F478442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 433 | 681 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_101912113|Ga0070689_1019121131 |
| Length | 135 |
| Sequence | MITTRYLPFVGRLMIGLPFAMSGLGKLGTYGATTAMIGAAGLPLPPLAYAELGGGLLLVAGYRVRLVAVALAVFTLAAAISFHGNFADQNQMIHFLKNVMMAGGLLQIAAFGAGALSLDHRRSNGQLTPSPTVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 4 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 5 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 6 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 7 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 8 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 9 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 10 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 11 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 12 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 13 | 2922368715 | |||
| 14 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 15 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 16 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 17 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 18 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 19 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 20 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 21 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 22 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 23 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 24 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 25 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 26 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 27 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 28 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 29 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 30 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 31 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 32 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 33 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 34 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 35 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 36 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 37 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 38 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 39 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 40 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 41 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 42 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 43 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 44 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 45 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 46 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 47 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 48 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 49 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 50 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 51 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 52 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 53 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 54 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 56 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 119 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 128 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 134 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 135 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 136 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 137 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 138 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 142 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 159 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 160 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 161 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 162 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 163 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 245 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 250 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 251 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 252 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 279 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 280 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 281 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 372 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 373 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 374 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 375 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 381 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 397 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 401 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 402 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 403 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 404 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 407 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 408 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 426 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 427 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 428 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 429 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 430 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 431 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 432 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 433 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.14 |
| Metatranscriptomes | 0.14 |
| Isolates | 7.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.18 |
| Nodule | 6.36 |
| Rhizoplane | 7.98 |
| Rhizosphere | 67.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1029064 | 3300001904 | Bacteria | 855 |
| 2 | JGI24739J22299_10159857 | 3300001989 | Bacteria | 665 |
| 3 | JGI25162J39368_1001596 | 3300002737 | Bacteria | 11415 |
| 4 | JGI25159J45721_1000015 | 3300002987 | Bacteria | 142431 |
| 5 | JGI25165J46597_1000280 | 3300003214 | Bacteria | 65126 |
| 6 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 7 | JGI25161J50226_1002742 | 3300003374 | Bacteria | 4345 |
| 8 | Ga0055526_1007083 | 3300003771 | Bacteria | 5923 |
| 9 | Ga0055524_1041650 | 3300003775 | Bacteria | 1154 |
| 10 | Ga0055536_1001123 | 3300003781 | Bacteria | 16800 |
| 11 | Ga0055536_1041459 | 3300003781 | Bacteria | 1086 |
| 12 | Ga0055530_10004321 | 3300003791 | Bacteria | 7390 |
| 13 | Ga0055530_10023186 | 3300003791 | Bacteria | 1789 |
| 14 | Ga0055540_1041907 | 3300003792 | Bacteria | 984 |
| 15 | Ga0055531_10000697 | 3300003794 | Bacteria | 28671 |
| 16 | Ga0055531_10044523 | 3300003794 | Bacteria | 1243 |
| 17 | Ga0055543_1000034 | 3300004625 | Bacteria | 128668 |
| 18 | Ga0065165_1000025 | 3300005262 | Bacteria | 246909 |
| 19 | Ga0070690_100645102 | 3300005330 | Bacteria | 808 |
| 20 | Ga0070670_100331594 | 3300005331 | Bacteria | 1334 |
| 21 | Ga0070677_10476250 | 3300005333 | Bacteria | 672 |
| 22 | Ga0070666_10031914 | 3300005335 | Bacteria | 3479 |
| 23 | Ga0070666_10162265 | 3300005335 | Bacteria | 1562 |
| 24 | Ga0070680_100541876 | 3300005336 | Bacteria | 997 |
| 25 | Ga0070682_100033993 | 3300005337 | Bacteria | 3101 |
| 26 | Ga0068868_100336151 | 3300005338 | Bacteria | 1290 |
| 27 | Ga0068868_100420909 | 3300005338 | Bacteria | 1156 |
| 28 | Ga0070689_100461258 | 3300005340 | Bacteria | 1082 |
| 29 | Ga0070689_101912113 | 3300005340 | Bacteria | 542 |
| 30 | Ga0070691_10333830 | 3300005341 | Bacteria | 837 |
| 31 | Ga0070687_100100429 | 3300005343 | Bacteria | 1619 |
| 32 | Ga0070661_100049498 | 3300005344 | Bacteria | 3076 |
| 33 | Ga0070668_100036882 | 3300005347 | Bacteria | 3731 |
| 34 | Ga0070669_100000438 | 3300005353 | Bacteria | 31742 |
| 35 | Ga0070669_100691660 | 3300005353 | Bacteria | 860 |
| 36 | Ga0070675_100415925 | 3300005354 | Bacteria | 1202 |
| 37 | Ga0070675_101883211 | 3300005354 | Bacteria | 552 |
| 38 | Ga0070671_100059070 | 3300005355 | Bacteria | 3191 |
| 39 | Ga0070671_100144711 | 3300005355 | Bacteria | 2006 |
| 40 | Ga0070674_100152366 | 3300005356 | Bacteria | 1746 |
| 41 | Ga0070673_100023208 | 3300005364 | Bacteria | 4530 |
| 42 | Ga0070673_101626359 | 3300005364 | Bacteria | 611 |
| 43 | Ga0070688_100640354 | 3300005365 | Bacteria | 818 |
| 44 | Ga0070667_100066963 | 3300005367 | Bacteria | 3052 |
| 45 | Ga0070709_10006594 | 3300005434 | Bacteria | 6332 |
| 46 | Ga0070709_10256865 | 3300005434 | Bacteria | 1261 |
| 47 | Ga0070714_100024651 | 3300005435 | Bacteria | 4956 |
| 48 | Ga0070714_100050162 | 3300005435 | Bacteria | 3554 |
| 49 | Ga0070714_100120710 | 3300005435 | Bacteria | 2331 |
| 50 | Ga0070714_100900473 | 3300005435 | Bacteria | 859 |
| 51 | Ga0070713_100013850 | 3300005436 | Bacteria | 5968 |
| 52 | Ga0070713_100022038 | 3300005436 | Bacteria | 4915 |
| 53 | Ga0070713_100115085 | 3300005436 | Bacteria | 2350 |
| 54 | Ga0070713_100216049 | 3300005436 | Bacteria | 1738 |
| 55 | Ga0070713_100254892 | 3300005436 | Bacteria | 1602 |
| 56 | Ga0070710_10006716 | 3300005437 | Bacteria | 5545 |
| 57 | Ga0070710_10383336 | 3300005437 | Bacteria | 938 |
| 58 | Ga0070710_10753845 | 3300005437 | Bacteria | 692 |
| 59 | Ga0070711_100011825 | 3300005439 | Bacteria | 5431 |
| 60 | Ga0070711_100074143 | 3300005439 | Bacteria | 2406 |
| 61 | Ga0070711_100138930 | 3300005439 | Bacteria | 1819 |
| 62 | Ga0070711_100544071 | 3300005439 | Bacteria | 962 |
| 63 | Ga0070711_100630139 | 3300005439 | Bacteria | 897 |
| 64 | Ga0070711_101216695 | 3300005439 | Bacteria | 652 |
| 65 | Ga0070663_100058160 | 3300005455 | Bacteria | 2775 |
| 66 | Ga0070663_100214577 | 3300005455 | Bacteria | 1508 |
| 67 | Ga0070678_100041051 | 3300005456 | Bacteria | 3277 |
| 68 | Ga0070681_10296286 | 3300005458 | Bacteria | 1527 |
| 69 | Ga0070685_10033295 | 3300005466 | Bacteria | 2894 |
| 70 | Ga0070706_100265211 | 3300005467 | Bacteria | 1603 |
| 71 | Ga0070706_100564086 | 3300005467 | Bacteria | 1059 |
| 72 | Ga0070706_100929972 | 3300005467 | Bacteria | 803 |
| 73 | Ga0070706_101064456 | 3300005467 | Bacteria | 745 |
| 74 | Ga0070707_100773233 | 3300005468 | Bacteria | 924 |
| 75 | Ga0070698_100352319 | 3300005471 | Bacteria | 1404 |
| 76 | Ga0070698_100588372 | 3300005471 | Bacteria | 1053 |
| 77 | Ga0070698_100746413 | 3300005471 | Bacteria | 922 |
| 78 | Ga0070699_100682520 | 3300005518 | Bacteria | 938 |
| 79 | Ga0070699_101431738 | 3300005518 | Bacteria | 634 |
| 80 | Ga0070679_100044161 | 3300005530 | Bacteria | 4440 |
| 81 | Ga0070684_100250152 | 3300005535 | Bacteria | 1620 |
| 82 | Ga0070684_100250578 | 3300005535 | Bacteria | 1618 |
| 83 | Ga0070684_100280207 | 3300005535 | Bacteria | 1527 |
| 84 | Ga0070697_101163105 | 3300005536 | Bacteria | 687 |
| 85 | Ga0070697_101407977 | 3300005536 | Bacteria | 623 |
| 86 | Ga0070697_102092728 | 3300005536 | Bacteria | 507 |
| 87 | Ga0068853_100209856 | 3300005539 | Bacteria | 1775 |
| 88 | Ga0070672_100249124 | 3300005543 | Bacteria | 1496 |
| 89 | Ga0070686_100028574 | 3300005544 | Bacteria | 3383 |
| 90 | Ga0070696_100694322 | 3300005546 | Bacteria | 829 |
| 91 | Ga0070693_100394740 | 3300005547 | Bacteria | 958 |
| 92 | Ga0070665_100128511 | 3300005548 | Bacteria | 2537 |
| 93 | Ga0070665_100504232 | 3300005548 | Bacteria | 1221 |
| 94 | Ga0070664_100252839 | 3300005564 | Bacteria | 1584 |
| 95 | Ga0070664_100508563 | 3300005564 | Bacteria | 1111 |
| 96 | Ga0068857_100202889 | 3300005577 | Bacteria | 1808 |
| 97 | Ga0068857_100230824 | 3300005577 | Bacteria | 1693 |
| 98 | Ga0068857_100562902 | 3300005577 | Bacteria | 1075 |
| 99 | Ga0068856_100081658 | 3300005614 | Bacteria | 3207 |
| 100 | Ga0068856_101457596 | 3300005614 | Bacteria | 699 |
| 101 | Ga0068856_102235263 | 3300005614 | Bacteria | 556 |
| 102 | Ga0070702_100164382 | 3300005615 | Bacteria | 1437 |
| 103 | Ga0068852_100822318 | 3300005616 | Bacteria | 944 |
| 104 | Ga0068859_100212221 | 3300005617 | Bacteria | 2022 |
| 105 | Ga0068864_100072302 | 3300005618 | Bacteria | 3005 |
| 106 | Ga0068861_101273324 | 3300005719 | Bacteria | 714 |
| 107 | Ga0068851_10359222 | 3300005834 | Bacteria | 849 |
| 108 | Ga0068863_100190180 | 3300005841 | Bacteria | 1972 |
| 109 | Ga0068863_100234561 | 3300005841 | Bacteria | 1770 |
| 110 | Ga0068863_100311724 | 3300005841 | Bacteria | 1527 |
| 111 | Ga0068863_102418364 | 3300005841 | Bacteria | 535 |
| 112 | Ga0068858_100167886 | 3300005842 | Bacteria | 2068 |
| 113 | Ga0068858_100546155 | 3300005842 | Bacteria | 1122 |
| 114 | Ga0068858_100825267 | 3300005842 | Bacteria | 905 |
| 115 | Ga0068860_100340567 | 3300005843 | Bacteria | 1474 |
