Ga0496101_0014676 3300048904 Bacteria 5270
522 Ga0496101_0142934 3300048904 Bacteria 1825
523 Ga0496101_0195873 3300048904 Bacteria 1561
524 Ga0496101_0388163 3300048904 Bacteria 1099
525 Ga0496101_0959572 3300048904 Bacteria 673
526 Ga0496102_0078719 3300048905 Bacteria 3035
527 Ga0496102_0783286 3300048905 Bacteria 876
528 Ga0496103_0253385 3300048906 Bacteria 1133
529 Ga0496104_0118808 3300048907 Bacteria 2538
530 Ga0496104_0119041 3300048907 Bacteria 2536
531 Ga0496104_0502247 3300048907 Bacteria 1124
532 Ga0496104_0940228 3300048907 Bacteria 769
533 Ga0496105_0063821 3300048908 Bacteria 3039
534 Ga0496105_0496325 3300048908 Bacteria 959
535 Ga0496105_0672547 3300048908 Bacteria 797
536 Ga0496106_0123700 3300048909 Bacteria 2024
537 Ga0496107_0034211 3300048910 Bacteria 3639
538 Ga0496107_0113951 3300048910 Bacteria 1989
539 Ga0496108_0634404 3300048911 Bacteria 929
540 Ga0496109_0310233 3300048912 Bacteria 1488
541 Ga0496109_0758550 3300048912 Bacteria 908
542 Ga0496110_0265996 3300048913 Bacteria 1561
543 Ga0496110_0865533 3300048913 Bacteria 809
544 Ga0496110_1146669 3300048913 Bacteria 686
545 Ga0496112_0054591 3300048915 Bacteria 3926
546 Ga0496112_0075202 3300048915 Bacteria 3341
547 Ga0496112_0247478 3300048915 Bacteria 1734
548 Ga0496112_0272790 3300048915 Bacteria 1640
549 Ga0496112_0453519 3300048915 Bacteria 1220
550 Ga0496112_1239479 3300048915 Bacteria 662
551 Ga0496112_1689514 3300048915 Bacteria 546
552 Ga0496113_0034902 3300048916 Bacteria 3674
553 Ga0496114_0040167 3300048917 Bacteria 3872
554 Ga0496114_0187741 3300048917 Bacteria 1807
555 Ga0496115_0191045 3300048918 Bacteria 1692
556 Ga0496115_0252441 3300048918 Bacteria 1452
557 Ga0496115_0338228 3300048918 Bacteria 1229
558 Ga0496115_0341021 3300048918 Bacteria 1223
559 Ga0496115_0348596 3300048918 Bacteria 1208
560 Ga0496117_0008923 3300048920 Bacteria 9440
561 Ga0496118_0003037 3300048921 Bacteria 21644
562 Ga0496121_0010897 3300048924 Bacteria 10160
563 Ga0496122_0005229 3300048925 Bacteria 15574
564 Ga0496123_0008487 3300048926 Bacteria 9428
565 Ga0496124_0027499 3300048927 Bacteria 5104
566 Ga0496125_0115221 3300048928 Bacteria 1933
567 Ga0496125_0177313 3300048928 Bacteria 1424
568 Ga0496126_0035975 3300048929 Bacteria 4635
569 Ga0496126_0422910 3300048929 Bacteria 1077
570 Ga0501031_0228515 3300049568 Bacteria 1211
571 Ga0501031_0598208 3300049568 Bacteria 709
572 Ga0501032_0251380 3300049569 Bacteria 1147
573 Ga0501032_0731770 3300049569 Bacteria 626
574 Ga0501033_0074370 3300049570 Bacteria 2494
575 Ga0501034_0024255 3300049571 Bacteria 6168
576 Ga0501034_0035496 3300049571 Bacteria 5055
577 Ga0501034_0491711 3300049571 Bacteria 1141
578 Ga0501034_0504389 3300049571 Bacteria 1123
579 Ga0501036_0015752 3300049572 Bacteria 6315
580 Ga0501036_0132215 3300049572 Bacteria 2106
581 Ga0501036_0138552 3300049572 Bacteria 2053
582 Ga0501036_0284797 3300049572 Bacteria 1383
583 Ga0501037_0004122 3300049573 Bacteria 10541
584 Ga0501037_0654387 3300049573 Bacteria 702
585 Ga0501038_0011112 3300049574 Bacteria 8222
586 Ga0501038_0018744 3300049574 Bacteria 6248
587 Ga0501038_0144272 3300049574 Bacteria 1945
588 Ga0501038_0252996 3300049574 Bacteria 1395
589 Ga0501039_0007105 3300049575 Bacteria 8529
590 Ga0501039_0028200 3300049575 Bacteria 4320
591 Ga0501039_0318846 3300049575 Bacteria 1222
592 Ga0501039_0523010 3300049575 Bacteria 931
593 Ga0501040_0010855 3300049576 Bacteria 5955
594 Ga0501040_0149722 3300049576 Bacteria 1646
