F478248

General Info

Members Datasets Scaffolds Average Seq Length
736 224 1472 84

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100168717|Ga0070668_1001687173
Length 94
Sequence MRAVILILIVAXXXILAGVVTGFININQIRGAQAPAISATHNGVVAKGGQTPAFDVETGSVEVGTRNATVKIPALEVKPPAETNTAAANQVNGM

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100168717 3300005347 Bacteria 1780
2 JGI24736J21556_1015145 3300001904 Bacteria 1237
3 JGI24741J21665_1033029 3300001915 Bacteria 771
4 JGI24752J21851_1018093 3300001976 Bacteria 919
5 JGI24752J21851_1054327 3300001976 Bacteria 547
6 JGI24740J21852_10009578 3300001979 Bacteria 3782
7 JGI24740J21852_10018108 3300001979 Bacteria 2507
8 JGI24740J21852_10033611 3300001979 Bacteria 1625
9 JGI24740J21852_10121633 3300001979 Bacteria 654
10 JGI24739J22299_10000785 3300001989 Bacteria 11588
11 JGI24739J22299_10006018 3300001989 Bacteria 4592
12 JGI24737J22298_10001142 3300001990 Bacteria 9352
13 JGI24737J22298_10018227 3300001990 Bacteria 2254
14 JGI24737J22298_10130304 3300001990 Bacteria 743
15 JGI24743J22301_10013283 3300001991 Bacteria 1507
16 JGI24743J22301_10021525 3300001991 Bacteria 1232
17 JGI24735J21928_10047770 3300002067 Bacteria 1240
18 JGI24735J21928_10132039 3300002067 Unclassified 720
19 JGI24735J21928_10237294 3300002067 Bacteria 531
20 JGI24738J21930_10001221 3300002075 Bacteria 7217
21 JGI24738J21930_10008723 3300002075 Bacteria 2300
22 JGI24738J21930_10052120 3300002075 Bacteria 835
23 JGI24035J26624_1014281 3300002126 Bacteria 810
24 JGI24742J22300_10027506 3300002244 Bacteria 986
25 rootH2_10297945 3300003320 Bacteria 1680
26 Ga0070658_10017631 3300005327 Bacteria 5711
27 Ga0070658_10116471 3300005327 Bacteria 2217
28 Ga0070658_10145087 3300005327 Bacteria 1984
29 Ga0070658_10560923 3300005327 Bacteria 988
30 Ga0070658_10724325 3300005327 Bacteria 864
31 Ga0070676_10008273 3300005328 Bacteria 5601
32 Ga0070676_10020742 3300005328 Bacteria 3673
33 Ga0070676_10091760 3300005328 Bacteria 1862
34 Ga0070676_10953592 3300005328 Bacteria 642
35 Ga0070683_100653479 3300005329 Bacteria 1007
36 Ga0070683_100886629 3300005329 Bacteria 856
37 Ga0070690_100031336 3300005330 Bacteria 3312
38 Ga0070690_101576543 3300005330 Bacteria 532
39 Ga0070670_100015599 3300005331 Bacteria 6525
40 Ga0070670_100085570 3300005331 Bacteria 2709
41 Ga0070670_100816371 3300005331 Bacteria 843
42 Ga0070670_101718817 3300005331 Unclassified 577
43 Ga0070677_10047120 3300005333 Bacteria 1727
44 Ga0068869_100001204 3300005334 Bacteria 15210
45 Ga0068869_100034373 3300005334 Bacteria 3585
46 Ga0068869_100048277 3300005334 Bacteria 3077
47 Ga0068869_100217301 3300005334 Bacteria 1514
48 Ga0068869_100298725 3300005334 Bacteria 1300
49 Ga0068869_102070681 3300005334 Bacteria 511
50 Ga0070666_10003007 3300005335 Bacteria 10225
51 Ga0070666_10059542 3300005335 Bacteria 2583
52 Ga0070666_10498498 3300005335 Bacteria 883
53 Ga0070666_10923724 3300005335 Bacteria 646
54 Ga0070680_100010794 3300005336 Bacteria 7051
55 Ga0070680_100599385 3300005336 Bacteria 945
56 Ga0070682_100269173 3300005337 Bacteria 1237
57 Ga0068868_100008744 3300005338 Bacteria 7253
58 Ga0068868_100123561 3300005338 Bacteria 2112
59 Ga0068868_100448678 3300005338 Bacteria 1121
60 Ga0068868_100511103 3300005338 Bacteria 1053
61 Ga0068868_100699702 3300005338 Bacteria 906
62 Ga0068868_101537625 3300005338 Bacteria 624
63 Ga0068868_102073589 3300005338 Bacteria 541
64 Ga0070660_100002605 3300005339 Bacteria 12382
65 Ga0070660_100006738 3300005339 Bacteria 7969
66 Ga0070660_100014398 3300005339 Bacteria 5695
67 Ga0070660_100029310 3300005339 Bacteria 4124
68 Ga0070660_100091991 3300005339 Bacteria 2393
69 Ga0070660_100308799 3300005339 Bacteria 1298
70 Ga0070660_100737206 3300005339 Bacteria 827
71 Ga0070660_101156715 3300005339 Bacteria 655
72 Ga0070689_100040791 3300005340 Bacteria 3560
73 Ga0070689_100402430 3300005340 Bacteria 1157
74 Ga0070689_100987982 3300005340 Unclassified 748
75 Ga0070687_100975503 3300005343 Bacteria 613
76 Ga0070661_100025966 3300005344 Bacteria 4210
77 Ga0070661_100262111 3300005344 Bacteria 1336
78 Ga0070661_100277863 3300005344 Bacteria 1298
79 Ga0070661_100304353 3300005344 Bacteria 1242
80 Ga0070661_101177206 3300005344 Bacteria 641
81 Ga0070661_101231342 3300005344 Bacteria 626
82 Ga0070692_10071022 3300005345 Bacteria 1855
83 Ga0070668_100003013 3300005347 Bacteria 12454
84 Ga0070668_100028225 3300005347 Bacteria 4261
85 Ga0070668_100695227 3300005347 Bacteria 896
86 Ga0070668_100743953 3300005347 Bacteria 867
87 Ga0070668_100807679 3300005347 Bacteria 834
88 Ga0070668_101368477 3300005347 Bacteria 645
89 Ga0070669_100000586 3300005353 Bacteria 27126
90 Ga0070669_100087092 3300005353 Bacteria 2335
91 Ga0070669_100113200 3300005353 Bacteria 2061
92 Ga0070669_100729304 3300005353 Bacteria 838
93 Ga0070669_101055105 3300005353 Bacteria 699
94 Ga0070669_101804839 3300005353 Unclassified 534
95 Ga0070675_100042818 3300005354 Bacteria 3700
96 Ga0070675_100565191 3300005354 Bacteria 1029
97 Ga0070675_101360233 3300005354 Bacteria 655
98 Ga0070671_100067691 3300005355 Bacteria 2977
99 Ga0070671_100068626 3300005355 Bacteria 2957
100 Ga0070671_100288857 3300005355 Bacteria 1395
101 Ga0070671_100561522 3300005355 Bacteria 985
102 Ga0070671_100566183 3300005355 Bacteria 980
103 Ga0070671_100585952 3300005355 Bacteria 963
104 Ga0070671_101284805 3300005355 Bacteria 645
105 Ga0070674_100006182 3300005356 Bacteria 6964
106 Ga0070674_100100545 3300005356 Bacteria 2105
107 Ga0070674_101410359 3300005356 Bacteria 624
108 Ga0070673_100002689 3300005364 Bacteria 10890
109 Ga0070673_100005010 3300005364 Bacteria 8447
110 Ga0070673_100013723 3300005364 Bacteria 5617
111 Ga0070673_100250537 3300005364 Bacteria 1543
112 Ga0070673_101295462 3300005364 Bacteria 684
113 Ga0070659_100001641 3300005366 Bacteria 16121
114 Ga0070659_100002860 3300005366 Bacteria 12286
115 Ga0070659_100080812 3300005366 Bacteria 2595
116 Ga0070659_100125924 3300005366 Bacteria 2078
117 Ga0070659_100360929 3300005366 Bacteria 1220
118 Ga0070659_100509315 3300005366 Bacteria 1027
119 Ga0070659_100944245 3300005366 Bacteria 755
120 Ga0070659_100972748 3300005366 Bacteria 744
121 Ga0070659_101617263 3300005366 Bacteria 579
122 Ga0070667_100003196 3300005367 Bacteria 14038
123 Ga0070667_100004953 3300005367 Bacteria 11156
124 Ga0070667_100012116 3300005367 Bacteria 7138
125 Ga0070667_100014809 3300005367 Bacteria 6442
126 Ga0070667_100097461 3300005367 Bacteria 2536
127 Ga0070667_100300476 3300005367 Bacteria 1445
128 Ga0070667_100305468 3300005367 Bacteria 1433
129 Ga0070667_100414461 3300005367 Bacteria 1227
130 Ga0070667_101024475 3300005367 Bacteria 770
131 Ga0070667_101896432 3300005367 Bacteria 561