| 116 | Ga0068862_100580020 | 3300005844 | Bacteria | 1074 |
| 117 | Ga0081538_10036483 | 3300005981 | Bacteria | 3206 |
| 118 | Ga0070717_10002063 | 3300006028 | Bacteria | 14061 |
| 119 | Ga0070717_10007835 | 3300006028 | Bacteria | 7949 |
| 120 | Ga0070717_10014255 | 3300006028 | Bacteria | 6113 |
| 121 | Ga0070717_10063991 | 3300006028 | Bacteria | 3054 |
| 122 | Ga0070717_10167061 | 3300006028 | Bacteria | 1912 |
| 123 | Ga0070717_10260551 | 3300006028 | Bacteria | 1534 |
| 124 | Ga0070717_10524093 | 3300006028 | Bacteria | 1072 |
| 125 | Ga0070717_10605578 | 3300006028 | Bacteria | 994 |
| 126 | Ga0075365_10024860 | 3300006038 | Bacteria | 3785 |
| 127 | Ga0075363_100196048 | 3300006048 | Bacteria | 1153 |
| 128 | Ga0075364_10090133 | 3300006051 | Bacteria | 2034 |
| 129 | Ga0070715_10004890 | 3300006163 | Bacteria | 4439 |
| 130 | Ga0070715_10034619 | 3300006163 | Bacteria | 2072 |
| 131 | Ga0070716_100003451 | 3300006173 | Bacteria | 7443 |
| 132 | Ga0070716_100007047 | 3300006173 | Bacteria | 5516 |
| 133 | Ga0070716_100780373 | 3300006173 | Bacteria | 738 |
| 134 | Ga0070712_100267905 | 3300006175 | Bacteria | 1371 |
| 135 | Ga0070712_100321967 | 3300006175 | Bacteria | 1257 |
| 136 | Ga0070712_100442663 | 3300006175 | Bacteria | 1081 |
| 137 | Ga0070712_100594498 | 3300006175 | Bacteria | 936 |
| 138 | Ga0070712_100749308 | 3300006175 | Bacteria | 836 |
| 139 | Ga0075362_10143408 | 3300006177 | Bacteria | 1142 |
| 140 | Ga0075367_10240951 | 3300006178 | Bacteria | 1133 |
| 141 | Ga0075367_10316159 | 3300006178 | Bacteria | 984 |
| 142 | Ga0075367_10712549 | 3300006178 | Bacteria | 638 |
| 143 | Ga0075369_10131074 | 3300006186 | Bacteria | 1139 |
| 144 | Ga0075369_10441910 | 3300006186 | Bacteria | 615 |
| 145 | Ga0075366_10012033 | 3300006195 | Bacteria | 4901 |
| 146 | Ga0097621_100024299 | 3300006237 | Unclassified | 4731 |
| 147 | Ga0097621_100102101 | 3300006237 | Bacteria | 2414 |
| 148 | Ga0075370_10083286 | 3300006353 | Bacteria | 1840 |
| 149 | Ga0068871_100053351 | 3300006358 | Bacteria | 3276 |
| 150 | Ga0068871_100066751 | 3300006358 | Bacteria | 2949 |
| 151 | Ga0068871_100144834 | 3300006358 | Bacteria | 2022 |
| 152 | Ga0075428_100194112 | 3300006844 | Bacteria | 2196 |
| 153 | Ga0075430_100456992 | 3300006846 | Bacteria | 1054 |
| 154 | Ga0075431_100700520 | 3300006847 | Bacteria | 990 |
| 155 | Ga0075433_10090020 | 3300006852 | Bacteria | 2712 |
| 156 | Ga0075433_10313534 | 3300006852 | Bacteria | 1388 |
| 157 | Ga0068865_100065878 | 3300006881 | Bacteria | 2554 |
| 158 | Ga0068865_100738678 | 3300006881 | Bacteria | 844 |
| 159 | Ga0075436_100392603 | 3300006914 | Bacteria | 1004 |
| 160 | Ga0097620_100212229 | 3300006931 | Bacteria | 2022 |
| 161 | Ga0075435_100009745 | 3300007076 | Bacteria | 6983 |
| 162 | Ga0075435_100391737 | 3300007076 | Bacteria | 1194 |
| 163 | Ga0075435_100570558 | 3300007076 | Bacteria | 980 |
| 164 | Ga0099795_10023932 | 3300007788 | Bacteria | 2031 |
| 165 | Ga0099795_10048771 | 3300007788 | Bacteria | 1535 |
| 166 | Ga0099795_10094602 | 3300007788 | Bacteria | 1163 |
| 167 | Ga0105251_10029408 | 3300009011 | Bacteria | 2768 |
| 168 | Ga0105250_10224504 | 3300009092 | Bacteria | 797 |
| 169 | Ga0105240_11079200 | 3300009093 | Unclassified | 855 |
| 170 | Ga0111539_10090477 | 3300009094 | Bacteria | 3596 |
| 171 | Ga0111539_10843425 | 3300009094 | Bacteria | 1066 |
| 172 | Ga0105245_10321862 | 3300009098 | Bacteria | 1524 |
| 173 | Ga0105245_11141935 | 3300009098 | Bacteria | 826 |
| 174 | Ga0105247_10165485 | 3300009101 | Bacteria | 1467 |
| 175 | Ga0105247_10273143 | 3300009101 | Bacteria | 1163 |
| 176 | Ga0105247_11261842 | 3300009101 | Bacteria | 591 |
| 177 | Ga0114129_10079908 | 3300009147 | Bacteria | 4546 |
| 178 | Ga0105243_10069112 | 3300009148 | Bacteria | 2848 |
| 179 | Ga0105243_10798501 | 3300009148 | Bacteria | 930 |
| 180 | Ga0105243_12295722 | 3300009148 | Bacteria | 577 |
| 181 | Ga0105241_10132181 | 3300009174 | Bacteria | 2022 |
| 182 | Ga0105242_10150596 | 3300009176 | Bacteria | 2028 |
| 183 | Ga0105248_10048981 | 3300009177 | Bacteria | 4739 |
| 184 | Ga0105248_10096567 | 3300009177 | Bacteria | 3329 |
| 185 | Ga0105248_10290835 | 3300009177 | Bacteria | 1840 |
| 186 | Ga0105248_10293218 | 3300009177 | Bacteria | 1832 |
| 187 | Ga0105237_10065253 | 3300009545 | Bacteria | 3637 |
| 188 | Ga0105237_10071604 | 3300009545 | Bacteria | 3461 |
| 189 | Ga0105237_10497877 | 3300009545 | Bacteria | 1225 |
| 190 | Ga0105238_10087189 | 3300009551 | Bacteria | 3108 |
| 191 | Ga0105238_10571889 | 3300009551 | Bacteria | 1136 |
| 192 | Ga0105238_10816175 | 3300009551 | Bacteria | 949 |
| 193 | Ga0105238_10860645 | 3300009551 | Bacteria | 924 |
| 194 | Ga0099796_10074170 | 3300010159 | Bacteria | 1235 |
| 195 | Ga0099796_10194774 | 3300010159 | Bacteria | 820 |
| 196 | Ga0099796_10227893 | 3300010159 | Bacteria | 766 |
| 197 | Ga0105239_10435458 | 3300010375 | Bacteria | 1486 |
| 198 | Ga0105239_10695543 | 3300010375 | Bacteria | 1162 |
| 199 | Ga0105246_10142512 | 3300011119 | Bacteria | 1804 |
| 200 | Ga0157346_1003875 | 3300012480 | Bacteria | 858 |
| 201 | Ga0157321_1006128 | 3300012487 | Bacteria | 810 |
| 202 | Ga0157341_1002933 | 3300012494 | Bacteria | 1162 |
| 203 | Ga0157324_1031631 | 3300012506 | Bacteria | 603 |
| 204 | Ga0157342_1006762 | 3300012507 | Bacteria | 1096 |
| 205 | Ga0157327_1020250 | 3300012512 | Bacteria | 744 |
| 206 | Ga0157369_10050653 | 3300013105 | Bacteria | 4496 |
| 207 | Ga0157369_10414934 | 3300013105 | Bacteria | 1396 |
| 208 | Ga0157374_10364707 | 3300013296 | Bacteria | 1437 |
| 209 | Ga0157378_10078599 | 3300013297 | Bacteria | 2977 |
| 210 | Ga0157378_11173336 | 3300013297 | Bacteria | 807 |
| 211 | Ga0163162_10241776 | 3300013306 | Bacteria | 1936 |
| 212 | Ga0163162_10476677 | 3300013306 | Bacteria | 1379 |
| 213 | Ga0163162_10810763 | 3300013306 | Bacteria | 1053 |
| 214 | Ga0157375_10505267 | 3300013308 | Bacteria | 1373 |
| 215 | Ga0157375_11503301 | 3300013308 | Bacteria | 795 |
| 216 | Ga0157375_12519970 | 3300013308 | Bacteria | 614 |
| 217 | Ga0163163_10182975 | 3300014325 | Bacteria | 2143 |
| 218 | Ga0163163_10646726 | 3300014325 | Bacteria | 1121 |
| 219 | Ga0163163_10870736 | 3300014325 | Bacteria | 964 |
| 220 | Ga0163163_11575952 | 3300014325 | Bacteria | 718 |
| 221 | Ga0157377_10466010 | 3300014745 | Bacteria | 876 |
| 222 | Ga0157377_11064020 | 3300014745 | Bacteria | 617 |
| 223 | Ga0157379_10182921 | 3300014968 | Bacteria | 1893 |
| 224 | Ga0157376_10103099 | 3300014969 | Bacteria | 2497 |
| 225 | Ga0163161_10660159 | 3300017792 | Bacteria | 867 |
| 226 | Ga0209436_100130 | 3300025208 | Bacteria | 37375 |
| 227 | Ga0209437_100281 | 3300025233 | Bacteria | 74945 |
| 228 | Ga0207425_1011713 | 3300025245 | Bacteria | 2079 |
| 229 | Ga0209646_1004247 | 3300025246 | Bacteria | 2639 |
| 230 | Ga0209233_1000267 | 3300025261 | Bacteria | 74945 |
| 231 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 232 | Ga0209676_1001348 | 3300025292 | Bacteria | 24430 |
| 233 | Ga0209676_1001927 | 3300025292 | Bacteria | 16772 |
| 234 | Ga0209025_1000105 | 3300025294 | Bacteria | 224157 |
| 235 | Ga0209564_1000113 | 3300025295 | Bacteria | 211564 |
| 236 | Ga0209758_1030383 | 3300025297 | Bacteria | 2239 |
| 237 | Ga0209050_1000644 | 3300025298 | Bacteria | 54118 |
| 238 | Ga0209050_1001277 | 3300025298 | Bacteria | 28847 |
| 239 | Ga0209050_1005247 | 3300025298 | Bacteria | 8259 |
| 240 | Ga0209256_1002435 | 3300025299 | Bacteria | 15208 |
| 241 | Ga0209256_1044068 | 3300025299 | Bacteria | 1116 |
| 242 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 243 | Ga0209051_1001056 | 3300025303 | Bacteria | 25758 |
| 244 | Ga0209051_1013495 | 3300025303 | Bacteria | 3886 |
| 245 | Ga0209257_1001078 | 3300025304 | Bacteria | 35791 |
| 246 | Ga0209257_1001948 | 3300025304 | Bacteria | 22281 |
| 247 | Ga0209257_1016366 | 3300025304 | Bacteria | 3004 |
| 248 | Ga0207656_10369960 | 3300025321 | Bacteria | 717 |
| 249 | Ga0207713_1029276 | 3300025735 | Bacteria | 2469 |
| 250 | Ga0207692_10007178 | 3300025898 | Bacteria | 4553 |
| 251 | Ga0207692_10015010 | 3300025898 | Bacteria | 3399 |
| 252 | Ga0207692_10308877 | 3300025898 | Bacteria | 965 |
| 253 | Ga0207710_10025982 | 3300025900 | Bacteria | 2529 |
| 254 | Ga0207710_10169683 | 3300025900 | Bacteria | 1066 |
| 255 | Ga0207710_10601175 | 3300025900 | Bacteria | 575 |
| 256 | Ga0207680_10133162 | 3300025903 | Bacteria | 1640 |
| 257 | Ga0207647_10114051 | 3300025904 | Bacteria | 1597 |
| 258 | Ga0207647_10535633 | 3300025904 | Bacteria | 651 |
| 259 | Ga0207685_10034813 | 3300025905 | Bacteria | 1833 |
| 260 | Ga0207699_10001770 | 3300025906 | Bacteria | 10191 |
| 261 | Ga0207699_10004550 | 3300025906 | Bacteria | 6625 |
| 262 | Ga0207645_10227402 | 3300025907 | Bacteria | 1231 |
| 263 | Ga0207684_10775129 | 3300025910 | Bacteria | 812 |
| 264 | Ga0207707_10226485 | 3300025912 | Bacteria | 1627 |
| 265 | Ga0207671_10190002 | 3300025914 | Bacteria | 1601 |
| 266 | Ga0207671_10351449 | 3300025914 | Bacteria | 1169 |
| 267 | Ga0207693_10001772 | 3300025915 | Bacteria | 18926 |
| 268 | Ga0207693_10110901 | 3300025915 | Bacteria | 2151 |
| 269 | Ga0207693_10238157 | 3300025915 | Bacteria | 1429 |
| 270 | Ga0207693_10432850 | 3300025915 | Bacteria | 1028 |
| 271 | Ga0207663_10008912 | 3300025916 | Bacteria | 5276 |
| 272 | Ga0207663_10052746 | 3300025916 | Bacteria | 2538 |
| 273 | Ga0207663_10070638 | 3300025916 | Bacteria | 2250 |
| 274 | Ga0207663_10407751 | 3300025916 | Bacteria | 1041 |
| 275 | Ga0207663_10949536 | 3300025916 | Bacteria | 689 |
| 276 | Ga0207657_10272274 | 3300025919 | Bacteria | 1346 |
| 277 | Ga0207657_10330779 | 3300025919 | Bacteria | 1203 |
| 278 | Ga0207649_11024230 | 3300025920 | Bacteria | 650 |
| 279 | Ga0207652_10010590 | 3300025921 | Bacteria | 7422 |
| 280 | Ga0207646_10631306 | 3300025922 | Bacteria | 960 |
| 281 | Ga0207681_10000037 | 3300025923 | Bacteria | 154417 |
| 282 | Ga0207694_10427688 | 3300025924 | Bacteria | 1104 |
| 283 | Ga0207650_10083520 | 3300025925 | Bacteria | 2426 |
| 284 | Ga0207650_10266822 | 3300025925 | Bacteria | 1390 |
| 285 | Ga0207687_10012794 | 3300025927 | Bacteria | 5483 |
| 286 | Ga0207687_10912353 | 3300025927 | Bacteria | 752 |
| 287 | Ga0207700_10004844 | 3300025928 | Bacteria | 7991 |
| 288 | Ga0207700_10010379 | 3300025928 | Bacteria | 5873 |
| 289 | Ga0207700_10400548 | 3300025928 | Bacteria | 1203 |
| 290 | Ga0207700_10539799 | 3300025928 | Bacteria | 1034 |
| 291 | Ga0207700_10597867 | 3300025928 | Bacteria | 982 |
| 292 | Ga0207700_10625256 | 3300025928 | Bacteria | 959 |
| 293 | Ga0207664_10007907 | 3300025929 | Bacteria | 7387 |
| 294 | Ga0207664_10763708 | 3300025929 | Bacteria | 869 |
| 295 | Ga0207644_10041350 | 3300025931 | Bacteria | 3260 |
| 296 | Ga0207644_10114805 | 3300025931 | Bacteria | 2041 |
| 297 | Ga0207644_10143676 | 3300025931 | Bacteria | 1840 |
| 298 | Ga0207690_10148701 | 3300025932 | Bacteria | 1734 |
| 299 | Ga0207690_10361681 | 3300025932 | Bacteria | 1150 |
| 300 | Ga0207706_10053868 | 3300025933 | Bacteria | 3551 |
| 301 | Ga0207706_10551467 | 3300025933 | Bacteria | 992 |
| 302 | Ga0207686_10034580 | 3300025934 | Bacteria | 3026 |
| 303 | Ga0207709_10164742 | 3300025935 | Bacteria | 1550 |
| 304 | Ga0207709_11356654 | 3300025935 | Bacteria | 588 |
| 305 | Ga0207704_10195864 | 3300025938 | Bacteria | 1474 |
| 306 | Ga0207665_10001072 | 3300025939 | Bacteria | 18388 |
| 307 | Ga0207665_10004233 | 3300025939 | Bacteria | 9549 |
| 308 | Ga0207665_10026869 | 3300025939 | Bacteria | 3801 |
| 309 | Ga0207665_10037803 | 3300025939 | Bacteria | 3213 |
| 310 | Ga0207665_10458333 | 3300025939 | Bacteria | 979 |
| 311 | Ga0207665_10567784 | 3300025939 | Bacteria | 883 |
| 312 | Ga0207691_10046346 | 3300025940 | Bacteria | 3995 |
| 313 | Ga0207711_10025595 | 3300025941 | Bacteria | 4949 |
| 314 | Ga0207711_10033852 | 3300025941 | Bacteria | 4325 |
| 315 | Ga0207711_10434829 | 3300025941 | Bacteria | 1221 |
| 316 | Ga0207661_10111892 | 3300025944 | Bacteria | 2310 |
| 317 | Ga0207661_10178685 | 3300025944 | Bacteria | 1852 |
| 318 | Ga0207679_10084323 | 3300025945 | Bacteria | 2438 |
| 319 | Ga0207667_10230320 | 3300025949 | Bacteria | 1897 |
| 320 | Ga0207651_10294295 | 3300025960 | Bacteria | 1347 |
| 321 | Ga0207668_10140262 | 3300025972 | Bacteria | 1858 |
| 322 | Ga0207668_10157418 | 3300025972 | Bacteria | 1766 |
| 323 | Ga0207668_10688752 | 3300025972 | Unclassified | 897 |
| 324 | Ga0207668_10979739 | 3300025972 | Bacteria | 755 |
| 325 | Ga0207658_10129624 | 3300025986 | Bacteria | 2024 |
| 326 | Ga0207677_10141054 | 3300026023 | Bacteria | 1845 |