595 Ga0501040_0595960 3300049576 Bacteria 798
596 Ga0501041_0047043 3300049577 Bacteria 2626
597 Ga0501041_0159921 3300049577 Bacteria 1408
598 Ga0501041_0936403 3300049577 Bacteria 557
599 Ga0501042_0096062 3300049578 Bacteria 2129
600 Ga0501042_0167506 3300049578 Bacteria 1585
601 Ga0501042_0220859 3300049578 Bacteria 1367
602 Ga0501043_0156199 3300049579 Bacteria 1784
603 Ga0501043_0229455 3300049579 Bacteria 1434
604 Ga0501043_0249951 3300049579 Bacteria 1366
605 Ga0501046_0377765 3300049580 Bacteria 1026
606 Ga0501047_0001345 3300049581 Bacteria 24129
607 Ga0501047_0008246 3300049581 Bacteria 9833
608 Ga0501047_0010574 3300049581 Bacteria 8727
609 Ga0501047_0088971 3300049581 Bacteria 2965
610 Ga0501047_0485581 3300049581 Bacteria 1063
611 Ga0501048_0011152 3300049582 Bacteria 6700
612 Ga0501048_0057820 3300049582 Bacteria 2750
613 Ga0501048_0456728 3300049582 Bacteria 915
614 Ga0501048_0507492 3300049582 Bacteria 865
615 Ga0501067_0025582 3300049583 Bacteria 3271
616 Ga0501068_0406880 3300049584 Bacteria 878
617 Ga0501068_0880962 3300049584 Bacteria 588
618 Ga0501070_0001913 3300049586 Bacteria 18381
619 Ga0501070_0010885 3300049586 Bacteria 7684
620 Ga0501070_0296578 3300049586 Bacteria 1317
621 Ga0501071_0249908 3300049587 Bacteria 1338
622 Ga0501071_0286916 3300049587 Bacteria 1246
623 Ga0501072_0336187 3300049588 Bacteria 1200
624 Ga0501072_0631278 3300049588 Bacteria 844
625 Ga0501073_0016476 3300049589 Bacteria 5356
626 Ga0501074_0221122 3300049590 Bacteria 1348
627 Ga0501076_0415356 3300049592 Bacteria 1107
628 Ga0501076_0921482 3300049592 Bacteria 720
629 Ga0501077_0107434 3300049593 Bacteria 1768
630 Ga0501077_0120535 3300049593 Bacteria 1662
631 Ga0501077_0126414 3300049593 Bacteria 1621
632 Ga0501077_0338553 3300049593 Bacteria 960
633 Ga0501079_0044895 3300049741 Bacteria 3411
634 Ga0501079_0074224 3300049741 Bacteria 2629
635 Ga0501079_0094084 3300049741 Bacteria 2322
636 Ga0501079_0137336 3300049741 Bacteria 1904
637 Ga0501080_0000123 3300049742 Bacteria 54710
638 Ga0501080_0696991 3300049742 Bacteria 896
639 Ga0501080_0727831 3300049742 Bacteria 874
640 Ga0501080_1034773 3300049742 Bacteria 711
641 Ga0501081_0008110 3300049743 Bacteria 6816
642 Ga0501081_0014509 3300049743 Bacteria 5197
643 Ga0501081_0020005 3300049743 Bacteria 4461
644 Ga0501081_0067587 3300049743 Bacteria 2488
645 Ga0501081_0161876 3300049743 Bacteria 1613
646 Ga0501081_0313965 3300049743 Bacteria 1151
647 Ga0501081_0602743 3300049743 Bacteria 822
648 Ga0501083_0032845 3300049744 Bacteria 3556
649 Ga0501035_0000351 3300049822 Bacteria 52894
650 Ga0501035_0005615 3300049822 Bacteria 11843
651 Ga0501035_0727488 3300049822 Bacteria 798
652 Ga0501035_0761205 3300049822 Bacteria 776
653 Ga0501035_1203568 3300049822 Bacteria 588
654 Ga0501044_0000115 3300049823 Bacteria 96999
655 Ga0501044_0335167 3300049823 Bacteria 1434
656 Ga0501044_0473380 3300049823 Bacteria 1156
657 Ga0501045_0056888 3300049824 Bacteria 2861
658 Ga0501045_0175160 3300049824 Bacteria 1598
659 Ga0501045_0637733 3300049824 Bacteria 788
660 nmdc:mga00v17_283231_c1 3300050491 Bacteria 1076
661 nmdc:mga00v17_4313_c1 3300050491 Bacteria 7387
662 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
663 nmdc:mga05p37_2721_c1 3300050507 Bacteria 20539
664 nmdc:mga09592_10181_c2 3300050508 Bacteria 5349
665 nmdc:mga09592_2153_c1 3300050508 Bacteria 15903
666 nmdc:mga09592_320380_c1 3300050508 Bacteria 1343
667 nmdc:mga0qj67_1123_c1 3300050509 Bacteria 18547
