F478442

General Info

Members Datasets Scaffolds Average Seq Length
739 433 681 141

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_101912113|Ga0070689_1019121131
Length 135
Sequence MITTRYLPFVGRLMIGLPFAMSGLGKLGTYGATTAMIGAAGLPLPPLAYAELGGGLLLVAGYRVRLVAVALAVFTLAAAISFHGNFADQNQMIHFLKNVMMAGGLLQIAAFGAGALSLDHRRSNGQLTPSPTVAA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
4 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
5 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
6 2643221557 Ensifer sp. Root558 Isolate Unclassified
7 2643221668 Ensifer sp. Root423 Isolate Unclassified
8 2643221723 Ensifer sp. Root278 Isolate Unclassified
9 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
10 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
11 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
12 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
13 2922368715
14 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
15 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
16 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
17 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
18 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
19 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
20 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
21 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
22 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
23 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
24 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
25 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
26 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
27 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
28 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
29 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
30 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
31 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
32 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
33 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
34 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
35 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
36 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
37 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
38 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
39 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
40 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
41 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
42 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
43 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
44 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
45 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
46 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
47 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
48 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
49 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
84 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
159 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
160 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
161 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
162 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
163 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
245 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
252 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
259 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
260 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
261 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
278 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
279 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
280 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
281 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
349 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
372 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
373 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
374 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
375 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
379 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
380 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
381 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
397 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
400 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
401 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
402 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
405 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
406 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
407 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
408 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
411 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
412 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
415 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
416 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
420 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
421 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
422 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
423 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
426 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
427 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
428 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
429 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
430 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
431 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
432 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
433 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 0.14
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 6.36
Rhizoplane 7.98
Rhizosphere 67.52
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1029064 3300001904 Bacteria 855
2 JGI24739J22299_10159857 3300001989 Bacteria 665
3 JGI25162J39368_1001596 3300002737 Bacteria 11415
4 JGI25159J45721_1000015 3300002987 Bacteria 142431
5 JGI25165J46597_1000280 3300003214 Bacteria 65126
6 JGI25160J50197_1000003 3300003354 Bacteria 482719
7 JGI25161J50226_1002742 3300003374 Bacteria 4345
8 Ga0055526_1007083 3300003771 Bacteria 5923
9 Ga0055524_1041650 3300003775 Bacteria 1154
10 Ga0055536_1001123 3300003781 Bacteria 16800
11 Ga0055536_1041459 3300003781 Bacteria 1086
12 Ga0055530_10004321 3300003791 Bacteria 7390
13 Ga0055530_10023186 3300003791 Bacteria 1789
14 Ga0055540_1041907 3300003792 Bacteria 984
15 Ga0055531_10000697 3300003794 Bacteria 28671
16 Ga0055531_10044523 3300003794 Bacteria 1243
17 Ga0055543_1000034 3300004625 Bacteria 128668
18 Ga0065165_1000025 3300005262 Bacteria 246909
19 Ga0070690_100645102 3300005330 Bacteria 808
20 Ga0070670_100331594 3300005331 Bacteria 1334
21 Ga0070677_10476250 3300005333 Bacteria 672
22 Ga0070666_10031914 3300005335 Bacteria 3479
23 Ga0070666_10162265 3300005335 Bacteria 1562
24 Ga0070680_100541876 3300005336 Bacteria 997
25 Ga0070682_100033993 3300005337 Bacteria 3101
26 Ga0068868_100336151 3300005338 Bacteria 1290
27 Ga0068868_100420909 3300005338 Bacteria 1156
28 Ga0070689_100461258 3300005340 Bacteria 1082
29 Ga0070689_101912113 3300005340 Bacteria 542
30 Ga0070691_10333830 3300005341 Bacteria 837
31 Ga0070687_100100429 3300005343 Bacteria 1619
32 Ga0070661_100049498 3300005344 Bacteria 3076
33 Ga0070668_100036882 3300005347 Bacteria 3731
34 Ga0070669_100000438 3300005353 Bacteria 31742
35 Ga0070669_100691660 3300005353 Bacteria 860
36 Ga0070675_100415925 3300005354 Bacteria 1202
37 Ga0070675_101883211 3300005354 Bacteria 552
38 Ga0070671_100059070 3300005355 Bacteria 3191
39 Ga0070671_100144711 3300005355 Bacteria 2006
40 Ga0070674_100152366 3300005356 Bacteria 1746
41 Ga0070673_100023208 3300005364 Bacteria 4530
42 Ga0070673_101626359 3300005364 Bacteria 611
43 Ga0070688_100640354 3300005365 Bacteria 818
44 Ga0070667_100066963 3300005367 Bacteria 3052
45 Ga0070709_10006594 3300005434 Bacteria 6332
46 Ga0070709_10256865 3300005434 Bacteria 1261
47 Ga0070714_100024651 3300005435 Bacteria 4956
48 Ga0070714_100050162 3300005435 Bacteria 3554
49 Ga0070714_100120710 3300005435 Bacteria 2331
50 Ga0070714_100900473 3300005435 Bacteria 859
51 Ga0070713_100013850 3300005436 Bacteria 5968
52 Ga0070713_100022038 3300005436 Bacteria 4915
53 Ga0070713_100115085 3300005436 Bacteria 2350
54 Ga0070713_100216049 3300005436 Bacteria 1738
55 Ga0070713_100254892 3300005436 Bacteria 1602
56 Ga0070710_10006716 3300005437 Bacteria 5545
57 Ga0070710_10383336 3300005437 Bacteria 938
58 Ga0070710_10753845 3300005437 Bacteria 692
59 Ga0070711_100011825 3300005439 Bacteria 5431
60 Ga0070711_100074143 3300005439 Bacteria 2406
61 Ga0070711_100138930 3300005439 Bacteria 1819
62 Ga0070711_100544071 3300005439 Bacteria 962
63 Ga0070711_100630139 3300005439 Bacteria 897
64 Ga0070711_101216695 3300005439 Bacteria 652
65 Ga0070663_100058160 3300005455 Bacteria 2775
66 Ga0070663_100214577 3300005455 Bacteria 1508
67 Ga0070678_100041051 3300005456 Bacteria 3277
68 Ga0070681_10296286 3300005458 Bacteria 1527
69 Ga0070685_10033295 3300005466 Bacteria 2894
70 Ga0070706_100265211 3300005467 Bacteria 1603
71 Ga0070706_100564086 3300005467 Bacteria 1059
72 Ga0070706_100929972 3300005467 Bacteria 803
73 Ga0070706_101064456 3300005467 Bacteria 745
74 Ga0070707_100773233 3300005468 Bacteria 924
75 Ga0070698_100352319 3300005471 Bacteria 1404
76 Ga0070698_100588372 3300005471 Bacteria 1053
77 Ga0070698_100746413 3300005471 Bacteria 922
78 Ga0070699_100682520 3300005518 Bacteria 938
79 Ga0070699_101431738 3300005518 Bacteria 634
80 Ga0070679_100044161 3300005530 Bacteria 4440
81 Ga0070684_100250152 3300005535 Bacteria 1620
82 Ga0070684_100250578 3300005535 Bacteria 1618
83 Ga0070684_100280207 3300005535 Bacteria 1527
84 Ga0070697_101163105 3300005536 Bacteria 687
85 Ga0070697_101407977 3300005536 Bacteria 623
86 Ga0070697_102092728 3300005536 Bacteria 507
87 Ga0068853_100209856 3300005539 Bacteria 1775
88 Ga0070672_100249124 3300005543 Bacteria 1496
89 Ga0070686_100028574 3300005544 Bacteria 3383
90 Ga0070696_100694322 3300005546 Bacteria 829
91 Ga0070693_100394740 3300005547 Bacteria 958
92 Ga0070665_100128511 3300005548 Bacteria 2537
93 Ga0070665_100504232 3300005548 Bacteria 1221
94 Ga0070664_100252839 3300005564 Bacteria 1584
95 Ga0070664_100508563 3300005564 Bacteria 1111
96 Ga0068857_100202889 3300005577 Bacteria 1808
97 Ga0068857_100230824 3300005577 Bacteria 1693
98 Ga0068857_100562902 3300005577 Bacteria 1075