| 327 | Ga0207703_10101418 | 3300026035 | Bacteria | 2440 |
| 328 | Ga0207703_10279671 | 3300026035 | Bacteria | 1515 |
| 329 | Ga0207703_10482658 | 3300026035 | Bacteria | 1161 |
| 330 | Ga0207639_10514690 | 3300026041 | Bacteria | 1095 |
| 331 | Ga0207678_10090345 | 3300026067 | Bacteria | 2618 |
| 332 | Ga0207678_10146846 | 3300026067 | Bacteria | 2013 |
| 333 | Ga0207678_10189873 | 3300026067 | Bacteria | 1755 |
| 334 | Ga0207708_10073466 | 3300026075 | Bacteria | 2621 |
| 335 | Ga0207702_10299535 | 3300026078 | Bacteria | 1526 |
| 336 | Ga0207702_10585597 | 3300026078 | Bacteria | 1094 |
| 337 | Ga0207641_10177653 | 3300026088 | Bacteria | 1947 |
| 338 | Ga0207641_10545956 | 3300026088 | Bacteria | 1130 |
| 339 | Ga0207648_10174815 | 3300026089 | Bacteria | 1899 |
| 340 | Ga0207676_10284533 | 3300026095 | Bacteria | 1502 |
| 341 | Ga0207676_10321976 | 3300026095 | Bacteria | 1420 |
| 342 | Ga0207674_10086582 | 3300026116 | Bacteria | 3128 |
| 343 | Ga0207674_10288352 | 3300026116 | Bacteria | 1590 |
| 344 | Ga0207675_101888401 | 3300026118 | Bacteria | 616 |
| 345 | Ga0207683_10017427 | 3300026121 | Bacteria | 6122 |
| 346 | Ga0207683_10266726 | 3300026121 | Bacteria | 1564 |
| 347 | Ga0207698_10237013 | 3300026142 | Bacteria | 1660 |
| 348 | Ga0209179_1054300 | 3300027512 | Bacteria | 863 |
| 349 | Ga0209588_1016132 | 3300027671 | Bacteria | 2303 |
| 350 | Ga0209588_1190935 | 3300027671 | Bacteria | 640 |
| 351 | Ga0207428_10086181 | 3300027907 | Bacteria | 2445 |
| 352 | Ga0207428_10424925 | 3300027907 | Bacteria | 971 |
| 353 | Ga0207428_11316093 | 3300027907 | Bacteria | 500 |
| 354 | Ga0265354_1004635 | 3300028016 | Bacteria | 1431 |
| 355 | Ga0265355_1011388 | 3300028036 | Bacteria | 731 |
| 356 | Ga0268266_10033064 | 3300028379 | Bacteria | 4397 |
| 357 | Ga0268265_10030300 | 3300028380 | Bacteria | 3895 |
| 358 | Ga0268264_10101786 | 3300028381 | Bacteria | 2498 |
| 359 | Ga0307517_10285537 | 3300028786 | Bacteria | 937 |
| 360 | Ga0307515_10058325 | 3300028794 | Bacteria | 5562 |
| 361 | Ga0307515_10420527 | 3300028794 | Bacteria | 957 |
| 362 | Ga0307511_10022068 | 3300030521 | Bacteria | 5975 |
| 363 | Ga0307511_10063150 | 3300030521 | Bacteria | 2801 |
| 364 | Ga0265770_1000015 | 3300030878 | Bacteria | 17088 |
| 365 | Ga0307509_10139206 | 3300031507 | Bacteria | 2366 |
| 366 | Ga0307508_10033908 | 3300031616 | Bacteria | 4604 |
| 367 | Ga0307508_10305488 | 3300031616 | Bacteria | 1183 |
| 368 | Ga0307516_10000276 | 3300031730 | Bacteria | 66471 |
| 369 | Ga0307507_10069784 | 3300033179 | Bacteria | 3194 |
| 370 | Ga0307510_10008458 | 3300033180 | Bacteria | 12263 |
| 371 | Ga0307510_10134756 | 3300033180 | Bacteria | 2131 |
| 372 | Ga0307510_10157839 | 3300033180 | Bacteria | 1872 |
| 373 | Ga0307510_10177098 | 3300033180 | Bacteria | 1702 |
| 374 | Ga0316215_1029823 | 3300033544 | Bacteria | 565 |
| 375 | Ga0373930_0023479 | 3300034816 | Bacteria | 1226 |
| 376 | Ga0373951_0075716 | 3300035091 | Bacteria | 864 |
| 377 | Ga0373952_0019801 | 3300035092 | Bacteria | 1405 |
| 378 | Ga0373939_0403998 | 3300035114 | Bacteria | 566 |
| 379 | Ga0373941_0187392 | 3300035115 | Bacteria | 780 |
| 380 | Ga0373945_0043635 | 3300035116 | Bacteria | 1628 |
| 381 | Ga0373954_0181451 | 3300035118 | Bacteria | 1032 |
| 382 | Ga0373960_0201203 | 3300035121 | Bacteria | 704 |
| 383 | Ga0373943_0039152 | 3300035170 | Bacteria | 2283 |
| 384 | Ga0373946_0026637 | 3300035171 | Bacteria | 2282 |
| 385 | Ga0373946_0414032 | 3300035171 | Bacteria | 682 |
| 386 | Ga0373955_0549519 | 3300035172 | Bacteria | 706 |
| 387 | Ga0373961_0012586 | 3300035241 | Bacteria | 2121 |
| 388 | Ga0373931_0129183 | 3300035691 | Bacteria | 1452 |
| 389 | Ga0373927_0007027 | 3300035695 | Bacteria | 7641 |
| 390 | Ga0373927_0387816 | 3300035695 | Bacteria | 921 |
| 391 | Ga0373933_0471483 | 3300035724 | Bacteria | 822 |
| 392 | Ga0373947_0001566 | 3300035725 | Bacteria | 14014 |
| 393 | Ga0373947_0028793 | 3300035725 | Bacteria | 3258 |
| 394 | Ga0373925_0013517 | 3300037068 | Bacteria | 5909 |
| 395 | Ga0373925_0086217 | 3300037068 | Bacteria | 2395 |
| 396 | Ga0395905_0139986 | 3300037471 | Bacteria | 2277 |
| 397 | Ga0451807_2026923 | 3300041486 | Bacteria | 581 |
| 398 | Ga0451835_0153052 | 3300041492 | Bacteria | 1030 |
| 399 | Ga0451837_0595071 | 3300041494 | Bacteria | 948 |
| 400 | Ga0451851_0227276 | 3300041507 | Bacteria | 3868 |
| 401 | Ga0451853_1297410 | 3300041512 | Bacteria | 1105 |
| 402 | Ga0466969_0167388 | 3300044656 | Bacteria | 1008 |
| 403 | Ga0466966_0539586 | 3300044684 | Bacteria | 702 |
| 404 | Ga0466970_0164137 | 3300044765 | Bacteria | 1229 |
| 405 | Ga0466959_0003549 | 3300045049 | Bacteria | 10253 |
| 406 | Ga0495603_0004010 | 3300046455 | Bacteria | 8765 |
| 407 | Ga0495590_0018331 | 3300046457 | Bacteria | 2506 |
| 408 | Ga0495629_0001306 | 3300046459 | Bacteria | 19602 |
| 409 | Ga0495629_0007863 | 3300046459 | Bacteria | 7846 |
| 410 | Ga0495638_0004919 | 3300046460 | Bacteria | 10042 |
| 411 | Ga0495638_0006659 | 3300046460 | Bacteria | 8384 |
| 412 | Ga0495641_0031370 | 3300046461 | Bacteria | 2540 |
| 413 | Ga0495641_0263431 | 3300046461 | Bacteria | 776 |
| 414 | Ga0495651_0691382 | 3300046462 | Bacteria | 636 |
| 415 | Ga0495653_0015161 | 3300046463 | Bacteria | 6283 |
| 416 | Ga0495653_0033105 | 3300046463 | Bacteria | 4097 |
| 417 | Ga0495650_0005382 | 3300046471 | Bacteria | 8328 |
| 418 | Ga0495580_0000405 | 3300046472 | Bacteria | 35466 |
| 419 | Ga0495580_0005620 | 3300046472 | Bacteria | 10326 |
| 420 | Ga0495582_0001069 | 3300046473 | Bacteria | 15376 |
| 421 | Ga0495582_0002617 | 3300046473 | Bacteria | 10021 |
| 422 | Ga0495582_0127007 | 3300046473 | Bacteria | 1439 |
| 423 | Ga0495605_0013142 | 3300046474 | Bacteria | 4574 |
| 424 | Ga0495605_0054123 | 3300046474 | Bacteria | 1945 |
| 425 | Ga0495605_0074470 | 3300046474 | Bacteria | 1598 |
| 426 | Ga0495662_0043219 | 3300046476 | Bacteria | 2175 |
| 427 | Ga0495662_0125321 | 3300046476 | Bacteria | 1262 |
| 428 | Ga0495664_0000547 | 3300046477 | Bacteria | 18910 |
| 429 | Ga0495664_0171034 | 3300046477 | Bacteria | 1318 |
| 430 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 431 | Ga0495585_0463162 | 3300046492 | Bacteria | 605 |
| 432 | Ga0495594_0005370 | 3300046499 | Bacteria | 6585 |
| 433 | Ga0495594_0127978 | 3300046499 | Bacteria | 1437 |
| 434 | Ga0495596_0057473 | 3300046500 | Bacteria | 1518 |
| 435 | Ga0495583_0002869 | 3300046506 | Bacteria | 14011 |
| 436 | Ga0495583_0262027 | 3300046506 | Bacteria | 691 |
| 437 | Ga0495606_0038857 | 3300046507 | Bacteria | 3215 |
| 438 | Ga0495606_0044716 | 3300046507 | Bacteria | 2942 |
| 439 | Ga0495606_0050123 | 3300046507 | Bacteria | 2733 |
| 440 | Ga0495606_0344983 | 3300046507 | Bacteria | 792 |
| 441 | Ga0495606_0533824 | 3300046507 | Bacteria | 586 |
| 442 | Ga0495610_0091732 | 3300046512 | Bacteria | 1376 |
| 443 | Ga0495610_0257871 | 3300046512 | Bacteria | 688 |
| 444 | Ga0495610_0274314 | 3300046512 | Bacteria | 659 |
| 445 | Ga0495618_0010352 | 3300046514 | Bacteria | 5643 |
| 446 | Ga0495618_0501904 | 3300046514 | Bacteria | 731 |
| 447 | Ga0495620_0035667 | 3300046515 | Bacteria | 2233 |
| 448 | Ga0495628_0009095 | 3300046516 | Bacteria | 8497 |
| 449 | Ga0495628_0052696 | 3300046516 | Bacteria | 3213 |
| 450 | Ga0495630_0012823 | 3300046517 | Bacteria | 6091 |
| 451 | Ga0495630_0051802 | 3300046517 | Bacteria | 3072 |
| 452 | Ga0495630_0405450 | 3300046517 | Bacteria | 1045 |
| 453 | Ga0495632_0038567 | 3300046519 | Bacteria | 2418 |
| 454 | Ga0495648_0002183 | 3300046524 | Bacteria | 18357 |
| 455 | Ga0495648_0026751 | 3300046524 | Bacteria | 3877 |
| 456 | Ga0495648_0048786 | 3300046524 | Bacteria | 2603 |
| 457 | Ga0495648_0049569 | 3300046524 | Bacteria | 2573 |
| 458 | Ga0495648_0072410 | 3300046524 | Bacteria | 1994 |
| 459 | Ga0495648_0075425 | 3300046524 | Bacteria | 1940 |
| 460 | Ga0495648_0116631 | 3300046524 | Bacteria | 1442 |
| 461 | Ga0495648_0155447 | 3300046524 | Bacteria | 1188 |
| 462 | Ga0495648_0383124 | 3300046524 | Bacteria | 633 |
| 463 | Ga0495666_0001085 | 3300046526 | Bacteria | 12965 |
| 464 | Ga0495652_0017711 | 3300046529 | Bacteria | 6357 |
| 465 | Ga0495654_0152506 | 3300046530 | Bacteria | 1021 |
| 466 | Ga0495665_0009393 | 3300046531 | Bacteria | 5294 |
| 467 | Ga0495665_0083475 | 3300046531 | Bacteria | 1680 |
| 468 | Ga0495640_0007678 | 3300046533 | Bacteria | 8481 |
| 469 | Ga0495640_0595823 | 3300046533 | Bacteria | 668 |
| 470 | Ga0495586_0009947 | 3300046535 | Bacteria | 5065 |
| 471 | Ga0495587_0003216 | 3300046536 | Bacteria | 10921 |
| 472 | Ga0495609_0060084 | 3300046538 | Bacteria | 1681 |
| 473 | Ga0495609_0204290 | 3300046538 | Bacteria | 825 |
| 474 | Ga0495597_0059674 | 3300046542 | Bacteria | 1665 |
| 475 | Ga0495645_0004363 | 3300046543 | Bacteria | 9663 |
| 476 | Ga0495622_0102961 | 3300046557 | Bacteria | 1308 |
| 477 | Ga0495622_0110318 | 3300046557 | Bacteria | 1260 |
| 478 | Ga0495622_0122110 | 3300046557 | Bacteria | 1189 |
| 479 | Ga0495668_0087653 | 3300046616 | Bacteria | 1707 |
| 480 | Ga0495668_0150115 | 3300046616 | Bacteria | 1276 |
| 481 | Ga0495634_0000661 | 3300046642 | Bacteria | 33530 |
| 482 | Ga0495634_0183924 | 3300046642 | Bacteria | 1307 |
| 483 | Ga0495634_0280449 | 3300046642 | Bacteria | 1012 |
| 484 | Ga0495611_0019704 | 3300046648 | Bacteria | 2899 |
| 485 | Ga0495611_0059673 | 3300046648 | Bacteria | 1732 |
| 486 | Ga0495625_0209923 | 3300046660 | Bacteria | 1280 |
| 487 | Ga0495625_0223929 | 3300046660 | Bacteria | 1231 |
| 488 | Ga0495625_0263961 | 3300046660 | Bacteria | 1113 |
| 489 | Ga0495625_0515761 | 3300046660 | Bacteria | 729 |
| 490 | Ga0495635_0006091 | 3300046663 | Bacteria | 8410 |
| 491 | Ga0495661_0004172 | 3300046665 | Bacteria | 10507 |
| 492 | Ga0495588_0138758 | 3300046674 | Bacteria | 1284 |
| 493 | Ga0495599_0018634 | 3300046678 | Bacteria | 4324 |
| 494 | Ga0495623_0098957 | 3300046679 | Bacteria | 1779 |
| 495 | Ga0495646_0003715 | 3300046680 | Bacteria | 9533 |
| 496 | Ga0495646_0005124 | 3300046680 | Bacteria | 8266 |
| 497 | Ga0495647_0026122 | 3300046681 | Bacteria | 2137 |
| 498 | Ga0495658_0000967 | 3300046683 | Bacteria | 15275 |
| 499 | Ga0495613_0002330 | 3300046689 | Bacteria | 14375 |
| 500 | Ga0495613_0101505 | 3300046689 | Bacteria | 2078 |
| 501 | Ga0495624_0006209 | 3300046690 | Bacteria | 8493 |
| 502 | Ga0495624_0022858 | 3300046690 | Bacteria | 4127 |
| 503 | Ga0495624_0079432 | 3300046690 | Bacteria | 2034 |
| 504 | Ga0495624_0691588 | 3300046690 | Bacteria | 606 |
| 505 | Ga0495671_0126295 | 3300046692 | Bacteria | 1247 |
| 506 | Ga0495671_0197755 | 3300046692 | Bacteria | 975 |
| 507 | Ga0495649_0507251 | 3300046694 | Bacteria | 599 |
| 508 | Ga0495649_0557779 | 3300046694 | Bacteria | 567 |
| 509 | Ga0495600_0176771 | 3300046809 | Bacteria | 1376 |
| 510 | Ga0495581_0002154 | 3300047315 | Bacteria | 11113 |
| 511 | Ga0495604_0002039 | 3300047317 | Bacteria | 16326 |
| 512 | Ga0495674_0005169 | 3300047319 | Bacteria | 12533 |
| 513 | Ga0495674_0043489 | 3300047319 | Bacteria | 3997 |
| 514 | Ga0495674_0354487 | 3300047319 | Bacteria | 1190 |
| 515 | Ga0495676_0010864 | 3300047321 | Bacteria | 8236 |
| 516 | Ga0495676_0022259 | 3300047321 | Bacteria | 5518 |
| 517 | Ga0495680_0002175 | 3300047322 | Bacteria | 20282 |
| 518 | Ga0495683_0090983 | 3300047323 | Bacteria | 1478 |
| 519 | Ga0495683_0109450 | 3300047323 | Bacteria | 1320 |
| 520 | Ga0495683_0343601 | 3300047323 | Bacteria | 631 |
| 521 | Ga0495687_161356 | 3300047443 | Bacteria | 753 |
| 522 | Ga0495679_000009 | 3300047446 | Bacteria | 343637 |
| 523 | Ga0495679_000748 | 3300047446 | Bacteria | 20826 |
| 524 | Ga0495673_0055630 | 3300047469 | Bacteria | 1715 |
| 525 | Ga0495673_0085907 | 3300047469 | Bacteria | 1294 |
| 526 | Ga0495673_0097803 | 3300047469 | Bacteria | 1191 |
| 527 | Ga0495673_0104426 | 3300047469 | Bacteria | 1141 |
| 528 | Ga0495673_0217300 | 3300047469 | Bacteria | 709 |
| 529 | Ga0495673_0244169 | 3300047469 | Bacteria | 657 |
| 530 | Ga0495673_0335510 | 3300047469 | Bacteria | 536 |
| 531 | Ga0495684_0081956 | 3300047471 | Bacteria | 2448 |
| 532 | Ga0495686_0313072 | 3300047472 | Bacteria | 863 |
| 533 | Ga0495593_0001822 | 3300047673 | Bacteria | 12674 |
| 534 | Ga0495593_0004348 | 3300047673 | Bacteria | 8431 |
| 535 | Ga0495593_0415253 | 3300047673 | Bacteria | 673 |
| 536 | Ga0495602_0006795 | 3300048088 | Bacteria | 12010 |
| 537 | Ga0495602_0621950 | 3300048088 | Bacteria | 740 |
| 538 | Ga0495614_0002666 | 3300048089 | Bacteria | 7938 |
| 539 | Ga0495614_0060933 | 3300048089 | Bacteria | 1621 |
| 540 | Ga0495626_0040568 | 3300048091 | Bacteria | 2198 |
