F478246

General Info

Members Datasets Scaffolds Average Seq Length
736 390 1472 135

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10274313|Ga0065715_102743132
Length 135
Sequence MHDVAAIQALIEPLFPGLMGVRVTELAGDRVVAEMPVRADLCTAGGILHGGAYMAFADTLGAIGTIVNLGPGKRTTTDSSTKFIAGARVGTTVTGESVALHRGRTTMVWQTSVRNAEGKLCALVTQTQLVLSNES

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
238 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
332 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
344 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
350 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
355 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
356 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
361 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
364 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
365 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
366 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
367 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
368 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
369 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
372 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
373 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
374 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
375 2738541307 Variovorax sp. GV008 Isolate Unclassified
376 2738543013 Variovorax sp. BT01 Isolate Unclassified
377 2818991446 Variovorax sp. 1180 Isolate Unclassified
378 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
379 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
380 2885198086 Variovorax sp. 679 Isolate Unclassified
381 2885211737 Variovorax sp. 553 Isolate Unclassified
382 2899924645 Variovorax sp. 369 Isolate Unclassified
383 2928037797 Variovorax sp. 1126 Isolate Unclassified
384 2928044640 Variovorax sp. 1128 Isolate Unclassified
385 2928051484 Variovorax sp. 1133 Isolate Unclassified
386 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
387 2928070936 Variovorax gossypii 1167 Isolate Unclassified
388 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
389 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
390 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.27
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.53
Nodule 0.14
Rhizoplane 5.71
Rhizosphere 69.97
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10274313 3300005293 Bacteria 1103
2 JGI24740J21852_10046222 3300001979 Bacteria 1279
3 JGI24739J22299_10012236 3300001989 Bacteria 3151
4 JGI24739J22299_10050669 3300001989 Bacteria 1342
5 JGI25158J39367_1023527 3300002739 Bacteria 735
6 JGI25152J39213_1000498 3300002773 Bacteria 22030
7 JGI25152J39213_1006493 3300002773 Bacteria 3173
8 JGI25152J39213_1011753 3300002773 Bacteria 1919
9 JGI25150J39212_1001039 3300002774 Bacteria 8501
10 JGI25159J45721_1000329 3300002987 Bacteria 22031
11 JGI25159J45721_1022287 3300002987 Bacteria 1174
12 JGI25159J45721_1022656 3300002987 Bacteria 1156
13 JGI25151J46595_10009852 3300003187 Bacteria 4491
14 JGI25151J46595_10017835 3300003187 Bacteria 3065
15 JGI25151J46595_10032031 3300003187 Bacteria 2043
16 JGI25151J46595_10156535 3300003187 Bacteria 540
17 JGI25153J46596_10009544 3300003215 Bacteria 4491
18 JGI25153J46596_10019585 3300003215 Bacteria 2586
19 JGI25153J46596_10052825 3300003215 Bacteria 1154
20 rootH1_10087169 3300003316 Bacteria 2729
21 rootH1_10108650 3300003323 Bacteria 1597
22 JGI25160J50197_1000602 3300003354 Bacteria 20126
23 JGI25160J50197_1037620 3300003354 Bacteria 1156
24 JGI25161J50226_1000391 3300003374 Bacteria 22031
25 JGI25161J50226_1003580 3300003374 Bacteria 3502
26 Ga0006562J51391_1005200 3300003578 Bacteria 3190
27 Ga0006562J51391_1005202 3300003578 Bacteria 1340
28 Ga0055526_1001055 3300003771 Bacteria 20125
29 Ga0055526_1017319 3300003771 Bacteria 2758
30 Ga0055537_1002816 3300003773 Bacteria 5581
31 Ga0055537_1029185 3300003773 Bacteria 724
32 Ga0055537_1029198 3300003773 Bacteria 724
33 Ga0055524_1000842 3300003775 Bacteria 20126
34 Ga0055524_1004396 3300003775 Bacteria 6502
35 Ga0055536_1011805 3300003781 Bacteria 3303
36 Ga0055534_1000508 3300003784 Bacteria 21216
37 Ga0055534_1000934 3300003784 Bacteria 13104
38 Ga0055534_1037574 3300003784 Bacteria 724
39 Ga0055528_1005710 3300003790 Bacteria 5740
40 Ga0055528_1059873 3300003790 Bacteria 724
41 Ga0055528_1059913 3300003790 Bacteria 724
42 Ga0055530_10002953 3300003791 Bacteria 10265
43 Ga0055540_1003279 3300003792 Bacteria 7913
44 Ga0055540_1003507 3300003792 Bacteria 7552
45 Ga0055540_1068703 3300003792 Bacteria 695
46 Ga0055531_10002575 3300003794 Bacteria 12031
47 Ga0055531_10003304 3300003794 Bacteria 10334
48 Ga0055543_1000515 3300004625 Bacteria 22069
49 Ga0055543_1004181 3300004625 Bacteria 4003
50 Ga0065165_1001705 3300005262 Bacteria 22069
51 Ga0065165_1022414 3300005262 Bacteria 2166
52 Ga0065165_1058799 3300005262 Bacteria 1060
53 Ga0065715_10115985 3300005293 Bacteria 2396
54 Ga0070658_10317162 3300005327 Bacteria 1331
55 Ga0070658_10791453 3300005327 Bacteria 824
56 Ga0070658_10988823 3300005327 Bacteria 732
57 Ga0070676_10007826 3300005328 Bacteria 5745
58 Ga0070676_11537126 3300005328 Bacteria 513
59 Ga0070676_11545420 3300005328 Bacteria 512
60 Ga0070670_100069059 3300005331 Bacteria 3033
61 Ga0070670_100075434 3300005331 Bacteria 2897
62 Ga0070670_100109813 3300005331 Bacteria 2376
63 Ga0070670_100130180 3300005331 Bacteria 2173
64 Ga0070670_100266732 3300005331 Bacteria 1493
65 Ga0070670_100466947 3300005331 Bacteria 1120
66 Ga0070670_100520859 3300005331 Bacteria 1059
67 Ga0070677_10016841 3300005333 Bacteria 2608
68 Ga0070677_10201508 3300005333 Bacteria 960
69 Ga0070677_10244986 3300005333 Bacteria 887
70 Ga0068869_100051553 3300005334 Bacteria 2986
71 Ga0070666_10000930 3300005335 Bacteria 17786
72 Ga0070680_100016107 3300005336 Bacteria 5874
73 Ga0070680_100055341 3300005336 Bacteria 3242
74 Ga0070682_100822083 3300005337 Bacteria 757
75 Ga0068868_100001477 3300005338 Bacteria 16207
76 Ga0068868_100160266 3300005338 Bacteria 1858
77 Ga0070660_100555833 3300005339 Bacteria 958
78 Ga0070689_100361471 3300005340 Bacteria 1220
79 Ga0070689_100514258 3300005340 Bacteria 1027
80 Ga0070691_10008832 3300005341 Bacteria 4613
81 Ga0070687_100148564 3300005343 Bacteria 1373
82 Ga0070661_100107183 3300005344 Bacteria 2084
83 Ga0070661_100426626 3300005344 Bacteria 1052
84 Ga0070692_10023165 3300005345 Bacteria 3040
85 Ga0070668_100015262 3300005347 Bacteria 5739
86 Ga0070668_100027303 3300005347 Bacteria 4334
87 Ga0070668_100900761 3300005347 Bacteria 791
88 Ga0070668_100988250 3300005347 Bacteria 756
89 Ga0070668_101604330 3300005347 Bacteria 596
90 Ga0070669_100004393 3300005353 Bacteria 10176
91 Ga0070669_100136757 3300005353 Bacteria 1885
92 Ga0070669_100166479 3300005353 Bacteria 1716
93 Ga0070669_100716912 3300005353 Bacteria 845
94 Ga0070669_101139410 3300005353 Bacteria 672
95 Ga0070675_100002416 3300005354 Bacteria 13927
96 Ga0070675_100013976 3300005354 Bacteria 6320