99 Ga0068856_100081658 3300005614 Bacteria 3207
100 Ga0068856_101457596 3300005614 Bacteria 699
101 Ga0068856_102235263 3300005614 Bacteria 556
102 Ga0070702_100164382 3300005615 Bacteria 1437
103 Ga0068852_100822318 3300005616 Bacteria 944
104 Ga0068859_100212221 3300005617 Bacteria 2022
105 Ga0068864_100072302 3300005618 Bacteria 3005
106 Ga0068861_101273324 3300005719 Bacteria 714
107 Ga0068851_10359222 3300005834 Bacteria 849
108 Ga0068863_100190180 3300005841 Bacteria 1972
109 Ga0068863_100234561 3300005841 Bacteria 1770
110 Ga0068863_100311724 3300005841 Bacteria 1527
111 Ga0068863_102418364 3300005841 Bacteria 535
112 Ga0068858_100167886 3300005842 Bacteria 2068
113 Ga0068858_100546155 3300005842 Bacteria 1122
114 Ga0068858_100825267 3300005842 Bacteria 905
115 Ga0068860_100340567 3300005843 Bacteria 1474
116 Ga0068862_100580020 3300005844 Bacteria 1074
117 Ga0081538_10036483 3300005981 Bacteria 3206
118 Ga0070717_10002063 3300006028 Bacteria 14061
119 Ga0070717_10007835 3300006028 Bacteria 7949
120 Ga0070717_10014255 3300006028 Bacteria 6113
121 Ga0070717_10063991 3300006028 Bacteria 3054
122 Ga0070717_10167061 3300006028 Bacteria 1912
123 Ga0070717_10260551 3300006028 Bacteria 1534
124 Ga0070717_10524093 3300006028 Bacteria 1072
125 Ga0070717_10605578 3300006028 Bacteria 994
126 Ga0075365_10024860 3300006038 Bacteria 3785
127 Ga0075363_100196048 3300006048 Bacteria 1153
128 Ga0075364_10090133 3300006051 Bacteria 2034
129 Ga0070715_10004890 3300006163 Bacteria 4439
130 Ga0070715_10034619 3300006163 Bacteria 2072
131 Ga0070716_100003451 3300006173 Bacteria 7443
132 Ga0070716_100007047 3300006173 Bacteria 5516
133 Ga0070716_100780373 3300006173 Bacteria 738
134 Ga0070712_100267905 3300006175 Bacteria 1371
135 Ga0070712_100321967 3300006175 Bacteria 1257
136 Ga0070712_100442663 3300006175 Bacteria 1081
137 Ga0070712_100594498 3300006175 Bacteria 936
138 Ga0070712_100749308 3300006175 Bacteria 836
139 Ga0075362_10143408 3300006177 Bacteria 1142
140 Ga0075367_10240951 3300006178 Bacteria 1133
141 Ga0075367_10316159 3300006178 Bacteria 984
142 Ga0075367_10712549 3300006178 Bacteria 638
143 Ga0075369_10131074 3300006186 Bacteria 1139
144 Ga0075369_10441910 3300006186 Bacteria 615
145 Ga0075366_10012033 3300006195 Bacteria 4901
146 Ga0097621_100024299 3300006237 Unclassified 4731
147 Ga0097621_100102101 3300006237 Bacteria 2414
148 Ga0075370_10083286 3300006353 Bacteria 1840
149 Ga0068871_100053351 3300006358 Bacteria 3276
150 Ga0068871_100066751 3300006358 Bacteria 2949
151 Ga0068871_100144834 3300006358 Bacteria 2022
152 Ga0075428_100194112 3300006844 Bacteria 2196
153 Ga0075430_100456992 3300006846 Bacteria 1054
154 Ga0075431_100700520 3300006847 Bacteria 990
155 Ga0075433_10090020 3300006852 Bacteria 2712
156 Ga0075433_10313534 3300006852 Bacteria 1388
157 Ga0068865_100065878 3300006881 Bacteria 2554
158 Ga0068865_100738678 3300006881 Bacteria 844
159 Ga0075436_100392603 3300006914 Bacteria 1004
160 Ga0097620_100212229 3300006931 Bacteria 2022
161 Ga0075435_100009745 3300007076 Bacteria 6983
162 Ga0075435_100391737 3300007076 Bacteria 1194
163 Ga0075435_100570558 3300007076 Bacteria 980
164 Ga0099795_10023932 3300007788 Bacteria 2031
165 Ga0099795_10048771 3300007788 Bacteria 1535
166 Ga0099795_10094602 3300007788 Bacteria 1163
167 Ga0105251_10029408 3300009011 Bacteria 2768
168 Ga0105250_10224504 3300009092 Bacteria 797
169 Ga0105240_11079200 3300009093 Unclassified 855
170 Ga0111539_10090477 3300009094 Bacteria 3596
171 Ga0111539_10843425 3300009094 Bacteria 1066
172 Ga0105245_10321862 3300009098 Bacteria 1524
173 Ga0105245_11141935 3300009098 Bacteria 826
174 Ga0105247_10165485 3300009101 Bacteria 1467
175 Ga0105247_10273143 3300009101 Bacteria 1163
176 Ga0105247_11261842 3300009101 Bacteria 591
177 Ga0114129_10079908 3300009147 Bacteria 4546
178 Ga0105243_10069112 3300009148 Bacteria 2848
179 Ga0105243_10798501 3300009148 Bacteria 930
180 Ga0105243_12295722 3300009148 Bacteria 577
181 Ga0105241_10132181 3300009174 Bacteria 2022
182 Ga0105242_10150596 3300009176 Bacteria 2028
183 Ga0105248_10048981 3300009177 Bacteria 4739
184 Ga0105248_10096567 3300009177 Bacteria 3329
185 Ga0105248_10290835 3300009177 Bacteria 1840
186 Ga0105248_10293218 3300009177 Bacteria 1832
187 Ga0105237_10065253 3300009545 Bacteria 3637
188 Ga0105237_10071604 3300009545 Bacteria 3461
189 Ga0105237_10497877 3300009545 Bacteria 1225
190 Ga0105238_10087189 3300009551 Bacteria 3108
191 Ga0105238_10571889 3300009551 Bacteria 1136
192 Ga0105238_10816175 3300009551 Bacteria 949
193 Ga0105238_10860645 3300009551 Bacteria 924
194 Ga0099796_10074170 3300010159 Bacteria 1235
195 Ga0099796_10194774 3300010159 Bacteria 820
196 Ga0099796_10227893 3300010159 Bacteria 766
197 Ga0105239_10435458 3300010375 Bacteria 1486
198 Ga0105239_10695543 3300010375 Bacteria 1162
199 Ga0105246_10142512 3300011119 Bacteria 1804
200 Ga0157346_1003875 3300012480 Bacteria 858
201 Ga0157321_1006128 3300012487 Bacteria 810
202 Ga0157341_1002933 3300012494 Bacteria 1162
203 Ga0157324_1031631 3300012506 Bacteria 603
204 Ga0157342_1006762 3300012507 Bacteria 1096
205 Ga0157327_1020250 3300012512 Bacteria 744
206 Ga0157369_10050653 3300013105 Bacteria 4496
207 Ga0157369_10414934 3300013105 Bacteria 1396
208 Ga0157374_10364707 3300013296 Bacteria 1437
209 Ga0157378_10078599 3300013297 Bacteria 2977
210 Ga0157378_11173336 3300013297 Bacteria 807
211 Ga0163162_10241776 3300013306 Bacteria 1936
212 Ga0163162_10476677 3300013306 Bacteria 1379
213 Ga0163162_10810763 3300013306 Bacteria 1053
214 Ga0157375_10505267 3300013308 Bacteria 1373
215 Ga0157375_11503301 3300013308 Bacteria 795
216 Ga0157375_12519970 3300013308 Bacteria 614
217 Ga0163163_10182975 3300014325 Bacteria 2143
218 Ga0163163_10646726 3300014325 Bacteria 1121
219 Ga0163163_10870736 3300014325 Bacteria 964
220 Ga0163163_11575952 3300014325 Bacteria 718
221 Ga0157377_10466010 3300014745 Bacteria 876
222 Ga0157377_11064020 3300014745 Bacteria 617
223 Ga0157379_10182921 3300014968 Bacteria 1893
224 Ga0157376_10103099 3300014969 Bacteria 2497
225 Ga0163161_10660159 3300017792 Bacteria 867
226 Ga0209436_100130 3300025208 Bacteria 37375
227 Ga0209437_100281 3300025233 Bacteria 74945
228 Ga0207425_1011713 3300025245 Bacteria 2079
229 Ga0209646_1004247 3300025246 Bacteria 2639
230 Ga0209233_1000267 3300025261 Bacteria 74945
231 Ga0209130_1000005 3300025284 Bacteria 599620
232 Ga0209676_1001348 3300025292 Bacteria 24430
233 Ga0209676_1001927 3300025292 Bacteria 16772
234 Ga0209025_1000105 3300025294 Bacteria 224157
235 Ga0209564_1000113 3300025295 Bacteria 211564
236 Ga0209758_1030383 3300025297 Bacteria 2239
237 Ga0209050_1000644 3300025298 Bacteria 54118
238 Ga0209050_1001277 3300025298 Bacteria 28847
239 Ga0209050_1005247 3300025298 Bacteria 8259
240 Ga0209256_1002435 3300025299 Bacteria 15208
241 Ga0209256_1044068 3300025299 Bacteria 1116
242 Ga0207426_1000015 3300025302 Bacteria 599316
243 Ga0209051_1001056 3300025303 Bacteria 25758
244 Ga0209051_1013495 3300025303 Bacteria 3886
245 Ga0209257_1001078 3300025304 Bacteria 35791
246 Ga0209257_1001948 3300025304 Bacteria 22281
247 Ga0209257_1016366 3300025304 Bacteria 3004
248 Ga0207656_10369960 3300025321 Bacteria 717
249 Ga0207713_1029276 3300025735 Bacteria 2469
250 Ga0207692_10007178 3300025898 Bacteria 4553
251 Ga0207692_10015010 3300025898 Bacteria 3399
252 Ga0207692_10308877 3300025898 Bacteria 965
253 Ga0207710_10025982 3300025900 Bacteria 2529
254 Ga0207710_10169683 3300025900 Bacteria 1066
255 Ga0207710_10601175 3300025900 Bacteria 575
256 Ga0207680_10133162 3300025903 Bacteria 1640
257 Ga0207647_10114051 3300025904 Bacteria 1597
258 Ga0207647_10535633 3300025904 Bacteria 651
259 Ga0207685_10034813 3300025905 Bacteria 1833
260 Ga0207699_10001770 3300025906 Bacteria 10191
261 Ga0207699_10004550 3300025906 Bacteria 6625
262 Ga0207645_10227402 3300025907 Bacteria 1231
263 Ga0207684_10775129 3300025910 Bacteria 812
264 Ga0207707_10226485 3300025912 Bacteria 1627
265 Ga0207671_10190002 3300025914 Bacteria 1601
266 Ga0207671_10351449 3300025914 Bacteria 1169
267 Ga0207693_10001772 3300025915 Bacteria 18926
268 Ga0207693_10110901 3300025915 Bacteria 2151
269 Ga0207693_10238157 3300025915 Bacteria 1429
270 Ga0207693_10432850 3300025915 Bacteria 1028
271 Ga0207663_10008912 3300025916 Bacteria 5276
272 Ga0207663_10052746 3300025916 Bacteria 2538
273 Ga0207663_10070638 3300025916 Bacteria 2250
274 Ga0207663_10407751 3300025916 Bacteria 1041
275 Ga0207663_10949536 3300025916 Bacteria 689
276 Ga0207657_10272274 3300025919 Bacteria 1346
277 Ga0207657_10330779 3300025919 Bacteria 1203
278 Ga0207649_11024230 3300025920 Bacteria 650
279 Ga0207652_10010590 3300025921 Bacteria 7422
280 Ga0207646_10631306 3300025922 Bacteria 960
281 Ga0207681_10000037 3300025923 Bacteria 154417
282 Ga0207694_10427688 3300025924 Bacteria 1104
283 Ga0207650_10083520 3300025925 Bacteria 2426
284 Ga0207650_10266822 3300025925 Bacteria 1390
285 Ga0207687_10012794 3300025927 Bacteria 5483
286 Ga0207687_10912353 3300025927 Bacteria 752
287 Ga0207700_10004844 3300025928 Bacteria 7991
288 Ga0207700_10010379 3300025928 Bacteria 5873
289 Ga0207700_10400548 3300025928 Bacteria 1203
290 Ga0207700_10539799 3300025928 Bacteria 1034
291 Ga0207700_10597867 3300025928 Bacteria 982
292 Ga0207700_10625256 3300025928 Bacteria 959
293 Ga0207664_10007907 3300025929 Bacteria 7387
294 Ga0207664_10763708 3300025929 Bacteria 869
295 Ga0207644_10041350 3300025931 Bacteria 3260
296 Ga0207644_10114805 3300025931 Bacteria 2041
297 Ga0207644_10143676 3300025931 Bacteria 1840
298 Ga0207690_10148701 3300025932 Bacteria 1734
299 Ga0207690_10361681 3300025932 Bacteria 1150
300 Ga0207706_10053868 3300025933 Bacteria 3551
301 Ga0207706_10551467 3300025933 Bacteria 992
302 Ga0207686_10034580 3300025934 Bacteria 3026
303 Ga0207709_10164742 3300025935 Bacteria 1550
304 Ga0207709_11356654 3300025935 Bacteria 588
305 Ga0207704_10195864 3300025938 Bacteria 1474
306 Ga0207665_10001072 3300025939 Bacteria 18388
307 Ga0207665_10004233 3300025939 Bacteria 9549
308 Ga0207665_10026869 3300025939 Bacteria 3801
309 Ga0207665_10037803 3300025939 Bacteria 3213
310 Ga0207665_10458333 3300025939 Bacteria 979
311 Ga0207665_10567784 3300025939 Bacteria 883
312 Ga0207691_10046346 3300025940 Bacteria 3995
313 Ga0207711_10025595 3300025941 Bacteria 4949
314 Ga0207711_10033852 3300025941 Bacteria 4325
315 Ga0207711_10434829 3300025941 Bacteria 1221
316 Ga0207661_10111892 3300025944 Bacteria 2310
317 Ga0207661_10178685 3300025944 Bacteria 1852