668 nmdc:mga0qj67_461_c1 3300050509 Bacteria 27816
669 nmdc:mga06r32_1267_c1 3300050510 Bacteria 22709
670 nmdc:mga06r32_274_c1 3300050510 Bacteria 42858
671 nmdc:mga06r32_648269_c1 3300050510 Bacteria 1024
672 nmdc:mga08y16_1013230_c1 3300050511 Bacteria 810
673 nmdc:mga08y16_33241_c1 3300050511 Bacteria 5418
674 nmdc:mga08y16_526020_c1 3300050511 Bacteria 1199
675 nmdc:mga08y16_91828_c1 3300050511 Bacteria 3164
676 nmdc:mga0n895_124_c1 3300050512 Bacteria 45833
677 nmdc:mga0n895_13539_c1 3300050512 Bacteria 7366
678 nmdc:mga0n895_14980_c1 3300050512 Bacteria 7063
679 nmdc:mga0n895_24552_c1 3300050512 Bacteria 5682
680 nmdc:mga0n895_389398_c1 3300050512 Bacteria 1410
681 nmdc:mga0rr50_1076_c1 3300050513 Bacteria 14869
682 nmdc:mga0rr50_18904_c1 3300050513 Bacteria 4640
683 nmdc:mga0rr50_33598_c1 3300050513 Bacteria 3665
684 nmdc:mga0rr50_424618_c1 3300050513 Bacteria 1125
685 nmdc:mga0a205_114771_c1 3300050515 Bacteria 2592
686 nmdc:mga0a205_126375_c1 3300050515 Bacteria 2457
687 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
688 Ga0495601_0004970 3300053077 Bacteria 7717
689 Ga0495601_0034259 3300053077 Bacteria 3167
690 Ga0495601_0054061 3300053077 Bacteria 2539
691 Ga0495601_0214093 3300053077 Bacteria 1258
692 Ga0495601_0608361 3300053077 Bacteria 701
693 Ga0495601_0732103 3300053077 Bacteria 630
694 Ga0495612_0007621 3300053078 Bacteria 4422
695 Ga0495612_0017518 3300053078 Bacteria 2868
696 Ga0495612_0020413 3300053078 Bacteria 2655
697 Ga0495612_0031153 3300053078 Bacteria 2149
698 Ga0495612_0035845 3300053078 Bacteria 2012
699 Ga0495612_0094055 3300053078 Bacteria 1272
700 Ga0495595_0016434 3300053084 Bacteria 3166
701 Ga0495595_0021696 3300053084 Bacteria 2808
702 Ga0495595_0136820 3300053084 Bacteria 1200
703 Ga0495595_0177798 3300053084 Bacteria 1054
704 Ga0495619_0002196 3300053085 Bacteria 12932
705 Ga0495619_0004292 3300053085 Bacteria 9088
706 Ga0495619_0011444 3300053085 Bacteria 5590
707 Ga0495619_0281246 3300053085 Bacteria 1153
708 Ga0500643_002669 3300053087 Bacteria 8981
709 Ga0500644_0000774 3300053088 Bacteria 10918
710 Ga0500651_0015949 3300053093 Bacteria 4620
711 Ga0500651_0217770 3300053093 Bacteria 1121
712 Ga0500566_0037182 3300053094 Bacteria 2821
713 Ga0500594_0116434 3300053118 Bacteria 836
714 Ga0500595_000029 3300053119 Bacteria 122318
715 Ga0500626_094718 3300053128 Bacteria 1307
716 Ga0500652_003938 3300053131 Bacteria 4539
717 Ga0500652_088819 3300053131 Bacteria 1290
718 Ga0500616_0000006 3300053153 Bacteria 944738
719 Ga0500616_0026910 3300053153 Bacteria 3179
720 Ga0500624_000091 3300053157 Bacteria 44769
721 Ga0500645_001244 3300053730 Bacteria 13438
722 Ga0500645_085939 3300053730 Bacteria 895
723 Ga0501084_0206768 3300054114 Bacteria 1656
724 Ga0501084_0460646 3300054114 Bacteria 1075
725 Ga0501084_0466344 3300054114 Bacteria 1068
726 Ga0501082_0039725 3300060353 Bacteria 4059
727 Ga0501082_0186819 3300060353 Bacteria 1803
728 Ga0501082_0203629 3300060353 Bacteria 1722
729 Ga0501082_0624283 3300060353 Bacteria 943
730 Ga0501082_0864853 3300060353 Bacteria 791
731 Ga0530510_0442341 3300061734 Bacteria 982
732 2545675842 2545555834 Bacteria 8130841
733 2643755285 2643221547 Bacteria 4740017
734 2739649517 2739367664 Bacteria 4114334
735 2740027990 2739367865 Bacteria 4114482
736 2792747671 2791355123 Bacteria 8049106
737 2874612342 2874604998 Bacteria 7834745
738 2889015355 2889010040 Bacteria 6749192
739 2896184457 2896184354 Bacteria 3258548