132 Ga0070701_10310311 3300005438 Bacteria 973
133 Ga0070694_100021250 3300005444 Bacteria 4144
134 Ga0070663_100003510 3300005455 Bacteria 9053
135 Ga0070663_100014290 3300005455 Bacteria 5093
136 Ga0070663_100024805 3300005455 Bacteria 4040
137 Ga0070663_100283541 3300005455 Bacteria 1321
138 Ga0070663_100337445 3300005455 Bacteria 1217
139 Ga0070678_101232779 3300005456 Bacteria 694
140 Ga0070662_100002851 3300005457 Bacteria 10717
141 Ga0070662_100006598 3300005457 Bacteria 7491
142 Ga0070662_100033399 3300005457 Bacteria 3622
143 Ga0070662_100051215 3300005457 Bacteria 2981
144 Ga0070662_100136726 3300005457 Bacteria 1895
145 Ga0070662_100390056 3300005457 Bacteria 1147
146 Ga0070662_101918701 3300005457 Bacteria 512
147 Ga0070681_10043355 3300005458 Bacteria 4507
148 Ga0070681_10131832 3300005458 Bacteria 2431
149 Ga0068867_100001360 3300005459 Bacteria 16886
150 Ga0068867_100052811 3300005459 Bacteria 3000
151 Ga0068867_100216397 3300005459 Bacteria 1541
152 Ga0068867_101282437 3300005459 Bacteria 676
153 Ga0070685_10879079 3300005466 Bacteria 666
154 Ga0070706_100483576 3300005467 Bacteria 1152
155 Ga0070698_101285119 3300005471 Bacteria 682
156 Ga0070679_100004912 3300005530 Bacteria 12333
157 Ga0070679_100186597 3300005530 Bacteria 2044
158 Ga0070679_101576250 3300005530 Bacteria 604
159 Ga0070684_100088262 3300005535 Bacteria 2755
160 Ga0070684_100618231 3300005535 Bacteria 1008
161 Ga0068853_100002189 3300005539 Bacteria 14573
162 Ga0068853_100084913 3300005539 Bacteria 2775
163 Ga0068853_100218562 3300005539 Bacteria 1739
164 Ga0068853_100434672 3300005539 Bacteria 1233
165 Ga0068853_100560577 3300005539 Bacteria 1083
166 Ga0068853_100830789 3300005539 Bacteria 885
167 Ga0068853_100979752 3300005539 Bacteria 813
168 Ga0068853_102016721 3300005539 Bacteria 559
169 Ga0068853_102224166 3300005539 Unclassified 532
170 Ga0070672_100001067 3300005543 Bacteria 16705
171 Ga0070672_100078686 3300005543 Bacteria 2638
172 Ga0070672_100277165 3300005543 Bacteria 1417
173 Ga0070672_100390007 3300005543 Bacteria 1192
174 Ga0070672_101086427 3300005543 Bacteria 711
175 Ga0070686_100291723 3300005544 Bacteria 1207
176 Ga0070686_101087710 3300005544 Bacteria 660
177 Ga0070686_101676127 3300005544 Unclassified 539
178 Ga0070695_100115228 3300005545 Bacteria 1831
179 Ga0070695_100204124 3300005545 Bacteria 1414
180 Ga0070693_100303574 3300005547 Bacteria 1077
181 Ga0070693_100527754 3300005547 Bacteria 842
182 Ga0070693_100926373 3300005547 Bacteria 654
183 Ga0070665_100001939 3300005548 Bacteria 23328
184 Ga0070665_100014501 3300005548 Bacteria 7905
185 Ga0070665_100074258 3300005548 Bacteria 3406
186 Ga0070665_100209510 3300005548 Bacteria 1950
187 Ga0070665_100484472 3300005548 Unclassified 1248
188 Ga0070665_100503439 3300005548 Bacteria 1222
189 Ga0070665_100821302 3300005548 Bacteria 943
190 Ga0070665_101347269 3300005548 Bacteria 723
191 Ga0070704_100192739 3300005549 Bacteria 1639
192 Ga0070704_101527244 3300005549 Bacteria 615
193 Ga0068855_100002788 3300005563 Bacteria 21511
194 Ga0068855_100093698 3300005563 Bacteria 3463
195 Ga0068855_100416806 3300005563 Bacteria 1469
196 Ga0068855_100546182 3300005563 Bacteria 1255
197 Ga0068855_100943014 3300005563 Bacteria 909
198 Ga0068855_102453227 3300005563 Bacteria 520
199 Ga0070664_100003372 3300005564 Bacteria 12910
200 Ga0070664_100038219 3300005564 Bacteria 4040
201 Ga0070664_100069607 3300005564 Bacteria 3011
202 Ga0070664_100126821 3300005564 Bacteria 2239
203 Ga0070664_100853780 3300005564 Bacteria 852
204 Ga0070664_101008555 3300005564 Bacteria 783
205 Ga0070664_101638529 3300005564 Bacteria 610
206 Ga0070664_101683974 3300005564 Bacteria 601
207 Ga0068857_100000338 3300005577 Bacteria 32330
208 Ga0068857_100014073 3300005577 Bacteria 6962
209 Ga0068857_100246891 3300005577 Bacteria 1635
210 Ga0068857_100308927 3300005577 Bacteria 1458
211 Ga0068857_100477113 3300005577 Bacteria 1168
212 Ga0068857_100515326 3300005577 Bacteria 1123
213 Ga0068854_100003108 3300005578 Bacteria 10326
214 Ga0068854_100006902 3300005578 Bacteria 7242
215 Ga0068854_100059254 3300005578 Bacteria 2766
216 Ga0068854_100170890 3300005578 Bacteria 1691
217 Ga0068854_100235415 3300005578 Bacteria 1456
218 Ga0068854_100330666 3300005578 Bacteria 1241
219 Ga0068854_101806389 3300005578 Bacteria 560
220 Ga0068856_100028278 3300005614 Bacteria 5474
221 Ga0068856_100097343 3300005614 Bacteria 2931
222 Ga0068856_101805013 3300005614 Unclassified 623
223 Ga0068856_102650044 3300005614 Unclassified 507
224 Ga0068852_100001883 3300005616 Bacteria 14288
225 Ga0068852_100015749 3300005616 Bacteria 5878
226 Ga0068852_100046139 3300005616 Bacteria 3711
227 Ga0068852_100121895 3300005616 Bacteria 2389
228 Ga0068852_100141530 3300005616 Bacteria 2227
229 Ga0068852_100534982 3300005616 Bacteria 1170
230 Ga0068852_101176980 3300005616 Bacteria 788
231 Ga0068852_101346136 3300005616 Bacteria 736
232 Ga0068859_100000464 3300005617 Bacteria 40106
233 Ga0068859_100006502 3300005617 Bacteria 11862
234 Ga0068859_100028717 3300005617 Bacteria 5577
235 Ga0068859_100048792 3300005617 Bacteria 4253
236 Ga0068859_100064789 3300005617 Bacteria 3687
237 Ga0068859_100073920 3300005617 Bacteria 3447
238 Ga0068859_100295664 3300005617 Bacteria 1712
239 Ga0068859_100682089 3300005617 Bacteria 1119
240 Ga0068864_100001187 3300005618 Bacteria 21670
241 Ga0068864_100003779 3300005618 Bacteria 12491
242 Ga0068864_100003818 3300005618 Bacteria 12421
243 Ga0068864_100839698 3300005618 Bacteria 905
244 Ga0068864_101371688 3300005618 Bacteria 708
245 Ga0068866_10031388 3300005718 Bacteria 2559
246 Ga0068866_10336468 3300005718 Bacteria 955
247 Ga0068866_11005399 3300005718 Bacteria 593
248 Ga0068861_100218372 3300005719 Bacteria 1610
249 Ga0068861_100902103 3300005719 Bacteria 837
250 Ga0068851_10045519 3300005834 Bacteria 2218
251 Ga0068851_10054535 3300005834 Bacteria 2036
252 Ga0068851_10098632 3300005834 Unclassified 1547
253 Ga0068851_10197765 3300005834 Bacteria 1121
254 Ga0068851_10480435 3300005834 Bacteria 743
255 Ga0068870_10147950 3300005840 Bacteria 1381
256 Ga0068870_10446543 3300005840 Bacteria 852
257 Ga0068863_100004975 3300005841 Bacteria 13100
258 Ga0068863_100007097 3300005841 Bacteria 10983
259 Ga0068863_100007450 3300005841 Bacteria 10711
260 Ga0068863_100034651 3300005841 Bacteria 4808
261 Ga0068863_100049793 3300005841 Bacteria 3972
262 Ga0068863_100050771 3300005841 Bacteria 3931
263 Ga0068863_100123913 3300005841 Bacteria 2465
264 Ga0068863_100849983 3300005841 Bacteria 911
265 Ga0068863_101539272 3300005841 Bacteria 674
266 Ga0068863_101737903 3300005841 Bacteria 633
267 Ga0068858_100009768 3300005842 Bacteria 9133
268 Ga0068858_100028517 3300005842 Bacteria 5185