318 Ga0207679_10084323 3300025945 Bacteria 2438
319 Ga0207667_10230320 3300025949 Bacteria 1897
320 Ga0207651_10294295 3300025960 Bacteria 1347
321 Ga0207668_10140262 3300025972 Bacteria 1858
322 Ga0207668_10157418 3300025972 Bacteria 1766
323 Ga0207668_10688752 3300025972 Unclassified 897
324 Ga0207668_10979739 3300025972 Bacteria 755
325 Ga0207658_10129624 3300025986 Bacteria 2024
326 Ga0207677_10141054 3300026023 Bacteria 1845
327 Ga0207703_10101418 3300026035 Bacteria 2440
328 Ga0207703_10279671 3300026035 Bacteria 1515
329 Ga0207703_10482658 3300026035 Bacteria 1161
330 Ga0207639_10514690 3300026041 Bacteria 1095
331 Ga0207678_10090345 3300026067 Bacteria 2618
332 Ga0207678_10146846 3300026067 Bacteria 2013
333 Ga0207678_10189873 3300026067 Bacteria 1755
334 Ga0207708_10073466 3300026075 Bacteria 2621
335 Ga0207702_10299535 3300026078 Bacteria 1526
336 Ga0207702_10585597 3300026078 Bacteria 1094
337 Ga0207641_10177653 3300026088 Bacteria 1947
338 Ga0207641_10545956 3300026088 Bacteria 1130
339 Ga0207648_10174815 3300026089 Bacteria 1899
340 Ga0207676_10284533 3300026095 Bacteria 1502
341 Ga0207676_10321976 3300026095 Bacteria 1420
342 Ga0207674_10086582 3300026116 Bacteria 3128
343 Ga0207674_10288352 3300026116 Bacteria 1590
344 Ga0207675_101888401 3300026118 Bacteria 616
345 Ga0207683_10017427 3300026121 Bacteria 6122
346 Ga0207683_10266726 3300026121 Bacteria 1564
347 Ga0207698_10237013 3300026142 Bacteria 1660
348 Ga0209179_1054300 3300027512 Bacteria 863
349 Ga0209588_1016132 3300027671 Bacteria 2303
350 Ga0209588_1190935 3300027671 Bacteria 640
351 Ga0207428_10086181 3300027907 Bacteria 2445
352 Ga0207428_10424925 3300027907 Bacteria 971
353 Ga0207428_11316093 3300027907 Bacteria 500
354 Ga0265354_1004635 3300028016 Bacteria 1431
355 Ga0265355_1011388 3300028036 Bacteria 731
356 Ga0268266_10033064 3300028379 Bacteria 4397
357 Ga0268265_10030300 3300028380 Bacteria 3895
358 Ga0268264_10101786 3300028381 Bacteria 2498
359 Ga0307517_10285537 3300028786 Bacteria 937
360 Ga0307515_10058325 3300028794 Bacteria 5562
361 Ga0307515_10420527 3300028794 Bacteria 957
362 Ga0307511_10022068 3300030521 Bacteria 5975
363 Ga0307511_10063150 3300030521 Bacteria 2801
364 Ga0265770_1000015 3300030878 Bacteria 17088
365 Ga0307509_10139206 3300031507 Bacteria 2366
366 Ga0307508_10033908 3300031616 Bacteria 4604
367 Ga0307508_10305488 3300031616 Bacteria 1183
368 Ga0307516_10000276 3300031730 Bacteria 66471
369 Ga0307507_10069784 3300033179 Bacteria 3194
370 Ga0307510_10008458 3300033180 Bacteria 12263
371 Ga0307510_10134756 3300033180 Bacteria 2131
372 Ga0307510_10157839 3300033180 Bacteria 1872
373 Ga0307510_10177098 3300033180 Bacteria 1702
374 Ga0316215_1029823 3300033544 Bacteria 565
375 Ga0373930_0023479 3300034816 Bacteria 1226
376 Ga0373951_0075716 3300035091 Bacteria 864
377 Ga0373952_0019801 3300035092 Bacteria 1405
378 Ga0373939_0403998 3300035114 Bacteria 566
379 Ga0373941_0187392 3300035115 Bacteria 780
380 Ga0373945_0043635 3300035116 Bacteria 1628
381 Ga0373954_0181451 3300035118 Bacteria 1032
382 Ga0373960_0201203 3300035121 Bacteria 704
383 Ga0373943_0039152 3300035170 Bacteria 2283
384 Ga0373946_0026637 3300035171 Bacteria 2282
385 Ga0373946_0414032 3300035171 Bacteria 682
386 Ga0373955_0549519 3300035172 Bacteria 706
387 Ga0373961_0012586 3300035241 Bacteria 2121
388 Ga0373931_0129183 3300035691 Bacteria 1452
389 Ga0373927_0007027 3300035695 Bacteria 7641
390 Ga0373927_0387816 3300035695 Bacteria 921
391 Ga0373933_0471483 3300035724 Bacteria 822
392 Ga0373947_0001566 3300035725 Bacteria 14014
393 Ga0373947_0028793 3300035725 Bacteria 3258
394 Ga0373925_0013517 3300037068 Bacteria 5909
395 Ga0373925_0086217 3300037068 Bacteria 2395
396 Ga0395905_0139986 3300037471 Bacteria 2277
397 Ga0451807_2026923 3300041486 Bacteria 581
398 Ga0451835_0153052 3300041492 Bacteria 1030
399 Ga0451837_0595071 3300041494 Bacteria 948
400 Ga0451851_0227276 3300041507 Bacteria 3868
401 Ga0451853_1297410 3300041512 Bacteria 1105
402 Ga0466969_0167388 3300044656 Bacteria 1008
403 Ga0466966_0539586 3300044684 Bacteria 702
404 Ga0466970_0164137 3300044765 Bacteria 1229
405 Ga0466959_0003549 3300045049 Bacteria 10253
406 Ga0495603_0004010 3300046455 Bacteria 8765
407 Ga0495590_0018331 3300046457 Bacteria 2506
408 Ga0495629_0001306 3300046459 Bacteria 19602
409 Ga0495629_0007863 3300046459 Bacteria 7846
410 Ga0495638_0004919 3300046460 Bacteria 10042
411 Ga0495638_0006659 3300046460 Bacteria 8384
412 Ga0495641_0031370 3300046461 Bacteria 2540
413 Ga0495641_0263431 3300046461 Bacteria 776
414 Ga0495651_0691382 3300046462 Bacteria 636
415 Ga0495653_0015161 3300046463 Bacteria 6283
416 Ga0495653_0033105 3300046463 Bacteria 4097
417 Ga0495650_0005382 3300046471 Bacteria 8328
418 Ga0495580_0000405 3300046472 Bacteria 35466
419 Ga0495580_0005620 3300046472 Bacteria 10326
420 Ga0495582_0001069 3300046473 Bacteria 15376
421 Ga0495582_0002617 3300046473 Bacteria 10021
422 Ga0495582_0127007 3300046473 Bacteria 1439
423 Ga0495605_0013142 3300046474 Bacteria 4574
424 Ga0495605_0054123 3300046474 Bacteria 1945
425 Ga0495605_0074470 3300046474 Bacteria 1598
426 Ga0495662_0043219 3300046476 Bacteria 2175
427 Ga0495662_0125321 3300046476 Bacteria 1262
428 Ga0495664_0000547 3300046477 Bacteria 18910
429 Ga0495664_0171034 3300046477 Bacteria 1318
430 Ga0495584_0000002 3300046491 Bacteria 512179
431 Ga0495585_0463162 3300046492 Bacteria 605
432 Ga0495594_0005370 3300046499 Bacteria 6585
433 Ga0495594_0127978 3300046499 Bacteria 1437
434 Ga0495596_0057473 3300046500 Bacteria 1518
435 Ga0495583_0002869 3300046506 Bacteria 14011
436 Ga0495583_0262027 3300046506 Bacteria 691
437 Ga0495606_0038857 3300046507 Bacteria 3215
438 Ga0495606_0044716 3300046507 Bacteria 2942
439 Ga0495606_0050123 3300046507 Bacteria 2733
440 Ga0495606_0344983 3300046507 Bacteria 792
441 Ga0495606_0533824 3300046507 Bacteria 586
442 Ga0495610_0091732 3300046512 Bacteria 1376
443 Ga0495610_0257871 3300046512 Bacteria 688
444 Ga0495610_0274314 3300046512 Bacteria 659
445 Ga0495618_0010352 3300046514 Bacteria 5643
446 Ga0495618_0501904 3300046514 Bacteria 731
447 Ga0495620_0035667 3300046515 Bacteria 2233
448 Ga0495628_0009095 3300046516 Bacteria 8497
449 Ga0495628_0052696 3300046516 Bacteria 3213
450 Ga0495630_0012823 3300046517 Bacteria 6091
451 Ga0495630_0051802 3300046517 Bacteria 3072
452 Ga0495630_0405450 3300046517 Bacteria 1045
453 Ga0495632_0038567 3300046519 Bacteria 2418
454 Ga0495648_0002183 3300046524 Bacteria 18357
455 Ga0495648_0026751 3300046524 Bacteria 3877
456 Ga0495648_0048786 3300046524 Bacteria 2603
457 Ga0495648_0049569 3300046524 Bacteria 2573
458 Ga0495648_0072410 3300046524 Bacteria 1994
459 Ga0495648_0075425 3300046524 Bacteria 1940
460 Ga0495648_0116631 3300046524 Bacteria 1442
461 Ga0495648_0155447 3300046524 Bacteria 1188
462 Ga0495648_0383124 3300046524 Bacteria 633
463 Ga0495666_0001085 3300046526 Bacteria 12965
464 Ga0495652_0017711 3300046529 Bacteria 6357
465 Ga0495654_0152506 3300046530 Bacteria 1021
466 Ga0495665_0009393 3300046531 Bacteria 5294
467 Ga0495665_0083475 3300046531 Bacteria 1680
468 Ga0495640_0007678 3300046533 Bacteria 8481
469 Ga0495640_0595823 3300046533 Bacteria 668
470 Ga0495586_0009947 3300046535 Bacteria 5065
471 Ga0495587_0003216 3300046536 Bacteria 10921
472 Ga0495609_0060084 3300046538 Bacteria 1681
473 Ga0495609_0204290 3300046538 Bacteria 825
474 Ga0495597_0059674 3300046542 Bacteria 1665
475 Ga0495645_0004363 3300046543 Bacteria 9663
476 Ga0495622_0102961 3300046557 Bacteria 1308
477 Ga0495622_0110318 3300046557 Bacteria 1260
478 Ga0495622_0122110 3300046557 Bacteria 1189
479 Ga0495668_0087653 3300046616 Bacteria 1707
480 Ga0495668_0150115 3300046616 Bacteria 1276
481 Ga0495634_0000661 3300046642 Bacteria 33530
482 Ga0495634_0183924 3300046642 Bacteria 1307
483 Ga0495634_0280449 3300046642 Bacteria 1012
484 Ga0495611_0019704 3300046648 Bacteria 2899
485 Ga0495611_0059673 3300046648 Bacteria 1732
486 Ga0495625_0209923 3300046660 Bacteria 1280
487 Ga0495625_0223929 3300046660 Bacteria 1231
488 Ga0495625_0263961 3300046660 Bacteria 1113
489 Ga0495625_0515761 3300046660 Bacteria 729
490 Ga0495635_0006091 3300046663 Bacteria 8410
491 Ga0495661_0004172 3300046665 Bacteria 10507
492 Ga0495588_0138758 3300046674 Bacteria 1284
493 Ga0495599_0018634 3300046678 Bacteria 4324
494 Ga0495623_0098957 3300046679 Bacteria 1779
495 Ga0495646_0003715 3300046680 Bacteria 9533
496 Ga0495646_0005124 3300046680 Bacteria 8266
497 Ga0495647_0026122 3300046681 Bacteria 2137
498 Ga0495658_0000967 3300046683 Bacteria 15275
499 Ga0495613_0002330 3300046689 Bacteria 14375
500 Ga0495613_0101505 3300046689 Bacteria 2078
501 Ga0495624_0006209 3300046690 Bacteria 8493
502 Ga0495624_0022858 3300046690 Bacteria 4127
503 Ga0495624_0079432 3300046690 Bacteria 2034
504 Ga0495624_0691588 3300046690 Bacteria 606
505 Ga0495671_0126295 3300046692 Bacteria 1247
506 Ga0495671_0197755 3300046692 Bacteria 975
507 Ga0495649_0507251 3300046694 Bacteria 599
508 Ga0495649_0557779 3300046694 Bacteria 567
509 Ga0495600_0176771 3300046809 Bacteria 1376
510 Ga0495581_0002154 3300047315 Bacteria 11113
511 Ga0495604_0002039 3300047317 Bacteria 16326
512 Ga0495674_0005169 3300047319 Bacteria 12533
513 Ga0495674_0043489 3300047319 Bacteria 3997
514 Ga0495674_0354487 3300047319 Bacteria 1190
515 Ga0495676_0010864 3300047321 Bacteria 8236
516 Ga0495676_0022259 3300047321 Bacteria 5518
517 Ga0495680_0002175 3300047322 Bacteria 20282
518 Ga0495683_0090983 3300047323 Bacteria 1478
519 Ga0495683_0109450 3300047323 Bacteria 1320
520 Ga0495683_0343601 3300047323 Bacteria 631
521 Ga0495687_161356 3300047443 Bacteria 753
522 Ga0495679_000009 3300047446 Bacteria 343637
523 Ga0495679_000748 3300047446 Bacteria 20826
524 Ga0495673_0055630 3300047469 Bacteria 1715
525 Ga0495673_0085907 3300047469 Bacteria 1294
526 Ga0495673_0097803 3300047469 Bacteria 1191
527 Ga0495673_0104426 3300047469 Bacteria 1141
528 Ga0495673_0217300 3300047469 Bacteria 709
529 Ga0495673_0244169 3300047469 Bacteria 657
530 Ga0495673_0335510 3300047469 Bacteria 536
531 Ga0495684_0081956 3300047471 Bacteria 2448
532 Ga0495686_0313072 3300047472 Bacteria 863
533 Ga0495593_0001822 3300047673 Bacteria 12674
534 Ga0495593_0004348 3300047673 Bacteria 8431
535 Ga0495593_0415253 3300047673 Bacteria 673
536 Ga0495602_0006795 3300048088 Bacteria 12010
537 Ga0495602_0621950 3300048088 Bacteria 740
538 Ga0495614_0002666 3300048089 Bacteria 7938
539 Ga0495614_0060933 3300048089 Bacteria 1621
540 Ga0495626_0040568 3300048091 Bacteria 2198