97 Ga0070675_100209411 3300005354 Bacteria 1694
98 Ga0070675_100297713 3300005354 Bacteria 1421
99 Ga0070675_100546704 3300005354 Bacteria 1047
100 Ga0070675_100780384 3300005354 Bacteria 873
101 Ga0070675_100934157 3300005354 Bacteria 795
102 Ga0070675_101015838 3300005354 Bacteria 761
103 Ga0070675_101532827 3300005354 Bacteria 615
104 Ga0070671_100030696 3300005355 Bacteria 4436
105 Ga0070671_100079789 3300005355 Bacteria 2736
106 Ga0070671_100478774 3300005355 Bacteria 1069
107 Ga0070671_100585622 3300005355 Bacteria 964
108 Ga0070671_101565383 3300005355 Bacteria 584
109 Ga0070674_100011834 3300005356 Bacteria 5328
110 Ga0070674_100060388 3300005356 Bacteria 2642
111 Ga0070674_100200309 3300005356 Bacteria 1541
112 Ga0070674_100612166 3300005356 Bacteria 922
113 Ga0070673_100002692 3300005364 Bacteria 10883
114 Ga0070673_100613067 3300005364 Bacteria 993
115 Ga0070673_100759951 3300005364 Bacteria 893
116 Ga0070688_100266726 3300005365 Bacteria 1225
117 Ga0070688_100703374 3300005365 Bacteria 783
118 Ga0070659_101041292 3300005366 Bacteria 720
119 Ga0070659_101239793 3300005366 Bacteria 660
120 Ga0070667_100002444 3300005367 Bacteria 16235
121 Ga0070667_100049950 3300005367 Bacteria 3524
122 Ga0070667_100654291 3300005367 Bacteria 970
123 Ga0070703_10003246 3300005406 Bacteria 4640
124 Ga0070714_101975333 3300005435 Bacteria 569
125 Ga0070701_10048544 3300005438 Bacteria 2191
126 Ga0070701_10136007 3300005438 Bacteria 1401
127 Ga0070705_100001692 3300005440 Bacteria 11518
128 Ga0070700_100009821 3300005441 Bacteria 5263
129 Ga0070700_100092282 3300005441 Bacteria 1978
130 Ga0070700_101586935 3300005441 Bacteria 559
131 Ga0070694_100059886 3300005444 Bacteria 2595
132 Ga0070694_100938551 3300005444 Bacteria 716
133 Ga0070708_100724933 3300005445 Bacteria 935
134 Ga0070663_100074462 3300005455 Bacteria 2479
135 Ga0070663_100257698 3300005455 Bacteria 1383
136 Ga0070663_100300490 3300005455 Bacteria 1285
137 Ga0070678_100000637 3300005456 Bacteria 17165
138 Ga0070678_100045900 3300005456 Bacteria 3129
139 Ga0070678_100052300 3300005456 Bacteria 2965
140 Ga0070678_100162823 3300005456 Bacteria 1809
141 Ga0070662_100069554 3300005457 Bacteria 2591
142 Ga0070662_100293101 3300005457 Bacteria 1319
143 Ga0070662_100795814 3300005457 Bacteria 803
144 Ga0070681_10163545 3300005458 Bacteria 2149
145 Ga0068867_100003306 3300005459 Bacteria 11358
146 Ga0068867_100292576 3300005459 Bacteria 1339
147 Ga0068867_100369135 3300005459 Bacteria 1202
148 Ga0068867_101077483 3300005459 Bacteria 732
149 Ga0070685_10071084 3300005466 Bacteria 2062
150 Ga0070706_100199314 3300005467 Bacteria 1870
151 Ga0070707_100274131 3300005468 Bacteria 1640
152 Ga0070699_100012641 3300005518 Bacteria 7281
153 Ga0070679_100192838 3300005530 Bacteria 2006
154 Ga0070697_100020321 3300005536 Bacteria 5252
155 Ga0068853_100001041 3300005539 Bacteria 19601
156 Ga0068853_100199026 3300005539 Bacteria 1822
157 Ga0068853_101993864 3300005539 Bacteria 563
158 Ga0070672_100021253 3300005543 Bacteria 4746
159 Ga0070672_100032759 3300005543 Bacteria 3926
160 Ga0070672_100037129 3300005543 Bacteria 3715
161 Ga0070672_100132917 3300005543 Bacteria 2047
162 Ga0070672_100182064 3300005543 Bacteria 1751
163 Ga0070672_100319070 3300005543 Bacteria 1320
164 Ga0070686_100113829 3300005544 Bacteria 1848
165 Ga0070686_100773703 3300005544 Bacteria 772
166 Ga0070695_100014839 3300005545 Bacteria 4700
167 Ga0070696_100002547 3300005546 Bacteria 12071
168 Ga0070693_100034480 3300005547 Bacteria 2800
169 Ga0070665_100026141 3300005548 Bacteria 5878
170 Ga0070665_100085918 3300005548 Bacteria 3152
171 Ga0070665_101571773 3300005548 Bacteria 666
172 Ga0070704_100004604 3300005549 Bacteria 7975
173 Ga0070664_100080962 3300005564 Bacteria 2798
174 Ga0070664_100165950 3300005564 Bacteria 1956
175 Ga0070664_100403223 3300005564 Bacteria 1251
176 Ga0070664_101293333 3300005564 Bacteria 689
177 Ga0068857_100014049 3300005577 Bacteria 6969
178 Ga0068854_100062400 3300005578 Bacteria 2702
179 Ga0068854_100331657 3300005578 Bacteria 1240
180 Ga0068856_101173392 3300005614 Bacteria 784
181 Ga0068852_100013930 3300005616 Bacteria 6167
182 Ga0068852_100136246 3300005616 Bacteria 2267
183 Ga0068852_100246558 3300005616 Bacteria 1709
184 Ga0068859_100001613 3300005617 Bacteria 23052
185 Ga0068859_100015903 3300005617 Bacteria 7562
186 Ga0068859_100136458 3300005617 Bacteria 2526
187 Ga0068864_100001828 3300005618 Bacteria 17480
188 Ga0068864_100012911 3300005618 Bacteria 6910
189 Ga0068864_100342764 3300005618 Bacteria 1408
190 Ga0068866_10044731 3300005718 Bacteria 2216
191 Ga0068866_10571615 3300005718 Bacteria 759
192 Ga0068861_100072097 3300005719 Bacteria 2679
193 Ga0068861_100088190 3300005719 Bacteria 2442
194 Ga0068861_100110128 3300005719 Bacteria 2205
195 Ga0068861_101474519 3300005719 Bacteria 667
196 Ga0068851_10341126 3300005834 Bacteria 869
197 Ga0068870_10084401 3300005840 Bacteria 1763
198 Ga0068870_10672361 3300005840 Bacteria 711
199 Ga0068863_100083293 3300005841 Bacteria 3031
200 Ga0068858_100001347 3300005842 Bacteria 25330
201 Ga0068858_101477595 3300005842 Bacteria 670
202 Ga0068860_100016513 3300005843 Bacteria 7200
203 Ga0068860_100019309 3300005843 Bacteria 6614
204 Ga0068860_100120892 3300005843 Bacteria 2508
205 Ga0068862_100000330 3300005844 Bacteria 51664
206 Ga0068862_100245817 3300005844 Bacteria 1629
207 Ga0068862_102067142 3300005844 Bacteria 581
208 Ga0075365_10024435 3300006038 Bacteria 3812
209 Ga0075365_10570691 3300006038 Bacteria 800
210 Ga0075363_100067589 3300006048 Bacteria 1937
211 Ga0070715_10192728 3300006163 Bacteria 1030
212 Ga0070716_100684158 3300006173 Bacteria 782
213 Ga0075366_10050783 3300006195 Bacteria 2463
214 Ga0097621_100007918 3300006237 Bacteria 7623
215 Ga0075370_10549178 3300006353 Bacteria 699
216 Ga0068871_100009531 3300006358 Bacteria 7044
217 Ga0068871_100257750 3300006358 Bacteria 1520
218 Ga0075428_101211281 3300006844 Unclassified 796
219 Ga0075431_100270755 3300006847 Bacteria 1721
220 Ga0068865_100032603 3300006881 Bacteria 3481
221 Ga0068865_100042325 3300006881 Bacteria 3106
222 Ga0097620_100001613 3300006931 Bacteria 23052
223 Ga0097620_100015903 3300006931 Bacteria 7562
224 Ga0097620_100136443 3300006931 Bacteria 2526
225 Ga0105244_10025712 3300009036 Bacteria 3195
226 Ga0105244_10126396 3300009036 Bacteria 1235
227 Ga0105244_10252902 3300009036 Bacteria 821
228 Ga0105240_10235339 3300009093 Bacteria 2126
229 Ga0105240_10290607 3300009093 Bacteria 1874
230 Ga0111539_11401347 3300009094 Bacteria 811
231 Ga0105245_10317242 3300009098 Bacteria 1534
232 Ga0105243_10087655 3300009148 Bacteria 2555
233 Ga0105243_10134396 3300009148 Bacteria 2102
234 Ga0105243_10709184 3300009148 Bacteria 982
235 Ga0105243_11657273 3300009148 Bacteria 667
236 Ga0105242_10094332 3300009176 Bacteria 2524
237 Ga0105242_10353474 3300009176 Bacteria 1358
238 Ga0105242_11220092 3300009176 Bacteria 772
239 Ga0105248_10005486 3300009177 Bacteria 13930
240 Ga0105248_10645592 3300009177 Bacteria 1194