269 Ga0068858_100059866 3300005842 Bacteria 3520
270 Ga0068858_100098881 3300005842 Bacteria 2720
271 Ga0068860_100004974 3300005843 Bacteria 13548
272 Ga0068860_100008094 3300005843 Bacteria 10470
273 Ga0068860_100009092 3300005843 Bacteria 9886
274 Ga0068860_100079423 3300005843 Bacteria 3119
275 Ga0068860_100155529 3300005843 Bacteria 2203
276 Ga0068860_100516896 3300005843 Bacteria 1194
277 Ga0068860_100942125 3300005843 Bacteria 880
278 Ga0068860_102557939 3300005843 Unclassified 530
279 Ga0068862_100001250 3300005844 Bacteria 23893
280 Ga0068862_100007782 3300005844 Bacteria 8860
281 Ga0068862_100034633 3300005844 Bacteria 4274
282 Ga0068862_100035570 3300005844 Bacteria 4219
283 Ga0068862_100118485 3300005844 Bacteria 2331
284 Ga0068862_100606591 3300005844 Bacteria 1051
285 Ga0068862_101112347 3300005844 Bacteria 785
286 Ga0068862_101748858 3300005844 Unclassified 630
287 Ga0068862_101777580 3300005844 Bacteria 625
288 Ga0068862_102301192 3300005844 Bacteria 550
289 Ga0070712_100236274 3300006175 Bacteria 1454
290 Ga0097621_100021949 3300006237 Bacteria 4947
291 Ga0097621_100219468 3300006237 Bacteria 1656
292 Ga0097621_100464766 3300006237 Bacteria 1142
293 Ga0097621_100640282 3300006237 Bacteria 975
294 Ga0068871_100031738 3300006358 Bacteria 4168
295 Ga0068871_100175044 3300006358 Bacteria 1841
296 Ga0068871_100222578 3300006358 Bacteria 1635
297 Ga0075428_100132666 3300006844 Bacteria 2709
298 Ga0075428_101920093 3300006844 Bacteria 615
299 Ga0075431_100666754 3300006847 Bacteria 1020
300 Ga0075433_10056610 3300006852 Bacteria 3425
301 Ga0075433_10140138 3300006852 Bacteria 2149
302 Ga0075433_11523278 3300006852 Bacteria 577
303 Ga0075434_100259265 3300006871 Bacteria 1757
304 Ga0075429_100380701 3300006880 Bacteria 1235
305 Ga0068865_100010731 3300006881 Bacteria 5710
306 Ga0068865_100145241 3300006881 Bacteria 1793
307 Ga0068865_100337699 3300006881 Bacteria 1217
308 Ga0068865_100531960 3300006881 Bacteria 984
309 Ga0097620_100000464 3300006931 Bacteria 40106
310 Ga0097620_100006502 3300006931 Bacteria 11862
311 Ga0097620_100028716 3300006931 Bacteria 5577
312 Ga0097620_100048792 3300006931 Bacteria 4253
313 Ga0097620_100064791 3300006931 Bacteria 3687
314 Ga0097620_100073918 3300006931 Bacteria 3447
315 Ga0097620_100295663 3300006931 Bacteria 1712
316 Ga0097620_100682037 3300006931 Bacteria 1119
317 Ga0075435_100252293 3300007076 Bacteria 1502
318 Ga0075435_100578202 3300007076 Bacteria 974
319 Ga0105244_10106757 3300009036 Bacteria 1366
320 Ga0105244_10377216 3300009036 Bacteria 653
321 Ga0111539_10297835 3300009094 Bacteria 1877
322 Ga0111539_10981917 3300009094 Bacteria 982
323 Ga0105245_10000128 3300009098 Bacteria 72249
324 Ga0105245_10154113 3300009098 Bacteria 2175
325 Ga0105245_12067619 3300009098 Bacteria 623
326 Ga0105247_10176916 3300009101 Bacteria 1422
327 Ga0105247_10574713 3300009101 Bacteria 832
328 Ga0114129_11086856 3300009147 Bacteria 1002
329 Ga0105243_10137854 3300009148 Bacteria 2078
330 Ga0105243_10218137 3300009148 Bacteria 1684
331 Ga0105243_11043081 3300009148 Bacteria 823
332 Ga0105241_10011856 3300009174 Bacteria 6404
333 Ga0105242_10352834 3300009176 Bacteria 1359
334 Ga0105242_11367534 3300009176 Bacteria 734
335 Ga0105248_10000787 3300009177 Bacteria 35583
336 Ga0105248_10013511 3300009177 Bacteria 8989
337 Ga0105248_10031888 3300009177 Bacteria 5888
338 Ga0105248_10044913 3300009177 Bacteria 4955
339 Ga0105248_10604791 3300009177 Bacteria 1237
340 Ga0105237_10047994 3300009545 Bacteria 4293
341 Ga0105237_10306817 3300009545 Bacteria 1590
342 Ga0105238_10012788 3300009551 Bacteria 8470
343 Ga0105238_10804733 3300009551 Bacteria 955
344 Ga0105249_10008508 3300009553 Bacteria 8945
345 Ga0105249_10239906 3300009553 Bacteria 1792
346 Ga0105249_10299483 3300009553 Bacteria 1612
347 Ga0105249_10429074 3300009553 Bacteria 1357
348 Ga0105249_12530564 3300009553 Bacteria 586
349 Ga0105249_12677434 3300009553 Unclassified 571
350 Ga0105249_13046824 3300009553 Bacteria 538
351 Ga0105239_10177613 3300010375 Bacteria 2382
352 Ga0105239_10271087 3300010375 Bacteria 1909
353 Ga0105246_10036675 3300011119 Bacteria 3286
354 Ga0105246_10117371 3300011119 Bacteria 1966
355 Ga0105246_10172663 3300011119 Bacteria 1657
356 Ga0105246_10450745 3300011119 Bacteria 1081
357 Ga0105246_10579360 3300011119 Bacteria 966
358 Ga0105246_10704666 3300011119 Bacteria 885
359 Ga0157373_10014869 3300013100 Bacteria 5699
360 Ga0157373_10060298 3300013100 Bacteria 2688
361 Ga0157373_10062139 3300013100 Bacteria 2645
362 Ga0157373_10654571 3300013100 Bacteria 767
363 Ga0157371_10007577 3300013102 Bacteria 8760
364 Ga0157371_10031977 3300013102 Bacteria 3789
365 Ga0157371_10037525 3300013102 Bacteria 3467
366 Ga0157371_10113510 3300013102 Bacteria 1924
367 Ga0157371_10885696 3300013102 Bacteria 676
368 Ga0157371_11093746 3300013102 Bacteria 611
369 Ga0157370_10048370 3300013104 Bacteria 4074
370 Ga0157370_10657907 3300013104 Bacteria 957
371 Ga0157370_10901727 3300013104 Bacteria 802
372 Ga0157369_10109826 3300013105 Bacteria 2932
373 Ga0157369_10549862 3300013105 Bacteria 1193
374 Ga0157378_10007423 3300013297 Bacteria 9576
375 Ga0157378_10168760 3300013297 Bacteria 2051
376 Ga0157378_10375007 3300013297 Bacteria 1396
377 Ga0157378_10878181 3300013297 Bacteria 926
378 Ga0163162_10022111 3300013306 Bacteria 6267
379 Ga0163162_10234721 3300013306 Bacteria 1965
380 Ga0163162_10400697 3300013306 Bacteria 1505
381 Ga0163162_10900472 3300013306 Bacteria 998
382 Ga0163162_11777484 3300013306 Bacteria 705
383 Ga0157372_11179556 3300013307 Bacteria 885
384 Ga0157372_11192458 3300013307 Bacteria 880
385 Ga0157375_10026499 3300013308 Bacteria 5403
386 Ga0157375_10040957 3300013308 Bacteria 4469
387 Ga0157375_10108900 3300013308 Bacteria 2866
388 Ga0157375_10564883 3300013308 Bacteria 1299
389 Ga0157375_11336136 3300013308 Bacteria 843
390 Ga0157375_11976976 3300013308 Bacteria 693
391 Ga0163163_10000139 3300014325 Bacteria 75197
392 Ga0163163_10045228 3300014325 Bacteria 4320
393 Ga0157380_12020882 3300014326 Bacteria 638
394 Ga0182008_10069146 3300014497 Bacteria 1738
395 Ga0182008_10270464 3300014497 Bacteria 881
396 Ga0157377_10020172 3300014745 Bacteria 3489
397 Ga0157377_10058180 3300014745 Bacteria 2200
398 Ga0157379_10026509 3300014968 Bacteria 5160
399 Ga0157379_10026587 3300014968 Bacteria 5151
400 Ga0157379_10078498 3300014968 Bacteria 2957
401 Ga0163161_10510894 3300017792 Bacteria 980
402 Ga0163161_10874515 3300017792 Bacteria 760
403 Ga0197907_11290166 3300020069 Bacteria 747
404 Ga0206355_1258189 3300020076 Bacteria 734
405 Ga0206352_11197090 3300020078 Bacteria 1856
406 Ga0206354_10717950 3300020081 Bacteria 663
407 Ga0213875_10009679 3300021388 Bacteria 4867
408 Ga0207673_1007719 3300025290 Bacteria 1353