541 Ga0496100_0038877 3300048903 Bacteria 3017
542 Ga0496100_0236171 3300048903 Bacteria 1347
543 Ga0496101_0004589 3300048904 Bacteria 8726
544 Ga0496101_0023487 3300048904 Bacteria 4261
545 Ga0496101_0164972 3300048904 Bacteria 1700
546 Ga0496101_1286975 3300048904 Bacteria 572
547 Ga0496102_0011208 3300048905 Bacteria 7722
548 Ga0496102_0093381 3300048905 Bacteria 2787
549 Ga0496102_0126223 3300048905 Bacteria 2392
550 Ga0496102_0290004 3300048905 Bacteria 1542
551 Ga0496103_0015983 3300048906 Bacteria 4476
552 Ga0496103_0188362 3300048906 Bacteria 1326
553 Ga0496104_0049184 3300048907 Bacteria 3976
554 Ga0496104_0181876 3300048907 Bacteria 2012
555 Ga0496104_0217293 3300048907 Bacteria 1823
556 Ga0496104_0291448 3300048907 Bacteria 1544
557 Ga0496105_0010764 3300048908 Bacteria 7201
558 Ga0496105_0043497 3300048908 Bacteria 3704
559 Ga0496105_0075306 3300048908 Bacteria 2787
560 Ga0496105_0151854 3300048908 Bacteria 1903
561 Ga0496105_0484640 3300048908 Bacteria 972
562 Ga0496105_0603594 3300048908 Bacteria 851
563 Ga0496105_1293804 3300048908 Bacteria 533
564 Ga0496106_0033052 3300048909 Bacteria 3858
565 Ga0496106_0124532 3300048909 Bacteria 2017
566 Ga0496106_0271628 3300048909 Bacteria 1357
567 Ga0496107_0056643 3300048910 Bacteria 2832
568 Ga0496107_0070722 3300048910 Bacteria 2534
569 Ga0496107_0576935 3300048910 Bacteria 832
570 Ga0496108_0012633 3300048911 Bacteria 6880
571 Ga0496108_0238582 3300048911 Bacteria 1581
572 Ga0496108_0326690 3300048911 Bacteria 1337
573 Ga0496109_0036006 3300048912 Bacteria 4467
574 Ga0496109_0206453 3300048912 Bacteria 1847
575 Ga0496109_0315724 3300048912 Bacteria 1474
576 Ga0496109_0379127 3300048912 Bacteria 1336
577 Ga0496110_0022139 3300048913 Bacteria 5392
578 Ga0496110_0042236 3300048913 Bacteria 3980
579 Ga0496110_0072136 3300048913 Bacteria 3063
580 Ga0496110_0888016 3300048913 Bacteria 797
581 Ga0496111_0007468 3300048914 Bacteria 7169
582 Ga0496111_0183651 3300048914 Bacteria 1555
583 Ga0496112_0032895 3300048915 Bacteria 5036
584 Ga0496112_0075775 3300048915 Bacteria 3326
585 Ga0496112_0212718 3300048915 Bacteria 1890
586 Ga0496112_0525721 3300048915 Bacteria 1117
587 Ga0496113_0110546 3300048916 Bacteria 2139
588 Ga0496113_0114845 3300048916 Bacteria 2100
589 Ga0496113_0205460 3300048916 Bacteria 1566
590 Ga0496113_0430942 3300048916 Bacteria 1059
591 Ga0496114_0009386 3300048917 Bacteria 7768
592 Ga0496114_0075322 3300048917 Bacteria 2842
593 Ga0496114_0628331 3300048917 Bacteria 946
594 Ga0496115_0083872 3300048918 Bacteria 2597
595 Ga0496115_0233276 3300048918 Bacteria 1517
596 Ga0496115_0762794 3300048918 Bacteria 755
597 Ga0496115_1014940 3300048918 Bacteria 633
598 Ga0496116_0047230 3300048919 Bacteria 2899
599 Ga0496116_0275111 3300048919 Bacteria 819
600 Ga0496117_0099668 3300048920 Bacteria 1842
601 Ga0496117_0228904 3300048920 Bacteria 1029
602 Ga0496118_0024558 3300048921 Bacteria 5197
603 Ga0496118_0060180 3300048921 Bacteria 2822
604 Ga0496119_0122871 3300048922 Bacteria 1425
605 Ga0496120_0214489 3300048923 Bacteria 924
606 Ga0496121_0046077 3300048924 Bacteria 3736
607 Ga0496122_0318247 3300048925 Bacteria 829
608 Ga0496124_0384566 3300048927 Bacteria 980
609 Ga0496125_0164900 3300048928 Bacteria 1499
610 Ga0496125_0179400 3300048928 Bacteria 1413
611 Ga0496126_0096161 3300048929 Bacteria 2597
612 Ga0496126_0101996 3300048929 Bacteria 2509
613 Ga0496126_0250191 3300048929 Bacteria 1477
614 Ga0495682_0014807 3300049460 Bacteria 2956
615 Ga0495682_0049600 3300049460 Bacteria 1529
616 Ga0495682_0083048 3300049460 Bacteria 1152
617 Ga0495682_0122959 3300049460 Bacteria 929
618 Ga0495682_0123722 3300049460 Bacteria 926
619 Ga0495682_0207770 3300049460 Bacteria 694
620 nmdc:mga03n38_511818_c1 3300050490 Bacteria 675
621 nmdc:mga0yw44_1061758_c1 3300050492 Bacteria 548
622 nmdc:mga0yw44_57930_c1 3300050492 Bacteria 2365
623 nmdc:mga0yw44_99120_c1 3300050492 Bacteria 1854
624 nmdc:mga0k408_125429_c1 3300050493 Bacteria 1523
625 nmdc:mga06z11_119875_c1 3300050494 Bacteria 1467
626 nmdc:mga05p37_60503_c1 3300050507 Bacteria 4663
627 nmdc:mga09592_241064_c1 3300050508 Bacteria 1567
628 nmdc:mga0qj67_105304_c1 3300050509 Unclassified 2276
629 nmdc:mga06r32_119839_c1 3300050510 Bacteria 2595
630 nmdc:mga06r32_54616_c1 3300050510 Bacteria 3831
631 nmdc:mga08y16_108791_c1 3300050511 Bacteria 2886
632 nmdc:mga08y16_391967_c1 3300050511 Bacteria 1423
633 nmdc:mga08y16_83147_c1 3300050511 Bacteria 3337
634 nmdc:mga0n895_137295_c1 3300050512 Bacteria 2472
635 nmdc:mga0n895_253520_c1 3300050512 Bacteria 1786
636 nmdc:mga0n895_351632_c1 3300050512 Bacteria 1493
637 nmdc:mga0n895_371392_c1 3300050512 Bacteria 1448
638 nmdc:mga0n895_851638_c1 3300050512 Unclassified 899
639 nmdc:mga0rr50_886470_c1 3300050513 Bacteria 761
640 nmdc:mga08x19_603155_c1 3300050514 Bacteria 778
641 nmdc:mga0a205_253321_c1 3300050515 Bacteria 1639
642 nmdc:mga0a205_573520_c1 3300050515 Bacteria 983
643 nmdc:mga0sz30_194346_c1 3300050516 Bacteria 901
644 nmdc:mga0sz30_92231_c1 3300050516 Bacteria 1319
645 Ga0500635_0008832 3300053080 Bacteria 2776
646 Ga0495655_0091952 3300053083 Bacteria 885
647 Ga0495655_0372034 3300053083 Bacteria 503
648 Ga0495619_0000197 3300053085 Bacteria 44259
649 Ga0500578_0111265 3300053086 Bacteria 1726
650 Ga0500643_050489 3300053087 Bacteria 1190
651 Ga0500647_0162140 3300053091 Bacteria 1037
652 Ga0500583_0021076 3300053092 Bacteria 2704
653 Ga0500651_0038651 3300053093 Bacteria 3006
654 Ga0500651_0094984 3300053093 Bacteria 1833
655 Ga0500641_0078346 3300053096 Bacteria 1400
656 Ga0500555_003590 3300053103 Bacteria 4420
657 Ga0500556_0003155 3300053104 Bacteria 4910
658 Ga0500556_0301841 3300053104 Bacteria 626
659 Ga0500562_006055 3300053108 Bacteria 3045
660 Ga0500569_000906 3300053109 Bacteria 5312
661 Ga0500595_007843 3300053119 Bacteria 4398
662 Ga0500614_049860 3300053123 Bacteria 1095
663 Ga0500642_0090055 3300053130 Bacteria 1417
664 Ga0500655_048735 3300053133 Bacteria 841
665 Ga0500658_0153128 3300053134 Bacteria 1040
666 Ga0500568_0019594 3300053139 Bacteria 2937
667 Ga0500568_0079662 3300053139 Bacteria 1245
668 Ga0500577_0066161 3300053142 Bacteria 1405
669 Ga0500588_0030651 3300053146 Bacteria 1545
670 Ga0500604_0029865 3300053151 Bacteria 1591
671 Ga0500622_0361311 3300053156 Bacteria 599
672 Ga0500627_0321952 3300053158 Bacteria 671
673 Ga0500633_0020658 3300053160 Bacteria 1990
674 Ga0500638_115711 3300053162 Bacteria 1233
675 Ga0500639_145842 3300053163 Bacteria 1099
676 Ga0500636_0117585 3300053177 Bacteria 1494
677 Ga0500636_0164511 3300053177 Bacteria 1206
678 Ga0500645_039681 3300053730 Bacteria 1394
679 Ga0500645_051857 3300053730 Bacteria 1196
680 Ga0500599_000400 3300053736 Bacteria 4398
681 Ga0500661_006184 3300055283 Bacteria 2232

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100645102 Ga0070690_1006451021 109
2 3300025939 Ga0207665_10037803 Ga0207665_100378031 129
3 3300005333 Ga0070677_10476250 Ga0070677_104762501 130
4 3300006237 Ga0097621_100024299 Ga0097621_1000242997 130
5 3300006358 Ga0068871_100066751 Ga0068871_1000667514 130
6 3300014969 Ga0157376_10103099 Ga0157376_101030991 130
7 3300048917 Ga0496114_0628331 Ga0496114_0628331_70_465 130
8 3300006844 Ga0075428_100194112 Ga0075428_1001941124 131
9 3300006846 Ga0075430_100456992 Ga0075430_1004569922 131
10 3300006852 Ga0075433_10313534 Ga0075433_103135342 131
11 3300007076 Ga0075435_100391737 Ga0075435_1003917372 131
12 3300009147 Ga0114129_10079908 Ga0114129_100799084 131
13 3300050507 nmdc:mga05p37_60503_c1 nmdc:mga05p37_60503_c1_578_1003 131
14 3300050512 nmdc:mga0n895_851638_c1 nmdc:mga0n895_851638_c1_69_548 131
15 3300050515 nmdc:mga0a205_253321_c1 nmdc:mga0a205_253321_c1_910_1335 131
16 3300030521 Ga0307511_10022068 Ga0307511_100220682 132
17 3300031730 Ga0307516_10000276 Ga0307516_100002767 132
18 iso_pu_bacteria 2643221557 2643807702 132
19 iso_pu_bacteria 2643221668 2644379190 132
20 3300028036 Ga0265355_1011388 Ga0265355_10113882 133
21 iso_pu_bacteria 2617270742 2617384125 133
22 iso_pu_bacteria 2744054900 2746086288 133
23 iso_pu_bacteria 2744054901 2746096959 133
24 3300006038 Ga0075365_10024860 Ga0075365_100248605 134
25 3300006178 Ga0075367_10316159 Ga0075367_103161592 134
26 3300025297 Ga0209758_1030383 Ga0209758_10303832 134
27 3300025299 Ga0209256_1044068 Ga0209256_10440682 134
28 iso_pu_bacteria 2501025502 2501078034 134
29 iso_pu_bacteria 2510917013 2511092005 134
30 iso_pu_bacteria 2524023228 2524538495 134
31 iso_pu_bacteria 2932794094 2932797077 134
32 iso_pu_bacteria 2932801729 2932807426 134
33 iso_pu_bacteria 2935959822 2935961642 134
34 iso_pu_bacteria 8019555841 8019556762 134
35 iso_pu_bacteria 8019565922 8019568544 134
36 3300005340 Ga0070689_101912113 Ga0070689_1019121131 135
37 3300005353 Ga0070669_100000438 Ga0070669_10000043824 135
38 3300025923 Ga0207681_10000037 Ga0207681_1000003799 135
39 3300025972 Ga0207668_10688752 Ga0207668_106887522 135
40 3300003781 Ga0055536_1041459 Ga0055536_10414592 136
41 3300003791 Ga0055530_10023186 Ga0055530_100231862 136
42 3300003794 Ga0055531_10000697 Ga0055531_1000069710 136
43 3300025292 Ga0209676_1001348 Ga0209676_100134827 136
44 3300025298 Ga0209050_1000644 Ga0209050_100064424 136
45 3300025298 Ga0209050_1001277 Ga0209050_10012779 136
46 3300025303 Ga0209051_1013495 Ga0209051_10134952 136
47 3300025304 Ga0209257_1001078 Ga0209257_100107814 136
48 3300026121 Ga0207683_10266726 Ga0207683_102667262 136
49 3300027512 Ga0209179_1054300 Ga0209179_10543002 136
50 3300027671 Ga0209588_1016132 Ga0209588_10161323 136
51 3300028380 Ga0268265_10030300 Ga0268265_100303003 136
52 3300037471 Ga0395905_0139986 Ga0395905_0139986_883_1314 136
53 3300041486 Ga0451807_2026923 Ga0451807_2026923_115_540 136
54 3300053139 Ga0500568_0079662 Ga0500568_0079662_578_997 136
55 iso_pu_bacteria 2599185352 2600197568 136
56 iso_pu_bacteria 2643221723 2644671557 136
57 iso_pu_bacteria 2935959822 2935963916 136
58 3300002737 JGI25162J39368_1001596 JGI25162J39368_10015965 137
59 3300003214 JGI25165J46597_1000280 JGI25165J46597_10002808 137
60 3300025233 Ga0209437_100281 Ga0209437_1002819 137
61 3300025246 Ga0209646_1004247 Ga0209646_10042472 137
62 3300025261 Ga0209233_1000267 Ga0209233_10002679 137
63 3300028016 Ga0265354_1004635 Ga0265354_10046352 137
64 3300030521 Ga0307511_10063150 Ga0307511_100631502 137
65 3300030878 Ga0265770_1000015 Ga0265770_10000157 137
66 3300031507 Ga0307509_10139206 Ga0307509_101392062 137
67 3300031616 Ga0307508_10305488 Ga0307508_103054882 137