740 Ga0075428_100640513
741 Ga0065712_10465855
742 Ga0070690_100178396
743 Ga0070690_100282369
744 Ga0070670_100004154
745 Ga0070670_100110950
746 Ga0070670_100118390
747 Ga0070677_10028823
748 Ga0070677_10765877
749 Ga0070666_10068430
750 Ga0070680_100121873
751 Ga0070680_100216398
752 Ga0070680_100723480
753 Ga0070682_100819420
754 Ga0068868_100873867
755 Ga0070689_100017828
756 Ga0070689_100164566
757 Ga0070691_10314211
758 Ga0070661_100256152
759 Ga0070661_100299850
760 Ga0070668_100351960
761 Ga0070669_100271106
762 Ga0070675_100037042
763 Ga0070671_100010117
764 Ga0070671_100659636
765 Ga0070671_100966183
766 Ga0070674_100084807
767 Ga0070673_100003980
768 Ga0070673_100304029
769 Ga0070688_100094232
770 Ga0070688_100132676
771 Ga0070659_100911596
772 Ga0070667_100061229
773 Ga0070667_100181996
774 Ga0070709_10103036
775 Ga0070709_10103623
776 Ga0070714_100219473
777 Ga0070714_100249839
778 Ga0070714_100558301
779 Ga0070714_100664716
780 Ga0070714_101135089
781 Ga0070714_101528765
782 Ga0070713_100612748
783 Ga0070713_102290210
784 Ga0070701_10119350
785 Ga0070701_10671823
786 Ga0070711_100081560
787 Ga0070711_100097473
788 Ga0070711_100603721
789 Ga0070711_101408591
790 Ga0070705_100465045
791 Ga0070700_100552470
792 Ga0070708_101319580
793 Ga0070678_100030678
794 Ga0070678_100066809
795 Ga0070678_100830633
796 Ga0070678_101231921
797 Ga0070662_100064212
798 Ga0070662_100162439
799 Ga0070662_100277272
800 Ga0070681_10001866
801 Ga0070681_10537094
802 Ga0070681_11344042
803 Ga0068867_100839015
804 Ga0070685_10036199
805 Ga0070707_100394379
806 Ga0070699_101872161
807 Ga0070679_100022623
808 Ga0070679_100198483
809 Ga0070679_100449101
810 Ga0070679_100983205
811 Ga0070684_101463022
812 Ga0070672_100185812
813 Ga0070672_100338990
814 Ga0070686_100074621
815 Ga0070696_100068052
816 Ga0070665_100031957
817 Ga0070665_100588403
818 Ga0070704_100036346
819 Ga0070664_100108938
820 Ga0070664_100539972
821 Ga0068857_100159460
822 Ga0068854_100032491
823 Ga0068854_101480961
824 Ga0068856_100453624
825 Ga0068856_100605075
826 Ga0070702_100164111
827 Ga0068852_100678059
828 Ga0068852_102019195
829 Ga0068864_101596240
830 Ga0068870_10358626
831 Ga0068863_100006027
832 Ga0068858_100426413
833 Ga0068860_102226030
834 Ga0081455_10311237
835 Ga0081455_10363670
836 Ga0081540_1017189
837 Ga0081540_1030048
838 Ga0081540_1096363
839 Ga0070717_10409094
840 Ga0070717_10443959
841 Ga0075363_100674739
842 Ga0075432_10010949
843 Ga0070712_100226111
844 Ga0070712_100483489
845 Ga0070712_100896929
846 Ga0070712_100898069
847 Ga0075367_10722653
848 Ga0075370_10253756
849 Ga0075428_100005390
850 Ga0075428_100093594
851 Ga0075430_100000011
852 Ga0075430_100000140
853 Ga0075431_100001318
854 Ga0075431_100005327
855 Ga0075433_10000050
856 Ga0075433_10111247
857 Ga0075433_10127826
858 Ga0075434_100000179
859 Ga0075434_100041752
860 Ga0075434_100112829
861 Ga0075434_100141071
862 Ga0075434_100350551
863 Ga0075434_100593478
864 Ga0075429_100001170
865 Ga0075429_100028970
866 Ga0068865_100244356
867 Ga0075436_100071264
868 Ga0075436_100244408
869 Ga0097620_101178329
870 Ga0075435_100001211
871 Ga0075435_100028045
872 Ga0075435_100042977
873 Ga0099794_10078577
874 Ga0105240_10129473
875 Ga0111539_10000565
876 Ga0111539_10029962
877 Ga0111539_10127143
878 Ga0111539_10270454
879 Ga0111539_10300427
880 Ga0111539_10446378
881 Ga0105245_10366061
882 Ga0105247_10197811
883 Ga0105247_10636421
884 Ga0114129_10003182