409 Ga0207697_10000461 3300025315 Bacteria 22887
410 Ga0207697_10122451 3300025315 Bacteria 1120
411 Ga0207656_10072929 3300025321 Unclassified 1529
412 Ga0207656_10232937 3300025321 Unclassified 898
413 Ga0207696_1005162 3300025711 Bacteria 5472
414 Ga0207682_10173507 3300025893 Bacteria 982
415 Ga0207642_10067709 3300025899 Bacteria 1686
416 Ga0207642_10298716 3300025899 Bacteria 933
417 Ga0207710_10144734 3300025900 Bacteria 1149
418 Ga0207710_10472147 3300025900 Bacteria 649
419 Ga0207688_10000063 3300025901 Bacteria 38711
420 Ga0207688_10012303 3300025901 Bacteria 4656
421 Ga0207688_10076135 3300025901 Bacteria 1911
422 Ga0207688_10217450 3300025901 Bacteria 1150
423 Ga0207688_10791257 3300025901 Bacteria 601
424 Ga0207688_10878023 3300025901 Unclassified 568
425 Ga0207680_10251329 3300025903 Bacteria 1221
426 Ga0207647_10000227 3300025904 Bacteria 46631
427 Ga0207647_10006423 3300025904 Bacteria 8544
428 Ga0207647_10014777 3300025904 Bacteria 5370
429 Ga0207647_10090138 3300025904 Bacteria 1830
430 Ga0207647_10175252 3300025904 Bacteria 1248
431 Ga0207645_10009859 3300025907 Bacteria 6583
432 Ga0207645_10020369 3300025907 Bacteria 4342
433 Ga0207645_10092914 3300025907 Bacteria 1941
434 Ga0207645_10252259 3300025907 Bacteria 1167
435 Ga0207645_11072529 3300025907 Unclassified 544
436 Ga0207705_10004232 3300025909 Bacteria 10869
437 Ga0207705_10048365 3300025909 Bacteria 3059
438 Ga0207705_10167437 3300025909 Bacteria 1653
439 Ga0207705_10238556 3300025909 Bacteria 1384
440 Ga0207705_10375616 3300025909 Bacteria 1098
441 Ga0207705_10623082 3300025909 Bacteria 839
442 Ga0207654_10089809 3300025911 Bacteria 1870
443 Ga0207707_10039018 3300025912 Bacteria 4152
444 Ga0207695_10820461 3300025913 Bacteria 810
445 Ga0207671_10069577 3300025914 Bacteria 2623
446 Ga0207671_10994931 3300025914 Bacteria 661
447 Ga0207693_10072852 3300025915 Bacteria 2689
448 Ga0207660_10022784 3300025917 Bacteria 4222
449 Ga0207660_10612226 3300025917 Bacteria 887
450 Ga0207662_10743359 3300025918 Bacteria 689
451 Ga0207662_10913668 3300025918 Bacteria 622
452 Ga0207657_10001753 3300025919 Bacteria 23414
453 Ga0207657_10002137 3300025919 Bacteria 21415
454 Ga0207657_10003245 3300025919 Bacteria 17415
455 Ga0207657_10012153 3300025919 Bacteria 8507
456 Ga0207657_10112371 3300025919 Bacteria 2248
457 Ga0207657_10200427 3300025919 Bacteria 1606
458 Ga0207657_11231063 3300025919 Bacteria 568
459 Ga0207649_10027640 3300025920 Bacteria 3332
460 Ga0207649_10057874 3300025920 Bacteria 2425
461 Ga0207649_10275927 3300025920 Bacteria 1220
462 Ga0207652_10004117 3300025921 Bacteria 11871
463 Ga0207652_10184151 3300025921 Bacteria 1878
464 Ga0207652_11127827 3300025921 Unclassified 685
465 Ga0207681_10012969 3300025923 Bacteria 5151
466 Ga0207681_10020914 3300025923 Bacteria 4153
467 Ga0207681_10080967 3300025923 Bacteria 2291
468 Ga0207681_10189471 3300025923 Bacteria 1572
469 Ga0207681_10732683 3300025923 Bacteria 823
470 Ga0207681_11171997 3300025923 Bacteria 645
471 Ga0207694_10037467 3300025924 Bacteria 3725
472 Ga0207650_10068205 3300025925 Bacteria 2670
473 Ga0207650_10158034 3300025925 Bacteria 1794
474 Ga0207650_10688473 3300025925 Bacteria 863
475 Ga0207650_11615001 3300025925 Unclassified 550
476 Ga0207659_10304310 3300025926 Bacteria 1310
477 Ga0207659_10611215 3300025926 Bacteria 930
478 Ga0207687_10003689 3300025927 Bacteria 10311
479 Ga0207687_10232898 3300025927 Bacteria 1456
480 Ga0207644_10026614 3300025931 Bacteria 3987
481 Ga0207644_10047130 3300025931 Bacteria 3073
482 Ga0207644_10290188 3300025931 Bacteria 1315
483 Ga0207644_10290596 3300025931 Bacteria 1314
484 Ga0207644_10871418 3300025931 Bacteria 754
485 Ga0207644_10900391 3300025931 Bacteria 741
486 Ga0207644_10991711 3300025931 Bacteria 705
487 Ga0207644_11486788 3300025931 Bacteria 569
488 Ga0207690_10006127 3300025932 Bacteria 7128
489 Ga0207690_10024623 3300025932 Bacteria 3771
490 Ga0207690_10089215 3300025932 Bacteria 2173
491 Ga0207690_10258594 3300025932 Bacteria 1348
492 Ga0207690_10729089 3300025932 Bacteria 816
493 Ga0207690_11337276 3300025932 Bacteria 599
494 Ga0207706_10009958 3300025933 Bacteria 8711
495 Ga0207706_10072786 3300025933 Bacteria 3022
496 Ga0207706_10094862 3300025933 Bacteria 2625
497 Ga0207706_10099702 3300025933 Bacteria 2556
498 Ga0207706_10258407 3300025933 Bacteria 1521
499 Ga0207706_10644349 3300025933 Bacteria 908
500 Ga0207686_11441449 3300025934 Bacteria 567
501 Ga0207709_10082236 3300025935 Bacteria 2079
502 Ga0207709_10659633 3300025935 Bacteria 834
503 Ga0207709_11030525 3300025935 Bacteria 674
504 Ga0207670_10088723 3300025936 Bacteria 2181
505 Ga0207670_10876006 3300025936 Bacteria 751
506 Ga0207669_10015845 3300025937 Bacteria 3813
507 Ga0207669_10318408 3300025937 Bacteria 1189
508 Ga0207704_10084370 3300025938 Bacteria 2064
509 Ga0207704_10168475 3300025938 Bacteria 1568
510 Ga0207704_10258045 3300025938 Bacteria 1313
511 Ga0207704_11486464 3300025938 Bacteria 581
512 Ga0207691_10000447 3300025940 Bacteria 40805
513 Ga0207691_10044505 3300025940 Bacteria 4086
514 Ga0207691_10251295 3300025940 Bacteria 1526
515 Ga0207691_11093220 3300025940 Bacteria 663
516 Ga0207711_10000258 3300025941 Bacteria 57473
517 Ga0207711_10001621 3300025941 Bacteria 20768
518 Ga0207711_10004550 3300025941 Bacteria 11798
519 Ga0207711_10081016 3300025941 Bacteria 2836
520 Ga0207711_11128912 3300025941 Bacteria 725
521 Ga0207689_10001047 3300025942 Bacteria 26563
522 Ga0207689_10024317 3300025942 Bacteria 5084
523 Ga0207689_10028026 3300025942 Bacteria 4712
524 Ga0207689_10039645 3300025942 Bacteria 3899
525 Ga0207689_10542198 3300025942 Bacteria 977
526 Ga0207661_10027352 3300025944 Bacteria 4356
527 Ga0207661_10032500 3300025944 Bacteria 4043
528 Ga0207679_10031199 3300025945 Bacteria 3729
529 Ga0207679_10031750 3300025945 Bacteria 3700
530 Ga0207679_10149429 3300025945 Bacteria 1899
531 Ga0207679_10326738 3300025945 Bacteria 1330
532 Ga0207679_10386987 3300025945 Bacteria 1227
533 Ga0207679_10751262 3300025945 Bacteria 887
534 Ga0207667_10046456 3300025949 Bacteria 4598
535 Ga0207667_10078589 3300025949 Bacteria 3419
536 Ga0207667_10080874 3300025949 Bacteria 3366
537 Ga0207667_10159341 3300025949 Bacteria 2322
538 Ga0207667_10536556 3300025949 Bacteria 1184
539 Ga0207667_11199162 3300025949 Bacteria 739
540 Ga0207651_10008150 3300025960 Bacteria 5638
541 Ga0207651_10031999 3300025960 Bacteria 3371
542 Ga0207651_10149034 3300025960 Bacteria 1818
543 Ga0207651_10211820 3300025960 Bacteria 1560
544 Ga0207651_10278028 3300025960 Bacteria 1382
545 Ga0207651_11012190 3300025960 Bacteria 743
546 Ga0207712_10001416 3300025961 Bacteria 16364
547 Ga0207712_11207940 3300025961 Bacteria 675