68 3300033179 Ga0307507_10069784 Ga0307507_100697842 137
69 3300033180 Ga0307510_10157839 Ga0307510_101578392 137
70 3300035171 Ga0373946_0414032 Ga0373946_0414032_159_572 137
71 3300035695 Ga0373927_0007027 Ga0373927_0007027_6156_6569 137
72 3300035725 Ga0373947_0028793 Ga0373947_0028793_2078_2491 137
73 3300037068 Ga0373925_0086217 Ga0373925_0086217_1614_2027 137
74 3300046461 Ga0495641_0263431 Ga0495641_0263431_273_686 137
75 3300046476 Ga0495662_0125321 Ga0495662_0125321_316_729 137
76 3300046533 Ga0495640_0595823 Ga0495640_0595823_48_464 137
77 3300046642 Ga0495634_0183924 Ga0495634_0183924_436_849 137
78 3300047469 Ga0495673_0097803 Ga0495673_0097803_358_771 137
79 3300053080 Ga0500635_0008832 Ga0500635_0008832_1447_1860 137
80 3300053091 Ga0500647_0162140 Ga0500647_0162140_588_1001 137
81 3300053093 Ga0500651_0094984 Ga0500651_0094984_1061_1477 137
82 3300053162 Ga0500638_115711 Ga0500638_115711_29_442 137
83 3300053163 Ga0500639_145842 Ga0500639_145842_63_476 137
84 3300053177 Ga0500636_0117585 Ga0500636_0117585_129_542 137
85 3300053177 Ga0500636_0164511 Ga0500636_0164511_274_708 137
86 iso_pu_bacteria 2824661429 2824668780 137
87 iso_pu_bacteria 2879099564 2879100676 137
88 iso_pu_bacteria 2922368715 2922373279 137
89 iso_pu_bacteria 2929615660 2929615692 137
90 iso_pu_bacteria 2929624759 2929630307 137
91 iso_pu_bacteria 2932784394 2932791866 137
92 iso_pu_bacteria 2932794094 2932796334 137
93 iso_pu_bacteria 2932801729 2932804360 137
94 iso_pu_bacteria 2932809354 2932815607 137
95 iso_pu_bacteria 2932818245 2932819320 137
96 iso_pu_bacteria 2933577622 2933579021 137
97 iso_pu_bacteria 2935616580 2935624268 137
98 iso_pu_bacteria 2935638405 2935647760 137
99 iso_pu_bacteria 2935665750 2935674783 137
100 iso_pu_bacteria 2935675223 2935678344 137
101 iso_pu_bacteria 2935684952 2935688230 137
102 iso_pu_bacteria 2935694250 2935698894 137
103 iso_pu_bacteria 2935703347 2935708513 137
104 iso_pu_bacteria 2935713505 2935715249 137
105 iso_pu_bacteria 2935722832 2935726186 137
106 iso_pu_bacteria 2935732158 2935734068 137
107 iso_pu_bacteria 2935741537 2935743447 137
108 iso_pu_bacteria 2935750917 2935754515 137
109 iso_pu_bacteria 2935760218 2935768285 137
110 iso_pu_bacteria 2935810662 2935819439 137
111 iso_pu_bacteria 2935827899 2935837244 137
112 iso_pu_bacteria 2935837841 2935846502 137
113 iso_pu_bacteria 2935855204 2935862698 137
114 iso_pu_bacteria 2935864058 2935871704 137
115 iso_pu_bacteria 2935873716 2935881929 137
116 iso_pu_bacteria 2935883170 2935888771 137
117 iso_pu_bacteria 2935992306 2935998802 137
118 iso_pu_bacteria 2936002035 2936007358 137
119 iso_pu_bacteria 2936037263 2936046284 137
120 iso_pu_bacteria 2940556831 2940560108 137
121 iso_pu_bacteria 2941538514 2941546921 137
122 iso_pu_bacteria 8019576017 8019581506 137
123 iso_pu_bacteria 8019586578 8019589134 137
124 iso_pu_bacteria 8019597564 8019602097 137
125 iso_pu_bacteria 8019608314 8019616457 137
126 iso_pu_bacteria 8055742211 8055747340 137
127 3300005338 Ga0068868_100336151 Ga0068868_1003361511 138
128 3300005536 Ga0070697_101163105 Ga0070697_1011631051 138
129 3300005719 Ga0068861_101273324 Ga0068861_1012733241 138
130 3300014325 Ga0163163_11575952 Ga0163163_115759522 138
131 3300046455 Ga0495603_0004010 Ga0495603_0004010_1422_1844 138
132 3300046457 Ga0495590_0018331 Ga0495590_0018331_1973_2395 138
133 3300046459 Ga0495629_0007863 Ga0495629_0007863_1228_1650 138
134 3300046460 Ga0495638_0006659 Ga0495638_0006659_2468_2953 138
135 3300046461 Ga0495641_0031370 Ga0495641_0031370_1190_1612 138
136 3300046463 Ga0495653_0015161 Ga0495653_0015161_2851_3273 138
137 3300046463 Ga0495653_0033105 Ga0495653_0033105_1517_2002 138
138 3300046471 Ga0495650_0005382 Ga0495650_0005382_1346_1768 138
139 3300046472 Ga0495580_0000405 Ga0495580_0000405_9742_10164 138
140 3300046472 Ga0495580_0005620 Ga0495580_0005620_8203_8688 138
141 3300046473 Ga0495582_0002617 Ga0495582_0002617_6717_7139 138
142 3300046473 Ga0495582_0127007 Ga0495582_0127007_441_926 138
143 3300046474 Ga0495605_0013142 Ga0495605_0013142_3798_4220 138
144 3300046476 Ga0495662_0043219 Ga0495662_0043219_1032_1454 138
145 3300046477 Ga0495664_0000547 Ga0495664_0000547_10157_10579 138
146 3300046477 Ga0495664_0171034 Ga0495664_0171034_154_639 138
147 3300046491 Ga0495584_0000002 Ga0495584_0000002_424517_424939 138
148 3300046499 Ga0495594_0127978 Ga0495594_0127978_552_974 138
149 3300046500 Ga0495596_0057473 Ga0495596_0057473_335_757 138
150 3300046506 Ga0495583_0002869 Ga0495583_0002869_2917_3402 138
151 3300046507 Ga0495606_0038857 Ga0495606_0038857_2732_3154 138
152 3300046507 Ga0495606_0533824 Ga0495606_0533824_25_510 138
153 3300046514 Ga0495618_0010352 Ga0495618_0010352_4305_4727 138
154 3300046514 Ga0495618_0501904 Ga0495618_0501904_215_637 138
155 3300046516 Ga0495628_0009095 Ga0495628_0009095_2144_2566 138
156 3300046516 Ga0495628_0052696 Ga0495628_0052696_995_1480 138
157 3300046517 Ga0495630_0012823 Ga0495630_0012823_3330_3752 138
158 3300046517 Ga0495630_0051802 Ga0495630_0051802_2170_2592 138
159 3300046524 Ga0495648_0002183 Ga0495648_0002183_2673_3095 138
160 3300046524 Ga0495648_0026751 Ga0495648_0026751_1256_1678 138
161 3300046524 Ga0495648_0075425 Ga0495648_0075425_454_876 138
162 3300046524 Ga0495648_0116631 Ga0495648_0116631_450_872 138
163 3300046524 Ga0495648_0155447 Ga0495648_0155447_166_582 138
164 3300046526 Ga0495666_0001085 Ga0495666_0001085_8335_8757 138
165 3300046529 Ga0495652_0017711 Ga0495652_0017711_3011_3433 138
166 3300046531 Ga0495665_0009393 Ga0495665_0009393_1862_2284 138
167 3300046531 Ga0495665_0083475 Ga0495665_0083475_507_992 138
168 3300046533 Ga0495640_0007678 Ga0495640_0007678_6950_7372 138
169 3300046535 Ga0495586_0009947 Ga0495586_0009947_1720_2142 138
170 3300046536 Ga0495587_0003216 Ga0495587_0003216_9271_9693 138
171 3300046543 Ga0495645_0004363 Ga0495645_0004363_1622_2044 138
172 3300046642 Ga0495634_0000661 Ga0495634_0000661_24760_25182 138
173 3300046642 Ga0495634_0280449 Ga0495634_0280449_175_660 138
174 3300046648 Ga0495611_0019704 Ga0495611_0019704_382_804 138
175 3300046663 Ga0495635_0006091 Ga0495635_0006091_1070_1492 138
176 3300046665 Ga0495661_0004172 Ga0495661_0004172_1207_1629 138
177 3300046678 Ga0495599_0018634 Ga0495599_0018634_1017_1439 138
178 3300046679 Ga0495623_0098957 Ga0495623_0098957_333_755 138
179 3300046680 Ga0495646_0003715 Ga0495646_0003715_1049_1471 138
180 3300046680 Ga0495646_0005124 Ga0495646_0005124_690_1175 138
181 3300046689 Ga0495613_0002330 Ga0495613_0002330_6922_7344 138
182 3300046689 Ga0495613_0101505 Ga0495613_0101505_32_517 138
183 3300046690 Ga0495624_0006209 Ga0495624_0006209_1119_1604 138
184 3300046690 Ga0495624_0022858 Ga0495624_0022858_1033_1455 138
185 3300046690 Ga0495624_0079432 Ga0495624_0079432_730_1152 138
186 3300046692 Ga0495671_0197755 Ga0495671_0197755_459_881 138
187 3300046809 Ga0495600_0176771 Ga0495600_0176771_28_450 138
188 3300047315 Ga0495581_0002154 Ga0495581_0002154_8421_8843 138
189 3300047317 Ga0495604_0002039 Ga0495604_0002039_8336_8758 138
190 3300047319 Ga0495674_0005169 Ga0495674_0005169_6996_7418 138
191 3300047319 Ga0495674_0043489 Ga0495674_0043489_2144_2566 138
192 3300047319 Ga0495674_0354487 Ga0495674_0354487_357_842 138
193 3300047321 Ga0495676_0010864 Ga0495676_0010864_1695_2117 138
194 3300047322 Ga0495680_0002175 Ga0495680_0002175_10803_11225 138
195 3300047323 Ga0495683_0109450 Ga0495683_0109450_475_960 138
196 3300047446 Ga0495679_000009 Ga0495679_000009_227517_227939 138
197 3300047446 Ga0495679_000748 Ga0495679_000748_7268_7690 138
198 3300047469 Ga0495673_0055630 Ga0495673_0055630_1222_1644 138
199 3300047469 Ga0495673_0335510 Ga0495673_0335510_35_451 138
200 3300047471 Ga0495684_0081956 Ga0495684_0081956_1136_1558 138
201 3300047472 Ga0495686_0313072 Ga0495686_0313072_358_843 138
202 3300047673 Ga0495593_0001822 Ga0495593_0001822_7901_8323 138
203 3300047673 Ga0495593_0004348 Ga0495593_0004348_3753_4238 138
204 3300048088 Ga0495602_0006795 Ga0495602_0006795_3524_3946 138
205 3300048089 Ga0495614_0002666 Ga0495614_0002666_6484_6906 138
206 3300048089 Ga0495614_0060933 Ga0495614_0060933_668_1090 138
207 3300048091 Ga0495626_0040568 Ga0495626_0040568_1719_2141 138
208 3300048905 Ga0496102_0126223 Ga0496102_0126223_440_925 138
209 3300048916 Ga0496113_0110546 Ga0496113_0110546_1172_1594 138
210 3300048920 Ga0496117_0099668 Ga0496117_0099668_275_760 138
211 3300048921 Ga0496118_0060180 Ga0496118_0060180_2063_2548 138
212 3300049460 Ga0495682_0014807 Ga0495682_0014807_481_903 138
213 3300049460 Ga0495682_0049600 Ga0495682_0049600_874_1296 138
214 3300049460 Ga0495682_0122959 Ga0495682_0122959_230_646 138
215 iso_pu_bacteria 3005710791 3005714002 138
216 3300005434 Ga0070709_10256865 Ga0070709_102568652 139
217 3300005436 Ga0070713_100254892 Ga0070713_1002548922 139
218 3300005439 Ga0070711_100074143 Ga0070711_1000741433 139
219 3300005467 Ga0070706_101064456 Ga0070706_1010644562 139
220 3300005564 Ga0070664_100252839 Ga0070664_1002528394 139
221 3300006028 Ga0070717_10014255 Ga0070717_100142554 139
222 3300006028 Ga0070717_10167061 Ga0070717_101670613 139
223 3300006028 Ga0070717_10260551 Ga0070717_102605512 139
224 3300006028 Ga0070717_10605578 Ga0070717_106055781 139
225 3300006048 Ga0075363_100196048 Ga0075363_1001960482 139
226 3300006175 Ga0070712_100267905 Ga0070712_1002679052 139
227 3300006353 Ga0075370_10083286 Ga0075370_100832863 139
228 3300007788 Ga0099795_10094602 Ga0099795_100946021 139
229 3300009093 Ga0105240_11079200 Ga0105240_110792001 139
230 3300009094 Ga0111539_10090477 Ga0111539_100904772 139
231 3300009545 Ga0105237_10071604 Ga0105237_100716043 139
232 3300009551 Ga0105238_10087189 Ga0105238_100871892 139
233 3300010159 Ga0099796_10074170 Ga0099796_100741702 139
234 3300010159 Ga0099796_10227893 Ga0099796_102278931 139
235 3300025914 Ga0207671_10351449 Ga0207671_103514492 139
236 3300025915 Ga0207693_10238157 Ga0207693_102381572 139
237 3300025928 Ga0207700_10625256 Ga0207700_106252562 139
238 3300025945 Ga0207679_10084323 Ga0207679_100843234 139
239 3300027671 Ga0209588_1190935 Ga0209588_11909351 139
240 3300027907 Ga0207428_11316093 Ga0207428_113160931 139
241 3300035118 Ga0373954_0181451 Ga0373954_0181451_330_749 139
242 3300035172 Ga0373955_0549519 Ga0373955_0549519_118_537 139
243 3300035724 Ga0373933_0471483 Ga0373933_0471483_80_499 139
244 3300046507 Ga0495606_0344983 Ga0495606_0344983_168_587 139
245 3300046524 Ga0495648_0049569 Ga0495648_0049569_1101_1520 139
246 3300046524 Ga0495648_0383124 Ga0495648_0383124_180_599 139