| 541 | Ga0496100_0038877 | 3300048903 | Bacteria | 3017 |
| 542 | Ga0496100_0236171 | 3300048903 | Bacteria | 1347 |
| 543 | Ga0496101_0004589 | 3300048904 | Bacteria | 8726 |
| 544 | Ga0496101_0023487 | 3300048904 | Bacteria | 4261 |
| 545 | Ga0496101_0164972 | 3300048904 | Bacteria | 1700 |
| 546 | Ga0496101_1286975 | 3300048904 | Bacteria | 572 |
| 547 | Ga0496102_0011208 | 3300048905 | Bacteria | 7722 |
| 548 | Ga0496102_0093381 | 3300048905 | Bacteria | 2787 |
| 549 | Ga0496102_0126223 | 3300048905 | Bacteria | 2392 |
| 550 | Ga0496102_0290004 | 3300048905 | Bacteria | 1542 |
| 551 | Ga0496103_0015983 | 3300048906 | Bacteria | 4476 |
| 552 | Ga0496103_0188362 | 3300048906 | Bacteria | 1326 |
| 553 | Ga0496104_0049184 | 3300048907 | Bacteria | 3976 |
| 554 | Ga0496104_0181876 | 3300048907 | Bacteria | 2012 |
| 555 | Ga0496104_0217293 | 3300048907 | Bacteria | 1823 |
| 556 | Ga0496104_0291448 | 3300048907 | Bacteria | 1544 |
| 557 | Ga0496105_0010764 | 3300048908 | Bacteria | 7201 |
| 558 | Ga0496105_0043497 | 3300048908 | Bacteria | 3704 |
| 559 | Ga0496105_0075306 | 3300048908 | Bacteria | 2787 |
| 560 | Ga0496105_0151854 | 3300048908 | Bacteria | 1903 |
| 561 | Ga0496105_0484640 | 3300048908 | Bacteria | 972 |
| 562 | Ga0496105_0603594 | 3300048908 | Bacteria | 851 |
| 563 | Ga0496105_1293804 | 3300048908 | Bacteria | 533 |
| 564 | Ga0496106_0033052 | 3300048909 | Bacteria | 3858 |
| 565 | Ga0496106_0124532 | 3300048909 | Bacteria | 2017 |
| 566 | Ga0496106_0271628 | 3300048909 | Bacteria | 1357 |
| 567 | Ga0496107_0056643 | 3300048910 | Bacteria | 2832 |
| 568 | Ga0496107_0070722 | 3300048910 | Bacteria | 2534 |
| 569 | Ga0496107_0576935 | 3300048910 | Bacteria | 832 |
| 570 | Ga0496108_0012633 | 3300048911 | Bacteria | 6880 |
| 571 | Ga0496108_0238582 | 3300048911 | Bacteria | 1581 |
| 572 | Ga0496108_0326690 | 3300048911 | Bacteria | 1337 |
| 573 | Ga0496109_0036006 | 3300048912 | Bacteria | 4467 |
| 574 | Ga0496109_0206453 | 3300048912 | Bacteria | 1847 |
| 575 | Ga0496109_0315724 | 3300048912 | Bacteria | 1474 |
| 576 | Ga0496109_0379127 | 3300048912 | Bacteria | 1336 |
| 577 | Ga0496110_0022139 | 3300048913 | Bacteria | 5392 |
| 578 | Ga0496110_0042236 | 3300048913 | Bacteria | 3980 |
| 579 | Ga0496110_0072136 | 3300048913 | Bacteria | 3063 |
| 580 | Ga0496110_0888016 | 3300048913 | Bacteria | 797 |
| 581 | Ga0496111_0007468 | 3300048914 | Bacteria | 7169 |
| 582 | Ga0496111_0183651 | 3300048914 | Bacteria | 1555 |
| 583 | Ga0496112_0032895 | 3300048915 | Bacteria | 5036 |
| 584 | Ga0496112_0075775 | 3300048915 | Bacteria | 3326 |
| 585 | Ga0496112_0212718 | 3300048915 | Bacteria | 1890 |
| 586 | Ga0496112_0525721 | 3300048915 | Bacteria | 1117 |
| 587 | Ga0496113_0110546 | 3300048916 | Bacteria | 2139 |
| 588 | Ga0496113_0114845 | 3300048916 | Bacteria | 2100 |
| 589 | Ga0496113_0205460 | 3300048916 | Bacteria | 1566 |
| 590 | Ga0496113_0430942 | 3300048916 | Bacteria | 1059 |
| 591 | Ga0496114_0009386 | 3300048917 | Bacteria | 7768 |
| 592 | Ga0496114_0075322 | 3300048917 | Bacteria | 2842 |
| 593 | Ga0496114_0628331 | 3300048917 | Bacteria | 946 |
| 594 | Ga0496115_0083872 | 3300048918 | Bacteria | 2597 |
| 595 | Ga0496115_0233276 | 3300048918 | Bacteria | 1517 |
| 596 | Ga0496115_0762794 | 3300048918 | Bacteria | 755 |
| 597 | Ga0496115_1014940 | 3300048918 | Bacteria | 633 |
| 598 | Ga0496116_0047230 | 3300048919 | Bacteria | 2899 |
| 599 | Ga0496116_0275111 | 3300048919 | Bacteria | 819 |
| 600 | Ga0496117_0099668 | 3300048920 | Bacteria | 1842 |
| 601 | Ga0496117_0228904 | 3300048920 | Bacteria | 1029 |
| 602 | Ga0496118_0024558 | 3300048921 | Bacteria | 5197 |
| 603 | Ga0496118_0060180 | 3300048921 | Bacteria | 2822 |
| 604 | Ga0496119_0122871 | 3300048922 | Bacteria | 1425 |
| 605 | Ga0496120_0214489 | 3300048923 | Bacteria | 924 |
| 606 | Ga0496121_0046077 | 3300048924 | Bacteria | 3736 |
| 607 | Ga0496122_0318247 | 3300048925 | Bacteria | 829 |
| 608 | Ga0496124_0384566 | 3300048927 | Bacteria | 980 |
| 609 | Ga0496125_0164900 | 3300048928 | Bacteria | 1499 |
| 610 | Ga0496125_0179400 | 3300048928 | Bacteria | 1413 |
| 611 | Ga0496126_0096161 | 3300048929 | Bacteria | 2597 |
| 612 | Ga0496126_0101996 | 3300048929 | Bacteria | 2509 |
| 613 | Ga0496126_0250191 | 3300048929 | Bacteria | 1477 |
| 614 | Ga0495682_0014807 | 3300049460 | Bacteria | 2956 |
| 615 | Ga0495682_0049600 | 3300049460 | Bacteria | 1529 |
| 616 | Ga0495682_0083048 | 3300049460 | Bacteria | 1152 |
| 617 | Ga0495682_0122959 | 3300049460 | Bacteria | 929 |
| 618 | Ga0495682_0123722 | 3300049460 | Bacteria | 926 |
| 619 | Ga0495682_0207770 | 3300049460 | Bacteria | 694 |
| 620 | nmdc:mga03n38_511818_c1 | 3300050490 | Bacteria | 675 |
| 621 | nmdc:mga0yw44_1061758_c1 | 3300050492 | Bacteria | 548 |
| 622 | nmdc:mga0yw44_57930_c1 | 3300050492 | Bacteria | 2365 |
| 623 | nmdc:mga0yw44_99120_c1 | 3300050492 | Bacteria | 1854 |
| 624 | nmdc:mga0k408_125429_c1 | 3300050493 | Bacteria | 1523 |
| 625 | nmdc:mga06z11_119875_c1 | 3300050494 | Bacteria | 1467 |
| 626 | nmdc:mga05p37_60503_c1 | 3300050507 | Bacteria | 4663 |
| 627 | nmdc:mga09592_241064_c1 | 3300050508 | Bacteria | 1567 |
| 628 | nmdc:mga0qj67_105304_c1 | 3300050509 | Unclassified | 2276 |
| 629 | nmdc:mga06r32_119839_c1 | 3300050510 | Bacteria | 2595 |
| 630 | nmdc:mga06r32_54616_c1 | 3300050510 | Bacteria | 3831 |
| 631 | nmdc:mga08y16_108791_c1 | 3300050511 | Bacteria | 2886 |
| 632 | nmdc:mga08y16_391967_c1 | 3300050511 | Bacteria | 1423 |
| 633 | nmdc:mga08y16_83147_c1 | 3300050511 | Bacteria | 3337 |
| 634 | nmdc:mga0n895_137295_c1 | 3300050512 | Bacteria | 2472 |
| 635 | nmdc:mga0n895_253520_c1 | 3300050512 | Bacteria | 1786 |
| 636 | nmdc:mga0n895_351632_c1 | 3300050512 | Bacteria | 1493 |
| 637 | nmdc:mga0n895_371392_c1 | 3300050512 | Bacteria | 1448 |
| 638 | nmdc:mga0n895_851638_c1 | 3300050512 | Unclassified | 899 |
| 639 | nmdc:mga0rr50_886470_c1 | 3300050513 | Bacteria | 761 |
| 640 | nmdc:mga08x19_603155_c1 | 3300050514 | Bacteria | 778 |
| 641 | nmdc:mga0a205_253321_c1 | 3300050515 | Bacteria | 1639 |
| 642 | nmdc:mga0a205_573520_c1 | 3300050515 | Bacteria | 983 |
| 643 | nmdc:mga0sz30_194346_c1 | 3300050516 | Bacteria | 901 |
| 644 | nmdc:mga0sz30_92231_c1 | 3300050516 | Bacteria | 1319 |
| 645 | Ga0500635_0008832 | 3300053080 | Bacteria | 2776 |
| 646 | Ga0495655_0091952 | 3300053083 | Bacteria | 885 |
| 647 | Ga0495655_0372034 | 3300053083 | Bacteria | 503 |
| 648 | Ga0495619_0000197 | 3300053085 | Bacteria | 44259 |
| 649 | Ga0500578_0111265 | 3300053086 | Bacteria | 1726 |
| 650 | Ga0500643_050489 | 3300053087 | Bacteria | 1190 |
| 651 | Ga0500647_0162140 | 3300053091 | Bacteria | 1037 |
| 652 | Ga0500583_0021076 | 3300053092 | Bacteria | 2704 |
| 653 | Ga0500651_0038651 | 3300053093 | Bacteria | 3006 |
| 654 | Ga0500651_0094984 | 3300053093 | Bacteria | 1833 |
| 655 | Ga0500641_0078346 | 3300053096 | Bacteria | 1400 |
| 656 | Ga0500555_003590 | 3300053103 | Bacteria | 4420 |
| 657 | Ga0500556_0003155 | 3300053104 | Bacteria | 4910 |
| 658 | Ga0500556_0301841 | 3300053104 | Bacteria | 626 |
| 659 | Ga0500562_006055 | 3300053108 | Bacteria | 3045 |
| 660 | Ga0500569_000906 | 3300053109 | Bacteria | 5312 |
| 661 | Ga0500595_007843 | 3300053119 | Bacteria | 4398 |
| 662 | Ga0500614_049860 | 3300053123 | Bacteria | 1095 |
| 663 | Ga0500642_0090055 | 3300053130 | Bacteria | 1417 |
| 664 | Ga0500655_048735 | 3300053133 | Bacteria | 841 |
| 665 | Ga0500658_0153128 | 3300053134 | Bacteria | 1040 |
| 666 | Ga0500568_0019594 | 3300053139 | Bacteria | 2937 |
| 667 | Ga0500568_0079662 | 3300053139 | Bacteria | 1245 |
| 668 | Ga0500577_0066161 | 3300053142 | Bacteria | 1405 |
| 669 | Ga0500588_0030651 | 3300053146 | Bacteria | 1545 |
| 670 | Ga0500604_0029865 | 3300053151 | Bacteria | 1591 |
| 671 | Ga0500622_0361311 | 3300053156 | Bacteria | 599 |
| 672 | Ga0500627_0321952 | 3300053158 | Bacteria | 671 |
| 673 | Ga0500633_0020658 | 3300053160 | Bacteria | 1990 |
| 674 | Ga0500638_115711 | 3300053162 | Bacteria | 1233 |
| 675 | Ga0500639_145842 | 3300053163 | Bacteria | 1099 |
| 676 | Ga0500636_0117585 | 3300053177 | Bacteria | 1494 |
| 677 | Ga0500636_0164511 | 3300053177 | Bacteria | 1206 |
| 678 | Ga0500645_039681 | 3300053730 | Bacteria | 1394 |
| 679 | Ga0500645_051857 | 3300053730 | Bacteria | 1196 |
| 680 | Ga0500599_000400 | 3300053736 | Bacteria | 4398 |
| 681 | Ga0500661_006184 | 3300055283 | Bacteria | 2232 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100645102 | Ga0070690_1006451021 | 109 |
| 2 | 3300025939 | Ga0207665_10037803 | Ga0207665_100378031 | 129 |
| 3 | 3300005333 | Ga0070677_10476250 | Ga0070677_104762501 | 130 |
| 4 | 3300006237 | Ga0097621_100024299 | Ga0097621_1000242997 | 130 |
| 5 | 3300006358 | Ga0068871_100066751 | Ga0068871_1000667514 | 130 |
| 6 | 3300014969 | Ga0157376_10103099 | Ga0157376_101030991 | 130 |
| 7 | 3300048917 | Ga0496114_0628331 | Ga0496114_0628331_70_465 | 130 |
| 8 | 3300006844 | Ga0075428_100194112 | Ga0075428_1001941124 | 131 |
| 9 | 3300006846 | Ga0075430_100456992 | Ga0075430_1004569922 | 131 |
| 10 | 3300006852 | Ga0075433_10313534 | Ga0075433_103135342 | 131 |
| 11 | 3300007076 | Ga0075435_100391737 | Ga0075435_1003917372 | 131 |
| 12 | 3300009147 | Ga0114129_10079908 | Ga0114129_100799084 | 131 |
| 13 | 3300050507 | nmdc:mga05p37_60503_c1 | nmdc:mga05p37_60503_c1_578_1003 | 131 |
| 14 | 3300050512 | nmdc:mga0n895_851638_c1 | nmdc:mga0n895_851638_c1_69_548 | 131 |
| 15 | 3300050515 | nmdc:mga0a205_253321_c1 | nmdc:mga0a205_253321_c1_910_1335 | 131 |
| 16 | 3300030521 | Ga0307511_10022068 | Ga0307511_100220682 | 132 |
| 17 | 3300031730 | Ga0307516_10000276 | Ga0307516_100002767 | 132 |
| 18 | iso_pu_bacteria | 2643221557 | 2643807702 | 132 |
| 19 | iso_pu_bacteria | 2643221668 | 2644379190 | 132 |
| 20 | 3300028036 | Ga0265355_1011388 | Ga0265355_10113882 | 133 |
| 21 | iso_pu_bacteria | 2617270742 | 2617384125 | 133 |
| 22 | iso_pu_bacteria | 2744054900 | 2746086288 | 133 |
| 23 | iso_pu_bacteria | 2744054901 | 2746096959 | 133 |
| 24 | 3300006038 | Ga0075365_10024860 | Ga0075365_100248605 | 134 |
| 25 | 3300006178 | Ga0075367_10316159 | Ga0075367_103161592 | 134 |
| 26 | 3300025297 | Ga0209758_1030383 | Ga0209758_10303832 | 134 |
| 27 | 3300025299 | Ga0209256_1044068 | Ga0209256_10440682 | 134 |
| 28 | iso_pu_bacteria | 2501025502 | 2501078034 | 134 |
| 29 | iso_pu_bacteria | 2510917013 | 2511092005 | 134 |
| 30 | iso_pu_bacteria | 2524023228 | 2524538495 | 134 |
| 31 | iso_pu_bacteria | 2932794094 | 2932797077 | 134 |
| 32 | iso_pu_bacteria | 2932801729 | 2932807426 | 134 |
| 33 | iso_pu_bacteria | 2935959822 | 2935961642 | 134 |
| 34 | iso_pu_bacteria | 8019555841 | 8019556762 | 134 |
| 35 | iso_pu_bacteria | 8019565922 | 8019568544 | 134 |
| 36 | 3300005340 | Ga0070689_101912113 | Ga0070689_1019121131 | 135 |
| 37 | 3300005353 | Ga0070669_100000438 | Ga0070669_10000043824 | 135 |
| 38 | 3300025923 | Ga0207681_10000037 | Ga0207681_1000003799 | 135 |
| 39 | 3300025972 | Ga0207668_10688752 | Ga0207668_106887522 | 135 |
| 40 | 3300003781 | Ga0055536_1041459 | Ga0055536_10414592 | 136 |
| 41 | 3300003791 | Ga0055530_10023186 | Ga0055530_100231862 | 136 |
| 42 | 3300003794 | Ga0055531_10000697 | Ga0055531_1000069710 | 136 |
| 43 | 3300025292 | Ga0209676_1001348 | Ga0209676_100134827 | 136 |
| 44 | 3300025298 | Ga0209050_1000644 | Ga0209050_100064424 | 136 |
| 45 | 3300025298 | Ga0209050_1001277 | Ga0209050_10012779 | 136 |
| 46 | 3300025303 | Ga0209051_1013495 | Ga0209051_10134952 | 136 |
| 47 | 3300025304 | Ga0209257_1001078 | Ga0209257_100107814 | 136 |
| 48 | 3300026121 | Ga0207683_10266726 | Ga0207683_102667262 | 136 |
| 49 | 3300027512 | Ga0209179_1054300 | Ga0209179_10543002 | 136 |
| 50 | 3300027671 | Ga0209588_1016132 | Ga0209588_10161323 | 136 |
| 51 | 3300028380 | Ga0268265_10030300 | Ga0268265_100303003 | 136 |
| 52 | 3300037471 | Ga0395905_0139986 | Ga0395905_0139986_883_1314 | 136 |
| 53 | 3300041486 | Ga0451807_2026923 | Ga0451807_2026923_115_540 | 136 |
| 54 | 3300053139 | Ga0500568_0079662 | Ga0500568_0079662_578_997 | 136 |
| 55 | iso_pu_bacteria | 2599185352 | 2600197568 | 136 |
| 56 | iso_pu_bacteria | 2643221723 | 2644671557 | 136 |
| 57 | iso_pu_bacteria | 2935959822 | 2935963916 | 136 |
| 58 | 3300002737 | JGI25162J39368_1001596 | JGI25162J39368_10015965 | 137 |
| 59 | 3300003214 | JGI25165J46597_1000280 | JGI25165J46597_10002808 | 137 |
| 60 | 3300025233 | Ga0209437_100281 | Ga0209437_1002819 | 137 |
| 61 | 3300025246 | Ga0209646_1004247 | Ga0209646_10042472 | 137 |
| 62 | 3300025261 | Ga0209233_1000267 | Ga0209233_10002679 | 137 |
| 63 | 3300028016 | Ga0265354_1004635 | Ga0265354_10046352 | 137 |