548 Ga0207668_10001204 3300025972 Bacteria 15359
549 Ga0207668_10021749 3300025972 Bacteria 4094
550 Ga0207668_10293897 3300025972 Bacteria 1338
551 Ga0207668_10434240 3300025972 Bacteria 1117
552 Ga0207668_10625285 3300025972 Bacteria 940
553 Ga0207640_10003003 3300025981 Bacteria 9075
554 Ga0207640_10186118 3300025981 Bacteria 1561
555 Ga0207640_10302196 3300025981 Bacteria 1266
556 Ga0207640_10589446 3300025981 Bacteria 939
557 Ga0207640_11368537 3300025981 Bacteria 633
558 Ga0207658_10003447 3300025986 Bacteria 11189
559 Ga0207658_10005224 3300025986 Bacteria 8931
560 Ga0207658_10010721 3300025986 Bacteria 6231
561 Ga0207658_10068282 3300025986 Bacteria 2681
562 Ga0207658_10096060 3300025986 Bacteria 2310
563 Ga0207658_10101820 3300025986 Bacteria 2251
564 Ga0207658_10308767 3300025986 Bacteria 1365
565 Ga0207658_10707712 3300025986 Bacteria 910
566 Ga0207658_11197115 3300025986 Unclassified 694
567 Ga0207677_10004522 3300026023 Bacteria 7480
568 Ga0207677_10117697 3300026023 Bacteria 1992
569 Ga0207677_10232790 3300026023 Bacteria 1485
570 Ga0207703_10002385 3300026035 Bacteria 16335
571 Ga0207703_10012883 3300026035 Bacteria 6521
572 Ga0207703_10048928 3300026035 Bacteria 3415
573 Ga0207703_10080669 3300026035 Bacteria 2710
574 Ga0207703_10445710 3300026035 Bacteria 1208
575 Ga0207639_10024197 3300026041 Bacteria 4391
576 Ga0207639_10396022 3300026041 Bacteria 1243
577 Ga0207639_10428375 3300026041 Bacteria 1197
578 Ga0207639_10999097 3300026041 Bacteria 783
579 Ga0207639_11513187 3300026041 Unclassified 630
580 Ga0207639_11901681 3300026041 Unclassified 556
581 Ga0207678_10000995 3300026067 Bacteria 25820
582 Ga0207678_10005309 3300026067 Bacteria 11539
583 Ga0207678_10011714 3300026067 Bacteria 7696
584 Ga0207678_10318949 3300026067 Bacteria 1337
585 Ga0207678_10374665 3300026067 Bacteria 1230
586 Ga0207702_10081960 3300026078 Bacteria 2804
587 Ga0207702_10140829 3300026078 Bacteria 2182
588 Ga0207702_11679828 3300026078 Unclassified 628
589 Ga0207641_10000621 3300026088 Bacteria 38687
590 Ga0207641_10011295 3300026088 Bacteria 7328
591 Ga0207641_10013785 3300026088 Bacteria 6629
592 Ga0207641_10071621 3300026088 Bacteria 2982
593 Ga0207641_10128473 3300026088 Bacteria 2272
594 Ga0207641_10132511 3300026088 Bacteria 2239
595 Ga0207641_10164012 3300026088 Bacteria 2022
596 Ga0207641_10322898 3300026088 Bacteria 1464
597 Ga0207641_10993808 3300026088 Bacteria 835
598 Ga0207641_12043718 3300026088 Bacteria 574
599 Ga0207648_10001177 3300026089 Bacteria 29264
600 Ga0207648_10010576 3300026089 Bacteria 8730
601 Ga0207648_10082790 3300026089 Bacteria 2798
602 Ga0207648_10251300 3300026089 Bacteria 1576
603 Ga0207676_10003397 3300026095 Bacteria 11248
604 Ga0207676_10004545 3300026095 Bacteria 9820
605 Ga0207676_10397869 3300026095 Bacteria 1286
606 Ga0207676_10534209 3300026095 Bacteria 1118
607 Ga0207676_11156123 3300026095 Bacteria 766
608 Ga0207674_10000859 3300026116 Bacteria 39717
609 Ga0207674_10001201 3300026116 Bacteria 33701
610 Ga0207674_10029023 3300026116 Bacteria 5831
611 Ga0207674_10874755 3300026116 Bacteria 866
612 Ga0207675_100113772 3300026118 Bacteria 2555
613 Ga0207675_100787496 3300026118 Bacteria 963
614 Ga0207683_10039638 3300026121 Bacteria 4110
615 Ga0207683_10159724 3300026121 Bacteria 2037
616 Ga0207698_10010461 3300026142 Bacteria 5963
617 Ga0207698_10057313 3300026142 Bacteria 3013
618 Ga0207698_10210416 3300026142 Bacteria 1749
619 Ga0207698_10332029 3300026142 Bacteria 1429
620 Ga0207698_10482545 3300026142 Bacteria 1203
621 Ga0207698_11699418 3300026142 Bacteria 646
622 Ga0207698_11726846 3300026142 Bacteria 641
623 Ga0268266_10002361 3300028379 Bacteria 20409
624 Ga0268266_10040908 3300028379 Bacteria 3952
625 Ga0268266_10096415 3300028379 Bacteria 2599
626 Ga0268266_10107292 3300028379 Bacteria 2469
627 Ga0268266_10296503 3300028379 Bacteria 1507
628 Ga0268266_11076702 3300028379 Bacteria 778
629 Ga0268266_11099576 3300028379 Bacteria 769
630 Ga0268265_10002831 3300028380 Bacteria 12756
631 Ga0268265_10004187 3300028380 Bacteria 10096
632 Ga0268265_10004549 3300028380 Bacteria 9592
633 Ga0268265_10089650 3300028380 Bacteria 2454
634 Ga0268265_10154473 3300028380 Bacteria 1940
635 Ga0268265_10725457 3300028380 Bacteria 962
636 Ga0268265_11837727 3300028380 Bacteria 612
637 Ga0268264_10001852 3300028381 Bacteria 19235
638 Ga0268264_10006616 3300028381 Bacteria 9747
639 Ga0268264_10007537 3300028381 Bacteria 9079
640 Ga0268264_10013078 3300028381 Bacteria 6823
641 Ga0268264_10139924 3300028381 Bacteria 2157
642 Ga0268264_10270592 3300028381 Bacteria 1587
643 Ga0268264_10468403 3300028381 Bacteria 1223
644 Ga0268264_10516203 3300028381 Bacteria 1167
645 Ga0307513_10501539 3300031456 Bacteria 931
646 Ga0307405_11184878 3300031731 Bacteria 660
647 Ga0307410_10107314 3300031852 Bacteria 2014
648 Ga0307410_11418533 3300031852 Bacteria 610
649 Ga0307406_10535050 3300031901 Bacteria 956
650 Ga0307412_10422784 3300031911 Bacteria 1090
651 Ga0307409_102614926 3300031995 Bacteria 533
652 Ga0307416_100861609 3300032002 Bacteria 1004
653 Ga0307416_101209105 3300032002 Bacteria 861
654 Ga0307416_102692644 3300032002 Bacteria 594
655 Ga0307414_10792431 3300032004 Bacteria 864
656 Ga0307414_11252968 3300032004 Bacteria 687
657 Ga0307411_10054371 3300032005 Bacteria 2628
658 Ga0307415_100047011 3300032126 Bacteria 2903
659 Ga0373949_0109515 3300035090 Bacteria 765
660 Ga0373939_0177940 3300035114 Bacteria 792
661 Ga0395899_0002414 3300037312 Bacteria 15186
662 Ga0395899_0167776 3300037312 Bacteria 1547
663 Ga0395899_0317401 3300037312 Bacteria 1050
664 Ga0395899_0449227 3300037312 Bacteria 844
665 Ga0395900_0034219 3300037418 Bacteria 5231
666 Ga0395900_0041469 3300037418 Bacteria 4745
667 Ga0395900_0118419 3300037418 Bacteria 2718
668 Ga0395900_0200644 3300037418 Bacteria 2018
669 Ga0395900_0825872 3300037418 Bacteria 853
670 Ga0395898_0029230 3300037466 Bacteria 5522
671 Ga0395898_0974341 3300037466 Bacteria 784
672 Ga0395898_1306335 3300037466 Bacteria 655
673 Ga0395898_1937104 3300037466 Unclassified 509
674 Ga0395905_0000187 3300037471 Bacteria 98895
675 Ga0395905_0000215 3300037471 Bacteria 89274
676 Ga0395905_0007611 3300037471 Bacteria 10754
677 Ga0395905_0028177 3300037471 Bacteria 5294
678 Ga0395905_0064809 3300037471 Bacteria 3420
679 Ga0395905_0124916 3300037471 Bacteria 2420
680 Ga0395905_0139002 3300037471 Bacteria 2285
681 Ga0395905_0174433 3300037471 Bacteria 2019
682 Ga0395905_0222984 3300037471 Bacteria 1764
683 Ga0395905_0269287 3300037471 Bacteria 1589
684 Ga0395905_0656832 3300037471 Bacteria 950
685 Ga0436364_1177049 3300037853 Bacteria 2853
686 Ga0395901_0000876 3300038443 Bacteria 33203
687 Ga0395901_0081388 3300038443 Bacteria 3382