247 3300046616 Ga0495668_0087653 Ga0495668_0087653_1111_1530 139
248 3300050511 nmdc:mga08y16_108791_c1 nmdc:mga08y16_108791_c1_2390_2809 139
249 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001567 140
250 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003117 140
251 3300003374 JGI25161J50226_1002742 JGI25161J50226_10027423 140
252 3300003771 Ga0055526_1007083 Ga0055526_10070835 140
253 3300003775 Ga0055524_1041650 Ga0055524_10416502 140
254 3300003781 Ga0055536_1001123 Ga0055536_100112313 140
255 3300003791 Ga0055530_10004321 Ga0055530_100043214 140
256 3300003792 Ga0055540_1041907 Ga0055540_10419071 140
257 3300004625 Ga0055543_1000034 Ga0055543_100003437 140
258 3300005262 Ga0065165_1000025 Ga0065165_1000025216 140
259 3300005435 Ga0070714_100120710 Ga0070714_1001207103 140
260 3300005436 Ga0070713_100022038 Ga0070713_1000220382 140
261 3300005436 Ga0070713_100216049 Ga0070713_1002160491 140
262 3300005437 Ga0070710_10006716 Ga0070710_100067162 140
263 3300005439 Ga0070711_100011825 Ga0070711_1000118255 140
264 3300005518 Ga0070699_101431738 Ga0070699_1014317381 140
265 3300005564 Ga0070664_100508563 Ga0070664_1005085632 140
266 3300005577 Ga0068857_100562902 Ga0068857_1005629022 140
267 3300005614 Ga0068856_102235263 Ga0068856_1022352631 140
268 3300005841 Ga0068863_102418364 Ga0068863_1024183641 140
269 3300005842 Ga0068858_100825267 Ga0068858_1008252671 140
270 3300005981 Ga0081538_10036483 Ga0081538_100364833 140
271 3300006028 Ga0070717_10007835 Ga0070717_100078355 140
272 3300006163 Ga0070715_10004890 Ga0070715_100048903 140
273 3300006173 Ga0070716_100007047 Ga0070716_1000070477 140
274 3300006175 Ga0070712_100594498 Ga0070712_1005944982 140
275 3300006358 Ga0068871_100144834 Ga0068871_1001448341 140
276 3300009101 Ga0105247_10273143 Ga0105247_102731432 140
277 3300009177 Ga0105248_10048981 Ga0105248_100489816 140
278 3300013306 Ga0163162_10810763 Ga0163162_108107631 140
279 3300013308 Ga0157375_12519970 Ga0157375_125199701 140
280 3300025208 Ga0209436_100130 Ga0209436_10013010 140
281 3300025245 Ga0207425_1011713 Ga0207425_10117132 140
282 3300025284 Ga0209130_1000005 Ga0209130_1000005364 140
283 3300025292 Ga0209676_1001927 Ga0209676_100192713 140
284 3300025294 Ga0209025_1000105 Ga0209025_100010553 140
285 3300025295 Ga0209564_1000113 Ga0209564_100011352 140
286 3300025298 Ga0209050_1005247 Ga0209050_100524710 140
287 3300025299 Ga0209256_1002435 Ga0209256_10024353 140
288 3300025302 Ga0207426_1000015 Ga0207426_1000015235 140
289 3300025303 Ga0209051_1001056 Ga0209051_10010564 140
290 3300025304 Ga0209257_1001948 Ga0209257_100194811 140
291 3300025898 Ga0207692_10007178 Ga0207692_100071785 140
292 3300025900 Ga0207710_10169683 Ga0207710_101696831 140
293 3300025906 Ga0207699_10004550 Ga0207699_100045504 140
294 3300025915 Ga0207693_10001772 Ga0207693_1000177216 140
295 3300025916 Ga0207663_10008912 Ga0207663_100089125 140
296 3300025916 Ga0207663_10949536 Ga0207663_109495362 140
297 3300025928 Ga0207700_10400548 Ga0207700_104005481 140
298 3300025928 Ga0207700_10539799 Ga0207700_105397992 140
299 3300025929 Ga0207664_10007907 Ga0207664_100079078 140
300 3300025931 Ga0207644_10143676 Ga0207644_101436763 140
301 3300025939 Ga0207665_10001072 Ga0207665_1000107217 140
302 3300025941 Ga0207711_10025595 Ga0207711_100255955 140
303 3300026035 Ga0207703_10482658 Ga0207703_104826581 140
304 3300026078 Ga0207702_10585597 Ga0207702_105855972 140
305 3300026116 Ga0207674_10288352 Ga0207674_102883523 140
306 3300028786 Ga0307517_10285537 Ga0307517_102855371 140
307 3300028794 Ga0307515_10058325 Ga0307515_100583253 140
308 3300028794 Ga0307515_10420527 Ga0307515_104205271 140
309 3300033180 Ga0307510_10008458 Ga0307510_100084589 140
310 3300033180 Ga0307510_10177098 Ga0307510_101770982 140
311 3300033544 Ga0316215_1029823 Ga0316215_10298232 140
312 3300035695 Ga0373927_0387816 Ga0373927_0387816_338_760 140
313 3300041492 Ga0451835_0153052 Ga0451835_0153052_100_522 140
314 3300041494 Ga0451837_0595071 Ga0451837_0595071_276_698 140
315 3300041507 Ga0451851_0227276 Ga0451851_0227276_1609_2031 140
316 3300041512 Ga0451853_1297410 Ga0451853_1297410_127_549 140
317 3300044656 Ga0466969_0167388 Ga0466969_0167388_55_495 140
318 3300044684 Ga0466966_0539586 Ga0466966_0539586_185_625 140
319 3300044765 Ga0466970_0164137 Ga0466970_0164137_612_1052 140
320 3300045049 Ga0466959_0003549 Ga0466959_0003549_2857_3297 140
321 3300046460 Ga0495638_0004919 Ga0495638_0004919_3443_3865 140
322 3300046492 Ga0495585_0463162 Ga0495585_0463162_56_478 140
323 3300046512 Ga0495610_0274314 Ga0495610_0274314_151_573 140
324 3300046519 Ga0495632_0038567 Ga0495632_0038567_985_1407 140
325 3300046524 Ga0495648_0048786 Ga0495648_0048786_560_982 140
326 3300046616 Ga0495668_0150115 Ga0495668_0150115_720_1142 140
327 3300046660 Ga0495625_0515761 Ga0495625_0515761_11_433 140
328 3300046694 Ga0495649_0557779 Ga0495649_0557779_66_488 140
329 3300047469 Ga0495673_0085907 Ga0495673_0085907_237_659 140
330 3300047469 Ga0495673_0217300 Ga0495673_0217300_181_603 140
331 3300048088 Ga0495602_0621950 Ga0495602_0621950_41_463 140
332 3300048904 Ga0496101_0023487 Ga0496101_0023487_757_1179 140
333 3300048905 Ga0496102_0093381 Ga0496102_0093381_34_456 140
334 3300048907 Ga0496104_0049184 Ga0496104_0049184_632_1054 140
335 3300048908 Ga0496105_0075306 Ga0496105_0075306_933_1355 140
336 3300048909 Ga0496106_0033052 Ga0496106_0033052_758_1180 140
337 3300048910 Ga0496107_0070722 Ga0496107_0070722_1520_1942 140
338 3300048912 Ga0496109_0206453 Ga0496109_0206453_1017_1439 140
339 3300048913 Ga0496110_0042236 Ga0496110_0042236_593_1015 140
340 3300048914 Ga0496111_0183651 Ga0496111_0183651_1103_1525 140
341 3300048915 Ga0496112_0032895 Ga0496112_0032895_3882_4304 140
342 3300048916 Ga0496113_0114845 Ga0496113_0114845_285_707 140
343 3300048918 Ga0496115_0083872 Ga0496115_0083872_1640_2062 140
344 3300049460 Ga0495682_0083048 Ga0495682_0083048_200_622 140
345 3300053083 Ga0495655_0372034 Ga0495655_0372034_17_439 140
346 3300053087 Ga0500643_050489 Ga0500643_050489_405_827 140
347 3300053092 Ga0500583_0021076 Ga0500583_0021076_217_639 140
348 3300053096 Ga0500641_0078346 Ga0500641_0078346_250_672 140
349 3300053103 Ga0500555_003590 Ga0500555_003590_2277_2699 140
350 3300053104 Ga0500556_0003155 Ga0500556_0003155_1637_2059 140
351 3300053104 Ga0500556_0301841 Ga0500556_0301841_104_526 140
352 3300053108 Ga0500562_006055 Ga0500562_006055_2458_2880 140
353 3300053130 Ga0500642_0090055 Ga0500642_0090055_28_450 140
354 3300053133 Ga0500655_048735 Ga0500655_048735_10_432 140
355 3300053139 Ga0500568_0019594 Ga0500568_0019594_2499_2921 140
356 3300053151 Ga0500604_0029865 Ga0500604_0029865_187_609 140
357 3300053156 Ga0500622_0361311 Ga0500622_0361311_101_523 140
358 3300053158 Ga0500627_0321952 Ga0500627_0321952_53_475 140
359 3300053160 Ga0500633_0020658 Ga0500633_0020658_561_983 140
360 3300053730 Ga0500645_039681 Ga0500645_039681_711_1136 140
361 3300053730 Ga0500645_051857 Ga0500645_051857_260_682 140
362 3300053736 Ga0500599_000400 Ga0500599_000400_352_774 140
363 3300001904 JGI24736J21556_1029064 JGI24736J21556_10290641 141
364 3300001989 JGI24739J22299_10159857 JGI24739J22299_101598571 141
365 3300003794 Ga0055531_10044523 Ga0055531_100445232 141
366 3300005331 Ga0070670_100331594 Ga0070670_1003315942 141
367 3300005335 Ga0070666_10031914 Ga0070666_100319144 141
368 3300005335 Ga0070666_10162265 Ga0070666_101622652 141
369 3300005336 Ga0070680_100541876 Ga0070680_1005418762 141
370 3300005337 Ga0070682_100033993 Ga0070682_1000339935 141
371 3300005338 Ga0068868_100420909 Ga0068868_1004209091 141
372 3300005340 Ga0070689_100461258 Ga0070689_1004612583 141
373 3300005341 Ga0070691_10333830 Ga0070691_103338302 141
374 3300005343 Ga0070687_100100429 Ga0070687_1001004293 141
375 3300005344 Ga0070661_100049498 Ga0070661_1000494985 141
376 3300005347 Ga0070668_100036882 Ga0070668_1000368822 141
377 3300005353 Ga0070669_100691660 Ga0070669_1006916602 141
378 3300005354 Ga0070675_100415925 Ga0070675_1004159252 141
379 3300005354 Ga0070675_101883211 Ga0070675_1018832111 141
380 3300005355 Ga0070671_100059070 Ga0070671_1000590702 141
381 3300005355 Ga0070671_100144711 Ga0070671_1001447113 141
382 3300005356 Ga0070674_100152366 Ga0070674_1001523663 141
383 3300005364 Ga0070673_100023208 Ga0070673_1000232084 141
384 3300005364 Ga0070673_101626359 Ga0070673_1016263591 141
385 3300005365 Ga0070688_100640354 Ga0070688_1006403541 141
386 3300005367 Ga0070667_100066963 Ga0070667_1000669634 141
387 3300005434 Ga0070709_10006594 Ga0070709_100065948 141
388 3300005435 Ga0070714_100024651 Ga0070714_1000246514 141
389 3300005435 Ga0070714_100050162 Ga0070714_1000501623 141
390 3300005435 Ga0070714_100900473 Ga0070714_1009004731 141
391 3300005436 Ga0070713_100013850 Ga0070713_1000138504 141
392 3300005436 Ga0070713_100115085 Ga0070713_1001150854 141
393 3300005437 Ga0070710_10383336 Ga0070710_103833362 141
394 3300005437 Ga0070710_10753845 Ga0070710_107538451 141
395 3300005439 Ga0070711_100138930 Ga0070711_1001389303 141
396 3300005439 Ga0070711_100544071 Ga0070711_1005440712 141
397 3300005439 Ga0070711_100630139 Ga0070711_1006301392 141
398 3300005439 Ga0070711_101216695 Ga0070711_1012166951 141
399 3300005455 Ga0070663_100058160 Ga0070663_1000581603 141
400 3300005455 Ga0070663_100214577 Ga0070663_1002145772 141
401 3300005456 Ga0070678_100041051 Ga0070678_1000410515 141
402 3300005458 Ga0070681_10296286 Ga0070681_102962862 141
403 3300005466 Ga0070685_10033295 Ga0070685_100332953 141
404 3300005467 Ga0070706_100265211 Ga0070706_1002652113 141
405 3300005467 Ga0070706_100564086 Ga0070706_1005640861 141
406 3300005467 Ga0070706_100929972 Ga0070706_1009299721 141
407 3300005468 Ga0070707_100773233 Ga0070707_1007732331 141
408 3300005471 Ga0070698_100352319 Ga0070698_1003523192 141
409 3300005471 Ga0070698_100588372 Ga0070698_1005883721 141
410 3300005471 Ga0070698_100746413 Ga0070698_1007464131 141
411 3300005518 Ga0070699_100682520 Ga0070699_1006825201 141
412 3300005530 Ga0070679_100044161 Ga0070679_1000441613 141
413 3300005535 Ga0070684_100250152 Ga0070684_1002501523 141
414 3300005535 Ga0070684_100250578 Ga0070684_1002505783 141
415 3300005535 Ga0070684_100280207 Ga0070684_1002802073 141
416 3300005536 Ga0070697_101407977 Ga0070697_1014079771 141
417 3300005536 Ga0070697_102092728 Ga0070697_1020927281 141
418 3300005539 Ga0068853_100209856 Ga0068853_1002098561 141
419 3300005543 Ga0070672_100249124 Ga0070672_1002491243 141
420 3300005544 Ga0070686_100028574 Ga0070686_1000285744 141