| 64 | 3300030521 | Ga0307511_10063150 | Ga0307511_100631502 | 137 |
| 65 | 3300030878 | Ga0265770_1000015 | Ga0265770_10000157 | 137 |
| 66 | 3300031507 | Ga0307509_10139206 | Ga0307509_101392062 | 137 |
| 67 | 3300031616 | Ga0307508_10305488 | Ga0307508_103054882 | 137 |
| 68 | 3300033179 | Ga0307507_10069784 | Ga0307507_100697842 | 137 |
| 69 | 3300033180 | Ga0307510_10157839 | Ga0307510_101578392 | 137 |
| 70 | 3300035171 | Ga0373946_0414032 | Ga0373946_0414032_159_572 | 137 |
| 71 | 3300035695 | Ga0373927_0007027 | Ga0373927_0007027_6156_6569 | 137 |
| 72 | 3300035725 | Ga0373947_0028793 | Ga0373947_0028793_2078_2491 | 137 |
| 73 | 3300037068 | Ga0373925_0086217 | Ga0373925_0086217_1614_2027 | 137 |
| 74 | 3300046461 | Ga0495641_0263431 | Ga0495641_0263431_273_686 | 137 |
| 75 | 3300046476 | Ga0495662_0125321 | Ga0495662_0125321_316_729 | 137 |
| 76 | 3300046533 | Ga0495640_0595823 | Ga0495640_0595823_48_464 | 137 |
| 77 | 3300046642 | Ga0495634_0183924 | Ga0495634_0183924_436_849 | 137 |
| 78 | 3300047469 | Ga0495673_0097803 | Ga0495673_0097803_358_771 | 137 |
| 79 | 3300053080 | Ga0500635_0008832 | Ga0500635_0008832_1447_1860 | 137 |
| 80 | 3300053091 | Ga0500647_0162140 | Ga0500647_0162140_588_1001 | 137 |
| 81 | 3300053093 | Ga0500651_0094984 | Ga0500651_0094984_1061_1477 | 137 |
| 82 | 3300053162 | Ga0500638_115711 | Ga0500638_115711_29_442 | 137 |
| 83 | 3300053163 | Ga0500639_145842 | Ga0500639_145842_63_476 | 137 |
| 84 | 3300053177 | Ga0500636_0117585 | Ga0500636_0117585_129_542 | 137 |
| 85 | 3300053177 | Ga0500636_0164511 | Ga0500636_0164511_274_708 | 137 |
| 86 | iso_pu_bacteria | 2824661429 | 2824668780 | 137 |
| 87 | iso_pu_bacteria | 2879099564 | 2879100676 | 137 |
| 88 | iso_pu_bacteria | 2922368715 | 2922373279 | 137 |
| 89 | iso_pu_bacteria | 2929615660 | 2929615692 | 137 |
| 90 | iso_pu_bacteria | 2929624759 | 2929630307 | 137 |
| 91 | iso_pu_bacteria | 2932784394 | 2932791866 | 137 |
| 92 | iso_pu_bacteria | 2932794094 | 2932796334 | 137 |
| 93 | iso_pu_bacteria | 2932801729 | 2932804360 | 137 |
| 94 | iso_pu_bacteria | 2932809354 | 2932815607 | 137 |
| 95 | iso_pu_bacteria | 2932818245 | 2932819320 | 137 |
| 96 | iso_pu_bacteria | 2933577622 | 2933579021 | 137 |
| 97 | iso_pu_bacteria | 2935616580 | 2935624268 | 137 |
| 98 | iso_pu_bacteria | 2935638405 | 2935647760 | 137 |
| 99 | iso_pu_bacteria | 2935665750 | 2935674783 | 137 |
| 100 | iso_pu_bacteria | 2935675223 | 2935678344 | 137 |
| 101 | iso_pu_bacteria | 2935684952 | 2935688230 | 137 |
| 102 | iso_pu_bacteria | 2935694250 | 2935698894 | 137 |
| 103 | iso_pu_bacteria | 2935703347 | 2935708513 | 137 |
| 104 | iso_pu_bacteria | 2935713505 | 2935715249 | 137 |
| 105 | iso_pu_bacteria | 2935722832 | 2935726186 | 137 |
| 106 | iso_pu_bacteria | 2935732158 | 2935734068 | 137 |
| 107 | iso_pu_bacteria | 2935741537 | 2935743447 | 137 |
| 108 | iso_pu_bacteria | 2935750917 | 2935754515 | 137 |
| 109 | iso_pu_bacteria | 2935760218 | 2935768285 | 137 |
| 110 | iso_pu_bacteria | 2935810662 | 2935819439 | 137 |
| 111 | iso_pu_bacteria | 2935827899 | 2935837244 | 137 |
| 112 | iso_pu_bacteria | 2935837841 | 2935846502 | 137 |
| 113 | iso_pu_bacteria | 2935855204 | 2935862698 | 137 |
| 114 | iso_pu_bacteria | 2935864058 | 2935871704 | 137 |
| 115 | iso_pu_bacteria | 2935873716 | 2935881929 | 137 |
| 116 | iso_pu_bacteria | 2935883170 | 2935888771 | 137 |
| 117 | iso_pu_bacteria | 2935992306 | 2935998802 | 137 |
| 118 | iso_pu_bacteria | 2936002035 | 2936007358 | 137 |
| 119 | iso_pu_bacteria | 2936037263 | 2936046284 | 137 |
| 120 | iso_pu_bacteria | 2940556831 | 2940560108 | 137 |
| 121 | iso_pu_bacteria | 2941538514 | 2941546921 | 137 |
| 122 | iso_pu_bacteria | 8019576017 | 8019581506 | 137 |
| 123 | iso_pu_bacteria | 8019586578 | 8019589134 | 137 |
| 124 | iso_pu_bacteria | 8019597564 | 8019602097 | 137 |
| 125 | iso_pu_bacteria | 8019608314 | 8019616457 | 137 |
| 126 | iso_pu_bacteria | 8055742211 | 8055747340 | 137 |
| 127 | 3300005338 | Ga0068868_100336151 | Ga0068868_1003361511 | 138 |
| 128 | 3300005536 | Ga0070697_101163105 | Ga0070697_1011631051 | 138 |
| 129 | 3300005719 | Ga0068861_101273324 | Ga0068861_1012733241 | 138 |
| 130 | 3300014325 | Ga0163163_11575952 | Ga0163163_115759522 | 138 |
| 131 | 3300046455 | Ga0495603_0004010 | Ga0495603_0004010_1422_1844 | 138 |
| 132 | 3300046457 | Ga0495590_0018331 | Ga0495590_0018331_1973_2395 | 138 |
| 133 | 3300046459 | Ga0495629_0007863 | Ga0495629_0007863_1228_1650 | 138 |
| 134 | 3300046460 | Ga0495638_0006659 | Ga0495638_0006659_2468_2953 | 138 |
| 135 | 3300046461 | Ga0495641_0031370 | Ga0495641_0031370_1190_1612 | 138 |
| 136 | 3300046463 | Ga0495653_0015161 | Ga0495653_0015161_2851_3273 | 138 |
| 137 | 3300046463 | Ga0495653_0033105 | Ga0495653_0033105_1517_2002 | 138 |
| 138 | 3300046471 | Ga0495650_0005382 | Ga0495650_0005382_1346_1768 | 138 |
| 139 | 3300046472 | Ga0495580_0000405 | Ga0495580_0000405_9742_10164 | 138 |
| 140 | 3300046472 | Ga0495580_0005620 | Ga0495580_0005620_8203_8688 | 138 |
| 141 | 3300046473 | Ga0495582_0002617 | Ga0495582_0002617_6717_7139 | 138 |
| 142 | 3300046473 | Ga0495582_0127007 | Ga0495582_0127007_441_926 | 138 |
| 143 | 3300046474 | Ga0495605_0013142 | Ga0495605_0013142_3798_4220 | 138 |
| 144 | 3300046476 | Ga0495662_0043219 | Ga0495662_0043219_1032_1454 | 138 |
| 145 | 3300046477 | Ga0495664_0000547 | Ga0495664_0000547_10157_10579 | 138 |
| 146 | 3300046477 | Ga0495664_0171034 | Ga0495664_0171034_154_639 | 138 |
| 147 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_424517_424939 | 138 |
| 148 | 3300046499 | Ga0495594_0127978 | Ga0495594_0127978_552_974 | 138 |
| 149 | 3300046500 | Ga0495596_0057473 | Ga0495596_0057473_335_757 | 138 |
| 150 | 3300046506 | Ga0495583_0002869 | Ga0495583_0002869_2917_3402 | 138 |
| 151 | 3300046507 | Ga0495606_0038857 | Ga0495606_0038857_2732_3154 | 138 |
| 152 | 3300046507 | Ga0495606_0533824 | Ga0495606_0533824_25_510 | 138 |
| 153 | 3300046514 | Ga0495618_0010352 | Ga0495618_0010352_4305_4727 | 138 |
| 154 | 3300046514 | Ga0495618_0501904 | Ga0495618_0501904_215_637 | 138 |
| 155 | 3300046516 | Ga0495628_0009095 | Ga0495628_0009095_2144_2566 | 138 |
| 156 | 3300046516 | Ga0495628_0052696 | Ga0495628_0052696_995_1480 | 138 |
| 157 | 3300046517 | Ga0495630_0012823 | Ga0495630_0012823_3330_3752 | 138 |
| 158 | 3300046517 | Ga0495630_0051802 | Ga0495630_0051802_2170_2592 | 138 |
| 159 | 3300046524 | Ga0495648_0002183 | Ga0495648_0002183_2673_3095 | 138 |
| 160 | 3300046524 | Ga0495648_0026751 | Ga0495648_0026751_1256_1678 | 138 |
| 161 | 3300046524 | Ga0495648_0075425 | Ga0495648_0075425_454_876 | 138 |
| 162 | 3300046524 | Ga0495648_0116631 | Ga0495648_0116631_450_872 | 138 |
| 163 | 3300046524 | Ga0495648_0155447 | Ga0495648_0155447_166_582 | 138 |
| 164 | 3300046526 | Ga0495666_0001085 | Ga0495666_0001085_8335_8757 | 138 |
| 165 | 3300046529 | Ga0495652_0017711 | Ga0495652_0017711_3011_3433 | 138 |
| 166 | 3300046531 | Ga0495665_0009393 | Ga0495665_0009393_1862_2284 | 138 |
| 167 | 3300046531 | Ga0495665_0083475 | Ga0495665_0083475_507_992 | 138 |
| 168 | 3300046533 | Ga0495640_0007678 | Ga0495640_0007678_6950_7372 | 138 |
| 169 | 3300046535 | Ga0495586_0009947 | Ga0495586_0009947_1720_2142 | 138 |
| 170 | 3300046536 | Ga0495587_0003216 | Ga0495587_0003216_9271_9693 | 138 |
| 171 | 3300046543 | Ga0495645_0004363 | Ga0495645_0004363_1622_2044 | 138 |
| 172 | 3300046642 | Ga0495634_0000661 | Ga0495634_0000661_24760_25182 | 138 |
| 173 | 3300046642 | Ga0495634_0280449 | Ga0495634_0280449_175_660 | 138 |
| 174 | 3300046648 | Ga0495611_0019704 | Ga0495611_0019704_382_804 | 138 |
| 175 | 3300046663 | Ga0495635_0006091 | Ga0495635_0006091_1070_1492 | 138 |
| 176 | 3300046665 | Ga0495661_0004172 | Ga0495661_0004172_1207_1629 | 138 |
| 177 | 3300046678 | Ga0495599_0018634 | Ga0495599_0018634_1017_1439 | 138 |
| 178 | 3300046679 | Ga0495623_0098957 | Ga0495623_0098957_333_755 | 138 |
| 179 | 3300046680 | Ga0495646_0003715 | Ga0495646_0003715_1049_1471 | 138 |
| 180 | 3300046680 | Ga0495646_0005124 | Ga0495646_0005124_690_1175 | 138 |
| 181 | 3300046689 | Ga0495613_0002330 | Ga0495613_0002330_6922_7344 | 138 |
| 182 | 3300046689 | Ga0495613_0101505 | Ga0495613_0101505_32_517 | 138 |
| 183 | 3300046690 | Ga0495624_0006209 | Ga0495624_0006209_1119_1604 | 138 |
| 184 | 3300046690 | Ga0495624_0022858 | Ga0495624_0022858_1033_1455 | 138 |
| 185 | 3300046690 | Ga0495624_0079432 | Ga0495624_0079432_730_1152 | 138 |
| 186 | 3300046692 | Ga0495671_0197755 | Ga0495671_0197755_459_881 | 138 |
| 187 | 3300046809 | Ga0495600_0176771 | Ga0495600_0176771_28_450 | 138 |
| 188 | 3300047315 | Ga0495581_0002154 | Ga0495581_0002154_8421_8843 | 138 |
| 189 | 3300047317 | Ga0495604_0002039 | Ga0495604_0002039_8336_8758 | 138 |
| 190 | 3300047319 | Ga0495674_0005169 | Ga0495674_0005169_6996_7418 | 138 |
| 191 | 3300047319 | Ga0495674_0043489 | Ga0495674_0043489_2144_2566 | 138 |
| 192 | 3300047319 | Ga0495674_0354487 | Ga0495674_0354487_357_842 | 138 |
| 193 | 3300047321 | Ga0495676_0010864 | Ga0495676_0010864_1695_2117 | 138 |
| 194 | 3300047322 | Ga0495680_0002175 | Ga0495680_0002175_10803_11225 | 138 |
| 195 | 3300047323 | Ga0495683_0109450 | Ga0495683_0109450_475_960 | 138 |
| 196 | 3300047446 | Ga0495679_000009 | Ga0495679_000009_227517_227939 | 138 |
| 197 | 3300047446 | Ga0495679_000748 | Ga0495679_000748_7268_7690 | 138 |
| 198 | 3300047469 | Ga0495673_0055630 | Ga0495673_0055630_1222_1644 | 138 |
| 199 | 3300047469 | Ga0495673_0335510 | Ga0495673_0335510_35_451 | 138 |
| 200 | 3300047471 | Ga0495684_0081956 | Ga0495684_0081956_1136_1558 | 138 |
| 201 | 3300047472 | Ga0495686_0313072 | Ga0495686_0313072_358_843 | 138 |
| 202 | 3300047673 | Ga0495593_0001822 | Ga0495593_0001822_7901_8323 | 138 |
| 203 | 3300047673 | Ga0495593_0004348 | Ga0495593_0004348_3753_4238 | 138 |
| 204 | 3300048088 | Ga0495602_0006795 | Ga0495602_0006795_3524_3946 | 138 |
| 205 | 3300048089 | Ga0495614_0002666 | Ga0495614_0002666_6484_6906 | 138 |
| 206 | 3300048089 | Ga0495614_0060933 | Ga0495614_0060933_668_1090 | 138 |
| 207 | 3300048091 | Ga0495626_0040568 | Ga0495626_0040568_1719_2141 | 138 |
| 208 | 3300048905 | Ga0496102_0126223 | Ga0496102_0126223_440_925 | 138 |
| 209 | 3300048916 | Ga0496113_0110546 | Ga0496113_0110546_1172_1594 | 138 |
| 210 | 3300048920 | Ga0496117_0099668 | Ga0496117_0099668_275_760 | 138 |
| 211 | 3300048921 | Ga0496118_0060180 | Ga0496118_0060180_2063_2548 | 138 |
| 212 | 3300049460 | Ga0495682_0014807 | Ga0495682_0014807_481_903 | 138 |
| 213 | 3300049460 | Ga0495682_0049600 | Ga0495682_0049600_874_1296 | 138 |
| 214 | 3300049460 | Ga0495682_0122959 | Ga0495682_0122959_230_646 | 138 |
| 215 | iso_pu_bacteria | 3005710791 | 3005714002 | 138 |
| 216 | 3300005434 | Ga0070709_10256865 | Ga0070709_102568652 | 139 |
| 217 | 3300005436 | Ga0070713_100254892 | Ga0070713_1002548922 | 139 |
| 218 | 3300005439 | Ga0070711_100074143 | Ga0070711_1000741433 | 139 |
| 219 | 3300005467 | Ga0070706_101064456 | Ga0070706_1010644562 | 139 |
| 220 | 3300005564 | Ga0070664_100252839 | Ga0070664_1002528394 | 139 |
| 221 | 3300006028 | Ga0070717_10014255 | Ga0070717_100142554 | 139 |
| 222 | 3300006028 | Ga0070717_10167061 | Ga0070717_101670613 | 139 |
| 223 | 3300006028 | Ga0070717_10260551 | Ga0070717_102605512 | 139 |
| 224 | 3300006028 | Ga0070717_10605578 | Ga0070717_106055781 | 139 |
| 225 | 3300006048 | Ga0075363_100196048 | Ga0075363_1001960482 | 139 |
| 226 | 3300006175 | Ga0070712_100267905 | Ga0070712_1002679052 | 139 |
| 227 | 3300006353 | Ga0075370_10083286 | Ga0075370_100832863 | 139 |
| 228 | 3300007788 | Ga0099795_10094602 | Ga0099795_100946021 | 139 |
| 229 | 3300009093 | Ga0105240_11079200 | Ga0105240_110792001 | 139 |
| 230 | 3300009094 | Ga0111539_10090477 | Ga0111539_100904772 | 139 |
| 231 | 3300009545 | Ga0105237_10071604 | Ga0105237_100716043 | 139 |
| 232 | 3300009551 | Ga0105238_10087189 | Ga0105238_100871892 | 139 |
| 233 | 3300010159 | Ga0099796_10074170 | Ga0099796_100741702 | 139 |
| 234 | 3300010159 | Ga0099796_10227893 | Ga0099796_102278931 | 139 |
| 235 | 3300025914 | Ga0207671_10351449 | Ga0207671_103514492 | 139 |
| 236 | 3300025915 | Ga0207693_10238157 | Ga0207693_102381572 | 139 |
| 237 | 3300025928 | Ga0207700_10625256 | Ga0207700_106252562 | 139 |
| 238 | 3300025945 | Ga0207679_10084323 | Ga0207679_100843234 | 139 |
| 239 | 3300027671 | Ga0209588_1190935 | Ga0209588_11909351 | 139 |
| 240 | 3300027907 | Ga0207428_11316093 | Ga0207428_113160931 | 139 |
| 241 | 3300035118 | Ga0373954_0181451 | Ga0373954_0181451_330_749 | 139 |
| 242 | 3300035172 | Ga0373955_0549519 | Ga0373955_0549519_118_537 | 139 |