885 Ga0114129_10008234
886 Ga0114129_10168072
887 Ga0114129_12290611
888 Ga0105243_10297954
889 Ga0105241_10156276
890 Ga0105242_10485119
891 Ga0105242_10756166
892 Ga0105242_11357763
893 Ga0105242_12021859
894 Ga0105248_10067186
895 Ga0105248_10884456
896 Ga0105238_10774178
897 Ga0105249_11168731
898 Ga0099796_10083781
899 Ga0105239_10106392
900 Ga0105246_10107390
901 Ga0157373_10044552
902 Ga0157371_10205152
903 Ga0157370_10002750
904 Ga0157370_10015559
905 Ga0157370_10015745
906 Ga0157370_11536439
907 Ga0157374_11311813
908 Ga0157374_11742170
909 Ga0163162_10817852
910 Ga0163162_12015624
911 Ga0157372_11067942
912 Ga0157375_10066562
913 Ga0163163_10100252
914 Ga0163163_10507542
915 Ga0163163_10961228
916 Ga0163163_11184231
917 Ga0157380_10503205
918 Ga0157380_11350443
919 Ga0182008_10000473
920 Ga0157379_10132717
921 Ga0157379_10613249
922 Ga0157379_11106614
923 Ga0157376_10429539
924 Ga0157376_12357768
925 Ga0163161_10000891
926 Ga0163161_11319616
927 Ga0213876_10108342
928 Ga0213876_10225995
929 Ga0213876_10262259
930 Ga0224572_1019374
931 Ga0228598_1007383
932 Ga0209148_1000936
933 Ga0209233_1059475
934 Ga0209455_1002182
935 Ga0207697_10420704
936 Ga0207682_10012188
937 Ga0207682_10267857
938 Ga0207692_10174873
939 Ga0207688_10041134
940 Ga0207680_10139278
941 Ga0207685_10135416
942 Ga0207685_10259798
943 Ga0207699_10169885
944 Ga0207645_10155367
945 Ga0207643_10073018
946 Ga0207707_10013190
947 Ga0207707_10286046
948 Ga0207707_11018646
949 Ga0207695_10280602
950 Ga0207693_10051704
951 Ga0207693_10359643
952 Ga0207693_10504074
953 Ga0207693_10569468
954 Ga0207663_10094403
955 Ga0207663_10112522
956 Ga0207663_10231095
957 Ga0207663_10233431
958 Ga0207663_10385484
959 Ga0207663_10519325
960 Ga0207660_10012065
961 Ga0207660_10040311
962 Ga0207649_10547395
963 Ga0207649_10910321
964 Ga0207652_10023091
965 Ga0207652_10165606
966 Ga0207652_10281592
967 Ga0207652_10402433
968 Ga0207681_10274309
969 Ga0207650_10069814
970 Ga0207650_10092991
971 Ga0207659_10028445
972 Ga0207659_10509027
973 Ga0207700_10066087
974 Ga0207700_10073994
975 Ga0207700_11533669
976 Ga0207664_10085367
977 Ga0207644_10012492
978 Ga0207644_10171038
979 Ga0207690_10380996
980 Ga0207706_10027864
981 Ga0207686_10536804
982 Ga0207709_10757221
983 Ga0207670_10019225
984 Ga0207670_10113234
985 Ga0207670_11560066
986 Ga0207669_10011290
987 Ga0207665_10103268
988 Ga0207665_11223764
989 Ga0207691_10069119
990 Ga0207691_10127241
991 Ga0207691_10252006
992 Ga0207711_10177508
993 Ga0207711_10810576
994 Ga0207689_10032408
995 Ga0207679_10086267
996 Ga0207679_10792102
997 Ga0207667_12137823
998 Ga0207651_10392028
999 Ga0207651_10425234
1000 Ga0207640_10060955
1001 Ga0207658_10131984
1002 Ga0207677_10731338
1003 Ga0207703_10391473
1004 Ga0207639_10462955
1005 Ga0207702_10475829
1006 Ga0207641_10099058
1007 Ga0207648_10094883
1008 Ga0207648_10519141
1009 Ga0207683_10003960
1010 Ga0207683_10562154
1011 Ga0207683_10897426
1012 Ga0207698_10724131
1013 Ga0209996_1077273
1014 Ga0209968_1071050
1015 Ga0209982_1030442
1016 Ga0207428_10000485
1017 Ga0207428_10159271
1018 Ga0268266_10054564
1019 Ga0268266_10309099
1020 Ga0268266_12291204
1021 Ga0265322_10140594
1022 Ga0265325_10000036
1023 Ga0265325_10100833
1024 Ga0265339_10014580
1025 Ga0265331_10001145
1026 Ga0265331_10033980
1027 Ga0307513_10767019
1028 Ga0265313_10005960
1029 Ga0265313_10007840
1030 Ga0307508_10000213
1031 Ga0265314_10001675
1032 Ga0265314_10066800
1033 Ga0307406_11205262