421 3300005546 Ga0070696_100694322 Ga0070696_1006943221 141
422 3300005547 Ga0070693_100394740 Ga0070693_1003947402 141
423 3300005548 Ga0070665_100128511 Ga0070665_1001285112 141
424 3300005548 Ga0070665_100504232 Ga0070665_1005042323 141
425 3300005577 Ga0068857_100202889 Ga0068857_1002028892 141
426 3300005577 Ga0068857_100230824 Ga0068857_1002308241 141
427 3300005614 Ga0068856_100081658 Ga0068856_1000816585 141
428 3300005614 Ga0068856_101457596 Ga0068856_1014575961 141
429 3300005615 Ga0070702_100164382 Ga0070702_1001643821 141
430 3300005616 Ga0068852_100822318 Ga0068852_1008223182 141
431 3300005617 Ga0068859_100212221 Ga0068859_1002122215 141
432 3300005618 Ga0068864_100072302 Ga0068864_1000723023 141
433 3300005834 Ga0068851_10359222 Ga0068851_103592221 141
434 3300005841 Ga0068863_100190180 Ga0068863_1001901802 141
435 3300005841 Ga0068863_100234561 Ga0068863_1002345611 141
436 3300005841 Ga0068863_100311724 Ga0068863_1003117243 141
437 3300005842 Ga0068858_100167886 Ga0068858_1001678863 141
438 3300005842 Ga0068858_100546155 Ga0068858_1005461551 141
439 3300005843 Ga0068860_100340567 Ga0068860_1003405671 141
440 3300005844 Ga0068862_100580020 Ga0068862_1005800202 141
441 3300006028 Ga0070717_10002063 Ga0070717_100020634 141
442 3300006028 Ga0070717_10063991 Ga0070717_100639914 141
443 3300006028 Ga0070717_10524093 Ga0070717_105240932 141
444 3300006051 Ga0075364_10090133 Ga0075364_100901332 141
445 3300006163 Ga0070715_10034619 Ga0070715_100346195 141
446 3300006173 Ga0070716_100003451 Ga0070716_1000034517 141
447 3300006173 Ga0070716_100780373 Ga0070716_1007803731 141
448 3300006175 Ga0070712_100321967 Ga0070712_1003219673 141
449 3300006175 Ga0070712_100442663 Ga0070712_1004426632 141
450 3300006175 Ga0070712_100749308 Ga0070712_1007493082 141
451 3300006177 Ga0075362_10143408 Ga0075362_101434082 141
452 3300006178 Ga0075367_10240951 Ga0075367_102409512 141
453 3300006178 Ga0075367_10712549 Ga0075367_107125491 141
454 3300006186 Ga0075369_10131074 Ga0075369_101310742 141
455 3300006186 Ga0075369_10441910 Ga0075369_104419102 141
456 3300006195 Ga0075366_10012033 Ga0075366_100120337 141
457 3300006237 Ga0097621_100102101 Ga0097621_1001021015 141
458 3300006358 Ga0068871_100053351 Ga0068871_1000533513 141
459 3300006847 Ga0075431_100700520 Ga0075431_1007005201 141
460 3300006852 Ga0075433_10090020 Ga0075433_100900203 141
461 3300006881 Ga0068865_100065878 Ga0068865_1000658785 141
462 3300006881 Ga0068865_100738678 Ga0068865_1007386782 141
463 3300006914 Ga0075436_100392603 Ga0075436_1003926032 141
464 3300006931 Ga0097620_100212229 Ga0097620_1002122295 141
465 3300007076 Ga0075435_100009745 Ga0075435_1000097453 141
466 3300007076 Ga0075435_100570558 Ga0075435_1005705582 141
467 3300007788 Ga0099795_10023932 Ga0099795_100239322 141
468 3300007788 Ga0099795_10048771 Ga0099795_100487712 141
469 3300009011 Ga0105251_10029408 Ga0105251_100294085 141
470 3300009092 Ga0105250_10224504 Ga0105250_102245041 141
471 3300009094 Ga0111539_10843425 Ga0111539_108434252 141
472 3300009098 Ga0105245_10321862 Ga0105245_103218622 141
473 3300009098 Ga0105245_11141935 Ga0105245_111419351 141
474 3300009101 Ga0105247_10165485 Ga0105247_101654852 141
475 3300009101 Ga0105247_11261842 Ga0105247_112618421 141
476 3300009148 Ga0105243_10069112 Ga0105243_100691122 141
477 3300009148 Ga0105243_10798501 Ga0105243_107985011 141
478 3300009148 Ga0105243_12295722 Ga0105243_122957221 141
479 3300009174 Ga0105241_10132181 Ga0105241_101321812 141
480 3300009176 Ga0105242_10150596 Ga0105242_101505962 141
481 3300009177 Ga0105248_10096567 Ga0105248_100965672 141
482 3300009177 Ga0105248_10290835 Ga0105248_102908352 141
483 3300009177 Ga0105248_10293218 Ga0105248_102932183 141
484 3300009545 Ga0105237_10065253 Ga0105237_100652534 141
485 3300009545 Ga0105237_10497877 Ga0105237_104978772 141
486 3300009551 Ga0105238_10571889 Ga0105238_105718892 141
487 3300009551 Ga0105238_10816175 Ga0105238_108161751 141
488 3300009551 Ga0105238_10860645 Ga0105238_108606452 141
489 3300010159 Ga0099796_10194774 Ga0099796_101947742 141
490 3300010375 Ga0105239_10435458 Ga0105239_104354582 141
491 3300010375 Ga0105239_10695543 Ga0105239_106955431 141
492 3300011119 Ga0105246_10142512 Ga0105246_101425122 141
493 3300012480 Ga0157346_1003875 Ga0157346_10038752 141
494 3300012487 Ga0157321_1006128 Ga0157321_10061282 141
495 3300012494 Ga0157341_1002933 Ga0157341_10029332 141
496 3300012506 Ga0157324_1031631 Ga0157324_10316311 141
497 3300012507 Ga0157342_1006762 Ga0157342_10067621 141
498 3300012512 Ga0157327_1020250 Ga0157327_10202502 141
499 3300013105 Ga0157369_10050653 Ga0157369_100506532 141
500 3300013105 Ga0157369_10414934 Ga0157369_104149343 141
501 3300013296 Ga0157374_10364707 Ga0157374_103647072 141
502 3300013297 Ga0157378_10078599 Ga0157378_100785994 141
503 3300013297 Ga0157378_11173336 Ga0157378_111733362 141
504 3300013306 Ga0163162_10241776 Ga0163162_102417762 141
505 3300013306 Ga0163162_10476677 Ga0163162_104766772 141
506 3300013308 Ga0157375_10505267 Ga0157375_105052671 141
507 3300013308 Ga0157375_11503301 Ga0157375_115033011 141
508 3300014325 Ga0163163_10182975 Ga0163163_101829752 141
509 3300014325 Ga0163163_10646726 Ga0163163_106467262 141
510 3300014325 Ga0163163_10870736 Ga0163163_108707362 141
511 3300014745 Ga0157377_10466010 Ga0157377_104660101 141
512 3300014745 Ga0157377_11064020 Ga0157377_110640201 141
513 3300014968 Ga0157379_10182921 Ga0157379_101829212 141
514 3300017792 Ga0163161_10660159 Ga0163161_106601592 141
515 3300025304 Ga0209257_1016366 Ga0209257_10163663 141
516 3300025321 Ga0207656_10369960 Ga0207656_103699601 141
517 3300025735 Ga0207713_1029276 Ga0207713_10292763 141
518 3300025898 Ga0207692_10015010 Ga0207692_100150104 141
519 3300025898 Ga0207692_10308877 Ga0207692_103088772 141
520 3300025900 Ga0207710_10025982 Ga0207710_100259823 141
521 3300025900 Ga0207710_10601175 Ga0207710_106011751 141
522 3300025903 Ga0207680_10133162 Ga0207680_101331623 141
523 3300025904 Ga0207647_10114051 Ga0207647_101140512 141
524 3300025904 Ga0207647_10535633 Ga0207647_105356332 141
525 3300025905 Ga0207685_10034813 Ga0207685_100348133 141
526 3300025906 Ga0207699_10001770 Ga0207699_100017708 141
527 3300025907 Ga0207645_10227402 Ga0207645_102274023 141
528 3300025910 Ga0207684_10775129 Ga0207684_107751292 141
529 3300025912 Ga0207707_10226485 Ga0207707_102264853 141
530 3300025914 Ga0207671_10190002 Ga0207671_101900023 141
531 3300025915 Ga0207693_10110901 Ga0207693_101109013 141
532 3300025915 Ga0207693_10432850 Ga0207693_104328502 141
533 3300025916 Ga0207663_10052746 Ga0207663_100527462 141
534 3300025916 Ga0207663_10070638 Ga0207663_100706384 141
535 3300025916 Ga0207663_10407751 Ga0207663_104077512 141
536 3300025919 Ga0207657_10272274 Ga0207657_102722742 141
537 3300025919 Ga0207657_10330779 Ga0207657_103307792 141
538 3300025920 Ga0207649_11024230 Ga0207649_110242301 141
539 3300025921 Ga0207652_10010590 Ga0207652_100105903 141
540 3300025922 Ga0207646_10631306 Ga0207646_106313061 141
541 3300025924 Ga0207694_10427688 Ga0207694_104276882 141
542 3300025925 Ga0207650_10083520 Ga0207650_100835202 141
543 3300025925 Ga0207650_10266822 Ga0207650_102668222 141
544 3300025927 Ga0207687_10012794 Ga0207687_100127945 141
545 3300025927 Ga0207687_10912353 Ga0207687_109123531 141
546 3300025928 Ga0207700_10004844 Ga0207700_100048446 141
547 3300025928 Ga0207700_10010379 Ga0207700_100103793 141
548 3300025928 Ga0207700_10597867 Ga0207700_105978672 141
549 3300025929 Ga0207664_10763708 Ga0207664_107637082 141
550 3300025931 Ga0207644_10041350 Ga0207644_100413504 141
551 3300025931 Ga0207644_10114805 Ga0207644_101148051 141
552 3300025932 Ga0207690_10148701 Ga0207690_101487012 141
553 3300025932 Ga0207690_10361681 Ga0207690_103616811 141
554 3300025933 Ga0207706_10053868 Ga0207706_100538682 141
555 3300025933 Ga0207706_10551467 Ga0207706_105514672 141
556 3300025934 Ga0207686_10034580 Ga0207686_100345805 141
557 3300025935 Ga0207709_10164742 Ga0207709_101647422 141
558 3300025935 Ga0207709_11356654 Ga0207709_113566541 141
559 3300025938 Ga0207704_10195864 Ga0207704_101958642 141
560 3300025939 Ga0207665_10004233 Ga0207665_1000423311 141
561 3300025939 Ga0207665_10026869 Ga0207665_100268695 141
562 3300025939 Ga0207665_10458333 Ga0207665_104583332 141
563 3300025939 Ga0207665_10567784 Ga0207665_105677842 141
564 3300025940 Ga0207691_10046346 Ga0207691_100463466 141
565 3300025941 Ga0207711_10033852 Ga0207711_100338523 141
566 3300025941 Ga0207711_10434829 Ga0207711_104348292 141
567 3300025944 Ga0207661_10111892 Ga0207661_101118922 141
568 3300025944 Ga0207661_10178685 Ga0207661_101786853 141
569 3300025949 Ga0207667_10230320 Ga0207667_102303202 141
570 3300025960 Ga0207651_10294295 Ga0207651_102942952 141
571 3300025972 Ga0207668_10140262 Ga0207668_101402622 141
572 3300025972 Ga0207668_10157418 Ga0207668_101574182 141
573 3300025972 Ga0207668_10979739 Ga0207668_109797392 141
574 3300025986 Ga0207658_10129624 Ga0207658_101296244 141
575 3300026023 Ga0207677_10141054 Ga0207677_101410542 141
576 3300026035 Ga0207703_10101418 Ga0207703_101014184 141
577 3300026035 Ga0207703_10279671 Ga0207703_102796711 141
578 3300026041 Ga0207639_10514690 Ga0207639_105146901 141
579 3300026067 Ga0207678_10090345 Ga0207678_100903452 141
580 3300026067 Ga0207678_10146846 Ga0207678_101468463 141
581 3300026067 Ga0207678_10189873 Ga0207678_101898732 141
582 3300026075 Ga0207708_10073466 Ga0207708_100734664 141
583 3300026078 Ga0207702_10299535 Ga0207702_102995353 141
584 3300026088 Ga0207641_10177653 Ga0207641_101776535 141
585 3300026088 Ga0207641_10545956 Ga0207641_105459562 141
586 3300026089 Ga0207648_10174815 Ga0207648_101748151 141
587 3300026095 Ga0207676_10284533 Ga0207676_102845331 141
588 3300026095 Ga0207676_10321976 Ga0207676_103219761 141
589 3300026116 Ga0207674_10086582 Ga0207674_100865823 141
590 3300026118 Ga0207675_101888401 Ga0207675_1018884011 141
591 3300026121 Ga0207683_10017427 Ga0207683_100174274 141
592 3300026142 Ga0207698_10237013 Ga0207698_102370131 141
593 3300027907 Ga0207428_10086181 Ga0207428_100861812 141
594 3300027907 Ga0207428_10424925 Ga0207428_104249251 141
595 3300028379 Ga0268266_10033064 Ga0268266_100330643 141
596 3300028381 Ga0268264_10101786 Ga0268264_101017863 141
597 3300031616 Ga0307508_10033908 Ga0307508_100339084 141
598 3300033180 Ga0307510_10134756 Ga0307510_101347561 141
599 3300034816 Ga0373930_0023479 Ga0373930_0023479_111_536 141
600 3300035091 Ga0373951_0075716 Ga0373951_0075716_246_671 141