| 243 | 3300035724 | Ga0373933_0471483 | Ga0373933_0471483_80_499 | 139 |
| 244 | 3300046507 | Ga0495606_0344983 | Ga0495606_0344983_168_587 | 139 |
| 245 | 3300046524 | Ga0495648_0049569 | Ga0495648_0049569_1101_1520 | 139 |
| 246 | 3300046524 | Ga0495648_0383124 | Ga0495648_0383124_180_599 | 139 |
| 247 | 3300046616 | Ga0495668_0087653 | Ga0495668_0087653_1111_1530 | 139 |
| 248 | 3300050511 | nmdc:mga08y16_108791_c1 | nmdc:mga08y16_108791_c1_2390_2809 | 139 |
| 249 | 3300002987 | JGI25159J45721_1000015 | JGI25159J45721_100001567 | 140 |
| 250 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003117 | 140 |
| 251 | 3300003374 | JGI25161J50226_1002742 | JGI25161J50226_10027423 | 140 |
| 252 | 3300003771 | Ga0055526_1007083 | Ga0055526_10070835 | 140 |
| 253 | 3300003775 | Ga0055524_1041650 | Ga0055524_10416502 | 140 |
| 254 | 3300003781 | Ga0055536_1001123 | Ga0055536_100112313 | 140 |
| 255 | 3300003791 | Ga0055530_10004321 | Ga0055530_100043214 | 140 |
| 256 | 3300003792 | Ga0055540_1041907 | Ga0055540_10419071 | 140 |
| 257 | 3300004625 | Ga0055543_1000034 | Ga0055543_100003437 | 140 |
| 258 | 3300005262 | Ga0065165_1000025 | Ga0065165_1000025216 | 140 |
| 259 | 3300005435 | Ga0070714_100120710 | Ga0070714_1001207103 | 140 |
| 260 | 3300005436 | Ga0070713_100022038 | Ga0070713_1000220382 | 140 |
| 261 | 3300005436 | Ga0070713_100216049 | Ga0070713_1002160491 | 140 |
| 262 | 3300005437 | Ga0070710_10006716 | Ga0070710_100067162 | 140 |
| 263 | 3300005439 | Ga0070711_100011825 | Ga0070711_1000118255 | 140 |
| 264 | 3300005518 | Ga0070699_101431738 | Ga0070699_1014317381 | 140 |
| 265 | 3300005564 | Ga0070664_100508563 | Ga0070664_1005085632 | 140 |
| 266 | 3300005577 | Ga0068857_100562902 | Ga0068857_1005629022 | 140 |
| 267 | 3300005614 | Ga0068856_102235263 | Ga0068856_1022352631 | 140 |
| 268 | 3300005841 | Ga0068863_102418364 | Ga0068863_1024183641 | 140 |
| 269 | 3300005842 | Ga0068858_100825267 | Ga0068858_1008252671 | 140 |
| 270 | 3300005981 | Ga0081538_10036483 | Ga0081538_100364833 | 140 |
| 271 | 3300006028 | Ga0070717_10007835 | Ga0070717_100078355 | 140 |
| 272 | 3300006163 | Ga0070715_10004890 | Ga0070715_100048903 | 140 |
| 273 | 3300006173 | Ga0070716_100007047 | Ga0070716_1000070477 | 140 |
| 274 | 3300006175 | Ga0070712_100594498 | Ga0070712_1005944982 | 140 |
| 275 | 3300006358 | Ga0068871_100144834 | Ga0068871_1001448341 | 140 |
| 276 | 3300009101 | Ga0105247_10273143 | Ga0105247_102731432 | 140 |
| 277 | 3300009177 | Ga0105248_10048981 | Ga0105248_100489816 | 140 |
| 278 | 3300013306 | Ga0163162_10810763 | Ga0163162_108107631 | 140 |
| 279 | 3300013308 | Ga0157375_12519970 | Ga0157375_125199701 | 140 |
| 280 | 3300025208 | Ga0209436_100130 | Ga0209436_10013010 | 140 |
| 281 | 3300025245 | Ga0207425_1011713 | Ga0207425_10117132 | 140 |
| 282 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005364 | 140 |
| 283 | 3300025292 | Ga0209676_1001927 | Ga0209676_100192713 | 140 |
| 284 | 3300025294 | Ga0209025_1000105 | Ga0209025_100010553 | 140 |
| 285 | 3300025295 | Ga0209564_1000113 | Ga0209564_100011352 | 140 |
| 286 | 3300025298 | Ga0209050_1005247 | Ga0209050_100524710 | 140 |
| 287 | 3300025299 | Ga0209256_1002435 | Ga0209256_10024353 | 140 |
| 288 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015235 | 140 |
| 289 | 3300025303 | Ga0209051_1001056 | Ga0209051_10010564 | 140 |
| 290 | 3300025304 | Ga0209257_1001948 | Ga0209257_100194811 | 140 |
| 291 | 3300025898 | Ga0207692_10007178 | Ga0207692_100071785 | 140 |
| 292 | 3300025900 | Ga0207710_10169683 | Ga0207710_101696831 | 140 |
| 293 | 3300025906 | Ga0207699_10004550 | Ga0207699_100045504 | 140 |
| 294 | 3300025915 | Ga0207693_10001772 | Ga0207693_1000177216 | 140 |
| 295 | 3300025916 | Ga0207663_10008912 | Ga0207663_100089125 | 140 |
| 296 | 3300025916 | Ga0207663_10949536 | Ga0207663_109495362 | 140 |
| 297 | 3300025928 | Ga0207700_10400548 | Ga0207700_104005481 | 140 |
| 298 | 3300025928 | Ga0207700_10539799 | Ga0207700_105397992 | 140 |
| 299 | 3300025929 | Ga0207664_10007907 | Ga0207664_100079078 | 140 |
| 300 | 3300025931 | Ga0207644_10143676 | Ga0207644_101436763 | 140 |
| 301 | 3300025939 | Ga0207665_10001072 | Ga0207665_1000107217 | 140 |
| 302 | 3300025941 | Ga0207711_10025595 | Ga0207711_100255955 | 140 |
| 303 | 3300026035 | Ga0207703_10482658 | Ga0207703_104826581 | 140 |
| 304 | 3300026078 | Ga0207702_10585597 | Ga0207702_105855972 | 140 |
| 305 | 3300026116 | Ga0207674_10288352 | Ga0207674_102883523 | 140 |
| 306 | 3300028786 | Ga0307517_10285537 | Ga0307517_102855371 | 140 |
| 307 | 3300028794 | Ga0307515_10058325 | Ga0307515_100583253 | 140 |
| 308 | 3300028794 | Ga0307515_10420527 | Ga0307515_104205271 | 140 |
| 309 | 3300033180 | Ga0307510_10008458 | Ga0307510_100084589 | 140 |
| 310 | 3300033180 | Ga0307510_10177098 | Ga0307510_101770982 | 140 |
| 311 | 3300033544 | Ga0316215_1029823 | Ga0316215_10298232 | 140 |
| 312 | 3300035695 | Ga0373927_0387816 | Ga0373927_0387816_338_760 | 140 |
| 313 | 3300041492 | Ga0451835_0153052 | Ga0451835_0153052_100_522 | 140 |
| 314 | 3300041494 | Ga0451837_0595071 | Ga0451837_0595071_276_698 | 140 |
| 315 | 3300041507 | Ga0451851_0227276 | Ga0451851_0227276_1609_2031 | 140 |
| 316 | 3300041512 | Ga0451853_1297410 | Ga0451853_1297410_127_549 | 140 |
| 317 | 3300044656 | Ga0466969_0167388 | Ga0466969_0167388_55_495 | 140 |
| 318 | 3300044684 | Ga0466966_0539586 | Ga0466966_0539586_185_625 | 140 |
| 319 | 3300044765 | Ga0466970_0164137 | Ga0466970_0164137_612_1052 | 140 |
| 320 | 3300045049 | Ga0466959_0003549 | Ga0466959_0003549_2857_3297 | 140 |
| 321 | 3300046460 | Ga0495638_0004919 | Ga0495638_0004919_3443_3865 | 140 |
| 322 | 3300046492 | Ga0495585_0463162 | Ga0495585_0463162_56_478 | 140 |
| 323 | 3300046512 | Ga0495610_0274314 | Ga0495610_0274314_151_573 | 140 |
| 324 | 3300046519 | Ga0495632_0038567 | Ga0495632_0038567_985_1407 | 140 |
| 325 | 3300046524 | Ga0495648_0048786 | Ga0495648_0048786_560_982 | 140 |
| 326 | 3300046616 | Ga0495668_0150115 | Ga0495668_0150115_720_1142 | 140 |
| 327 | 3300046660 | Ga0495625_0515761 | Ga0495625_0515761_11_433 | 140 |
| 328 | 3300046694 | Ga0495649_0557779 | Ga0495649_0557779_66_488 | 140 |
| 329 | 3300047469 | Ga0495673_0085907 | Ga0495673_0085907_237_659 | 140 |
| 330 | 3300047469 | Ga0495673_0217300 | Ga0495673_0217300_181_603 | 140 |
| 331 | 3300048088 | Ga0495602_0621950 | Ga0495602_0621950_41_463 | 140 |
| 332 | 3300048904 | Ga0496101_0023487 | Ga0496101_0023487_757_1179 | 140 |
| 333 | 3300048905 | Ga0496102_0093381 | Ga0496102_0093381_34_456 | 140 |
| 334 | 3300048907 | Ga0496104_0049184 | Ga0496104_0049184_632_1054 | 140 |
| 335 | 3300048908 | Ga0496105_0075306 | Ga0496105_0075306_933_1355 | 140 |
| 336 | 3300048909 | Ga0496106_0033052 | Ga0496106_0033052_758_1180 | 140 |
| 337 | 3300048910 | Ga0496107_0070722 | Ga0496107_0070722_1520_1942 | 140 |
| 338 | 3300048912 | Ga0496109_0206453 | Ga0496109_0206453_1017_1439 | 140 |
| 339 | 3300048913 | Ga0496110_0042236 | Ga0496110_0042236_593_1015 | 140 |
| 340 | 3300048914 | Ga0496111_0183651 | Ga0496111_0183651_1103_1525 | 140 |
| 341 | 3300048915 | Ga0496112_0032895 | Ga0496112_0032895_3882_4304 | 140 |
| 342 | 3300048916 | Ga0496113_0114845 | Ga0496113_0114845_285_707 | 140 |
| 343 | 3300048918 | Ga0496115_0083872 | Ga0496115_0083872_1640_2062 | 140 |
| 344 | 3300049460 | Ga0495682_0083048 | Ga0495682_0083048_200_622 | 140 |
| 345 | 3300053083 | Ga0495655_0372034 | Ga0495655_0372034_17_439 | 140 |
| 346 | 3300053087 | Ga0500643_050489 | Ga0500643_050489_405_827 | 140 |
| 347 | 3300053092 | Ga0500583_0021076 | Ga0500583_0021076_217_639 | 140 |
| 348 | 3300053096 | Ga0500641_0078346 | Ga0500641_0078346_250_672 | 140 |
| 349 | 3300053103 | Ga0500555_003590 | Ga0500555_003590_2277_2699 | 140 |
| 350 | 3300053104 | Ga0500556_0003155 | Ga0500556_0003155_1637_2059 | 140 |
| 351 | 3300053104 | Ga0500556_0301841 | Ga0500556_0301841_104_526 | 140 |
| 352 | 3300053108 | Ga0500562_006055 | Ga0500562_006055_2458_2880 | 140 |
| 353 | 3300053130 | Ga0500642_0090055 | Ga0500642_0090055_28_450 | 140 |
| 354 | 3300053133 | Ga0500655_048735 | Ga0500655_048735_10_432 | 140 |
| 355 | 3300053139 | Ga0500568_0019594 | Ga0500568_0019594_2499_2921 | 140 |
| 356 | 3300053151 | Ga0500604_0029865 | Ga0500604_0029865_187_609 | 140 |
| 357 | 3300053156 | Ga0500622_0361311 | Ga0500622_0361311_101_523 | 140 |
| 358 | 3300053158 | Ga0500627_0321952 | Ga0500627_0321952_53_475 | 140 |
| 359 | 3300053160 | Ga0500633_0020658 | Ga0500633_0020658_561_983 | 140 |
| 360 | 3300053730 | Ga0500645_039681 | Ga0500645_039681_711_1136 | 140 |
| 361 | 3300053730 | Ga0500645_051857 | Ga0500645_051857_260_682 | 140 |
| 362 | 3300053736 | Ga0500599_000400 | Ga0500599_000400_352_774 | 140 |
| 363 | 3300001904 | JGI24736J21556_1029064 | JGI24736J21556_10290641 | 141 |
| 364 | 3300001989 | JGI24739J22299_10159857 | JGI24739J22299_101598571 | 141 |
| 365 | 3300003794 | Ga0055531_10044523 | Ga0055531_100445232 | 141 |
| 366 | 3300005331 | Ga0070670_100331594 | Ga0070670_1003315942 | 141 |
| 367 | 3300005335 | Ga0070666_10031914 | Ga0070666_100319144 | 141 |
| 368 | 3300005335 | Ga0070666_10162265 | Ga0070666_101622652 | 141 |
| 369 | 3300005336 | Ga0070680_100541876 | Ga0070680_1005418762 | 141 |
| 370 | 3300005337 | Ga0070682_100033993 | Ga0070682_1000339935 | 141 |
| 371 | 3300005338 | Ga0068868_100420909 | Ga0068868_1004209091 | 141 |
| 372 | 3300005340 | Ga0070689_100461258 | Ga0070689_1004612583 | 141 |
| 373 | 3300005341 | Ga0070691_10333830 | Ga0070691_103338302 | 141 |
| 374 | 3300005343 | Ga0070687_100100429 | Ga0070687_1001004293 | 141 |
| 375 | 3300005344 | Ga0070661_100049498 | Ga0070661_1000494985 | 141 |
| 376 | 3300005347 | Ga0070668_100036882 | Ga0070668_1000368822 | 141 |
| 377 | 3300005353 | Ga0070669_100691660 | Ga0070669_1006916602 | 141 |
| 378 | 3300005354 | Ga0070675_100415925 | Ga0070675_1004159252 | 141 |
| 379 | 3300005354 | Ga0070675_101883211 | Ga0070675_1018832111 | 141 |
| 380 | 3300005355 | Ga0070671_100059070 | Ga0070671_1000590702 | 141 |
| 381 | 3300005355 | Ga0070671_100144711 | Ga0070671_1001447113 | 141 |
| 382 | 3300005356 | Ga0070674_100152366 | Ga0070674_1001523663 | 141 |
| 383 | 3300005364 | Ga0070673_100023208 | Ga0070673_1000232084 | 141 |
| 384 | 3300005364 | Ga0070673_101626359 | Ga0070673_1016263591 | 141 |
| 385 | 3300005365 | Ga0070688_100640354 | Ga0070688_1006403541 | 141 |
| 386 | 3300005367 | Ga0070667_100066963 | Ga0070667_1000669634 | 141 |
| 387 | 3300005434 | Ga0070709_10006594 | Ga0070709_100065948 | 141 |
| 388 | 3300005435 | Ga0070714_100024651 | Ga0070714_1000246514 | 141 |
| 389 | 3300005435 | Ga0070714_100050162 | Ga0070714_1000501623 | 141 |
| 390 | 3300005435 | Ga0070714_100900473 | Ga0070714_1009004731 | 141 |
| 391 | 3300005436 | Ga0070713_100013850 | Ga0070713_1000138504 | 141 |
| 392 | 3300005436 | Ga0070713_100115085 | Ga0070713_1001150854 | 141 |
| 393 | 3300005437 | Ga0070710_10383336 | Ga0070710_103833362 | 141 |
| 394 | 3300005437 | Ga0070710_10753845 | Ga0070710_107538451 | 141 |
| 395 | 3300005439 | Ga0070711_100138930 | Ga0070711_1001389303 | 141 |
| 396 | 3300005439 | Ga0070711_100544071 | Ga0070711_1005440712 | 141 |
| 397 | 3300005439 | Ga0070711_100630139 | Ga0070711_1006301392 | 141 |
| 398 | 3300005439 | Ga0070711_101216695 | Ga0070711_1012166951 | 141 |
| 399 | 3300005455 | Ga0070663_100058160 | Ga0070663_1000581603 | 141 |
| 400 | 3300005455 | Ga0070663_100214577 | Ga0070663_1002145772 | 141 |
| 401 | 3300005456 | Ga0070678_100041051 | Ga0070678_1000410515 | 141 |
| 402 | 3300005458 | Ga0070681_10296286 | Ga0070681_102962862 | 141 |
| 403 | 3300005466 | Ga0070685_10033295 | Ga0070685_100332953 | 141 |
| 404 | 3300005467 | Ga0070706_100265211 | Ga0070706_1002652113 | 141 |
| 405 | 3300005467 | Ga0070706_100564086 | Ga0070706_1005640861 | 141 |
| 406 | 3300005467 | Ga0070706_100929972 | Ga0070706_1009299721 | 141 |
| 407 | 3300005468 | Ga0070707_100773233 | Ga0070707_1007732331 | 141 |
| 408 | 3300005471 | Ga0070698_100352319 | Ga0070698_1003523192 | 141 |
| 409 | 3300005471 | Ga0070698_100588372 | Ga0070698_1005883721 | 141 |
| 410 | 3300005471 | Ga0070698_100746413 | Ga0070698_1007464131 | 141 |
| 411 | 3300005518 | Ga0070699_100682520 | Ga0070699_1006825201 | 141 |
| 412 | 3300005530 | Ga0070679_100044161 | Ga0070679_1000441613 | 141 |
| 413 | 3300005535 | Ga0070684_100250152 | Ga0070684_1002501523 | 141 |
| 414 | 3300005535 | Ga0070684_100250578 | Ga0070684_1002505783 | 141 |
| 415 | 3300005535 | Ga0070684_100280207 | Ga0070684_1002802073 | 141 |
| 416 | 3300005536 | Ga0070697_101407977 | Ga0070697_1014079771 | 141 |