1034 Ga0373926_0047473
1035 Ga0373934_0218364
1036 Ga0373944_0052845
1037 Ga0373923_0054356
1038 Ga0373923_0068907
1039 Ga0373932_0340332
1040 Ga0373936_0004494
1041 Ga0373936_0070911
1042 Ga0373936_0159399
1043 Ga0373945_0066646
1044 Ga0373945_0181995
1045 Ga0373954_0124946
1046 Ga0373954_0296614
1047 Ga0373954_0297577
1048 Ga0373954_0333578
1049 Ga0373956_0044698
1050 Ga0373956_0171820
1051 Ga0373957_0188810
1052 Ga0373957_0222856
1053 Ga0373960_0017784
1054 Ga0373943_0090327
1055 Ga0373943_0341696
1056 Ga0373943_0602824
1057 Ga0373946_0008754
1058 Ga0373946_0154620
1059 Ga0373955_0041213
1060 Ga0373955_0090571
1061 Ga0373955_0217283
1062 Ga0373955_0309398
1063 Ga0373924_0021858
1064 Ga0373924_0025384
1065 Ga0373924_0080527
1066 Ga0373924_0106689
1067 Ga0373924_0110448
1068 Ga0373931_0009154
1069 Ga0373935_0025909
1070 Ga0373935_0057546
1071 Ga0373935_0350453
1072 Ga0373935_0704006
1073 Ga0373935_0911567
1074 Ga0373927_0009130
1075 Ga0373927_0021146
1076 Ga0373927_0025712
1077 Ga0373927_0082727
1078 Ga0373933_0019813
1079 Ga0373933_0080573
1080 Ga0373933_0223150
1081 Ga0373933_0335736
1082 Ga0373933_0475258
1083 Ga0373947_0026591
1084 Ga0373947_0075547
1085 Ga0373947_0083107
1086 Ga0373937_0017778
1087 Ga0373937_0332805
1088 Ga0373937_0439312
1089 Ga0373937_1317919
1090 Ga0373937_1431048
1091 Ga0373925_0046031
1092 Ga0373925_0086153
1093 Ga0373925_0122071
1094 Ga0373925_0180127
1095 Ga0373925_0372197
1096 Ga0373925_0381923
1097 Ga0436364_0425880
1098 Ga0436364_0800479
1099 Ga0436365_0146471
1100 Ga0436365_0359684
1101 Ga0436365_0839417
1102 Ga0436365_1527269
1103 Ga0436361_0451205
1104 Ga0436363_0051780
1105 Ga0436363_0098895
1106 Ga0439448_0037267
1107 Ga0439450_002616
1108 Ga0439455_0169293
1109 Ga0495627_013334
1110 Ga0495592_0027186
1111 Ga0495592_0399182
1112 Ga0495603_0060470
1113 Ga0495603_0576606
1114 Ga0495629_0028510
1115 Ga0495629_0100028
1116 Ga0495638_0000904
1117 Ga0495638_0062195
1118 Ga0495638_0322039
1119 Ga0495641_0014778
1120 Ga0495651_0005894
1121 Ga0495651_0355374
1122 Ga0495651_0396545
1123 Ga0495651_0721775
1124 Ga0495653_0002617
1125 Ga0495653_0145179
1126 Ga0495653_0476311
1127 Ga0495653_0661058
1128 Ga0495580_0048169
1129 Ga0495580_0268794
1130 Ga0495580_0317007
1131 Ga0495582_0025385
1132 Ga0495582_0241483
1133 Ga0495639_0002862
1134 Ga0495639_0030792
1135 Ga0495662_0002617
1136 Ga0495662_0007696
1137 Ga0495662_0069009
1138 Ga0495662_0144361
1139 Ga0495664_0002556
1140 Ga0495664_0050669
1141 Ga0495584_0173220
1142 Ga0495594_0014698
1143 Ga0495594_0168524
1144 Ga0495607_0009728
1145 Ga0495608_0024386
1146 Ga0495608_0138063
1147 Ga0495610_0022421
1148 Ga0495616_0087015
1149 Ga0495618_0066697
1150 Ga0495620_0149223
1151 Ga0495628_0007753
1152 Ga0495628_0227626
1153 Ga0495628_0807185
1154 Ga0495630_0080450
1155 Ga0495630_0109612
1156 Ga0495630_0355257
1157 Ga0495637_0063378
1158 Ga0495663_0003803
1159 Ga0495666_0428708
1160 Ga0495652_0015920
1161 Ga0495652_0099829
1162 Ga0495652_0112830
1163 Ga0495652_0185014
1164 Ga0495652_0277673
1165 Ga0495652_0463947
1166 Ga0495665_0002284
1167 Ga0495665_0127956
1168 Ga0495665_0200777
1169 Ga0495665_0282381
1170 Ga0495640_0035356
1171 Ga0495640_0087288
1172 Ga0495640_0106159
1173 Ga0495640_0182744
1174 Ga0495640_0194874
1175 Ga0495587_0010972
1176 Ga0495587_0087714
1177 Ga0495587_0278376
1178 Ga0495598_0002282
1179 Ga0495598_0120500
1180 Ga0495609_0073223
1181 Ga0495621_0016954
1182 Ga0495645_0040519
1183 Ga0495645_0043632
1184 Ga0495645_0738769