601 3300035092 Ga0373952_0019801 Ga0373952_0019801_923_1348 141
602 3300035114 Ga0373939_0403998 Ga0373939_0403998_105_530 141
603 3300035115 Ga0373941_0187392 Ga0373941_0187392_247_672 141
604 3300035116 Ga0373945_0043635 Ga0373945_0043635_219_644 141
605 3300035121 Ga0373960_0201203 Ga0373960_0201203_168_593 141
606 3300035170 Ga0373943_0039152 Ga0373943_0039152_112_537 141
607 3300035171 Ga0373946_0026637 Ga0373946_0026637_63_488 141
608 3300035241 Ga0373961_0012586 Ga0373961_0012586_32_457 141
609 3300035691 Ga0373931_0129183 Ga0373931_0129183_619_1044 141
610 3300035725 Ga0373947_0001566 Ga0373947_0001566_6405_6830 141
611 3300037068 Ga0373925_0013517 Ga0373925_0013517_5439_5864 141
612 3300046459 Ga0495629_0001306 Ga0495629_0001306_15668_16093 141
613 3300046462 Ga0495651_0691382 Ga0495651_0691382_80_505 141
614 3300046473 Ga0495582_0001069 Ga0495582_0001069_381_806 141
615 3300046474 Ga0495605_0054123 Ga0495605_0054123_1471_1896 141
616 3300046474 Ga0495605_0074470 Ga0495605_0074470_427_852 141
617 3300046499 Ga0495594_0005370 Ga0495594_0005370_1315_1740 141
618 3300046506 Ga0495583_0262027 Ga0495583_0262027_149_574 141
619 3300046507 Ga0495606_0044716 Ga0495606_0044716_1896_2321 141
620 3300046507 Ga0495606_0050123 Ga0495606_0050123_1235_1666 141
621 3300046512 Ga0495610_0091732 Ga0495610_0091732_40_465 141
622 3300046512 Ga0495610_0257871 Ga0495610_0257871_223_648 141
623 3300046515 Ga0495620_0035667 Ga0495620_0035667_698_1123 141
624 3300046517 Ga0495630_0405450 Ga0495630_0405450_563_988 141
625 3300046524 Ga0495648_0072410 Ga0495648_0072410_378_803 141
626 3300046530 Ga0495654_0152506 Ga0495654_0152506_547_972 141
627 3300046538 Ga0495609_0060084 Ga0495609_0060084_921_1346 141
628 3300046538 Ga0495609_0204290 Ga0495609_0204290_379_804 141
629 3300046542 Ga0495597_0059674 Ga0495597_0059674_984_1409 141
630 3300046557 Ga0495622_0102961 Ga0495622_0102961_250_675 141
631 3300046557 Ga0495622_0110318 Ga0495622_0110318_587_1012 141
632 3300046557 Ga0495622_0122110 Ga0495622_0122110_45_476 141
633 3300046648 Ga0495611_0059673 Ga0495611_0059673_1110_1541 141
634 3300046660 Ga0495625_0209923 Ga0495625_0209923_815_1246 141
635 3300046660 Ga0495625_0223929 Ga0495625_0223929_427_852 141
636 3300046660 Ga0495625_0263961 Ga0495625_0263961_495_920 141
637 3300046674 Ga0495588_0138758 Ga0495588_0138758_306_731 141
638 3300046681 Ga0495647_0026122 Ga0495647_0026122_1213_1638 141
639 3300046683 Ga0495658_0000967 Ga0495658_0000967_7928_8353 141
640 3300046690 Ga0495624_0691588 Ga0495624_0691588_121_546 141
641 3300046692 Ga0495671_0126295 Ga0495671_0126295_751_1182 141
642 3300046694 Ga0495649_0507251 Ga0495649_0507251_148_573 141
643 3300047321 Ga0495676_0022259 Ga0495676_0022259_182_607 141
644 3300047323 Ga0495683_0090983 Ga0495683_0090983_151_576 141
645 3300047323 Ga0495683_0343601 Ga0495683_0343601_74_505 141
646 3300047443 Ga0495687_161356 Ga0495687_161356_157_582 141
647 3300047469 Ga0495673_0104426 Ga0495673_0104426_73_498 141
648 3300047469 Ga0495673_0244169 Ga0495673_0244169_178_603 141
649 3300047673 Ga0495593_0415253 Ga0495593_0415253_220_645 141
650 3300048903 Ga0496100_0038877 Ga0496100_0038877_2551_2976 141
651 3300048903 Ga0496100_0236171 Ga0496100_0236171_649_1074 141
652 3300048904 Ga0496101_0004589 Ga0496101_0004589_320_745 141
653 3300048904 Ga0496101_0164972 Ga0496101_0164972_316_747 141
654 3300048904 Ga0496101_1286975 Ga0496101_1286975_21_446 141
655 3300048905 Ga0496102_0011208 Ga0496102_0011208_581_1006 141
656 3300048905 Ga0496102_0290004 Ga0496102_0290004_801_1226 141
657 3300048906 Ga0496103_0015983 Ga0496103_0015983_1406_1831 141
658 3300048906 Ga0496103_0188362 Ga0496103_0188362_861_1286 141
659 3300048907 Ga0496104_0181876 Ga0496104_0181876_324_749 141
660 3300048907 Ga0496104_0217293 Ga0496104_0217293_1075_1500 141
661 3300048907 Ga0496104_0291448 Ga0496104_0291448_1090_1515 141
662 3300048908 Ga0496105_0010764 Ga0496105_0010764_324_749 141
663 3300048908 Ga0496105_0043497 Ga0496105_0043497_1619_2050 141
664 3300048908 Ga0496105_0151854 Ga0496105_0151854_388_813 141
665 3300048908 Ga0496105_0484640 Ga0496105_0484640_391_816 141
666 3300048908 Ga0496105_0603594 Ga0496105_0603594_391_816 141
667 3300048908 Ga0496105_1293804 Ga0496105_1293804_61_486 141
668 3300048909 Ga0496106_0124532 Ga0496106_0124532_1553_1984 141
669 3300048909 Ga0496106_0271628 Ga0496106_0271628_653_1078 141
670 3300048910 Ga0496107_0056643 Ga0496107_0056643_995_1420 141
671 3300048910 Ga0496107_0576935 Ga0496107_0576935_319_750 141
672 3300048911 Ga0496108_0012633 Ga0496108_0012633_113_538 141
673 3300048911 Ga0496108_0238582 Ga0496108_0238582_1073_1498 141
674 3300048911 Ga0496108_0326690 Ga0496108_0326690_520_945 141
675 3300048912 Ga0496109_0036006 Ga0496109_0036006_1077_1502 141
676 3300048912 Ga0496109_0315724 Ga0496109_0315724_730_1155 141
677 3300048912 Ga0496109_0379127 Ga0496109_0379127_635_1066 141
678 3300048913 Ga0496110_0022139 Ga0496110_0022139_3894_4319 141
679 3300048913 Ga0496110_0072136 Ga0496110_0072136_1513_1944 141
680 3300048913 Ga0496110_0888016 Ga0496110_0888016_178_603 141
681 3300048914 Ga0496111_0007468 Ga0496111_0007468_6011_6436 141
682 3300048915 Ga0496112_0075775 Ga0496112_0075775_324_749 141
683 3300048915 Ga0496112_0212718 Ga0496112_0212718_1118_1543 141
684 3300048915 Ga0496112_0525721 Ga0496112_0525721_419_844 141
685 3300048916 Ga0496113_0205460 Ga0496113_0205460_700_1125 141
686 3300048916 Ga0496113_0430942 Ga0496113_0430942_336_761 141
687 3300048917 Ga0496114_0009386 Ga0496114_0009386_4740_5165 141
688 3300048917 Ga0496114_0075322 Ga0496114_0075322_1089_1520 141
689 3300048918 Ga0496115_0233276 Ga0496115_0233276_803_1234 141
690 3300048918 Ga0496115_0762794 Ga0496115_0762794_172_597 141
691 3300048918 Ga0496115_1014940 Ga0496115_1014940_86_511 141
692 3300048919 Ga0496116_0047230 Ga0496116_0047230_2434_2859 141
693 3300048919 Ga0496116_0275111 Ga0496116_0275111_306_737 141
694 3300048920 Ga0496117_0228904 Ga0496117_0228904_386_811 141
695 3300048921 Ga0496118_0024558 Ga0496118_0024558_1301_1732 141
696 3300048922 Ga0496119_0122871 Ga0496119_0122871_266_691 141
697 3300048923 Ga0496120_0214489 Ga0496120_0214489_353_778 141
698 3300048924 Ga0496121_0046077 Ga0496121_0046077_692_1123 141
699 3300048925 Ga0496122_0318247 Ga0496122_0318247_95_520 141
700 3300048927 Ga0496124_0384566 Ga0496124_0384566_393_818 141
701 3300048928 Ga0496125_0164900 Ga0496125_0164900_688_1113 141
702 3300048928 Ga0496125_0179400 Ga0496125_0179400_718_1143 141
703 3300048929 Ga0496126_0096161 Ga0496126_0096161_99_524 141
704 3300048929 Ga0496126_0101996 Ga0496126_0101996_1418_1843 141
705 3300048929 Ga0496126_0250191 Ga0496126_0250191_895_1326 141
706 3300049460 Ga0495682_0123722 Ga0495682_0123722_114_539 141
707 3300049460 Ga0495682_0207770 Ga0495682_0207770_202_627 141
708 3300050490 nmdc:mga03n38_511818_c1 nmdc:mga03n38_511818_c1_101_526 141
709 3300050492 nmdc:mga0yw44_1061758_c1 nmdc:mga0yw44_1061758_c1_106_531 141
710 3300050492 nmdc:mga0yw44_57930_c1 nmdc:mga0yw44_57930_c1_1871_2302 141
711 3300050492 nmdc:mga0yw44_99120_c1 nmdc:mga0yw44_99120_c1_759_1184 141
712 3300050493 nmdc:mga0k408_125429_c1 nmdc:mga0k408_125429_c1_883_1308 141
713 3300050494 nmdc:mga06z11_119875_c1 nmdc:mga06z11_119875_c1_992_1417 141
714 3300050508 nmdc:mga09592_241064_c1 nmdc:mga09592_241064_c1_294_719 141
715 3300050509 nmdc:mga0qj67_105304_c1 nmdc:mga0qj67_105304_c1_1558_1983 141
716 3300050510 nmdc:mga06r32_119839_c1 nmdc:mga06r32_119839_c1_28_453 141
717 3300050510 nmdc:mga06r32_54616_c1 nmdc:mga06r32_54616_c1_2791_3216 141
718 3300050511 nmdc:mga08y16_391967_c1 nmdc:mga08y16_391967_c1_681_1106 141
719 3300050511 nmdc:mga08y16_83147_c1 nmdc:mga08y16_83147_c1_2791_3216 141
720 3300050512 nmdc:mga0n895_137295_c1 nmdc:mga0n895_137295_c1_1579_2004 141
721 3300050512 nmdc:mga0n895_253520_c1 nmdc:mga0n895_253520_c1_1044_1469 141
722 3300050512 nmdc:mga0n895_351632_c1 nmdc:mga0n895_351632_c1_181_606 141
723 3300050512 nmdc:mga0n895_371392_c1 nmdc:mga0n895_371392_c1_425_850 141
724 3300050513 nmdc:mga0rr50_886470_c1 nmdc:mga0rr50_886470_c1_230_655 141
725 3300050514 nmdc:mga08x19_603155_c1 nmdc:mga08x19_603155_c1_234_659 141
726 3300050515 nmdc:mga0a205_573520_c1 nmdc:mga0a205_573520_c1_180_605 141
727 3300050516 nmdc:mga0sz30_194346_c1 nmdc:mga0sz30_194346_c1_62_487 141
728 3300050516 nmdc:mga0sz30_92231_c1 nmdc:mga0sz30_92231_c1_801_1226 141
729 3300053083 Ga0495655_0091952 Ga0495655_0091952_232_657 141
730 3300053085 Ga0495619_0000197 Ga0495619_0000197_6945_7370 141
731 3300053086 Ga0500578_0111265 Ga0500578_0111265_579_1004 141
732 3300053093 Ga0500651_0038651 Ga0500651_0038651_1095_1520 141
733 3300053109 Ga0500569_000906 Ga0500569_000906_890_1315 141
734 3300053119 Ga0500595_007843 Ga0500595_007843_214_639 141
735 3300053123 Ga0500614_049860 Ga0500614_049860_153_581 141
736 3300053134 Ga0500658_0153128 Ga0500658_0153128_55_480 141
737 3300053142 Ga0500577_0066161 Ga0500577_0066161_303_728 141
738 3300053146 Ga0500588_0030651 Ga0500588_0030651_101_526 141
739 3300055283 Ga0500661_006184 Ga0500661_006184_396_821 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

7

84

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c1r-assembly1.cif.gz_E resting state homomeric glua2 f231a mutant ampa receptor in complex with tarp gamma-2 0.649 53 115
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.4789 7 115
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.4781 2 115
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.4687 7 114
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.459 2 115
ID Description Score Start End Superfamily
af_Q9LSW5_1_134_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.814 1 116 1.20.120.550
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.773 3 115 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7594 11 108 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.745 6 115 1.10.10.1740
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7422 3 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A3D5CZY7-F1-model_v4 DoxX family protein 0.9957 5 126 GO:0005886
AF-A0A6A7YDW1-F1-model_v4 DoxX family membrane protein 0.9938 3 126 GO:0005886
AF-A0A6I3T101-F1-model_v4 DoxX family membrane protein 0.9935 4 137 GO:0005886
AF-A0A840YS47-F1-model_v4 Putative oxidoreductase 0.9929 7 126 GO:0005886
AF-A0A1G8DHB0-F1-model_v4 deleted 0.9928 3 129

Feature Viewer

pLDDT pTM Quality
92.91 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map