241 Ga0105248_10676176 3300009177 Bacteria 1165
242 Ga0105238_10214417 3300009551 Bacteria 1901
243 Ga0105238_11009783 3300009551 Bacteria 853
244 Ga0105249_10008716 3300009553 Bacteria 8843
245 Ga0105249_10018770 3300009553 Bacteria 6161
246 Ga0105249_11060732 3300009553 Bacteria 880
247 Ga0105239_10612575 3300010375 Bacteria 1242
248 Ga0105246_10165677 3300011119 Bacteria 1688
249 Ga0105246_10384559 3300011119 Bacteria 1161
250 Ga0157325_1014910 3300012485 Bacteria 629
251 Ga0157373_10252010 3300013100 Bacteria 1249
252 Ga0157373_10728811 3300013100 Bacteria 728
253 Ga0157371_10053034 3300013102 Bacteria 2880
254 Ga0157371_10098377 3300013102 Bacteria 2074
255 Ga0157371_10297451 3300013102 Bacteria 1168
256 Ga0157370_10082144 3300013104 Bacteria 3031
257 Ga0157369_10000249 3300013105 Bacteria 74245
258 Ga0157374_10033778 3300013296 Bacteria 4669
259 Ga0157374_11338321 3300013296 Bacteria 738
260 Ga0157378_11114737 3300013297 Bacteria 826
261 Ga0163162_10017053 3300013306 Bacteria 7106
262 Ga0163162_10351632 3300013306 Bacteria 1606
263 Ga0157375_10004033 3300013308 Bacteria 12738
264 Ga0157375_10006696 3300013308 Bacteria 10035
265 Ga0157375_10114320 3300013308 Bacteria 2801
266 Ga0157375_10114364 3300013308 Bacteria 2800
267 Ga0157375_10217316 3300013308 Bacteria 2069
268 Ga0157375_11912561 3300013308 Bacteria 704
269 Ga0163163_10003621 3300014325 Bacteria 13134
270 Ga0163163_11112018 3300014325 Bacteria 853
271 Ga0163163_13130729 3300014325 Bacteria 516
272 Ga0157380_10016401 3300014326 Bacteria 5463
273 Ga0157380_10053091 3300014326 Bacteria 3212
274 Ga0157380_10370345 3300014326 Bacteria 1348
275 Ga0157380_11554011 3300014326 Bacteria 716
276 Ga0157379_10006033 3300014968 Bacteria 10437
277 Ga0157379_10243041 3300014968 Bacteria 1633
278 Ga0157379_11416073 3300014968 Bacteria 674
279 Ga0157376_10971108 3300014969 Bacteria 871
280 Ga0163161_10013297 3300017792 Bacteria 5724
281 Ga0163161_10162103 3300017792 Bacteria 1705
282 Ga0163161_10168207 3300017792 Bacteria 1675
283 Ga0163161_10358022 3300017792 Bacteria 1162
284 Ga0163161_10554777 3300017792 Bacteria 942
285 Ga0163161_11440491 3300017792 Bacteria 603
286 Ga0209436_100599 3300025208 Bacteria 15413
287 Ga0209436_103730 3300025208 Bacteria 3948
288 Ga0207425_1000127 3300025245 Bacteria 72085
289 Ga0207425_1002431 3300025245 Bacteria 6556
290 Ga0209129_1000117 3300025258 Bacteria 140115
291 Ga0209129_1013264 3300025258 Bacteria 1826
292 Ga0209129_1019297 3300025258 Bacteria 1291
293 Ga0209565_1000555 3300025263 Bacteria 25909
294 Ga0209565_1000594 3300025263 Bacteria 24365
295 Ga0209565_1047917 3300025263 Bacteria 776
296 Ga0209673_1000493 3300025273 Bacteria 65247
297 Ga0209673_1001269 3300025273 Bacteria 25909
298 Ga0209673_1054231 3300025273 Bacteria 1040
299 Ga0209130_1000850 3300025284 Bacteria 25268
300 Ga0209130_1001158 3300025284 Bacteria 19079
301 Ga0209130_1022626 3300025284 Bacteria 1398
302 Ga0209675_1000597 3300025291 Bacteria 25909
303 Ga0209675_1002001 3300025291 Bacteria 10940
304 Ga0209675_1005227 3300025291 Bacteria 5500
305 Ga0209675_1073231 3300025291 Bacteria 648
306 Ga0209676_1001219 3300025292 Bacteria 27305
307 Ga0209025_1000233 3300025294 Bacteria 130512
308 Ga0209025_1006547 3300025294 Bacteria 8989
309 Ga0209025_1023519 3300025294 Bacteria 3216
310 Ga0209025_1046615 3300025294 Bacteria 1781
311 Ga0209564_1000108 3300025295 Bacteria 213699
312 Ga0209564_1000212 3300025295 Bacteria 133160
313 Ga0209758_1000330 3300025297 Bacteria 89233
314 Ga0209758_1038547 3300025297 Bacteria 1831
315 Ga0209758_1038567 3300025297 Bacteria 1830
316 Ga0209758_1112607 3300025297 Bacteria 750
317 Ga0209050_1000052 3300025298 Bacteria 351785
318 Ga0209256_1000101 3300025299 Bacteria 200246
319 Ga0209256_1000275 3300025299 Bacteria 90061
320 Ga0209256_1078197 3300025299 Bacteria 728
321 Ga0207426_1000207 3300025302 Bacteria 140594
322 Ga0207426_1000540 3300025302 Bacteria 54151
323 Ga0207426_1019579 3300025302 Bacteria 2363
324 Ga0209051_1000105 3300025303 Bacteria 160893
325 Ga0209051_1000623 3300025303 Bacteria 40736
326 Ga0209051_1109070 3300025303 Bacteria 726
327 Ga0209257_1000037 3300025304 Bacteria 612915
328 Ga0209257_1000096 3300025304 Bacteria 259390
329 Ga0209257_1001974 3300025304 Bacteria 22060
330 Ga0207656_10018066 3300025321 Bacteria 2770
331 Ga0207653_10001546 3300025885 Bacteria 7444
332 Ga0207682_10020658 3300025893 Bacteria 2586
333 Ga0207682_10052784 3300025893 Bacteria 1685
334 Ga0207682_10165548 3300025893 Bacteria 1004
335 Ga0207682_10183077 3300025893 Bacteria 957
336 Ga0207688_10078086 3300025901 Bacteria 1887
337 Ga0207680_10001996 3300025903 Bacteria 9560
338 Ga0207680_10188983 3300025903 Bacteria 1397
339 Ga0207680_10338463 3300025903 Bacteria 1055
340 Ga0207685_10358871 3300025905 Bacteria 737
341 Ga0207645_10000390 3300025907 Bacteria 36191
342 Ga0207645_10014239 3300025907 Bacteria 5327
343 Ga0207645_10131311 3300025907 Bacteria 1630
344 Ga0207643_11052147 3300025908 Bacteria 526
345 Ga0207705_10195513 3300025909 Bacteria 1531
346 Ga0207705_10750050 3300025909 Bacteria 758
347 Ga0207707_10024194 3300025912 Bacteria 5313
348 Ga0207707_10155219 3300025912 Bacteria 2002
349 Ga0207660_10007583 3300025917 Bacteria 7022
350 Ga0207660_10137207 3300025917 Bacteria 1867
351 Ga0207657_10591697 3300025919 Bacteria 866
352 Ga0207649_10311940 3300025920 Bacteria 1153
353 Ga0207649_10880503 3300025920 Bacteria 701
354 Ga0207652_10178174 3300025921 Bacteria 1909
355 Ga0207646_10249067 3300025922 Bacteria 1605
356 Ga0207681_10083944 3300025923 Bacteria 2256
357 Ga0207681_11362675 3300025923 Bacteria 595
358 Ga0207694_11007014 3300025924 Bacteria 705
359 Ga0207650_10078249 3300025925 Bacteria 2502
360 Ga0207650_10083503 3300025925 Bacteria 2426
361 Ga0207650_10103122 3300025925 Bacteria 2199
362 Ga0207650_10146559 3300025925 Bacteria 1860
363 Ga0207650_10312947 3300025925 Bacteria 1285
364 Ga0207650_10552207 3300025925 Bacteria 966
365 Ga0207659_10001313 3300025926 Bacteria 14851
366 Ga0207659_10457032 3300025926 Bacteria 1076
367 Ga0207659_10485811 3300025926 Bacteria 1044
368 Ga0207659_11258236 3300025926 Bacteria 636
369 Ga0207659_11311983 3300025926 Bacteria 621
370 Ga0207644_10003952 3300025931 Bacteria 9617
371 Ga0207644_10238047 3300025931 Bacteria 1448
372 Ga0207644_10502683 3300025931 Bacteria 1000
373 Ga0207690_10284466 3300025932 Bacteria 1289
374 Ga0207690_10846940 3300025932 Bacteria 757
375 Ga0207706_10035079 3300025933 Bacteria 4462
376 Ga0207706_10039260 3300025933 Bacteria 4196
377 Ga0207706_10192415 3300025933 Bacteria 1790
378 Ga0207706_10279804 3300025933 Bacteria 1455
379 Ga0207706_10822791 3300025933 Bacteria 788
380 Ga0207686_10122806 3300025934 Unclassified 1770
381 Ga0207686_10349259 3300025934 Bacteria 1113
382 Ga0207709_10079084 3300025935 Bacteria 2113
383 Ga0207709_10462095 3300025935 Bacteria 983
384 Ga0207709_11174369 3300025935 Bacteria 632
385 Ga0207670_10176130 3300025936 Bacteria 1608
386 Ga0207670_10294335 3300025936 Bacteria 1269