688 Ga0395901_0102510 3300038443 Bacteria 3003
689 Ga0395901_0431326 3300038443 Bacteria 1350
690 Ga0395901_0463075 3300038443 Bacteria 1295
691 Ga0395901_1691338 3300038443 Bacteria 584
692 Ga0466972_0071855 3300044658 Bacteria 1650
693 Ga0466965_0113221 3300044683 Bacteria 1396
694 Ga0466965_0119723 3300044683 Bacteria 1359
695 Ga0466970_0539201 3300044765 Unclassified 674
696 Ga0466970_0846550 3300044765 Bacteria 537
697 Ga0466957_1111015 3300044842 Bacteria 570
698 Ga0466960_0251174 3300044901 Bacteria 982
699 Ga0466960_0507002 3300044901 Bacteria 707
700 Ga0466967_0612701 3300045976 Bacteria 1075
701 Ga0495668_0010821 3300046616 Bacteria 5499
702 Ga0495625_0416164 3300046660 Bacteria 837
703 Ga0495669_0004734 3300046684 Bacteria 5645
704 Ga0495669_0069394 3300046684 Bacteria 1604
705 Ga0496100_1309454 3300048903 Bacteria 572
706 Ga0496101_0031898 3300048904 Bacteria 3706
707 Ga0496101_1022068 3300048904 Bacteria 650
708 Ga0496102_0061306 3300048905 Bacteria 3442
709 Ga0496102_0829861 3300048905 Bacteria 847
710 Ga0496103_0059357 3300048906 Bacteria 2376
711 Ga0496103_0746757 3300048906 Bacteria 619
712 Ga0496104_0058715 3300048907 Bacteria 3642
713 Ga0496106_0019051 3300048909 Bacteria 5087
714 Ga0496106_0242296 3300048909 Bacteria 1441
715 Ga0496106_1041370 3300048909 Bacteria 643
716 Ga0496107_0022369 3300048910 Bacteria 4467
717 Ga0496107_0633411 3300048910 Bacteria 789
718 Ga0496107_0796349 3300048910 Bacteria 692
719 Ga0496108_0014771 3300048911 Bacteria 6373
720 Ga0496109_0017483 3300048912 Bacteria 6288
721 Ga0496109_0241569 3300048912 Bacteria 1700
722 Ga0496109_0269498 3300048912 Bacteria 1604
723 Ga0496109_1392874 3300048912 Bacteria 637
724 Ga0496110_1112327 3300048913 Bacteria 698
725 Ga0496111_0003153 3300048914 Bacteria 10148
726 Ga0496112_0127388 3300048915 Bacteria 2516
727 Ga0496113_0054398 3300048916 Bacteria 2996
728 nmdc:mga09592_287158_c1 3300050508 Bacteria 1426
729 nmdc:mga08y16_287493_c1 3300050511 Bacteria 1695
730 nmdc:mga0n895_527708_c1 3300050512 Bacteria 1188
731 nmdc:mga0rr50_211609_c1 3300050513 Bacteria 1597
732 nmdc:mga0rr50_712140_c1 3300050513 Bacteria 857
733 nmdc:mga0a205_62891_c1 3300050515 Bacteria 3586
734 Ga0495655_0063997 3300053083 Bacteria 1011
735 Ga0500658_0000164 3300053134 Bacteria 31944
736 Ga0587067_115061 3300059640 Unclassified 639
737 Ga0070668_100168717
738 JGI24736J21556_1015145
739 JGI24741J21665_1033029
740 JGI24752J21851_1018093
741 JGI24752J21851_1054327
742 JGI24740J21852_10009578
743 JGI24740J21852_10018108
744 JGI24740J21852_10033611
745 JGI24740J21852_10121633
746 JGI24739J22299_10000785
747 JGI24739J22299_10006018
748 JGI24737J22298_10001142
749 JGI24737J22298_10018227
750 JGI24737J22298_10130304
751 JGI24743J22301_10013283
752 JGI24743J22301_10021525
753 JGI24735J21928_10047770
754 JGI24735J21928_10132039
755 JGI24735J21928_10237294
756 JGI24738J21930_10001221
757 JGI24738J21930_10008723
758 JGI24738J21930_10052120
759 JGI24035J26624_1014281
760 JGI24742J22300_10027506
761 rootH2_10297945
762 Ga0070658_10017631
763 Ga0070658_10116471
764 Ga0070658_10145087
765 Ga0070658_10560923
766 Ga0070658_10724325
767 Ga0070676_10008273
768 Ga0070676_10020742
769 Ga0070676_10091760
770 Ga0070676_10953592
771 Ga0070683_100653479
772 Ga0070683_100886629
773 Ga0070690_100031336
774 Ga0070690_101576543
775 Ga0070670_100015599
776 Ga0070670_100085570
777 Ga0070670_100816371
778 Ga0070670_101718817
779 Ga0070677_10047120
780 Ga0068869_100001204
781 Ga0068869_100034373
782 Ga0068869_100048277
783 Ga0068869_100217301
784 Ga0068869_100298725
785 Ga0068869_102070681
786 Ga0070666_10003007
787 Ga0070666_10059542
788 Ga0070666_10498498
789 Ga0070666_10923724
790 Ga0070680_100010794
791 Ga0070680_100599385
792 Ga0070682_100269173
793 Ga0068868_100008744
794 Ga0068868_100123561
795 Ga0068868_100448678
796 Ga0068868_100511103
797 Ga0068868_100699702
798 Ga0068868_101537625
799 Ga0068868_102073589
800 Ga0070660_100002605
801 Ga0070660_100006738
802 Ga0070660_100014398
803 Ga0070660_100029310
804 Ga0070660_100091991
805 Ga0070660_100308799
806 Ga0070660_100737206
807 Ga0070660_101156715
808 Ga0070689_100040791
809 Ga0070689_100402430
810 Ga0070689_100987982
811 Ga0070687_100975503
812 Ga0070661_100025966
813 Ga0070661_100262111
814 Ga0070661_100277863
815 Ga0070661_100304353
816 Ga0070661_101177206
817 Ga0070661_101231342
818 Ga0070692_10071022
819 Ga0070668_100003013
820 Ga0070668_100028225
821 Ga0070668_100695227
822 Ga0070668_100743953
823 Ga0070668_100807679
824 Ga0070668_101368477
825 Ga0070669_100000586
826 Ga0070669_100087092
827 Ga0070669_100113200
828 Ga0070669_100729304
829 Ga0070669_101055105
830 Ga0070669_101804839
831 Ga0070675_100042818
832 Ga0070675_100565191
833 Ga0070675_101360233
834 Ga0070671_100067691
835 Ga0070671_100068626
836 Ga0070671_100288857
837 Ga0070671_100561522
838 Ga0070671_100566183
839 Ga0070671_100585952
840 Ga0070671_101284805
841 Ga0070674_100006182
842 Ga0070674_100100545
843 Ga0070674_101410359
844 Ga0070673_100002689
845 Ga0070673_100005010
846 Ga0070673_100013723
847 Ga0070673_100250537
848 Ga0070673_101295462
849 Ga0070659_100001641
850 Ga0070659_100002860
851 Ga0070659_100080812
852 Ga0070659_100125924
853 Ga0070659_100360929
854 Ga0070659_100509315
855 Ga0070659_100944245
856 Ga0070659_100972748
857 Ga0070659_101617263
858 Ga0070667_100003196
859 Ga0070667_100004953
860 Ga0070667_100012116
861 Ga0070667_100014809
862 Ga0070667_100097461
863 Ga0070667_100300476
864 Ga0070667_100305468
865 Ga0070667_100414461
866 Ga0070667_101024475
867 Ga0070667_101896432
868 Ga0070701_10310311
869 Ga0070694_100021250
870 Ga0070663_100003510
871 Ga0070663_100014290
872 Ga0070663_100024805
873 Ga0070663_100283541
874 Ga0070663_100337445
875 Ga0070678_101232779
876 Ga0070662_100002851
877 Ga0070662_100006598
878 Ga0070662_100033399
879 Ga0070662_100051215
880 Ga0070662_100136726
881 Ga0070662_100390056
882 Ga0070662_101918701
883 Ga0070681_10043355
884 Ga0070681_10131832
885 Ga0068867_100001360
886 Ga0068867_100052811
887 Ga0068867_100216397
888 Ga0068867_101282437
889 Ga0070685_10879079
890 Ga0070706_100483576
891 Ga0070698_101285119
892 Ga0070679_100004912
893 Ga0070679_100186597
894 Ga0070679_101576250
895 Ga0070684_100088262
896 Ga0070684_100618231
897 Ga0068853_100002189
898 Ga0068853_100084913
899 Ga0068853_100218562
900 Ga0068853_100434672
901 Ga0068853_100560577
902 Ga0068853_100830789
903 Ga0068853_100979752
904 Ga0068853_102016721
905 Ga0068853_102224166
906 Ga0070672_100001067
907 Ga0070672_100078686
908 Ga0070672_100277165
909 Ga0070672_100390007
910 Ga0070672_101086427
911 Ga0070686_100291723
912 Ga0070686_101087710
913 Ga0070686_101676127
914 Ga0070695_100115228
915 Ga0070695_100204124
916 Ga0070693_100303574