| 417 | 3300005536 | Ga0070697_102092728 | Ga0070697_1020927281 | 141 |
| 418 | 3300005539 | Ga0068853_100209856 | Ga0068853_1002098561 | 141 |
| 419 | 3300005543 | Ga0070672_100249124 | Ga0070672_1002491243 | 141 |
| 420 | 3300005544 | Ga0070686_100028574 | Ga0070686_1000285744 | 141 |
| 421 | 3300005546 | Ga0070696_100694322 | Ga0070696_1006943221 | 141 |
| 422 | 3300005547 | Ga0070693_100394740 | Ga0070693_1003947402 | 141 |
| 423 | 3300005548 | Ga0070665_100128511 | Ga0070665_1001285112 | 141 |
| 424 | 3300005548 | Ga0070665_100504232 | Ga0070665_1005042323 | 141 |
| 425 | 3300005577 | Ga0068857_100202889 | Ga0068857_1002028892 | 141 |
| 426 | 3300005577 | Ga0068857_100230824 | Ga0068857_1002308241 | 141 |
| 427 | 3300005614 | Ga0068856_100081658 | Ga0068856_1000816585 | 141 |
| 428 | 3300005614 | Ga0068856_101457596 | Ga0068856_1014575961 | 141 |
| 429 | 3300005615 | Ga0070702_100164382 | Ga0070702_1001643821 | 141 |
| 430 | 3300005616 | Ga0068852_100822318 | Ga0068852_1008223182 | 141 |
| 431 | 3300005617 | Ga0068859_100212221 | Ga0068859_1002122215 | 141 |
| 432 | 3300005618 | Ga0068864_100072302 | Ga0068864_1000723023 | 141 |
| 433 | 3300005834 | Ga0068851_10359222 | Ga0068851_103592221 | 141 |
| 434 | 3300005841 | Ga0068863_100190180 | Ga0068863_1001901802 | 141 |
| 435 | 3300005841 | Ga0068863_100234561 | Ga0068863_1002345611 | 141 |
| 436 | 3300005841 | Ga0068863_100311724 | Ga0068863_1003117243 | 141 |
| 437 | 3300005842 | Ga0068858_100167886 | Ga0068858_1001678863 | 141 |
| 438 | 3300005842 | Ga0068858_100546155 | Ga0068858_1005461551 | 141 |
| 439 | 3300005843 | Ga0068860_100340567 | Ga0068860_1003405671 | 141 |
| 440 | 3300005844 | Ga0068862_100580020 | Ga0068862_1005800202 | 141 |
| 441 | 3300006028 | Ga0070717_10002063 | Ga0070717_100020634 | 141 |
| 442 | 3300006028 | Ga0070717_10063991 | Ga0070717_100639914 | 141 |
| 443 | 3300006028 | Ga0070717_10524093 | Ga0070717_105240932 | 141 |
| 444 | 3300006051 | Ga0075364_10090133 | Ga0075364_100901332 | 141 |
| 445 | 3300006163 | Ga0070715_10034619 | Ga0070715_100346195 | 141 |
| 446 | 3300006173 | Ga0070716_100003451 | Ga0070716_1000034517 | 141 |
| 447 | 3300006173 | Ga0070716_100780373 | Ga0070716_1007803731 | 141 |
| 448 | 3300006175 | Ga0070712_100321967 | Ga0070712_1003219673 | 141 |
| 449 | 3300006175 | Ga0070712_100442663 | Ga0070712_1004426632 | 141 |
| 450 | 3300006175 | Ga0070712_100749308 | Ga0070712_1007493082 | 141 |
| 451 | 3300006177 | Ga0075362_10143408 | Ga0075362_101434082 | 141 |
| 452 | 3300006178 | Ga0075367_10240951 | Ga0075367_102409512 | 141 |
| 453 | 3300006178 | Ga0075367_10712549 | Ga0075367_107125491 | 141 |
| 454 | 3300006186 | Ga0075369_10131074 | Ga0075369_101310742 | 141 |
| 455 | 3300006186 | Ga0075369_10441910 | Ga0075369_104419102 | 141 |
| 456 | 3300006195 | Ga0075366_10012033 | Ga0075366_100120337 | 141 |
| 457 | 3300006237 | Ga0097621_100102101 | Ga0097621_1001021015 | 141 |
| 458 | 3300006358 | Ga0068871_100053351 | Ga0068871_1000533513 | 141 |
| 459 | 3300006847 | Ga0075431_100700520 | Ga0075431_1007005201 | 141 |
| 460 | 3300006852 | Ga0075433_10090020 | Ga0075433_100900203 | 141 |
| 461 | 3300006881 | Ga0068865_100065878 | Ga0068865_1000658785 | 141 |
| 462 | 3300006881 | Ga0068865_100738678 | Ga0068865_1007386782 | 141 |
| 463 | 3300006914 | Ga0075436_100392603 | Ga0075436_1003926032 | 141 |
| 464 | 3300006931 | Ga0097620_100212229 | Ga0097620_1002122295 | 141 |
| 465 | 3300007076 | Ga0075435_100009745 | Ga0075435_1000097453 | 141 |
| 466 | 3300007076 | Ga0075435_100570558 | Ga0075435_1005705582 | 141 |
| 467 | 3300007788 | Ga0099795_10023932 | Ga0099795_100239322 | 141 |
| 468 | 3300007788 | Ga0099795_10048771 | Ga0099795_100487712 | 141 |
| 469 | 3300009011 | Ga0105251_10029408 | Ga0105251_100294085 | 141 |
| 470 | 3300009092 | Ga0105250_10224504 | Ga0105250_102245041 | 141 |
| 471 | 3300009094 | Ga0111539_10843425 | Ga0111539_108434252 | 141 |
| 472 | 3300009098 | Ga0105245_10321862 | Ga0105245_103218622 | 141 |
| 473 | 3300009098 | Ga0105245_11141935 | Ga0105245_111419351 | 141 |
| 474 | 3300009101 | Ga0105247_10165485 | Ga0105247_101654852 | 141 |
| 475 | 3300009101 | Ga0105247_11261842 | Ga0105247_112618421 | 141 |
| 476 | 3300009148 | Ga0105243_10069112 | Ga0105243_100691122 | 141 |
| 477 | 3300009148 | Ga0105243_10798501 | Ga0105243_107985011 | 141 |
| 478 | 3300009148 | Ga0105243_12295722 | Ga0105243_122957221 | 141 |
| 479 | 3300009174 | Ga0105241_10132181 | Ga0105241_101321812 | 141 |
| 480 | 3300009176 | Ga0105242_10150596 | Ga0105242_101505962 | 141 |
| 481 | 3300009177 | Ga0105248_10096567 | Ga0105248_100965672 | 141 |
| 482 | 3300009177 | Ga0105248_10290835 | Ga0105248_102908352 | 141 |
| 483 | 3300009177 | Ga0105248_10293218 | Ga0105248_102932183 | 141 |
| 484 | 3300009545 | Ga0105237_10065253 | Ga0105237_100652534 | 141 |
| 485 | 3300009545 | Ga0105237_10497877 | Ga0105237_104978772 | 141 |
| 486 | 3300009551 | Ga0105238_10571889 | Ga0105238_105718892 | 141 |
| 487 | 3300009551 | Ga0105238_10816175 | Ga0105238_108161751 | 141 |
| 488 | 3300009551 | Ga0105238_10860645 | Ga0105238_108606452 | 141 |
| 489 | 3300010159 | Ga0099796_10194774 | Ga0099796_101947742 | 141 |
| 490 | 3300010375 | Ga0105239_10435458 | Ga0105239_104354582 | 141 |
| 491 | 3300010375 | Ga0105239_10695543 | Ga0105239_106955431 | 141 |
| 492 | 3300011119 | Ga0105246_10142512 | Ga0105246_101425122 | 141 |
| 493 | 3300012480 | Ga0157346_1003875 | Ga0157346_10038752 | 141 |
| 494 | 3300012487 | Ga0157321_1006128 | Ga0157321_10061282 | 141 |
| 495 | 3300012494 | Ga0157341_1002933 | Ga0157341_10029332 | 141 |
| 496 | 3300012506 | Ga0157324_1031631 | Ga0157324_10316311 | 141 |
| 497 | 3300012507 | Ga0157342_1006762 | Ga0157342_10067621 | 141 |
| 498 | 3300012512 | Ga0157327_1020250 | Ga0157327_10202502 | 141 |
| 499 | 3300013105 | Ga0157369_10050653 | Ga0157369_100506532 | 141 |
| 500 | 3300013105 | Ga0157369_10414934 | Ga0157369_104149343 | 141 |
| 501 | 3300013296 | Ga0157374_10364707 | Ga0157374_103647072 | 141 |
| 502 | 3300013297 | Ga0157378_10078599 | Ga0157378_100785994 | 141 |
| 503 | 3300013297 | Ga0157378_11173336 | Ga0157378_111733362 | 141 |
| 504 | 3300013306 | Ga0163162_10241776 | Ga0163162_102417762 | 141 |
| 505 | 3300013306 | Ga0163162_10476677 | Ga0163162_104766772 | 141 |
| 506 | 3300013308 | Ga0157375_10505267 | Ga0157375_105052671 | 141 |
| 507 | 3300013308 | Ga0157375_11503301 | Ga0157375_115033011 | 141 |
| 508 | 3300014325 | Ga0163163_10182975 | Ga0163163_101829752 | 141 |
| 509 | 3300014325 | Ga0163163_10646726 | Ga0163163_106467262 | 141 |
| 510 | 3300014325 | Ga0163163_10870736 | Ga0163163_108707362 | 141 |
| 511 | 3300014745 | Ga0157377_10466010 | Ga0157377_104660101 | 141 |
| 512 | 3300014745 | Ga0157377_11064020 | Ga0157377_110640201 | 141 |
| 513 | 3300014968 | Ga0157379_10182921 | Ga0157379_101829212 | 141 |
| 514 | 3300017792 | Ga0163161_10660159 | Ga0163161_106601592 | 141 |
| 515 | 3300025304 | Ga0209257_1016366 | Ga0209257_10163663 | 141 |
| 516 | 3300025321 | Ga0207656_10369960 | Ga0207656_103699601 | 141 |
| 517 | 3300025735 | Ga0207713_1029276 | Ga0207713_10292763 | 141 |
| 518 | 3300025898 | Ga0207692_10015010 | Ga0207692_100150104 | 141 |
| 519 | 3300025898 | Ga0207692_10308877 | Ga0207692_103088772 | 141 |
| 520 | 3300025900 | Ga0207710_10025982 | Ga0207710_100259823 | 141 |
| 521 | 3300025900 | Ga0207710_10601175 | Ga0207710_106011751 | 141 |
| 522 | 3300025903 | Ga0207680_10133162 | Ga0207680_101331623 | 141 |
| 523 | 3300025904 | Ga0207647_10114051 | Ga0207647_101140512 | 141 |
| 524 | 3300025904 | Ga0207647_10535633 | Ga0207647_105356332 | 141 |
| 525 | 3300025905 | Ga0207685_10034813 | Ga0207685_100348133 | 141 |
| 526 | 3300025906 | Ga0207699_10001770 | Ga0207699_100017708 | 141 |
| 527 | 3300025907 | Ga0207645_10227402 | Ga0207645_102274023 | 141 |
| 528 | 3300025910 | Ga0207684_10775129 | Ga0207684_107751292 | 141 |
| 529 | 3300025912 | Ga0207707_10226485 | Ga0207707_102264853 | 141 |
| 530 | 3300025914 | Ga0207671_10190002 | Ga0207671_101900023 | 141 |
| 531 | 3300025915 | Ga0207693_10110901 | Ga0207693_101109013 | 141 |
| 532 | 3300025915 | Ga0207693_10432850 | Ga0207693_104328502 | 141 |
| 533 | 3300025916 | Ga0207663_10052746 | Ga0207663_100527462 | 141 |
| 534 | 3300025916 | Ga0207663_10070638 | Ga0207663_100706384 | 141 |
| 535 | 3300025916 | Ga0207663_10407751 | Ga0207663_104077512 | 141 |
| 536 | 3300025919 | Ga0207657_10272274 | Ga0207657_102722742 | 141 |
| 537 | 3300025919 | Ga0207657_10330779 | Ga0207657_103307792 | 141 |
| 538 | 3300025920 | Ga0207649_11024230 | Ga0207649_110242301 | 141 |
| 539 | 3300025921 | Ga0207652_10010590 | Ga0207652_100105903 | 141 |
| 540 | 3300025922 | Ga0207646_10631306 | Ga0207646_106313061 | 141 |
| 541 | 3300025924 | Ga0207694_10427688 | Ga0207694_104276882 | 141 |
| 542 | 3300025925 | Ga0207650_10083520 | Ga0207650_100835202 | 141 |
| 543 | 3300025925 | Ga0207650_10266822 | Ga0207650_102668222 | 141 |
| 544 | 3300025927 | Ga0207687_10012794 | Ga0207687_100127945 | 141 |
| 545 | 3300025927 | Ga0207687_10912353 | Ga0207687_109123531 | 141 |
| 546 | 3300025928 | Ga0207700_10004844 | Ga0207700_100048446 | 141 |
| 547 | 3300025928 | Ga0207700_10010379 | Ga0207700_100103793 | 141 |
| 548 | 3300025928 | Ga0207700_10597867 | Ga0207700_105978672 | 141 |
| 549 | 3300025929 | Ga0207664_10763708 | Ga0207664_107637082 | 141 |
| 550 | 3300025931 | Ga0207644_10041350 | Ga0207644_100413504 | 141 |
| 551 | 3300025931 | Ga0207644_10114805 | Ga0207644_101148051 | 141 |
| 552 | 3300025932 | Ga0207690_10148701 | Ga0207690_101487012 | 141 |
| 553 | 3300025932 | Ga0207690_10361681 | Ga0207690_103616811 | 141 |
| 554 | 3300025933 | Ga0207706_10053868 | Ga0207706_100538682 | 141 |
| 555 | 3300025933 | Ga0207706_10551467 | Ga0207706_105514672 | 141 |
| 556 | 3300025934 | Ga0207686_10034580 | Ga0207686_100345805 | 141 |
| 557 | 3300025935 | Ga0207709_10164742 | Ga0207709_101647422 | 141 |
| 558 | 3300025935 | Ga0207709_11356654 | Ga0207709_113566541 | 141 |
| 559 | 3300025938 | Ga0207704_10195864 | Ga0207704_101958642 | 141 |
| 560 | 3300025939 | Ga0207665_10004233 | Ga0207665_1000423311 | 141 |
| 561 | 3300025939 | Ga0207665_10026869 | Ga0207665_100268695 | 141 |
| 562 | 3300025939 | Ga0207665_10458333 | Ga0207665_104583332 | 141 |
| 563 | 3300025939 | Ga0207665_10567784 | Ga0207665_105677842 | 141 |
| 564 | 3300025940 | Ga0207691_10046346 | Ga0207691_100463466 | 141 |
| 565 | 3300025941 | Ga0207711_10033852 | Ga0207711_100338523 | 141 |
| 566 | 3300025941 | Ga0207711_10434829 | Ga0207711_104348292 | 141 |
| 567 | 3300025944 | Ga0207661_10111892 | Ga0207661_101118922 | 141 |
| 568 | 3300025944 | Ga0207661_10178685 | Ga0207661_101786853 | 141 |
| 569 | 3300025949 | Ga0207667_10230320 | Ga0207667_102303202 | 141 |
| 570 | 3300025960 | Ga0207651_10294295 | Ga0207651_102942952 | 141 |
| 571 | 3300025972 | Ga0207668_10140262 | Ga0207668_101402622 | 141 |
| 572 | 3300025972 | Ga0207668_10157418 | Ga0207668_101574182 | 141 |
| 573 | 3300025972 | Ga0207668_10979739 | Ga0207668_109797392 | 141 |
| 574 | 3300025986 | Ga0207658_10129624 | Ga0207658_101296244 | 141 |
| 575 | 3300026023 | Ga0207677_10141054 | Ga0207677_101410542 | 141 |
| 576 | 3300026035 | Ga0207703_10101418 | Ga0207703_101014184 | 141 |
| 577 | 3300026035 | Ga0207703_10279671 | Ga0207703_102796711 | 141 |
| 578 | 3300026041 | Ga0207639_10514690 | Ga0207639_105146901 | 141 |
| 579 | 3300026067 | Ga0207678_10090345 | Ga0207678_100903452 | 141 |
| 580 | 3300026067 | Ga0207678_10146846 | Ga0207678_101468463 | 141 |
| 581 | 3300026067 | Ga0207678_10189873 | Ga0207678_101898732 | 141 |
| 582 | 3300026075 | Ga0207708_10073466 | Ga0207708_100734664 | 141 |
| 583 | 3300026078 | Ga0207702_10299535 | Ga0207702_102995353 | 141 |
| 584 | 3300026088 | Ga0207641_10177653 | Ga0207641_101776535 | 141 |
| 585 | 3300026088 | Ga0207641_10545956 | Ga0207641_105459562 | 141 |
| 586 | 3300026089 | Ga0207648_10174815 | Ga0207648_101748151 | 141 |
| 587 | 3300026095 | Ga0207676_10284533 | Ga0207676_102845331 | 141 |
| 588 | 3300026095 | Ga0207676_10321976 | Ga0207676_103219761 | 141 |
| 589 | 3300026116 | Ga0207674_10086582 | Ga0207674_100865823 | 141 |
| 590 | 3300026118 | Ga0207675_101888401 | Ga0207675_1018884011 | 141 |
| 591 | 3300026121 | Ga0207683_10017427 | Ga0207683_100174274 | 141 |
| 592 | 3300026142 | Ga0207698_10237013 | Ga0207698_102370131 | 141 |
| 593 | 3300027907 | Ga0207428_10086181 | Ga0207428_100861812 | 141 |
| 594 | 3300027907 | Ga0207428_10424925 | Ga0207428_104249251 | 141 |
| 595 | 3300028379 | Ga0268266_10033064 | Ga0268266_100330643 | 141 |
| 596 | 3300028381 | Ga0268264_10101786 | Ga0268264_101017863 | 141 |