387 Ga0207670_10495990 3300025936 Bacteria 991
388 Ga0207669_10042987 3300025937 Bacteria 2643
389 Ga0207669_10338120 3300025937 Bacteria 1158
390 Ga0207669_10410568 3300025937 Bacteria 1063
391 Ga0207665_10387182 3300025939 Bacteria 1062
392 Ga0207691_10008918 3300025940 Bacteria 9629
393 Ga0207691_10045135 3300025940 Bacteria 4052
394 Ga0207691_10074226 3300025940 Bacteria 3068
395 Ga0207691_10108649 3300025940 Bacteria 2468
396 Ga0207691_10210473 3300025940 Bacteria 1689
397 Ga0207691_10306659 3300025940 Bacteria 1363
398 Ga0207691_10336992 3300025940 Bacteria 1291
399 Ga0207711_10019340 3300025941 Bacteria 5671
400 Ga0207711_10236747 3300025941 Bacteria 1673
401 Ga0207711_10237131 3300025941 Bacteria 1672
402 Ga0207711_11724074 3300025941 Bacteria 570
403 Ga0207689_10004319 3300025942 Bacteria 12943
404 Ga0207679_10053493 3300025945 Bacteria 2967
405 Ga0207679_10179929 3300025945 Bacteria 1748
406 Ga0207679_10306259 3300025945 Bacteria 1371
407 Ga0207679_10669872 3300025945 Bacteria 940
408 Ga0207667_10046719 3300025949 Bacteria 4585
409 Ga0207651_10002814 3300025960 Bacteria 8370
410 Ga0207651_10153349 3300025960 Bacteria 1796
411 Ga0207651_10169071 3300025960 Bacteria 1722
412 Ga0207651_10445715 3300025960 Bacteria 1110
413 Ga0207712_10015145 3300025961 Bacteria 4970
414 Ga0207712_10153176 3300025961 Bacteria 1783
415 Ga0207712_10211152 3300025961 Bacteria 1546
416 Ga0207668_10074109 3300025972 Bacteria 2442
417 Ga0207668_10860275 3300025972 Bacteria 805
418 Ga0207668_12076448 3300025972 Bacteria 512
419 Ga0207640_10128404 3300025981 Bacteria 1828
420 Ga0207640_10218792 3300025981 Bacteria 1456
421 Ga0207658_10004261 3300025986 Bacteria 9965
422 Ga0207658_10007627 3300025986 Bacteria 7369
423 Ga0207677_10000836 3300026023 Bacteria 17591
424 Ga0207677_10093726 3300026023 Bacteria 2190
425 Ga0207703_10000361 3300026035 Bacteria 48627
426 Ga0207703_12258860 3300026035 Bacteria 520
427 Ga0207639_10023779 3300026041 Bacteria 4426
428 Ga0207639_10592290 3300026041 Bacteria 1022
429 Ga0207639_11956137 3300026041 Bacteria 547
430 Ga0207678_10029809 3300026067 Bacteria 4764
431 Ga0207678_10065311 3300026067 Bacteria 3125
432 Ga0207678_10208596 3300026067 Bacteria 1671
433 Ga0207678_10603617 3300026067 Bacteria 962
434 Ga0207708_10018508 3300026075 Bacteria 5247
435 Ga0207708_10098926 3300026075 Bacteria 2255
436 Ga0207708_10167735 3300026075 Bacteria 1737
437 Ga0207702_10747095 3300026078 Bacteria 966
438 Ga0207702_10790555 3300026078 Bacteria 938
439 Ga0207702_11015484 3300026078 Bacteria 823
440 Ga0207702_11076643 3300026078 Bacteria 798
441 Ga0207641_10018243 3300026088 Bacteria 5752
442 Ga0207641_10566086 3300026088 Bacteria 1109
443 Ga0207648_10037742 3300026089 Bacteria 4254
444 Ga0207648_10302561 3300026089 Bacteria 1434
445 Ga0207648_10363760 3300026089 Bacteria 1306
446 Ga0207676_10001719 3300026095 Bacteria 16125
447 Ga0207676_10102042 3300026095 Bacteria 2380
448 Ga0207676_10126469 3300026095 Bacteria 2165
449 Ga0207674_10021212 3300026116 Bacteria 7003
450 Ga0207675_100010672 3300026118 Bacteria 8607
451 Ga0207675_100078226 3300026118 Bacteria 3099
452 Ga0207675_100147333 3300026118 Bacteria 2239
453 Ga0207675_100211910 3300026118 Bacteria 1864
454 Ga0207675_100540489 3300026118 Bacteria 1163
455 Ga0207683_10001709 3300026121 Bacteria 19640
456 Ga0207683_10033956 3300026121 Bacteria 4432
457 Ga0207683_10070738 3300026121 Bacteria 3083
458 Ga0207683_10125228 3300026121 Bacteria 2309
459 Ga0207683_10298569 3300026121 Bacteria 1474
460 Ga0207698_10267648 3300026142 Bacteria 1573
461 Ga0207698_10455416 3300026142 Bacteria 1236
462 Ga0207698_11395589 3300026142 Bacteria 715
463 Ga0268266_10002285 3300028379 Bacteria 20799
464 Ga0268266_10115646 3300028379 Bacteria 2382
465 Ga0268266_10396890 3300028379 Bacteria 1304
466 Ga0268266_11399553 3300028379 Bacteria 675
467 Ga0268265_10003365 3300028380 Bacteria 11521
468 Ga0268265_10585282 3300028380 Bacteria 1064
469 Ga0268265_11281724 3300028380 Bacteria 732
470 Ga0268264_10017246 3300028381 Bacteria 5915
471 Ga0268264_10157838 3300028381 Bacteria 2040
472 Ga0268264_10411075 3300028381 Bacteria 1303
473 Ga0307517_10164437 3300028786 Bacteria 1478
474 Ga0307515_10053598 3300028794 Bacteria 5946
475 Ga0307515_10055325 3300028794 Bacteria 5801
476 Ga0307515_10131191 3300028794 Bacteria 2758
477 Ga0265327_10004975 3300031251 Bacteria 11411
478 Ga0307513_10454762 3300031456 Bacteria 1004
479 Ga0307408_101365346 3300031548 Bacteria 666
480 Ga0307514_10033993 3300031649 Bacteria 4064
481 Ga0307516_10413356 3300031730 Bacteria 1007
482 Ga0307518_10118024 3300031838 Bacteria 1882
483 Ga0307406_10118786 3300031901 Bacteria 1834
484 Ga0307406_11000611 3300031901 Bacteria 717
485 Ga0307412_10165198 3300031911 Bacteria 1650
486 Ga0307412_10841088 3300031911 Bacteria 800
487 Ga0307412_10876139 3300031911 Bacteria 785
488 Ga0307412_10921711 3300031911 Bacteria 767
489 Ga0307409_100004076 3300031995 Bacteria 8123
490 Ga0307416_100009579 3300032002 Bacteria 6349
491 Ga0307411_10591751 3300032005 Bacteria 953
492 Ga0307415_100006556 3300032126 Bacteria 6293
493 Ga0307510_10413081 3300033180 Bacteria 792
494 Ga0373958_0062382 3300034819 Bacteria 810
495 Ga0373923_0281572 3300035111 Bacteria 784
496 Ga0373943_0365839 3300035170 Bacteria 828
497 Ga0373946_0215605 3300035171 Bacteria 925
498 Ga0373955_0464187 3300035172 Bacteria 772
499 Ga0373931_0187954 3300035691 Bacteria 1227
500 Ga0373935_0031096 3300035692 Bacteria 3311
501 Ga0373927_0020582 3300035695 Bacteria 4326
502 Ga0373927_0562123 3300035695 Bacteria 754
503 Ga0373947_0121755 3300035725 Bacteria 1658
504 Ga0373947_0482867 3300035725 Bacteria 841
505 Ga0373937_0913899 3300036401 Bacteria 826
506 Ga0373925_0003246 3300037068 Bacteria 12682
507 Ga0373925_0222065 3300037068 Bacteria 1508
508 Ga0395900_0129134 3300037418 Bacteria 2591
509 Ga0395898_1468729 3300037466 Bacteria 608
510 Ga0395905_0014761 3300037471 Bacteria 7447
511 Ga0395905_0047160 3300037471 Bacteria 4039
512 Ga0395905_0155008 3300037471 Bacteria 2154
513 Ga0395905_0207416 3300037471 Bacteria 1836
514 Ga0395905_1567577 3300037471 Bacteria 563
515 Ga0436364_0514139 3300037853 Bacteria 1176
516 Ga0395901_0724011 3300038443 Bacteria 990
517 Ga0451800_0433568 3300041459 Bacteria 628
518 Ga0451802_1569538 3300041460 Bacteria 754
519 Ga0451807_0052150 3300041486 Bacteria 504
520 Ga0451851_0287805 3300041507 Bacteria 589
521 Ga0451843_1626818 3300041509 Bacteria 699
522 Ga0451853_2956183 3300041512 Bacteria 1128
523 Ga0451853_3797753 3300041512 Bacteria 592
524 Ga0451853_4100126 3300041512 Bacteria 1106
525 Ga0439437_024840 3300042000 Bacteria 737
526 Ga0439449_0095922 3300042007 Bacteria 1096
527 Ga0439450_018359 3300042008 Bacteria 1469
528 Ga0439457_024301 3300042014 Bacteria 1341
529 Ga0450898_006253 3300042134 Bacteria 1822
530 Ga0439464_0032526 3300042439 Bacteria 1466
531 Ga0451577_0573749 3300042876 Bacteria 1024
532 Ga0466964_0539086 3300044706 Bacteria 632
533 Ga0453684_0708502 3300044712 Bacteria 1093