1185 Ga0495622_0008078
1186 Ga0495622_0121176
1187 Ga0495633_0013142
1188 Ga0495633_0039608
1189 Ga0495633_0171668
1190 Ga0495633_0460749
1191 Ga0495667_0061515
1192 Ga0495667_0061880
1193 Ga0495667_0160158
1194 Ga0495667_0160218
1195 Ga0495667_0206472
1196 Ga0495656_0001097
1197 Ga0495656_0024890
1198 Ga0495634_0028566
1199 Ga0495634_0047658
1200 Ga0495634_0199213
1201 Ga0495635_0018733
1202 Ga0495635_0041501
1203 Ga0495635_0101294
1204 Ga0495659_0037068
1205 Ga0495659_0377327
1206 Ga0495661_0495736
1207 Ga0495588_0002233
1208 Ga0495588_0218589
1209 Ga0495657_0082523
1210 Ga0495599_0062398
1211 Ga0495599_0068921
1212 Ga0495646_0025191
1213 Ga0495646_0110983
1214 Ga0495646_0292382
1215 Ga0495646_0351297
1216 Ga0495647_0209649
1217 Ga0495647_0242806
1218 Ga0495658_0003902
1219 Ga0495658_0008767
1220 Ga0495658_0082211
1221 Ga0495658_0280933
1222 Ga0495613_0036851
1223 Ga0495613_0134762
1224 Ga0495613_0197777
1225 Ga0495624_0004671
1226 Ga0495624_0149608
1227 Ga0495670_0162647
1228 Ga0495649_0411569
1229 Ga0495600_0008687
1230 Ga0495600_0081796
1231 Ga0495600_0088859
1232 Ga0495600_0550580
1233 Ga0495660_0473445
1234 Ga0495581_0071690
1235 Ga0495581_0458735
1236 Ga0495604_0004875
1237 Ga0495604_0021033
1238 Ga0495604_0250359
1239 Ga0495636_0197922
1240 Ga0495674_0222344
1241 Ga0495674_0335431
1242 Ga0495674_0393547
1243 Ga0495672_0187195
1244 Ga0495676_0014436
1245 Ga0495680_0056602
1246 Ga0495680_0561780
1247 Ga0495680_0709949
1248 Ga0495675_0228028
1249 Ga0495685_147832
1250 Ga0495681_0033638
1251 Ga0495684_0014026
1252 Ga0495684_0063911
1253 Ga0495593_0209225
1254 Ga0495602_0042613
1255 Ga0495602_0222458
1256 Ga0495614_0015002
1257 Ga0495615_0077487
1258 Ga0496100_0033153
1259 Ga0496100_0674325
1260 Ga0496101_0014676
1261 Ga0496101_0142934
1262 Ga0496101_0195873
1263 Ga0496101_0388163
1264 Ga0496101_0959572
1265 Ga0496102_0078719
1266 Ga0496102_0783286
1267 Ga0496103_0253385
1268 Ga0496104_0118808
1269 Ga0496104_0119041
1270 Ga0496104_0502247
1271 Ga0496104_0940228
1272 Ga0496105_0063821
1273 Ga0496105_0496325
1274 Ga0496105_0672547
1275 Ga0496106_0123700
1276 Ga0496107_0034211
1277 Ga0496107_0113951
1278 Ga0496108_0634404
1279 Ga0496109_0310233
1280 Ga0496109_0758550
1281 Ga0496110_0265996
1282 Ga0496110_0865533
1283 Ga0496110_1146669
1284 Ga0496112_0054591
1285 Ga0496112_0075202
1286 Ga0496112_0247478
1287 Ga0496112_0272790
1288 Ga0496112_0453519
1289 Ga0496112_1239479
1290 Ga0496112_1689514
1291 Ga0496113_0034902
1292 Ga0496114_0040167
1293 Ga0496114_0187741
1294 Ga0496115_0191045
1295 Ga0496115_0252441
1296 Ga0496115_0338228
1297 Ga0496115_0341021
1298 Ga0496115_0348596
1299 Ga0496117_0008923
1300 Ga0496118_0003037
1301 Ga0496121_0010897
1302 Ga0496122_0005229
1303 Ga0496123_0008487
1304 Ga0496124_0027499
1305 Ga0496125_0115221
1306 Ga0496125_0177313
1307 Ga0496126_0035975
1308 Ga0496126_0422910
1309 Ga0501031_0228515
1310 Ga0501031_0598208
1311 Ga0501032_0251380
1312 Ga0501032_0731770
1313 Ga0501033_0074370
1314 Ga0501034_0024255
1315 Ga0501034_0035496
1316 Ga0501034_0491711
1317 Ga0501034_0504389
1318 Ga0501036_0015752
1319 Ga0501036_0132215
1320 Ga0501036_0138552
1321 Ga0501036_0284797
1322 Ga0501037_0004122
1323 Ga0501037_0654387
1324 Ga0501038_0011112
1325 Ga0501038_0018744
1326 Ga0501038_0144272
1327 Ga0501038_0252996
1328 Ga0501039_0007105
1329 Ga0501039_0028200
1330 Ga0501039_0318846
1331 Ga0501039_0523010
1332 Ga0501040_0010855
1333 Ga0501040_0149722
1334 Ga0501040_0595960