917 Ga0070693_100527754
918 Ga0070693_100926373
919 Ga0070665_100001939
920 Ga0070665_100014501
921 Ga0070665_100074258
922 Ga0070665_100209510
923 Ga0070665_100484472
924 Ga0070665_100503439
925 Ga0070665_100821302
926 Ga0070665_101347269
927 Ga0070704_100192739
928 Ga0070704_101527244
929 Ga0068855_100002788
930 Ga0068855_100093698
931 Ga0068855_100416806
932 Ga0068855_100546182
933 Ga0068855_100943014
934 Ga0068855_102453227
935 Ga0070664_100003372
936 Ga0070664_100038219
937 Ga0070664_100069607
938 Ga0070664_100126821
939 Ga0070664_100853780
940 Ga0070664_101008555
941 Ga0070664_101638529
942 Ga0070664_101683974
943 Ga0068857_100000338
944 Ga0068857_100014073
945 Ga0068857_100246891
946 Ga0068857_100308927
947 Ga0068857_100477113
948 Ga0068857_100515326
949 Ga0068854_100003108
950 Ga0068854_100006902
951 Ga0068854_100059254
952 Ga0068854_100170890
953 Ga0068854_100235415
954 Ga0068854_100330666
955 Ga0068854_101806389
956 Ga0068856_100028278
957 Ga0068856_100097343
958 Ga0068856_101805013
959 Ga0068856_102650044
960 Ga0068852_100001883
961 Ga0068852_100015749
962 Ga0068852_100046139
963 Ga0068852_100121895
964 Ga0068852_100141530
965 Ga0068852_100534982
966 Ga0068852_101176980
967 Ga0068852_101346136
968 Ga0068859_100000464
969 Ga0068859_100006502
970 Ga0068859_100028717
971 Ga0068859_100048792
972 Ga0068859_100064789
973 Ga0068859_100073920
974 Ga0068859_100295664
975 Ga0068859_100682089
976 Ga0068864_100001187
977 Ga0068864_100003779
978 Ga0068864_100003818
979 Ga0068864_100839698
980 Ga0068864_101371688
981 Ga0068866_10031388
982 Ga0068866_10336468
983 Ga0068866_11005399
984 Ga0068861_100218372
985 Ga0068861_100902103
986 Ga0068851_10045519
987 Ga0068851_10054535
988 Ga0068851_10098632
989 Ga0068851_10197765
990 Ga0068851_10480435
991 Ga0068870_10147950
992 Ga0068870_10446543
993 Ga0068863_100004975
994 Ga0068863_100007097
995 Ga0068863_100007450
996 Ga0068863_100034651
997 Ga0068863_100049793
998 Ga0068863_100050771
999 Ga0068863_100123913
1000 Ga0068863_100849983
1001 Ga0068863_101539272
1002 Ga0068863_101737903
1003 Ga0068858_100009768
1004 Ga0068858_100028517
1005 Ga0068858_100059866
1006 Ga0068858_100098881
1007 Ga0068860_100004974
1008 Ga0068860_100008094
1009 Ga0068860_100009092
1010 Ga0068860_100079423
1011 Ga0068860_100155529
1012 Ga0068860_100516896
1013 Ga0068860_100942125
1014 Ga0068860_102557939
1015 Ga0068862_100001250
1016 Ga0068862_100007782
1017 Ga0068862_100034633
1018 Ga0068862_100035570
1019 Ga0068862_100118485
1020 Ga0068862_100606591
1021 Ga0068862_101112347
1022 Ga0068862_101748858
1023 Ga0068862_101777580
1024 Ga0068862_102301192
1025 Ga0070712_100236274
1026 Ga0097621_100021949
1027 Ga0097621_100219468
1028 Ga0097621_100464766
1029 Ga0097621_100640282
1030 Ga0068871_100031738
1031 Ga0068871_100175044
1032 Ga0068871_100222578
1033 Ga0075428_100132666
1034 Ga0075428_101920093
1035 Ga0075431_100666754
1036 Ga0075433_10056610
1037 Ga0075433_10140138
1038 Ga0075433_11523278
1039 Ga0075434_100259265
1040 Ga0075429_100380701
1041 Ga0068865_100010731
1042 Ga0068865_100145241
1043 Ga0068865_100337699
1044 Ga0068865_100531960
1045 Ga0097620_100000464
1046 Ga0097620_100006502
1047 Ga0097620_100028716
1048 Ga0097620_100048792
1049 Ga0097620_100064791
1050 Ga0097620_100073918
1051 Ga0097620_100295663
1052 Ga0097620_100682037
1053 Ga0075435_100252293
1054 Ga0075435_100578202
1055 Ga0105244_10106757
1056 Ga0105244_10377216
1057 Ga0111539_10297835
1058 Ga0111539_10981917
1059 Ga0105245_10000128
1060 Ga0105245_10154113
1061 Ga0105245_12067619
1062 Ga0105247_10176916
1063 Ga0105247_10574713
1064 Ga0114129_11086856
1065 Ga0105243_10137854
1066 Ga0105243_10218137
1067 Ga0105243_11043081
1068 Ga0105241_10011856
1069 Ga0105242_10352834
1070 Ga0105242_11367534
1071 Ga0105248_10000787
1072 Ga0105248_10013511
1073 Ga0105248_10031888
1074 Ga0105248_10044913
1075 Ga0105248_10604791
1076 Ga0105237_10047994
1077 Ga0105237_10306817
1078 Ga0105238_10012788
1079 Ga0105238_10804733
1080 Ga0105249_10008508
1081 Ga0105249_10239906
1082 Ga0105249_10299483
1083 Ga0105249_10429074
1084 Ga0105249_12530564
1085 Ga0105249_12677434
1086 Ga0105249_13046824
1087 Ga0105239_10177613
1088 Ga0105239_10271087
1089 Ga0105246_10036675
1090 Ga0105246_10117371
1091 Ga0105246_10172663
1092 Ga0105246_10450745
1093 Ga0105246_10579360
1094 Ga0105246_10704666
1095 Ga0157373_10014869
1096 Ga0157373_10060298
1097 Ga0157373_10062139
1098 Ga0157373_10654571
1099 Ga0157371_10007577
1100 Ga0157371_10031977
1101 Ga0157371_10037525
1102 Ga0157371_10113510
1103 Ga0157371_10885696
1104 Ga0157371_11093746
1105 Ga0157370_10048370
1106 Ga0157370_10657907
1107 Ga0157370_10901727
1108 Ga0157369_10109826
1109 Ga0157369_10549862
1110 Ga0157378_10007423
1111 Ga0157378_10168760
1112 Ga0157378_10375007
1113 Ga0157378_10878181
1114 Ga0163162_10022111
1115 Ga0163162_10234721
1116 Ga0163162_10400697
1117 Ga0163162_10900472
1118 Ga0163162_11777484
1119 Ga0157372_11179556
1120 Ga0157372_11192458
1121 Ga0157375_10026499
1122 Ga0157375_10040957
1123 Ga0157375_10108900
1124 Ga0157375_10564883
1125 Ga0157375_11336136
1126 Ga0157375_11976976
1127 Ga0163163_10000139
1128 Ga0163163_10045228
1129 Ga0157380_12020882
1130 Ga0182008_10069146
1131 Ga0182008_10270464
1132 Ga0157377_10020172
1133 Ga0157377_10058180
1134 Ga0157379_10026509
1135 Ga0157379_10026587
1136 Ga0157379_10078498
1137 Ga0163161_10510894
1138 Ga0163161_10874515
1139 Ga0197907_11290166
1140 Ga0206355_1258189
1141 Ga0206352_11197090
1142 Ga0206354_10717950
1143 Ga0213875_10009679
1144 Ga0207673_1007719
1145 Ga0207697_10000461
1146 Ga0207697_10122451
1147 Ga0207656_10072929
1148 Ga0207656_10232937
1149 Ga0207696_1005162
1150 Ga0207682_10173507
1151 Ga0207642_10067709
1152 Ga0207642_10298716
1153 Ga0207710_10144734
1154 Ga0207710_10472147
1155 Ga0207688_10000063
1156 Ga0207688_10012303
1157 Ga0207688_10076135
1158 Ga0207688_10217450
1159 Ga0207688_10791257
1160 Ga0207688_10878023
1161 Ga0207680_10251329
1162 Ga0207647_10000227
1163 Ga0207647_10006423
1164 Ga0207647_10014777
1165 Ga0207647_10090138
1166 Ga0207647_10175252
1167 Ga0207645_10009859
1168 Ga0207645_10020369
1169 Ga0207645_10092914
1170 Ga0207645_10252259
1171 Ga0207645_11072529
1172 Ga0207705_10004232
1173 Ga0207705_10048365
1174 Ga0207705_10167437
1175 Ga0207705_10238556
1176 Ga0207705_10375616
1177 Ga0207705_10623082
1178 Ga0207654_10089809
1179 Ga0207707_10039018
1180 Ga0207695_10820461
1181 Ga0207671_10069577
1182 Ga0207671_10994931
1183 Ga0207693_10072852
1184 Ga0207660_10022784
1185 Ga0207660_10612226
1186 Ga0207662_10743359
1187 Ga0207662_10913668
1188 Ga0207657_10001753
1189 Ga0207657_10002137
1190 Ga0207657_10003245
1191 Ga0207657_10012153
1192 Ga0207657_10112371
1193 Ga0207657_10200427
1194 Ga0207657_11231063