534 Ga0466957_0180062 3300044842 Bacteria 1380
535 Ga0466960_0242035 3300044901 Bacteria 999
536 Ga0451576_2169605 3300045051 Bacteria 571
537 Ga0495627_005958 3300046453 Bacteria 4843
538 Ga0495592_0000058 3300046454 Bacteria 101492
539 Ga0495629_0191368 3300046459 Bacteria 1416
540 Ga0495629_0243508 3300046459 Bacteria 1238
541 Ga0495629_0329739 3300046459 Bacteria 1043
542 Ga0495638_0016050 3300046460 Bacteria 5020
543 Ga0495641_0545395 3300046461 Bacteria 529
544 Ga0495651_0304841 3300046462 Bacteria 1067
545 Ga0495650_0053682 3300046471 Bacteria 1649
546 Ga0495580_0344252 3300046472 Bacteria 1011
547 Ga0495580_0452427 3300046472 Bacteria 861
548 Ga0495582_0533588 3300046473 Bacteria 679
549 Ga0495639_0143576 3300046475 Bacteria 1148
550 Ga0495585_0318001 3300046492 Bacteria 762
551 Ga0495608_0284954 3300046511 Bacteria 1025
552 Ga0495610_0079045 3300046512 Bacteria 1515
553 Ga0495616_0000833 3300046513 Bacteria 22530
554 Ga0495618_0616633 3300046514 Bacteria 644
555 Ga0495630_0416870 3300046517 Bacteria 1029
556 Ga0495631_0000789 3300046518 Bacteria 20239
557 Ga0495654_0010673 3300046530 Bacteria 4990
558 Ga0495665_0108868 3300046531 Bacteria 1454
559 Ga0495598_0097439 3300046537 Bacteria 968
560 Ga0495598_0261433 3300046537 Bacteria 644
561 Ga0495621_0179534 3300046539 Bacteria 844
562 Ga0495645_0431522 3300046543 Bacteria 834
563 Ga0495622_0122893 3300046557 Bacteria 1185
564 Ga0495633_0218403 3300046558 Bacteria 873
565 Ga0495667_0413351 3300046559 Bacteria 849
566 Ga0495625_0097109 3300046660 Bacteria 2028
567 Ga0495625_0443581 3300046660 Bacteria 803
568 Ga0495635_0231175 3300046663 Bacteria 1249
569 Ga0495588_0008018 3300046674 Bacteria 4828
570 Ga0495588_0014198 3300046674 Bacteria 3809
571 Ga0495588_0033683 3300046674 Bacteria 2588
572 Ga0495646_0288648 3300046680 Bacteria 870
573 Ga0495646_0485721 3300046680 Bacteria 635
574 Ga0495647_0016085 3300046681 Bacteria 2630
575 Ga0495647_0061057 3300046681 Bacteria 1488
576 Ga0495658_0040949 3300046683 Bacteria 2578
577 Ga0495658_0234149 3300046683 Bacteria 1152
578 Ga0495658_0385662 3300046683 Bacteria 892
579 Ga0495669_0311181 3300046684 Bacteria 760
580 Ga0495613_0214724 3300046689 Bacteria 1352
581 Ga0495613_0468401 3300046689 Bacteria 852
582 Ga0495624_0043725 3300046690 Bacteria 2857
583 Ga0495670_0552397 3300046691 Bacteria 627
584 Ga0495671_0009791 3300046692 Bacteria 5338
585 Ga0495600_0158137 3300046809 Bacteria 1466
586 Ga0495660_0134011 3300046810 Bacteria 1240
587 Ga0495636_0185791 3300047318 Bacteria 945
588 Ga0495636_0302220 3300047318 Bacteria 749
589 Ga0495676_0039729 3300047321 Bacteria 3893
590 Ga0495676_0624561 3300047321 Bacteria 700
591 Ga0495684_0167211 3300047471 Bacteria 1638
592 Ga0495686_0002279 3300047472 Bacteria 18470
593 Ga0495593_0000223 3300047673 Bacteria 30267
594 Ga0495614_0005881 3300048089 Bacteria 5527
595 Ga0496100_0029754 3300048903 Bacteria 3381
596 Ga0496100_0119215 3300048903 Bacteria 1844
597 Ga0496101_0015354 3300048904 Bacteria 5159
598 Ga0496101_0248415 3300048904 Bacteria 1386
599 Ga0496102_0007310 3300048905 Bacteria 9427
600 Ga0496102_0015560 3300048905 Bacteria 6627
601 Ga0496103_0021657 3300048906 Bacteria 3868
602 Ga0496103_0023539 3300048906 Bacteria 3715
603 Ga0496104_0019260 3300048907 Bacteria 6241
604 Ga0496104_0064618 3300048907 Bacteria 3471
605 Ga0496104_0112570 3300048907 Bacteria 2610
606 Ga0496104_0361603 3300048907 Bacteria 1364
607 Ga0496105_0016369 3300048908 Bacteria 5918
608 Ga0496105_0019171 3300048908 Bacteria 5515
609 Ga0496106_0006393 3300048909 Bacteria 8720
610 Ga0496106_0017826 3300048909 Bacteria 5251
611 Ga0496107_0002641 3300048910 Bacteria 11722
612 Ga0496108_0049577 3300048911 Bacteria 3512
613 Ga0496108_0354776 3300048911 Bacteria 1280
614 Ga0496108_0470970 3300048911 Bacteria 1097
615 Ga0496109_0223673 3300048912 Bacteria 1770
616 Ga0496109_0251527 3300048912 Bacteria 1664
617 Ga0496109_0268256 3300048912 Bacteria 1608
618 Ga0496109_0756596 3300048912 Bacteria 909
619 Ga0496110_0177112 3300048913 Bacteria 1936
620 Ga0496110_0384216 3300048913 Bacteria 1279
621 Ga0496110_0835239 3300048913 Bacteria 826
622 Ga0496111_0339128 3300048914 Bacteria 1113
623 Ga0496111_0565297 3300048914 Bacteria 834
624 Ga0496112_1721730 3300048915 Bacteria 539
625 Ga0496112_1905277 3300048915 Bacteria 506
626 Ga0496113_0041502 3300048916 Bacteria 3396
627 Ga0496114_0094349 3300048917 Bacteria 2545
628 Ga0496114_0276326 3300048917 Bacteria 1480
629 Ga0496114_1446122 3300048917 Bacteria 575
630 Ga0496115_0015407 3300048918 Bacteria 5798
631 Ga0496116_0036997 3300048919 Bacteria 3409
632 Ga0496117_0039108 3300048920 Bacteria 3505
633 Ga0496117_0050817 3300048920 Bacteria 2937
634 Ga0496117_0395931 3300048920 Bacteria 698
635 Ga0496118_0001366 3300048921 Bacteria 36777
636 Ga0496118_0193224 3300048921 Bacteria 1215
637 Ga0496121_0029441 3300048924 Bacteria 5076
638 Ga0496121_0158558 3300048924 Bacteria 1657
639 Ga0496121_0192495 3300048924 Bacteria 1461
640 Ga0496122_0122283 3300048925 Bacteria 1675
641 Ga0496122_0548388 3300048925 Bacteria 551
642 Ga0496123_0073940 3300048926 Bacteria 2112
643 Ga0496123_0127918 3300048926 Bacteria 1414
644 Ga0496123_0178400 3300048926 Bacteria 1112
645 Ga0496124_0093624 3300048927 Bacteria 2445
646 Ga0496124_0256003 3300048927 Bacteria 1291
647 Ga0496125_0015802 3300048928 Bacteria 7274
648 Ga0496125_0222206 3300048928 Bacteria 1216
649 Ga0496125_0409142 3300048928 Bacteria 790
650 Ga0501031_0457036 3300049568 Bacteria 825
651 Ga0501032_0341146 3300049569 Bacteria 966
652 Ga0501036_0283276 3300049572 Bacteria 1387
653 Ga0501037_0162286 3300049573 Bacteria 1593
654 Ga0501038_0754832 3300049574 Bacteria 725
655 Ga0501038_1272917 3300049574 Bacteria 532
656 Ga0501040_0081459 3300049576 Bacteria 2243
657 Ga0501041_0130369 3300049577 Bacteria 1566
658 Ga0501041_0508480 3300049577 Bacteria 767
659 Ga0501042_0245354 3300049578 Bacteria 1292
660 Ga0501043_0000012 3300049579 Bacteria 188907
661 Ga0501046_0000030 3300049580 Bacteria 187803
662 Ga0501046_0019056 3300049580 Bacteria 5696
663 Ga0501047_0000049 3300049581 Bacteria 162513
664 Ga0501048_0000082 3300049582 Bacteria 49693
665 Ga0501048_1230243 3300049582 Bacteria 538
666 Ga0501069_0140406 3300049585 Bacteria 1386
667 Ga0501072_0426398 3300049588 Bacteria 1051
668 Ga0501079_0027840 3300049741 Bacteria 4335
669 Ga0501080_1200263 3300049742 Bacteria 652
670 Ga0501081_0008289 3300049743 Bacteria 6744
671 Ga0501263_091770 3300049760 Bacteria 513
672 Ga0501268_028569 3300049765 Bacteria 997
673 Ga0501035_0121391 3300049822 Bacteria 2284
674 Ga0501035_0164958 3300049822 Bacteria 1916
675 Ga0501044_0213794 3300049823 Bacteria 1881
676 Ga0501045_0234956 3300049824 Bacteria 1365
677 nmdc:mga03n38_213748_c1 3300050490 Bacteria 1003
678 nmdc:mga0yw44_630934_c1 3300050492 Bacteria 728
679 nmdc:mga0k408_27880_c1 3300050493 Bacteria 3210
680 nmdc:mga0k408_437683_c1 3300050493 Bacteria 777
681 nmdc:mga06z11_575755_c1 3300050494 Bacteria 684
682 nmdc:mga07m45_238052_c1 3300050496 Bacteria 1059