1335 Ga0501041_0047043
1336 Ga0501041_0159921
1337 Ga0501041_0936403
1338 Ga0501042_0096062
1339 Ga0501042_0167506
1340 Ga0501042_0220859
1341 Ga0501043_0156199
1342 Ga0501043_0229455
1343 Ga0501043_0249951
1344 Ga0501046_0377765
1345 Ga0501047_0001345
1346 Ga0501047_0008246
1347 Ga0501047_0010574
1348 Ga0501047_0088971
1349 Ga0501047_0485581
1350 Ga0501048_0011152
1351 Ga0501048_0057820
1352 Ga0501048_0456728
1353 Ga0501048_0507492
1354 Ga0501067_0025582
1355 Ga0501068_0406880
1356 Ga0501068_0880962
1357 Ga0501070_0001913
1358 Ga0501070_0010885
1359 Ga0501070_0296578
1360 Ga0501071_0249908
1361 Ga0501071_0286916
1362 Ga0501072_0336187
1363 Ga0501072_0631278
1364 Ga0501073_0016476
1365 Ga0501074_0221122
1366 Ga0501076_0415356
1367 Ga0501076_0921482
1368 Ga0501077_0107434
1369 Ga0501077_0120535
1370 Ga0501077_0126414
1371 Ga0501077_0338553
1372 Ga0501079_0044895
1373 Ga0501079_0074224
1374 Ga0501079_0094084
1375 Ga0501079_0137336
1376 Ga0501080_0000123
1377 Ga0501080_0696991
1378 Ga0501080_0727831
1379 Ga0501080_1034773
1380 Ga0501081_0008110
1381 Ga0501081_0014509
1382 Ga0501081_0020005
1383 Ga0501081_0067587
1384 Ga0501081_0161876
1385 Ga0501081_0313965
1386 Ga0501081_0602743
1387 Ga0501083_0032845
1388 Ga0501035_0000351
1389 Ga0501035_0005615
1390 Ga0501035_0727488
1391 Ga0501035_0761205
1392 Ga0501035_1203568
1393 Ga0501044_0000115
1394 Ga0501044_0335167
1395 Ga0501044_0473380
1396 Ga0501045_0056888
1397 Ga0501045_0175160
1398 Ga0501045_0637733
1399 nmdc:mga00v17_283231_c1
1400 nmdc:mga00v17_4313_c1
1401 nmdc:mga05p37_219_c1
1402 nmdc:mga05p37_2721_c1
1403 nmdc:mga09592_10181_c2
1404 nmdc:mga09592_2153_c1
1405 nmdc:mga09592_320380_c1
1406 nmdc:mga0qj67_1123_c1
1407 nmdc:mga0qj67_461_c1
1408 nmdc:mga06r32_1267_c1
1409 nmdc:mga06r32_274_c1
1410 nmdc:mga06r32_648269_c1
1411 nmdc:mga08y16_1013230_c1
1412 nmdc:mga08y16_33241_c1
1413 nmdc:mga08y16_526020_c1
1414 nmdc:mga08y16_91828_c1
1415 nmdc:mga0n895_124_c1
1416 nmdc:mga0n895_13539_c1
1417 nmdc:mga0n895_14980_c1
1418 nmdc:mga0n895_24552_c1
1419 nmdc:mga0n895_389398_c1
1420 nmdc:mga0rr50_1076_c1
1421 nmdc:mga0rr50_18904_c1
1422 nmdc:mga0rr50_33598_c1
1423 nmdc:mga0rr50_424618_c1
1424 nmdc:mga0a205_114771_c1
1425 nmdc:mga0a205_126375_c1
1426 nmdc:mga0a205_97_c1
1427 Ga0495601_0004970
1428 Ga0495601_0034259
1429 Ga0495601_0054061
1430 Ga0495601_0214093
1431 Ga0495601_0608361
1432 Ga0495601_0732103
1433 Ga0495612_0007621
1434 Ga0495612_0017518
1435 Ga0495612_0020413
1436 Ga0495612_0031153
1437 Ga0495612_0035845
1438 Ga0495612_0094055
1439 Ga0495595_0016434
1440 Ga0495595_0021696
1441 Ga0495595_0136820
1442 Ga0495595_0177798
1443 Ga0495619_0002196
1444 Ga0495619_0004292
1445 Ga0495619_0011444
1446 Ga0495619_0281246
1447 Ga0500643_002669
1448 Ga0500644_0000774
1449 Ga0500651_0015949
1450 Ga0500651_0217770
1451 Ga0500566_0037182
1452 Ga0500594_0116434
1453 Ga0500595_000029
1454 Ga0500626_094718
1455 Ga0500652_003938
1456 Ga0500652_088819
1457 Ga0500616_0000006
1458 Ga0500616_0026910
1459 Ga0500624_000091
1460 Ga0500645_001244
1461 Ga0500645_085939
1462 Ga0501084_0206768
1463 Ga0501084_0460646
1464 Ga0501084_0466344
1465 Ga0501082_0039725
1466 Ga0501082_0186819
1467 Ga0501082_0203629
1468 Ga0501082_0624283
1469 Ga0501082_0864853
1470 Ga0530510_0442341
1471 2545675842
1472 2643755285
1473 2739649517
1474 2740027990
1475 2792747671
1476 2874612342
1477 2889015355
1478 2896184457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

11

136

0.98

Map