1195 Ga0207649_10027640
1196 Ga0207649_10057874
1197 Ga0207649_10275927
1198 Ga0207652_10004117
1199 Ga0207652_10184151
1200 Ga0207652_11127827
1201 Ga0207681_10012969
1202 Ga0207681_10020914
1203 Ga0207681_10080967
1204 Ga0207681_10189471
1205 Ga0207681_10732683
1206 Ga0207681_11171997
1207 Ga0207694_10037467
1208 Ga0207650_10068205
1209 Ga0207650_10158034
1210 Ga0207650_10688473
1211 Ga0207650_11615001
1212 Ga0207659_10304310
1213 Ga0207659_10611215
1214 Ga0207687_10003689
1215 Ga0207687_10232898
1216 Ga0207644_10026614
1217 Ga0207644_10047130
1218 Ga0207644_10290188
1219 Ga0207644_10290596
1220 Ga0207644_10871418
1221 Ga0207644_10900391
1222 Ga0207644_10991711
1223 Ga0207644_11486788
1224 Ga0207690_10006127
1225 Ga0207690_10024623
1226 Ga0207690_10089215
1227 Ga0207690_10258594
1228 Ga0207690_10729089
1229 Ga0207690_11337276
1230 Ga0207706_10009958
1231 Ga0207706_10072786
1232 Ga0207706_10094862
1233 Ga0207706_10099702
1234 Ga0207706_10258407
1235 Ga0207706_10644349
1236 Ga0207686_11441449
1237 Ga0207709_10082236
1238 Ga0207709_10659633
1239 Ga0207709_11030525
1240 Ga0207670_10088723
1241 Ga0207670_10876006
1242 Ga0207669_10015845
1243 Ga0207669_10318408
1244 Ga0207704_10084370
1245 Ga0207704_10168475
1246 Ga0207704_10258045
1247 Ga0207704_11486464
1248 Ga0207691_10000447
1249 Ga0207691_10044505
1250 Ga0207691_10251295
1251 Ga0207691_11093220
1252 Ga0207711_10000258
1253 Ga0207711_10001621
1254 Ga0207711_10004550
1255 Ga0207711_10081016
1256 Ga0207711_11128912
1257 Ga0207689_10001047
1258 Ga0207689_10024317
1259 Ga0207689_10028026
1260 Ga0207689_10039645
1261 Ga0207689_10542198
1262 Ga0207661_10027352
1263 Ga0207661_10032500
1264 Ga0207679_10031199
1265 Ga0207679_10031750
1266 Ga0207679_10149429
1267 Ga0207679_10326738
1268 Ga0207679_10386987
1269 Ga0207679_10751262
1270 Ga0207667_10046456
1271 Ga0207667_10078589
1272 Ga0207667_10080874
1273 Ga0207667_10159341
1274 Ga0207667_10536556
1275 Ga0207667_11199162
1276 Ga0207651_10008150
1277 Ga0207651_10031999
1278 Ga0207651_10149034
1279 Ga0207651_10211820
1280 Ga0207651_10278028
1281 Ga0207651_11012190
1282 Ga0207712_10001416
1283 Ga0207712_11207940
1284 Ga0207668_10001204
1285 Ga0207668_10021749
1286 Ga0207668_10293897
1287 Ga0207668_10434240
1288 Ga0207668_10625285
1289 Ga0207640_10003003
1290 Ga0207640_10186118
1291 Ga0207640_10302196
1292 Ga0207640_10589446
1293 Ga0207640_11368537
1294 Ga0207658_10003447
1295 Ga0207658_10005224
1296 Ga0207658_10010721
1297 Ga0207658_10068282
1298 Ga0207658_10096060
1299 Ga0207658_10101820
1300 Ga0207658_10308767
1301 Ga0207658_10707712
1302 Ga0207658_11197115
1303 Ga0207677_10004522
1304 Ga0207677_10117697
1305 Ga0207677_10232790
1306 Ga0207703_10002385
1307 Ga0207703_10012883
1308 Ga0207703_10048928
1309 Ga0207703_10080669
1310 Ga0207703_10445710
1311 Ga0207639_10024197
1312 Ga0207639_10396022
1313 Ga0207639_10428375
1314 Ga0207639_10999097
1315 Ga0207639_11513187
1316 Ga0207639_11901681
1317 Ga0207678_10000995
1318 Ga0207678_10005309
1319 Ga0207678_10011714
1320 Ga0207678_10318949
1321 Ga0207678_10374665
1322 Ga0207702_10081960
1323 Ga0207702_10140829
1324 Ga0207702_11679828
1325 Ga0207641_10000621
1326 Ga0207641_10011295
1327 Ga0207641_10013785
1328 Ga0207641_10071621
1329 Ga0207641_10128473
1330 Ga0207641_10132511
1331 Ga0207641_10164012
1332 Ga0207641_10322898
1333 Ga0207641_10993808
1334 Ga0207641_12043718
1335 Ga0207648_10001177
1336 Ga0207648_10010576
1337 Ga0207648_10082790
1338 Ga0207648_10251300
1339 Ga0207676_10003397
1340 Ga0207676_10004545
1341 Ga0207676_10397869
1342 Ga0207676_10534209
1343 Ga0207676_11156123
1344 Ga0207674_10000859
1345 Ga0207674_10001201
1346 Ga0207674_10029023
1347 Ga0207674_10874755
1348 Ga0207675_100113772
1349 Ga0207675_100787496
1350 Ga0207683_10039638
1351 Ga0207683_10159724
1352 Ga0207698_10010461
1353 Ga0207698_10057313
1354 Ga0207698_10210416
1355 Ga0207698_10332029
1356 Ga0207698_10482545
1357 Ga0207698_11699418
1358 Ga0207698_11726846
1359 Ga0268266_10002361
1360 Ga0268266_10040908
1361 Ga0268266_10096415
1362 Ga0268266_10107292
1363 Ga0268266_10296503
1364 Ga0268266_11076702
1365 Ga0268266_11099576
1366 Ga0268265_10002831
1367 Ga0268265_10004187
1368 Ga0268265_10004549
1369 Ga0268265_10089650
1370 Ga0268265_10154473
1371 Ga0268265_10725457
1372 Ga0268265_11837727
1373 Ga0268264_10001852
1374 Ga0268264_10006616
1375 Ga0268264_10007537
1376 Ga0268264_10013078
1377 Ga0268264_10139924
1378 Ga0268264_10270592
1379 Ga0268264_10468403
1380 Ga0268264_10516203
1381 Ga0307513_10501539
1382 Ga0307405_11184878
1383 Ga0307410_10107314
1384 Ga0307410_11418533
1385 Ga0307406_10535050
1386 Ga0307412_10422784
1387 Ga0307409_102614926
1388 Ga0307416_100861609
1389 Ga0307416_101209105
1390 Ga0307416_102692644
1391 Ga0307414_10792431
1392 Ga0307414_11252968
1393 Ga0307411_10054371
1394 Ga0307415_100047011
1395 Ga0373949_0109515
1396 Ga0373939_0177940
1397 Ga0395899_0002414
1398 Ga0395899_0167776
1399 Ga0395899_0317401
1400 Ga0395899_0449227
1401 Ga0395900_0034219
1402 Ga0395900_0041469
1403 Ga0395900_0118419
1404 Ga0395900_0200644
1405 Ga0395900_0825872
1406 Ga0395898_0029230
1407 Ga0395898_0974341
1408 Ga0395898_1306335
1409 Ga0395898_1937104
1410 Ga0395905_0000187
1411 Ga0395905_0000215
1412 Ga0395905_0007611
1413 Ga0395905_0028177
1414 Ga0395905_0064809
1415 Ga0395905_0124916
1416 Ga0395905_0139002
1417 Ga0395905_0174433
1418 Ga0395905_0222984
1419 Ga0395905_0269287
1420 Ga0395905_0656832
1421 Ga0436364_1177049
1422 Ga0395901_0000876
1423 Ga0395901_0081388
1424 Ga0395901_0102510
1425 Ga0395901_0431326
1426 Ga0395901_0463075
1427 Ga0395901_1691338
1428 Ga0466972_0071855
1429 Ga0466965_0113221
1430 Ga0466965_0119723
1431 Ga0466970_0539201
1432 Ga0466970_0846550
1433 Ga0466957_1111015
1434 Ga0466960_0251174
1435 Ga0466960_0507002
1436 Ga0466967_0612701
1437 Ga0495668_0010821
1438 Ga0495625_0416164
1439 Ga0495669_0004734
1440 Ga0495669_0069394
1441 Ga0496100_1309454
1442 Ga0496101_0031898
1443 Ga0496101_1022068
1444 Ga0496102_0061306
1445 Ga0496102_0829861
1446 Ga0496103_0059357
1447 Ga0496103_0746757
1448 Ga0496104_0058715
1449 Ga0496106_0019051
1450 Ga0496106_0242296
1451 Ga0496106_1041370
1452 Ga0496107_0022369
1453 Ga0496107_0633411
1454 Ga0496107_0796349
1455 Ga0496108_0014771
1456 Ga0496109_0017483
1457 Ga0496109_0241569
1458 Ga0496109_0269498
1459 Ga0496109_1392874
1460 Ga0496110_1112327
1461 Ga0496111_0003153
1462 Ga0496112_0127388
1463 Ga0496113_0054398
1464 nmdc:mga09592_287158_c1
1465 nmdc:mga08y16_287493_c1
1466 nmdc:mga0n895_527708_c1
1467 nmdc:mga0rr50_211609_c1
1468 nmdc:mga0rr50_712140_c1
1469 nmdc:mga0a205_62891_c1
1470 Ga0495655_0063997
1471 Ga0500658_0000164
1472 Ga0587067_115061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map