683 nmdc:mga06r32_305933_c1 3300050510 Bacteria 1575
684 nmdc:mga08y16_703345_c1 3300050511 Bacteria 1010
685 Ga0500610_0007158 3300053079 Bacteria 4752
686 Ga0495655_0079095 3300053083 Bacteria 936
687 Ga0495619_0342849 3300053085 Bacteria 1034
688 Ga0500643_009509 3300053087 Bacteria 3707
689 Ga0500651_0000035 3300053093 Bacteria 105120
690 Ga0500651_0161799 3300053093 Bacteria 1338
691 Ga0500569_057658 3300053109 Bacteria 1191
692 Ga0500571_008144 3300053110 Bacteria 5736
693 Ga0500593_000193 3300053117 Bacteria 24731
694 Ga0500594_0009080 3300053118 Bacteria 2281
695 Ga0500607_005126 3300053121 Bacteria 8671
696 Ga0500608_019016 3300053122 Bacteria 3143
697 Ga0500608_130248 3300053122 Bacteria 1129
698 Ga0500618_020546 3300053125 Bacteria 1617
699 Ga0500628_107518 3300053129 Bacteria 745
700 Ga0500655_002787 3300053133 Bacteria 3174
701 Ga0500658_0000047 3300053134 Bacteria 66543
702 Ga0500658_0000775 3300053134 Bacteria 13182
703 Ga0500559_0028574 3300053136 Bacteria 2383
704 Ga0500568_0006963 3300053139 Bacteria 5604
705 Ga0500574_004603 3300053141 Bacteria 2595
706 Ga0500604_0102689 3300053151 Bacteria 944
707 Ga0500616_0170079 3300053153 Bacteria 990
708 Ga0500619_132599 3300053154 Bacteria 849
709 Ga0500624_048094 3300053157 Bacteria 786
710 Ga0500634_0003941 3300053161 Bacteria 6744
711 Ga0500634_0042438 3300053161 Bacteria 2468
712 Ga0500638_005302 3300053162 Bacteria 5112
713 Ga0500636_0041972 3300053177 Bacteria 2705
714 Ga0500625_093228 3300053729 Bacteria 1283
715 Ga0500596_009160 3300053735 Bacteria 1553
716 Ga0501082_0130669 3300060353 Bacteria 2179
717 2599621147 2599185214 Bacteria 8209958
718 2599675166 2599185226 Bacteria 8233575
719 2599678237 2599185227 Bacteria 8246414
720 2599690658 2599185229 Bacteria 8216126
721 2738882582 2738541307 Bacteria 8606193
722 2739247870 2738543013 Bacteria 5618633
723 2819602426 2818991446 Bacteria 7757362
724 2831270085 2831265667 Bacteria 7184833
725 2838054905 2838054893 Bacteria 7451788
726 2885201435 2885198086 Bacteria 7212419
727 2885215089 2885211737 Bacteria 7212420
728 2899927844 2899924645 Bacteria 7487985
729 2928042462 2928037797 Bacteria 7273642
730 2928048487 2928044640 Bacteria 7271509
731 2928054812 2928051484 Bacteria 7773759
732 2928068250 2928064002 Bacteria 7419480
733 2928073876 2928070936 Bacteria 8062541
734 2928086124 2928084124 Bacteria 7159212
735 2945977757 2945972063 Bacteria 6086495
736 2945986483 2945984333 Bacteria 7358892
737 Ga0065715_10274313
738 JGI24740J21852_10046222
739 JGI24739J22299_10012236
740 JGI24739J22299_10050669
741 JGI25158J39367_1023527
742 JGI25152J39213_1000498
743 JGI25152J39213_1006493
744 JGI25152J39213_1011753
745 JGI25150J39212_1001039
746 JGI25159J45721_1000329
747 JGI25159J45721_1022287
748 JGI25159J45721_1022656
749 JGI25151J46595_10009852
750 JGI25151J46595_10017835
751 JGI25151J46595_10032031
752 JGI25151J46595_10156535
753 JGI25153J46596_10009544
754 JGI25153J46596_10019585
755 JGI25153J46596_10052825
756 rootH1_10087169
757 rootH1_10108650
758 JGI25160J50197_1000602
759 JGI25160J50197_1037620
760 JGI25161J50226_1000391
761 JGI25161J50226_1003580
762 Ga0006562J51391_1005200
763 Ga0006562J51391_1005202
764 Ga0055526_1001055
765 Ga0055526_1017319
766 Ga0055537_1002816
767 Ga0055537_1029185
768 Ga0055537_1029198
769 Ga0055524_1000842
770 Ga0055524_1004396
771 Ga0055536_1011805
772 Ga0055534_1000508
773 Ga0055534_1000934
774 Ga0055534_1037574
775 Ga0055528_1005710
776 Ga0055528_1059873
777 Ga0055528_1059913
778 Ga0055530_10002953
779 Ga0055540_1003279
780 Ga0055540_1003507
781 Ga0055540_1068703
782 Ga0055531_10002575
783 Ga0055531_10003304
784 Ga0055543_1000515
785 Ga0055543_1004181
786 Ga0065165_1001705
787 Ga0065165_1022414
788 Ga0065165_1058799
789 Ga0065715_10115985
790 Ga0070658_10317162
791 Ga0070658_10791453
792 Ga0070658_10988823
793 Ga0070676_10007826
794 Ga0070676_11537126
795 Ga0070676_11545420
796 Ga0070670_100069059
797 Ga0070670_100075434
798 Ga0070670_100109813
799 Ga0070670_100130180
800 Ga0070670_100266732
801 Ga0070670_100466947
802 Ga0070670_100520859
803 Ga0070677_10016841
804 Ga0070677_10201508
805 Ga0070677_10244986
806 Ga0068869_100051553
807 Ga0070666_10000930
808 Ga0070680_100016107
809 Ga0070680_100055341
810 Ga0070682_100822083
811 Ga0068868_100001477
812 Ga0068868_100160266
813 Ga0070660_100555833
814 Ga0070689_100361471
815 Ga0070689_100514258
816 Ga0070691_10008832
817 Ga0070687_100148564
818 Ga0070661_100107183
819 Ga0070661_100426626
820 Ga0070692_10023165
821 Ga0070668_100015262
822 Ga0070668_100027303
823 Ga0070668_100900761
824 Ga0070668_100988250
825 Ga0070668_101604330
826 Ga0070669_100004393
827 Ga0070669_100136757
828 Ga0070669_100166479
829 Ga0070669_100716912
830 Ga0070669_101139410
831 Ga0070675_100002416
832 Ga0070675_100013976
833 Ga0070675_100209411
834 Ga0070675_100297713
835 Ga0070675_100546704
836 Ga0070675_100780384
837 Ga0070675_100934157
838 Ga0070675_101015838
839 Ga0070675_101532827
840 Ga0070671_100030696
841 Ga0070671_100079789
842 Ga0070671_100478774
843 Ga0070671_100585622
844 Ga0070671_101565383
845 Ga0070674_100011834
846 Ga0070674_100060388
847 Ga0070674_100200309
848 Ga0070674_100612166
849 Ga0070673_100002692
850 Ga0070673_100613067
851 Ga0070673_100759951
852 Ga0070688_100266726
853 Ga0070688_100703374
854 Ga0070659_101041292
855 Ga0070659_101239793
856 Ga0070667_100002444
857 Ga0070667_100049950
858 Ga0070667_100654291
859 Ga0070703_10003246
860 Ga0070714_101975333
861 Ga0070701_10048544
862 Ga0070701_10136007
863 Ga0070705_100001692
864 Ga0070700_100009821
865 Ga0070700_100092282
866 Ga0070700_101586935
867 Ga0070694_100059886
868 Ga0070694_100938551
869 Ga0070708_100724933
870 Ga0070663_100074462
871 Ga0070663_100257698
872 Ga0070663_100300490
873 Ga0070678_100000637
874 Ga0070678_100045900
875 Ga0070678_100052300
876 Ga0070678_100162823
877 Ga0070662_100069554
878 Ga0070662_100293101
879 Ga0070662_100795814
880 Ga0070681_10163545
881 Ga0068867_100003306
882 Ga0068867_100292576
883 Ga0068867_100369135
884 Ga0068867_101077483
885 Ga0070685_10071084
886 Ga0070706_100199314
887 Ga0070707_100274131
888 Ga0070699_100012641
889 Ga0070679_100192838
890 Ga0070697_100020321
891 Ga0068853_100001041
892 Ga0068853_100199026
893 Ga0068853_101993864
894 Ga0070672_100021253
895 Ga0070672_100032759
896 Ga0070672_100037129
897 Ga0070672_100132917
898 Ga0070672_100182064
899 Ga0070672_100319070
900 Ga0070686_100113829
901 Ga0070686_100773703
902 Ga0070695_100014839
903 Ga0070696_100002547
904 Ga0070693_100034480
905 Ga0070665_100026141
906 Ga0070665_100085918
907 Ga0070665_101571773
908 Ga0070704_100004604
909 Ga0070664_100080962
910 Ga0070664_100165950
911 Ga0070664_100403223
912 Ga0070664_101293333
913 Ga0068857_100014049
914 Ga0068854_100062400
915 Ga0068854_100331657
916 Ga0068856_101173392
917 Ga0068852_100013930
918 Ga0068852_100136246
919 Ga0068852_100246558
920 Ga0068859_100001613
921 Ga0068859_100015903
922 Ga0068859_100136458
923 Ga0068864_100001828
924 Ga0068864_100012911
925 Ga0068864_100342764
926 Ga0068866_10044731
927 Ga0068866_10571615
928 Ga0068861_100072097
929 Ga0068861_100088190
930 Ga0068861_100110128
931 Ga0068861_101474519
932 Ga0068851_10341126
933 Ga0068870_10084401
934 Ga0068870_10672361
935 Ga0068863_100083293
936 Ga0068858_100001347
937 Ga0068858_101477595
938 Ga0068860_100016513
939 Ga0068860_100019309
940 Ga0068860_100120892
941 Ga0068862_100000330
942 Ga0068862_100245817
943 Ga0068862_102067142
944 Ga0075365_10024435
945 Ga0075365_10570691
946 Ga0075363_100067589
947 Ga0070715_10192728
948 Ga0070716_100684158
949 Ga0075366_10050783
950 Ga0097621_100007918
951 Ga0075370_10549178
952 Ga0068871_100009531
953 Ga0068871_100257750
954 Ga0075428_101211281
955 Ga0075431_100270755
956 Ga0068865_100032603
957 Ga0068865_100042325
958 Ga0097620_100001613
959 Ga0097620_100015903
960 Ga0097620_100136443
961 Ga0105244_10025712
962 Ga0105244_10126396
963 Ga0105244_10252902
964 Ga0105240_10235339
965 Ga0105240_10290607
966 Ga0111539_11401347
967 Ga0105245_10317242
968 Ga0105243_10087655
969 Ga0105243_10134396
970 Ga0105243_10709184
971 Ga0105243_11657273
972 Ga0105242_10094332
973 Ga0105242_10353474
974 Ga0105242_11220092
975 Ga0105248_10005486
976 Ga0105248_10645592
977 Ga0105248_10676176
978 Ga0105238_10214417
979 Ga0105238_11009783
980 Ga0105249_10008716
981 Ga0105249_10018770
982 Ga0105249_11060732
983 Ga0105239_10612575
984 Ga0105246_10165677
985 Ga0105246_10384559
986 Ga0157325_1014910
987 Ga0157373_10252010
988 Ga0157373_10728811
989 Ga0157371_10053034
990 Ga0157371_10098377
991 Ga0157371_10297451
992 Ga0157370_10082144
993 Ga0157369_10000249
994 Ga0157374_10033778
995 Ga0157374_11338321
996 Ga0157378_11114737
997 Ga0163162_10017053
998 Ga0163162_10351632
999 Ga0157375_10004033
1000 Ga0157375_10006696
1001 Ga0157375_10114320
1002 Ga0157375_10114364
1003 Ga0157375_10217316
1004 Ga0157375_11912561
1005 Ga0163163_10003621
1006 Ga0163163_11112018
1007 Ga0163163_13130729
1008 Ga0157380_10016401
1009 Ga0157380_10053091
1010 Ga0157380_10370345
1011 Ga0157380_11554011
1012 Ga0157379_10006033
1013 Ga0157379_10243041
1014 Ga0157379_11416073
1015 Ga0157376_10971108
1016 Ga0163161_10013297
1017 Ga0163161_10162103
1018 Ga0163161_10168207
1019 Ga0163161_10358022
1020 Ga0163161_10554777
1021 Ga0163161_11440491
1022 Ga0209436_100599
1023 Ga0209436_103730
1024 Ga0207425_1000127
1025 Ga0207425_1002431
1026 Ga0209129_1000117
1027 Ga0209129_1013264
1028 Ga0209129_1019297
1029 Ga0209565_1000555
1030 Ga0209565_1000594
1031 Ga0209565_1047917
1032 Ga0209673_1000493
1033 Ga0209673_1001269
1034 Ga0209673_1054231
1035 Ga0209130_1000850
1036 Ga0209130_1001158
1037 Ga0209130_1022626
1038 Ga0209675_1000597
1039 Ga0209675_1002001
1040 Ga0209675_1005227
1041 Ga0209675_1073231
1042 Ga0209676_1001219
1043 Ga0209025_1000233
1044 Ga0209025_1006547
1045 Ga0209025_1023519
1046 Ga0209025_1046615
1047 Ga0209564_1000108
1048 Ga0209564_1000212
1049 Ga0209758_1000330
1050 Ga0209758_1038547
1051 Ga0209758_1038567
1052 Ga0209758_1112607
1053 Ga0209050_1000052
1054 Ga0209256_1000101
1055 Ga0209256_1000275
1056 Ga0209256_1078197
1057 Ga0207426_1000207
1058 Ga0207426_1000540
1059 Ga0207426_1019579
1060 Ga0209051_1000105
1061 Ga0209051_1000623
1062 Ga0209051_1109070
1063 Ga0209257_1000037
1064 Ga0209257_1000096
1065 Ga0209257_1001974
1066 Ga0207656_10018066
1067 Ga0207653_10001546
1068 Ga0207682_10020658
1069 Ga0207682_10052784
1070 Ga0207682_10165548
1071 Ga0207682_10183077
1072 Ga0207688_10078086
1073 Ga0207680_10001996
1074 Ga0207680_10188983
1075 Ga0207680_10338463
1076 Ga0207685_10358871
1077 Ga0207645_10000390
1078 Ga0207645_10014239
1079 Ga0207645_10131311
1080 Ga0207643_11052147
1081 Ga0207705_10195513
1082 Ga0207705_10750050
1083 Ga0207707_10024194
1084 Ga0207707_10155219
1085 Ga0207660_10007583
1086 Ga0207660_10137207
1087 Ga0207657_10591697
1088 Ga0207649_10311940
1089 Ga0207649_10880503
1090 Ga0207652_10178174
1091 Ga0207646_10249067
1092 Ga0207681_10083944
1093 Ga0207681_11362675
1094 Ga0207694_11007014
1095 Ga0207650_10078249
1096 Ga0207650_10083503
1097 Ga0207650_10103122
1098 Ga0207650_10146559
1099 Ga0207650_10312947
1100 Ga0207650_10552207
1101 Ga0207659_10001313
1102 Ga0207659_10457032
1103 Ga0207659_10485811
1104 Ga0207659_11258236
1105 Ga0207659_11311983
1106 Ga0207644_10003952
1107 Ga0207644_10238047
1108 Ga0207644_10502683
1109 Ga0207690_10284466
1110 Ga0207690_10846940
1111 Ga0207706_10035079
1112 Ga0207706_10039260
1113 Ga0207706_10192415
1114 Ga0207706_10279804
1115 Ga0207706_10822791
1116 Ga0207686_10122806
1117 Ga0207686_10349259
1118 Ga0207709_10079084
1119 Ga0207709_10462095
1120 Ga0207709_11174369
1121 Ga0207670_10176130
1122 Ga0207670_10294335
1123 Ga0207670_10495990
1124 Ga0207669_10042987
1125 Ga0207669_10338120
1126 Ga0207669_10410568
1127 Ga0207665_10387182
1128 Ga0207691_10008918
1129 Ga0207691_10045135
1130 Ga0207691_10074226
1131 Ga0207691_10108649
1132 Ga0207691_10210473
1133 Ga0207691_10306659
1134 Ga0207691_10336992
1135 Ga0207711_10019340
1136 Ga0207711_10236747
1137 Ga0207711_10237131
1138 Ga0207711_11724074
1139 Ga0207689_10004319
1140 Ga0207679_10053493
1141 Ga0207679_10179929
1142 Ga0207679_10306259
1143 Ga0207679_10669872
1144 Ga0207667_10046719
1145 Ga0207651_10002814
1146 Ga0207651_10153349
1147 Ga0207651_10169071
1148 Ga0207651_10445715
1149 Ga0207712_10015145
1150 Ga0207712_10153176
1151 Ga0207712_10211152
1152 Ga0207668_10074109
1153 Ga0207668_10860275
1154 Ga0207668_12076448
1155 Ga0207640_10128404
1156 Ga0207640_10218792
1157 Ga0207658_10004261
1158 Ga0207658_10007627
1159 Ga0207677_10000836
1160 Ga0207677_10093726
1161 Ga0207703_10000361
1162 Ga0207703_12258860
1163 Ga0207639_10023779
1164 Ga0207639_10592290
1165 Ga0207639_11956137
1166 Ga0207678_10029809
1167 Ga0207678_10065311
1168 Ga0207678_10208596
1169 Ga0207678_10603617
1170 Ga0207708_10018508
1171 Ga0207708_10098926
1172 Ga0207708_10167735
1173 Ga0207702_10747095
1174 Ga0207702_10790555
1175 Ga0207702_11015484
1176 Ga0207702_11076643
1177 Ga0207641_10018243
1178 Ga0207641_10566086
1179 Ga0207648_10037742
1180 Ga0207648_10302561
1181 Ga0207648_10363760
1182 Ga0207676_10001719
1183 Ga0207676_10102042
1184 Ga0207676_10126469
1185 Ga0207674_10021212
1186 Ga0207675_100010672
1187 Ga0207675_100078226
1188 Ga0207675_100147333
1189 Ga0207675_100211910
1190 Ga0207675_100540489
1191 Ga0207683_10001709
1192 Ga0207683_10033956
1193 Ga0207683_10070738
1194 Ga0207683_10125228
1195 Ga0207683_10298569
1196 Ga0207698_10267648
1197 Ga0207698_10455416
1198 Ga0207698_11395589
1199 Ga0268266_10002285
1200 Ga0268266_10115646
1201 Ga0268266_10396890
1202 Ga0268266_11399553
1203 Ga0268265_10003365
1204 Ga0268265_10585282
1205 Ga0268265_11281724
1206 Ga0268264_10017246
1207 Ga0268264_10157838
1208 Ga0268264_10411075
1209 Ga0307517_10164437
1210 Ga0307515_10053598
1211 Ga0307515_10055325
1212 Ga0307515_10131191
1213 Ga0265327_10004975
1214 Ga0307513_10454762
1215 Ga0307408_101365346
1216 Ga0307514_10033993
1217 Ga0307516_10413356
1218 Ga0307518_10118024
1219 Ga0307406_10118786
1220 Ga0307406_11000611
1221 Ga0307412_10165198
1222 Ga0307412_10841088
1223 Ga0307412_10876139
1224 Ga0307412_10921711
1225 Ga0307409_100004076
1226 Ga0307416_100009579
1227 Ga0307411_10591751
1228 Ga0307415_100006556
1229 Ga0307510_10413081
1230 Ga0373958_0062382
1231 Ga0373923_0281572
1232 Ga0373943_0365839
1233 Ga0373946_0215605
1234 Ga0373955_0464187
1235 Ga0373931_0187954
1236 Ga0373935_0031096
1237 Ga0373927_0020582
1238 Ga0373927_0562123
1239 Ga0373947_0121755
1240 Ga0373947_0482867
1241 Ga0373937_0913899
1242 Ga0373925_0003246
1243 Ga0373925_0222065
1244 Ga0395900_0129134
1245 Ga0395898_1468729
1246 Ga0395905_0014761
1247 Ga0395905_0047160
1248 Ga0395905_0155008
1249 Ga0395905_0207416
1250 Ga0395905_1567577
1251 Ga0436364_0514139
1252 Ga0395901_0724011
1253 Ga0451800_0433568
1254 Ga0451802_1569538
1255 Ga0451807_0052150
1256 Ga0451851_0287805
1257 Ga0451843_1626818
1258 Ga0451853_2956183
1259 Ga0451853_3797753
1260 Ga0451853_4100126
1261 Ga0439437_024840
1262 Ga0439449_0095922
1263 Ga0439450_018359
1264 Ga0439457_024301
1265 Ga0450898_006253
1266 Ga0439464_0032526
1267 Ga0451577_0573749
1268 Ga0466964_0539086
1269 Ga0453684_0708502
1270 Ga0466957_0180062
1271 Ga0466960_0242035
1272 Ga0451576_2169605
1273 Ga0495627_005958
1274 Ga0495592_0000058
1275 Ga0495629_0191368
1276 Ga0495629_0243508
1277 Ga0495629_0329739
1278 Ga0495638_0016050
1279 Ga0495641_0545395
1280 Ga0495651_0304841
1281 Ga0495650_0053682
1282 Ga0495580_0344252
1283 Ga0495580_0452427
1284 Ga0495582_0533588
1285 Ga0495639_0143576
1286 Ga0495585_0318001
1287 Ga0495608_0284954
1288 Ga0495610_0079045
1289 Ga0495616_0000833
1290 Ga0495618_0616633
1291 Ga0495630_0416870
1292 Ga0495631_0000789
1293 Ga0495654_0010673
1294 Ga0495665_0108868
1295 Ga0495598_0097439
1296 Ga0495598_0261433
1297 Ga0495621_0179534
1298 Ga0495645_0431522
1299 Ga0495622_0122893
1300 Ga0495633_0218403
1301 Ga0495667_0413351
1302 Ga0495625_0097109
1303 Ga0495625_0443581
1304 Ga0495635_0231175
1305 Ga0495588_0008018
1306 Ga0495588_0014198
1307 Ga0495588_0033683
1308 Ga0495646_0288648
1309 Ga0495646_0485721
1310 Ga0495647_0016085
1311 Ga0495647_0061057
1312 Ga0495658_0040949
1313 Ga0495658_0234149
1314 Ga0495658_0385662
1315 Ga0495669_0311181
1316 Ga0495613_0214724
1317 Ga0495613_0468401
1318 Ga0495624_0043725
1319 Ga0495670_0552397
1320 Ga0495671_0009791
1321 Ga0495600_0158137
1322 Ga0495660_0134011
1323 Ga0495636_0185791
1324 Ga0495636_0302220
1325 Ga0495676_0039729
1326 Ga0495676_0624561
1327 Ga0495684_0167211
1328 Ga0495686_0002279
1329 Ga0495593_0000223
1330 Ga0495614_0005881
1331 Ga0496100_0029754
1332 Ga0496100_0119215
1333 Ga0496101_0015354
1334 Ga0496101_0248415
1335 Ga0496102_0007310
1336 Ga0496102_0015560
1337 Ga0496103_0021657
1338 Ga0496103_0023539
1339 Ga0496104_0019260
1340 Ga0496104_0064618
1341 Ga0496104_0112570
1342 Ga0496104_0361603
1343 Ga0496105_0016369
1344 Ga0496105_0019171
1345 Ga0496106_0006393
1346 Ga0496106_0017826
1347 Ga0496107_0002641
1348 Ga0496108_0049577
1349 Ga0496108_0354776
1350 Ga0496108_0470970
1351 Ga0496109_0223673
1352 Ga0496109_0251527
1353 Ga0496109_0268256
1354 Ga0496109_0756596
1355 Ga0496110_0177112
1356 Ga0496110_0384216
1357 Ga0496110_0835239
1358 Ga0496111_0339128
1359 Ga0496111_0565297
1360 Ga0496112_1721730
1361 Ga0496112_1905277
1362 Ga0496113_0041502
1363 Ga0496114_0094349
1364 Ga0496114_0276326
1365 Ga0496114_1446122
1366 Ga0496115_0015407
1367 Ga0496116_0036997
1368 Ga0496117_0039108
1369 Ga0496117_0050817
1370 Ga0496117_0395931
1371 Ga0496118_0001366
1372 Ga0496118_0193224
1373 Ga0496121_0029441
1374 Ga0496121_0158558
1375 Ga0496121_0192495
1376 Ga0496122_0122283
1377 Ga0496122_0548388
1378 Ga0496123_0073940
1379 Ga0496123_0127918
1380 Ga0496123_0178400
1381 Ga0496124_0093624
1382 Ga0496124_0256003
1383 Ga0496125_0015802
1384 Ga0496125_0222206
1385 Ga0496125_0409142
1386 Ga0501031_0457036
1387 Ga0501032_0341146
1388 Ga0501036_0283276
1389 Ga0501037_0162286
1390 Ga0501038_0754832
1391 Ga0501038_1272917
1392 Ga0501040_0081459
1393 Ga0501041_0130369
1394 Ga0501041_0508480
1395 Ga0501042_0245354
1396 Ga0501043_0000012
1397 Ga0501046_0000030
1398 Ga0501046_0019056
1399 Ga0501047_0000049
1400 Ga0501048_0000082
1401 Ga0501048_1230243
1402 Ga0501069_0140406
1403 Ga0501072_0426398
1404 Ga0501079_0027840
1405 Ga0501080_1200263
1406 Ga0501081_0008289
1407 Ga0501263_091770
1408 Ga0501268_028569
1409 Ga0501035_0121391
1410 Ga0501035_0164958
1411 Ga0501044_0213794
1412 Ga0501045_0234956
1413 nmdc:mga03n38_213748_c1
1414 nmdc:mga0yw44_630934_c1
1415 nmdc:mga0k408_27880_c1
1416 nmdc:mga0k408_437683_c1
1417 nmdc:mga06z11_575755_c1
1418 nmdc:mga07m45_238052_c1
1419 nmdc:mga06r32_305933_c1
1420 nmdc:mga08y16_703345_c1
1421 Ga0500610_0007158
1422 Ga0495655_0079095
1423 Ga0495619_0342849
1424 Ga0500643_009509
1425 Ga0500651_0000035
1426 Ga0500651_0161799
1427 Ga0500569_057658
1428 Ga0500571_008144
1429 Ga0500593_000193
1430 Ga0500594_0009080
1431 Ga0500607_005126
1432 Ga0500608_019016
1433 Ga0500608_130248
1434 Ga0500618_020546
1435 Ga0500628_107518
1436 Ga0500655_002787
1437 Ga0500658_0000047
1438 Ga0500658_0000775
1439 Ga0500559_0028574
1440 Ga0500568_0006963
1441 Ga0500574_004603
1442 Ga0500604_0102689
1443 Ga0500616_0170079
1444 Ga0500619_132599
1445 Ga0500624_048094
1446 Ga0500634_0003941
1447 Ga0500634_0042438
1448 Ga0500638_005302
1449 Ga0500636_0041972
1450 Ga0500625_093228
1451 Ga0500596_009160
1452 Ga0501082_0130669
1453 2599621147
1454 2599675166
1455 2599678237
1456 2599690658
1457 2738882582
1458 2739247870
1459 2819602426
1460 2831270085
1461 2838054905
1462 2885201435
1463 2885215089
1464 2899927844
1465 2928042462
1466 2928048487
1467 2928054812
1468 2928068250
1469 2928073876
1470 2928086124
1471 2945977757
1472 2945986483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

45

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9498 30 133
3gek-assembly1.cif.gz_B crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9483 30 132
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9444 32 132
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9435 21 131
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9428 1 133
ID Description Score Start End Superfamily
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9501 21 131 3.10.129.10
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9381 1 132 3.10.129.10
3gekA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9361 30 133 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.931 9 132 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9309 10 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A515DH57-F1-model_v4 PaaI family thioesterase 0.9892 23 133 GO:0005829
GO:0061522
AF-A0A2H5YHT7-F1-model_v4 Esterase (EC 3.1.2.-) 0.9891 35 133 GO:0047617
AF-A0A5C7PGL2-F1-model_v4 PaaI family thioesterase 0.9837 1 132 GO:0005829
GO:0061522
AF-A0A2U2AEI1-F1-model_v4 PaaI family thioesterase 0.9826 19 132 GO:0005829
GO:0061522
AF-A0A6L6HQW9-F1-model_v4 Hotdog fold thioesterase 0.9809 19 133 GO:0005829
GO:0061522

Map