| 597 | 3300031616 | Ga0307508_10033908 | Ga0307508_100339084 | 141 |
| 598 | 3300033180 | Ga0307510_10134756 | Ga0307510_101347561 | 141 |
| 599 | 3300034816 | Ga0373930_0023479 | Ga0373930_0023479_111_536 | 141 |
| 600 | 3300035091 | Ga0373951_0075716 | Ga0373951_0075716_246_671 | 141 |
| 601 | 3300035092 | Ga0373952_0019801 | Ga0373952_0019801_923_1348 | 141 |
| 602 | 3300035114 | Ga0373939_0403998 | Ga0373939_0403998_105_530 | 141 |
| 603 | 3300035115 | Ga0373941_0187392 | Ga0373941_0187392_247_672 | 141 |
| 604 | 3300035116 | Ga0373945_0043635 | Ga0373945_0043635_219_644 | 141 |
| 605 | 3300035121 | Ga0373960_0201203 | Ga0373960_0201203_168_593 | 141 |
| 606 | 3300035170 | Ga0373943_0039152 | Ga0373943_0039152_112_537 | 141 |
| 607 | 3300035171 | Ga0373946_0026637 | Ga0373946_0026637_63_488 | 141 |
| 608 | 3300035241 | Ga0373961_0012586 | Ga0373961_0012586_32_457 | 141 |
| 609 | 3300035691 | Ga0373931_0129183 | Ga0373931_0129183_619_1044 | 141 |
| 610 | 3300035725 | Ga0373947_0001566 | Ga0373947_0001566_6405_6830 | 141 |
| 611 | 3300037068 | Ga0373925_0013517 | Ga0373925_0013517_5439_5864 | 141 |
| 612 | 3300046459 | Ga0495629_0001306 | Ga0495629_0001306_15668_16093 | 141 |
| 613 | 3300046462 | Ga0495651_0691382 | Ga0495651_0691382_80_505 | 141 |
| 614 | 3300046473 | Ga0495582_0001069 | Ga0495582_0001069_381_806 | 141 |
| 615 | 3300046474 | Ga0495605_0054123 | Ga0495605_0054123_1471_1896 | 141 |
| 616 | 3300046474 | Ga0495605_0074470 | Ga0495605_0074470_427_852 | 141 |
| 617 | 3300046499 | Ga0495594_0005370 | Ga0495594_0005370_1315_1740 | 141 |
| 618 | 3300046506 | Ga0495583_0262027 | Ga0495583_0262027_149_574 | 141 |
| 619 | 3300046507 | Ga0495606_0044716 | Ga0495606_0044716_1896_2321 | 141 |
| 620 | 3300046507 | Ga0495606_0050123 | Ga0495606_0050123_1235_1666 | 141 |
| 621 | 3300046512 | Ga0495610_0091732 | Ga0495610_0091732_40_465 | 141 |
| 622 | 3300046512 | Ga0495610_0257871 | Ga0495610_0257871_223_648 | 141 |
| 623 | 3300046515 | Ga0495620_0035667 | Ga0495620_0035667_698_1123 | 141 |
| 624 | 3300046517 | Ga0495630_0405450 | Ga0495630_0405450_563_988 | 141 |
| 625 | 3300046524 | Ga0495648_0072410 | Ga0495648_0072410_378_803 | 141 |
| 626 | 3300046530 | Ga0495654_0152506 | Ga0495654_0152506_547_972 | 141 |
| 627 | 3300046538 | Ga0495609_0060084 | Ga0495609_0060084_921_1346 | 141 |
| 628 | 3300046538 | Ga0495609_0204290 | Ga0495609_0204290_379_804 | 141 |
| 629 | 3300046542 | Ga0495597_0059674 | Ga0495597_0059674_984_1409 | 141 |
| 630 | 3300046557 | Ga0495622_0102961 | Ga0495622_0102961_250_675 | 141 |
| 631 | 3300046557 | Ga0495622_0110318 | Ga0495622_0110318_587_1012 | 141 |
| 632 | 3300046557 | Ga0495622_0122110 | Ga0495622_0122110_45_476 | 141 |
| 633 | 3300046648 | Ga0495611_0059673 | Ga0495611_0059673_1110_1541 | 141 |
| 634 | 3300046660 | Ga0495625_0209923 | Ga0495625_0209923_815_1246 | 141 |
| 635 | 3300046660 | Ga0495625_0223929 | Ga0495625_0223929_427_852 | 141 |
| 636 | 3300046660 | Ga0495625_0263961 | Ga0495625_0263961_495_920 | 141 |
| 637 | 3300046674 | Ga0495588_0138758 | Ga0495588_0138758_306_731 | 141 |
| 638 | 3300046681 | Ga0495647_0026122 | Ga0495647_0026122_1213_1638 | 141 |
| 639 | 3300046683 | Ga0495658_0000967 | Ga0495658_0000967_7928_8353 | 141 |
| 640 | 3300046690 | Ga0495624_0691588 | Ga0495624_0691588_121_546 | 141 |
| 641 | 3300046692 | Ga0495671_0126295 | Ga0495671_0126295_751_1182 | 141 |
| 642 | 3300046694 | Ga0495649_0507251 | Ga0495649_0507251_148_573 | 141 |
| 643 | 3300047321 | Ga0495676_0022259 | Ga0495676_0022259_182_607 | 141 |
| 644 | 3300047323 | Ga0495683_0090983 | Ga0495683_0090983_151_576 | 141 |
| 645 | 3300047323 | Ga0495683_0343601 | Ga0495683_0343601_74_505 | 141 |
| 646 | 3300047443 | Ga0495687_161356 | Ga0495687_161356_157_582 | 141 |
| 647 | 3300047469 | Ga0495673_0104426 | Ga0495673_0104426_73_498 | 141 |
| 648 | 3300047469 | Ga0495673_0244169 | Ga0495673_0244169_178_603 | 141 |
| 649 | 3300047673 | Ga0495593_0415253 | Ga0495593_0415253_220_645 | 141 |
| 650 | 3300048903 | Ga0496100_0038877 | Ga0496100_0038877_2551_2976 | 141 |
| 651 | 3300048903 | Ga0496100_0236171 | Ga0496100_0236171_649_1074 | 141 |
| 652 | 3300048904 | Ga0496101_0004589 | Ga0496101_0004589_320_745 | 141 |
| 653 | 3300048904 | Ga0496101_0164972 | Ga0496101_0164972_316_747 | 141 |
| 654 | 3300048904 | Ga0496101_1286975 | Ga0496101_1286975_21_446 | 141 |
| 655 | 3300048905 | Ga0496102_0011208 | Ga0496102_0011208_581_1006 | 141 |
| 656 | 3300048905 | Ga0496102_0290004 | Ga0496102_0290004_801_1226 | 141 |
| 657 | 3300048906 | Ga0496103_0015983 | Ga0496103_0015983_1406_1831 | 141 |
| 658 | 3300048906 | Ga0496103_0188362 | Ga0496103_0188362_861_1286 | 141 |
| 659 | 3300048907 | Ga0496104_0181876 | Ga0496104_0181876_324_749 | 141 |
| 660 | 3300048907 | Ga0496104_0217293 | Ga0496104_0217293_1075_1500 | 141 |
| 661 | 3300048907 | Ga0496104_0291448 | Ga0496104_0291448_1090_1515 | 141 |
| 662 | 3300048908 | Ga0496105_0010764 | Ga0496105_0010764_324_749 | 141 |
| 663 | 3300048908 | Ga0496105_0043497 | Ga0496105_0043497_1619_2050 | 141 |
| 664 | 3300048908 | Ga0496105_0151854 | Ga0496105_0151854_388_813 | 141 |
| 665 | 3300048908 | Ga0496105_0484640 | Ga0496105_0484640_391_816 | 141 |
| 666 | 3300048908 | Ga0496105_0603594 | Ga0496105_0603594_391_816 | 141 |
| 667 | 3300048908 | Ga0496105_1293804 | Ga0496105_1293804_61_486 | 141 |
| 668 | 3300048909 | Ga0496106_0124532 | Ga0496106_0124532_1553_1984 | 141 |
| 669 | 3300048909 | Ga0496106_0271628 | Ga0496106_0271628_653_1078 | 141 |
| 670 | 3300048910 | Ga0496107_0056643 | Ga0496107_0056643_995_1420 | 141 |
| 671 | 3300048910 | Ga0496107_0576935 | Ga0496107_0576935_319_750 | 141 |
| 672 | 3300048911 | Ga0496108_0012633 | Ga0496108_0012633_113_538 | 141 |
| 673 | 3300048911 | Ga0496108_0238582 | Ga0496108_0238582_1073_1498 | 141 |
| 674 | 3300048911 | Ga0496108_0326690 | Ga0496108_0326690_520_945 | 141 |
| 675 | 3300048912 | Ga0496109_0036006 | Ga0496109_0036006_1077_1502 | 141 |
| 676 | 3300048912 | Ga0496109_0315724 | Ga0496109_0315724_730_1155 | 141 |
| 677 | 3300048912 | Ga0496109_0379127 | Ga0496109_0379127_635_1066 | 141 |
| 678 | 3300048913 | Ga0496110_0022139 | Ga0496110_0022139_3894_4319 | 141 |
| 679 | 3300048913 | Ga0496110_0072136 | Ga0496110_0072136_1513_1944 | 141 |
| 680 | 3300048913 | Ga0496110_0888016 | Ga0496110_0888016_178_603 | 141 |
| 681 | 3300048914 | Ga0496111_0007468 | Ga0496111_0007468_6011_6436 | 141 |
| 682 | 3300048915 | Ga0496112_0075775 | Ga0496112_0075775_324_749 | 141 |
| 683 | 3300048915 | Ga0496112_0212718 | Ga0496112_0212718_1118_1543 | 141 |
| 684 | 3300048915 | Ga0496112_0525721 | Ga0496112_0525721_419_844 | 141 |
| 685 | 3300048916 | Ga0496113_0205460 | Ga0496113_0205460_700_1125 | 141 |
| 686 | 3300048916 | Ga0496113_0430942 | Ga0496113_0430942_336_761 | 141 |
| 687 | 3300048917 | Ga0496114_0009386 | Ga0496114_0009386_4740_5165 | 141 |
| 688 | 3300048917 | Ga0496114_0075322 | Ga0496114_0075322_1089_1520 | 141 |
| 689 | 3300048918 | Ga0496115_0233276 | Ga0496115_0233276_803_1234 | 141 |
| 690 | 3300048918 | Ga0496115_0762794 | Ga0496115_0762794_172_597 | 141 |
| 691 | 3300048918 | Ga0496115_1014940 | Ga0496115_1014940_86_511 | 141 |
| 692 | 3300048919 | Ga0496116_0047230 | Ga0496116_0047230_2434_2859 | 141 |
| 693 | 3300048919 | Ga0496116_0275111 | Ga0496116_0275111_306_737 | 141 |
| 694 | 3300048920 | Ga0496117_0228904 | Ga0496117_0228904_386_811 | 141 |
| 695 | 3300048921 | Ga0496118_0024558 | Ga0496118_0024558_1301_1732 | 141 |
| 696 | 3300048922 | Ga0496119_0122871 | Ga0496119_0122871_266_691 | 141 |
| 697 | 3300048923 | Ga0496120_0214489 | Ga0496120_0214489_353_778 | 141 |
| 698 | 3300048924 | Ga0496121_0046077 | Ga0496121_0046077_692_1123 | 141 |
| 699 | 3300048925 | Ga0496122_0318247 | Ga0496122_0318247_95_520 | 141 |
| 700 | 3300048927 | Ga0496124_0384566 | Ga0496124_0384566_393_818 | 141 |
| 701 | 3300048928 | Ga0496125_0164900 | Ga0496125_0164900_688_1113 | 141 |
| 702 | 3300048928 | Ga0496125_0179400 | Ga0496125_0179400_718_1143 | 141 |
| 703 | 3300048929 | Ga0496126_0096161 | Ga0496126_0096161_99_524 | 141 |
| 704 | 3300048929 | Ga0496126_0101996 | Ga0496126_0101996_1418_1843 | 141 |
| 705 | 3300048929 | Ga0496126_0250191 | Ga0496126_0250191_895_1326 | 141 |
| 706 | 3300049460 | Ga0495682_0123722 | Ga0495682_0123722_114_539 | 141 |
| 707 | 3300049460 | Ga0495682_0207770 | Ga0495682_0207770_202_627 | 141 |
| 708 | 3300050490 | nmdc:mga03n38_511818_c1 | nmdc:mga03n38_511818_c1_101_526 | 141 |
| 709 | 3300050492 | nmdc:mga0yw44_1061758_c1 | nmdc:mga0yw44_1061758_c1_106_531 | 141 |
| 710 | 3300050492 | nmdc:mga0yw44_57930_c1 | nmdc:mga0yw44_57930_c1_1871_2302 | 141 |
| 711 | 3300050492 | nmdc:mga0yw44_99120_c1 | nmdc:mga0yw44_99120_c1_759_1184 | 141 |
| 712 | 3300050493 | nmdc:mga0k408_125429_c1 | nmdc:mga0k408_125429_c1_883_1308 | 141 |
| 713 | 3300050494 | nmdc:mga06z11_119875_c1 | nmdc:mga06z11_119875_c1_992_1417 | 141 |
| 714 | 3300050508 | nmdc:mga09592_241064_c1 | nmdc:mga09592_241064_c1_294_719 | 141 |
| 715 | 3300050509 | nmdc:mga0qj67_105304_c1 | nmdc:mga0qj67_105304_c1_1558_1983 | 141 |
| 716 | 3300050510 | nmdc:mga06r32_119839_c1 | nmdc:mga06r32_119839_c1_28_453 | 141 |
| 717 | 3300050510 | nmdc:mga06r32_54616_c1 | nmdc:mga06r32_54616_c1_2791_3216 | 141 |
| 718 | 3300050511 | nmdc:mga08y16_391967_c1 | nmdc:mga08y16_391967_c1_681_1106 | 141 |
| 719 | 3300050511 | nmdc:mga08y16_83147_c1 | nmdc:mga08y16_83147_c1_2791_3216 | 141 |
| 720 | 3300050512 | nmdc:mga0n895_137295_c1 | nmdc:mga0n895_137295_c1_1579_2004 | 141 |
| 721 | 3300050512 | nmdc:mga0n895_253520_c1 | nmdc:mga0n895_253520_c1_1044_1469 | 141 |
| 722 | 3300050512 | nmdc:mga0n895_351632_c1 | nmdc:mga0n895_351632_c1_181_606 | 141 |
| 723 | 3300050512 | nmdc:mga0n895_371392_c1 | nmdc:mga0n895_371392_c1_425_850 | 141 |
| 724 | 3300050513 | nmdc:mga0rr50_886470_c1 | nmdc:mga0rr50_886470_c1_230_655 | 141 |
| 725 | 3300050514 | nmdc:mga08x19_603155_c1 | nmdc:mga08x19_603155_c1_234_659 | 141 |
| 726 | 3300050515 | nmdc:mga0a205_573520_c1 | nmdc:mga0a205_573520_c1_180_605 | 141 |
| 727 | 3300050516 | nmdc:mga0sz30_194346_c1 | nmdc:mga0sz30_194346_c1_62_487 | 141 |
| 728 | 3300050516 | nmdc:mga0sz30_92231_c1 | nmdc:mga0sz30_92231_c1_801_1226 | 141 |
| 729 | 3300053083 | Ga0495655_0091952 | Ga0495655_0091952_232_657 | 141 |
| 730 | 3300053085 | Ga0495619_0000197 | Ga0495619_0000197_6945_7370 | 141 |
| 731 | 3300053086 | Ga0500578_0111265 | Ga0500578_0111265_579_1004 | 141 |
| 732 | 3300053093 | Ga0500651_0038651 | Ga0500651_0038651_1095_1520 | 141 |
| 733 | 3300053109 | Ga0500569_000906 | Ga0500569_000906_890_1315 | 141 |
| 734 | 3300053119 | Ga0500595_007843 | Ga0500595_007843_214_639 | 141 |
| 735 | 3300053123 | Ga0500614_049860 | Ga0500614_049860_153_581 | 141 |
| 736 | 3300053134 | Ga0500658_0153128 | Ga0500658_0153128_55_480 | 141 |
| 737 | 3300053142 | Ga0500577_0066161 | Ga0500577_0066161_303_728 | 141 |
| 738 | 3300053146 | Ga0500588_0030651 | Ga0500588_0030651_101_526 | 141 |
| 739 | 3300055283 | Ga0500661_006184 | Ga0500661_006184_396_821 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c1r-assembly1.cif.gz_E | resting state homomeric glua2 f231a mutant ampa receptor in complex with tarp gamma-2 | 0.649 | 53 | 115 |
| 6q6b-assembly1.cif.gz_A | structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents | 0.4789 | 7 | 115 |
| 6q58-assembly1.cif.gz_A | copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) | 0.4781 | 2 | 115 |
| 5arm-assembly1.cif.gz_A | apo-csp3 (copper storage protein 3) from methylosinus | 0.4687 | 7 | 114 |
| 6q58-assembly1.cif.gz_A | copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) | 0.459 | 2 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LSW5_1_134_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.814 | 1 | 116 | 1.20.120.550 |
| af_Q7TP91_4_196_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.773 | 3 | 115 | 1.20.120.550 |
| af_Q8T0T9_12_131_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7594 | 11 | 108 | 1.20.120.550 |
| af_Q2FUV7_1_119_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.745 | 6 | 115 | 1.10.10.1740 |
| af_A4IAM6_1_156_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7422 | 3 | 136 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5CZY7-F1-model_v4 | DoxX family protein | 0.9957 | 5 | 126 |
GO:0005886
|
| AF-A0A6A7YDW1-F1-model_v4 | DoxX family membrane protein | 0.9938 | 3 | 126 |
GO:0005886
|
| AF-A0A6I3T101-F1-model_v4 | DoxX family membrane protein | 0.9935 | 4 | 137 |
GO:0005886
|
| AF-A0A840YS47-F1-model_v4 | Putative oxidoreductase | 0.9929 | 7 | 126 |
GO:0005886
|
| AF-A0A1G8DHB0-F1-model_v4 | deleted | 0.9928 | 3 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar